3DRPA

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drpA05
1HNIB 2BANA 5J2MB 3AO4A 2KZMA 3LP0A 4QWAA 4F3TA 4FW1A 2FC0A 1QAJA 4J9KA 5J2PA 3BQ0A 3NH0A 3TAQA 3AVKA 3BSCA 3RMCA 3KLGA 3OSNA 1WSEA 4JLHA 4ED8A 4J2DA 2HHWA 2JLEA 2UUTA 4DSLA 5HP1A 4J9QA 2FVPA 2B43A 1SL1A 3K5OA 3RAQA 1ZETA 1CXQA 3M8SA 3HPHA 5JS1A 4CEBA 3BSAA 4CF0A 1UWBA 3I5AA 3OL9A 2D5RA 1X1PA 4FW2A 2ZKUA 3DYAB 4HUFA 4Y1DA 1LAVA 4PA1A 1BQMB 4CJKA 3HVTA 1VSFA 5F8NA 5DQGA 2JGUA 4M45A 4O3PA 4C8OA 1TAQA 2BQRA 1FKPB 1KCFA 1IKWB 3AVLA 4FJHA 4ED3A 3AA4A 4C8MA 4AHSA 1FXXA 2G8VA 3QO9A 3E01B 4ECXA 4W5OA 4M3YA 2Z1IA 1JLEA 5F8IA 4DSEA 4Y2CA 3BR9A 2BE2B 3H59A 1VRTA 4KB1A 1Y97A 3AVMA 2ATLA 4U7CA 4IQXA 5KT4A 4PQUB 3T5JA 3V9WA 1K6YA 1JIHA 3PJXA 4EBDA 4Q43A 4RW9B 4E3SA 2C2EA 2QKKA 3LP2A 3ICLA 4ZVFA 2ZE2A 1TL1A 3O4NA 4MFBB 4F3OA 1ZTTA 1N5YA 3PR4A 2FBXA 5KFMA 1LWFB 4CEQA 3NGDA 2B5JB 2G8UA 4EYIB 3HXMA 4CJTA 1B9FA 4O55A 3N6NA 3OYJA 3P1GA 3VQ8A 3G10A 2OPPA 3VA3A 4DTUA 3Q8SB 4TLRA 4KB7A 4CIGA 2XO7A 4Q44A 2BQ3A 1WN7A 4URQU 3NKYA 3ZT1A 4FZYA 1CZ9A 4F2RA 4TY8A 2WHOA 1S1VB 3L2RA 1NHUA 5C42A 3MR6A 2RKIA 3DMJB 1T7PA 1S1XA 4DU4A 4IOBA 4KHQA 1JLBB 2ASJA 2YNFB 3D0PA 1TKZB 2HW3A 3TABA 4CJ3A 3I0SA 3S3NA 1RCHA 1FKPA 2DY4A 3VQ6A 3P5JA 1C1AA 3K5NA 3KLHA 4TXSA 3SUPA 2FLPA 3TAMB 3ZSZA 4KBIA 2A1SA 3EPIA 2WRMA 3H5YA 4DFMA 3H5XA 3DOLA 3TANA 4CEOA 3FDSA 2R2TA 4K4WA 3CM5A 4NLYA 4DQIA 1RDDA 4DFJA 4I9LA 4MIAA 4KI6A 4DS5A 1RTIA 1BCMA 4IH6A 1ASVA 4YR3A 3MR2A 1YTAA 1RT6A 5C25B 2R8JA 3DRRA 2P51A 3KLIA 4KSEB 1C0TB 3KTQA 4G3IA 2ZQBA 4CJSA 2VG7A 1S9EB 1WSGA 1J54A 3HHKA 5KT6A 1RT4A 3NF6A 4U6PA 3OYCA 3NH1A 2G8HA 1IKYA 1HMVA 3SI8A 4OLBA 2W9BA 1HNIA 4F4XA 1S5JA 4KAIA 3GIMA 5DK5A 4KTWA 4GW6A 1F21A 2QV6A 3K2PA 4DSFA 1RBSA 4ECTA 3M9NB 5KTQA 3H4DA 5KFBA 3MEGA 4KV8A 4DG1B 3PW2A 5CYQB 4I2PA 4K4XA 4JV1A 1EP4B 3AVHA 4W5RA 4O4GA 1D0EA 3OL7A 3DDKA 3V1RA 3PR5B 3KK1A 5HRNA 3KMQA 5KGWA 4N47A 3TVKA 4J2AA 4QW8A 4LQ9A 1J9AA 4FJKA 3IN5A 1T03A 3HVWA 1VSIA 3PW0A 4BE2A 5J1EB 1S6PB 3HO1A 5F8JA 4IBNA 3HVAA 4N5SA 3UIQA 4KPYA 3IGVA 3KLHB 4C8KA 4CEDA 5HROB 3RTVA 3DI6A 2Z1GA 1HQEA 3KLEB 3DOKB 4CGHA 2W9AA 2P5GA 1JLQB 2QXFA 1T8EA 4EEYA 4B8AB 2FJVA 1S0NA 3AO3A 3HVTB 1RT3A 3K59A 4WFXA 4H4MB 3I8DA 3FSIA 2W8KA 2Z1HA 3QESA 4MK8A 3KD1E 1BGXT 4FJMA 1ZTWA 2A1RA 1Q9YA 3RMDA 3DRSA 3OYGA 4OPKA 4NLPA 4FM0A 4JRQA 4ELVA 4B9TA 4FLXA 3OYHA 3DRPA 2WCXA 4TSXA 1JLFA 2B6AB 4Y34A 4TQRA 2G8KA 1ZBHA 4NLVA 3RBEA 3OL8A 4IFVA 1RTDB 4ED2A 3V6DA 4IR9A 4LSLB 3OYLA 2FLLA 5J2NB 1NK8A 4MFBA 3MEGB 4KV8B 4DG1A 1RYRA 2ZD1B 4Y1CA 3C6TA 4K4SA 5J2QB 3SQ2A 2OH2A 2YNHA 3IRXB 5F8HA 5J2PB 5HLFA 2XHBA 4NCAA 3QLHB 4CECA 1WLJA 3RMBA 1GX6A 4O3OA 1U48A 4WE1A 1Q8IA 1RA7A 1GOCA 5DLFA 2EX3A 2IAJA 1RBTA 4ZVGA 3VN5A 4OJRA 5KRSA 1D5AA 4NLSA 4IDKB 1HPZA 2FJXA 4EP5A 3JYTA 5EWGA 3EZ5A 3KKRA 4GC6A 2ALZA 5HBMB 2XI2A 4GMJB 3AO1A 3PW4A 2E6LA 4CJQA 4EZ9A 4Z4EA 1T3NA 1BHLA 2D3UA 4AHRA 1RT2B 4WFZA 5D3GB 3KLVA 4ZPCA 1QTMA 5J2MA 4OKJA 2VG5B 5JUMA 5SWMA 2WOMB 1N48A 5C5JA 3CVKA 4DSKA 4LY7A 3NF7A 3H2LA 1IM4A 3L2WA 2D7SA 4DFKA 1RTIB 1N56A 2BE2A 2DFFA 4QCLA 3BGRB 3NAEA 1YTUA 1JLAB 2HAIA 3V1QA 3V1OA 1T05B 2F8SA 4FZZA 3FQLA 3N6LA 1OS5A 4NRUA 2I5JB 4ICLB 3V6JA 2HHXA 2C2RA 3L8BA 2VG7B 1KFSA 1S9EA 1SH3A 4ECSA 4XO0A 5KG0A 2GBZA 1S4FA 1S9FA 4R5PB 3CDEA 5KG1A 3PO5A 1FKOB 4FLYA 1KSPA 1BISA 1QQCA 1JLCB 3KHGA 3AVJA 1BL3A 2UVRA 4KREA 4JUZA 1U09A 4RUAA 1CZBA 5C24B 4Q0BB 2ATQA 3HKWA 4DQPA 4DTJA 5F8GA 2AU0A 3NL0A 2YHAA 4KTZA 4HUEA 1LWCA 2XCAA 3CJ2A 3G86A 4PUOB 4B3OA 1HNVB 5HBMA 4DL4A 4LSNB 5DG9A 3M8RA 1EETA 3SI6A 2OYQA 4GC7A 2PY5A 2XC9A 3DLHA 3T5LA 2WONA 3CM6A 4RW7A 2ZE2B 4J9OA 3L2VA 4NLGA 3MTKA 1O1WA 3IS9A 4N56A 3KK3A 2HVIA 3JSMB 2CKWA 3QEPA 3TQ1A 4R8UA 4JS5A 4UQGA 1XR5A 2OZMA 4E7JA 1JLAA 3L3UA 1K1SA 4NLQA 2YNGB 4ZTFA 3T19A 4XPCA 1JLGA 3AA2A 3CFOA 2UVUA 2BRKA 4CGJA 3KLIB 1BI4B 2XY8A 4IKFA 4OGEA 4CIEA 2YV0X 1S1VA 3K57A 4IFVB 2XCPA 1EKEA 2HNYB 1UA1A 1NJZA 2FBYA 1JLBA 2W9BB 5I42A 3QIDA 4O0JA 3GIIA 2F8EX 2XI3A 3LPTA 4IH5A 1RDRA 3RR7A 2YNHB 3IRXA 3NBPA 1ASWA 3NE6A 4MIBA 3MF5A 3QEVA 4K8ZA 3H40A 4Y3CA 3ZSVA 3RR8A 2VG6A 1QSSA 1C6VA 4FLVA 3SUOA 1MU2A 4BDPA 5KFRA 3PY8A 4H4OA 3PO4A 2HWHA 1ZBIA 4AHCA 3KJVB 3LANA 1NKCA 3VQ5A 3QIPB 4CF8A 3O3FA 2O4IA 5DGAA 4B9MA 3PZPA 4URGA 2UVVA 2HWIA 3VQAA 4B9LA 3MAQA 4URSA 1UWBB 4NLXA 1BCOA 4ZP6A 2O4GA 1RAJA 4O4RA 1RT3B 3TI0A 1NKBA 2E9RX 1L3SA 3AV9A 4YMEA 1HYVA 1HQUB 4HCCA 1S10A 2OPQA 4H8KA 3OSPA 2WOMA 3AVFA 2YNIA 1CSJA 2IJNA 2FBTA 4FJLA 3KD5E 5KFXA 4DL3A 4DSIA 3L2UA 4HVJA 1WAJA 4E7HA 1LW2B 3MEEB 3HT3A 2PYJA 2WB4A 3E01A 3LP3A 2GV9A 1L3UA 2XY6A 2FVQA 4RNMA 5CZ1A 4IFYB 4IKAA 1SH0A 2FLNA 1VRTB 4DTPA 2BANB 3KOAA 5KT5A 2WK4A 3WNEA 4O3RA 1NOYA 3EZUA 3SQ4A 1QS4A 1NHVA 1TP7A 5EUHA 5HROA 1ZBLA 4ED1A 2HNDB 4B8CA 2ZD1A 1JXEA 4RW9A 4AHVA 4IRDA 1TK8A 1KVCA 5J2QA 3NDKA 4KHNA 3VQQA 1NK4A 3KLGB 4E7KA 1A5XA 1I39A 1BIUA 1WSHA 3I5BA 1KRPA 4RW4A 4CGDA 2HMIA 5DG7A 4WE1B 4CJLA 3PVXA 3BSNA 4ID5A 3FFIB 4CERA 2HNZA 1TKTB 1ZBUA 2QKBA 4J9SA 3K58A 1CXUA 1LWEB 1YVUA 4DEZA 1QAIA 1FK9A 3TAGA 3WNGA 4EZ6A 4B3OB 4RUCA 5HRSA 4FLUA 2W42A 1SKSA 2OPRB 4RNFA 4EBEA 3PJWA 1LW0A 3DM2A 1JLFB 5KT7A 4MKAA 2E6MA 4DS4A 1HQUA 1EETB 2EHGA 2RN2A 4O0IA 3OJSA 4FLTA 4Z4CA 5KFVA 5KG5A 1IKXB 4KO0B 1S6QB 4RNNA 1GX5A 4Q8FA 1RT2A 5D3GA 4RZRA 4FJJA 3DLGA 4AHTA 3D5MA 1QHTA 4ECYA 2UUWA 1JLEB 2BGGA 1VSMA 4I7FA 1ITGA 3JSMA 4DQSA 4ID1A 1RDBA 2FBVA 3GV5B 3OYIA 1DTQA 3KIOA 1SH2A 2P5OA 1XC9A 4AH9A 4FJXA 2Y1IA 3OVNA 3AVIA 3HYFA 3V9XA 3TAPA 1NJXA 4C8NA 2YKMA 1SKRA 3DLEA 2VA2A 2IAJB 4FBTA 3OYKA 3RAXA 1U4BA 1LAWA 1WNSA 1TKXB 3C94A 4IH7A 4ZVEA 1BQMA 3I0RA 1RT7A 4E19A 5K14A 3OS0A 1NK5A 5KGXA 3GIJA 4KFBB 4CJWA 3G0ZA 4EO6A 5KFLA 4ED7A 3NF9A 1VSHA 4I2QA 4ECRA 4YR0A 2X6NA 4ZVHA 1XHXA 4WXOA 4G1QA 2AJQA 2G8IA 3GQCA 4TY8B 3LZJA 2ETJA 2DPIA 2XY7A 3OYNA 3ZSQA 1JXLA 4OGCA 1VSKA 2RKIB 3DMJA 2KTQA 2BRLA 4TN2A 3AA5X 1LV5A 4NLUA 2HHSA 3QGHA 1W25A 4QAGA 2HHUA 4H4OB 1RT1B 3VQEA 3AVGA 4KE5A 1RT5B 4DL6A 3CJ3A 3LDSA 3H08A 4CEEA 1KHWA 5CYMB 3QIPA 3BSOA 4HHTA 3KLFA 3PX6A 4FS2A 3TAMA 4JV0A 3HP6A 2I5JA 2AWZA 5KI6A 3AO5A 1HYZA 2B5JA 4CFAA 4YR2A 3F9KA 3CQ8A 3BQ2A 5KFGA 4WXWA 5KFCA 4CHYA 3TR8A 3ZT4A 2OPPB 2OPQB 1S0OA 1SV5A 3CJ0A 2W7PA 4OVLA 2I1RA 4HKQA 5KFKA 2X6SA 1KLNA 3RB4A 4K4ZA 2BDPA 3V6KA 5SZTA 2YNGA 4O3NA 4CCHA 2KFNA 1JLGB 1VK0A 4BWJA 3D28A 4KTQA 3SUNA 4ZP7A 2Y1JA 4E0DA 3C6UB 4J9NA 1S1XB 3IG1A 4K4VA 3OL6A 3SJJA 4KFBA 2F8TA 3LWLA 4BE0A 3NH2A 2YNFA 1L3TA 4IRCA 4OKEA 5KG4A 3FQKA 2AQ4A 1RBVA 5L1KA 3T3FA 4EYHB 2PZSA 2HNDA 4CF2A 4O4GB 4Z4FA 2DFEA 4RW8A 3HK2A 3OHBA 4IG0B 5L9XA 3G6VA 2ASDA 3NBPB 1TVRA 4MH8A 2IS3A 2VWJA 3DLKA 1RDCA 4E7LA 3RMAA 1IO2A 1VSLA 3KNAA 2J6TA 1S1TB 2LSNA 1C1BB 3LWMA 3CJ4A 4CFBA 3OYAA 2HNZB 1N4LA 4JS4A 5HP1B 4ZP8A 4KHUA 5KFPA 4DQQA 5DGBA 4ECZA 1VRUB 4RG8A 4RNHA 1TL3A 1XWLA 4RU9A 3VQ4A 5L1JA 3O3HA 1C0TA 1FK9B 1Z4UA 3DOKA 3GIKA 1QE1A 3CFPA 3KMSA 3T5KA 2KW4A 1UA0A 4Z4IA 2ITGA 2VWKA 5CY4A 1N5YB 4NLWA 1NK9A 2E9TA 1TGOA 4F50A 4GVMA 1R0AB 4ZPBA 4CHNA 1L5UA 2EC0A 1W0HA 4CK3A 2X74A 3SPYA 5KFIA 2HNYA 1SV5B 3H5SA 3NMAA 4NLTA 4HUGA 3LALA 5FDLA 5EWEA 2QE5A 2Q3SA 5KFZA 2ILYA 5F9LA 3LP1B 1S9GA 2GIRA 2R2SA 2YNIB 3M9MB 1S1WA 1L3VA 3C6UA 4FM1A 1JKHA 2V4QA 3ZSYA 1RILA 1C1CB 2IGIA 3OYDA 5KFDA 1DTTA 5KFTA 5F8MA 2IMWP 3UDLA 1VSJA 4CJ4A 3OYBA 5F9NA 4CJEA 3EPGA 1BIZA 3SQ0A 3O3GA 4X2BA 3KJVA 1S48A 2RF2A 2V0NA 1X9SA 3MXIA 1D8YA 4IG0A 1Z26A 2GC8A 3DLKB 3QLHA 4AILC 1S1UB 3V9SA 4Z4GA 4BDZA 4H4MA 5T7BA 1TAUA 4NLRA 3MECA 3QGGA 1U45A 4L8RB 2OA8A 3QEXA 1GOAA 4XIUA 2WTFA 3SPZA 3FFIA 2AX1A 3OLBA 2HHVA 4O44B 2R8KA 1SUQA 3C95A 4QW9A 4M94A 4ELUA 5EDWA 5C24A 4Q0BA 1VSDA 3NHGA 3MXMA 2ILZA 4DWIA 4DTSA 1LW2A 3MEEA 3H4BA 4LH5A 3NAIA 4ZHRB 1LWCB 1TQLA 2ASLA 1NOZA 3DM2B 5F8LA 1IKYB 1TV6B 5KFUA 4LSLA 3PW7A 1EXQA 4DL7A 3CG7A 1BQNA 3ZSRA 4CE9A 3V9ZA 2IM2A 2JC1A 3V9UA 4EO8A 1MMLA 2KQ2A 3OS1A 3HM9A 1IKWA 4CJRA 3DOLB 3V4IA 3MR5A 5EU7A 4RW7B 2XY5A 3IAYA 1NKEA 4JV2A 3OYFA 4MK9A 4OPJA 3WNHA 1JL1A 3GV8B 4FK4A 1A5VA 1K1QA 3S9HA 3EYZA 4RNOA 4W5QA 1TK0A 4DU3A 4ICLA 4RW6B 1EX4A 4FJ5A 1XHZA 4FJIA 3AVAA 1HPZB 4TYAA 1HYSA 1C0MA 3JYTB 4YQWA 5KRTA 4KHWA 3IG1B 1D9DA 3LP2B 1HQEB 2AGPA 2G8FA 2R8IA 2IC3A 3KHRA 1TL1B 4E89A 3U3YA 1C0UA 1KTQA 3SZ2A 3LPUA 3VQPA 3DYAA 5K14B 4NYZA 3TARA 3BJYA 1CLQA 3TAFA 4B9VA 3CWJA 4I2QB 3K5LA 1SUQB 5I42B 4BACA 3PHEA 2JEFA 4O3SA 3KKSA 2JC0A 3LAKA 2VA3A 1S1TA 4DFPA 5KFJA 2D0BA 3WNFA 1KLMB 5CZ2A 1T03B 2PYLA 1TV6A 2VG6B 2RDJA 4F4YA 2B6AA 1I6JA 4DTMA 5KG3A 2FVRA 5KG7A 4TQSA 1HJRA 2R7YA 2D3ZA 3LP0B 3KLFB 2QK9A 4CEFA 3AA3A 1UOCA 3Q8PB 1JLQA 1WSJA 3V4IB 4NLDA 5DG8A 3T1AA 4OLAA 3F73A 4FVMA 1RA6A 1JXBA 4C8LA 1YVFA 5KFWA 1LWFA 2BQUA 1SKWA 4KKOA 3S3MA 4Z0UA 4CK2A 1J5OB 4CEZA 3SV4A 3O4QA 4NZ0A 4KHSA 4ELTA 3IGNA 3ZCMA 1NJWA 3U6FA 1HNVA 5DQIA 4BE1A 5KFQA 1WSFA 5KFYA 3VQBA 3RWUA 3CDUA 5I3UB 4DTXA 4DF8A 1QSYA 2J6SA 3E51A 1RT1A 3LAMA 1JX4A 3MFIA 2JEGA 2FVCA 3MFHA 2RF2B 1IKVB 4IFYA 3NAHA 3KHLA 1RTJA 1ASUA 4Z4HA 4NCGB 2RPIA 3CFRA 4K4YA 1I3AA 3NGIA 4CJPA 4M41A 5KFOA 4I2PB 2AGQA 3VQ7A 2D0CA 3SCXA 5DQHA 4DL2A 4Q5VA 1HARA 3I5CA 1C1BA 2JEIA 3CIZA 4HTUA 3M8PB 3OYMA 2HMIB 5J1EA 4CF9A 1U47A 4ID5B 3OYEA 3SUQA 4E7IA 5L1IA 3KHHA 4QWDA 3HP9A 1W9HA 2GIQA 2AGOA 5KG2A 4F2SA 4M3ZA 2O5DA 2UVWA 1B92A 4WFYA 4IG3B 4F8RA 1FKOA 1J5OA 4CJ5A 1RTHA 2DPJA 2JEJA 1JLCA 1HMVB 1UAXA 4J9LA 4WYWA 4M3WA 5FDLB 4ZMMA 2R2UA 3AVNA 1S6QA 1RBRA 3HSTB 2HHTA 4RW8B 3QEWA 3TAEA 3VA0A 1QUVA 4CHOA 3BDPA 1S97A 3ZT2A 2R2RA 4DU1A 1MU2B 3DLGB 2IOCA 3B6OA 1RYSA 3PX4A 2KZZA 3VQDA 5KG6A 4DF4A 3N6MA 4NYFA 4AHUA 5KFNA 1IKVA 4CHPA 4J9PA 1B9DA 4B9NA 4FK2A 4NCGA 1NK6A 1S6PA 1KHVA 1TL3B 1SL2A 4FK0A 3ZT0A 3DLRA 4Q45A 4CHQA 1XR7A 1X9WA 3ITHA 5KFFA 4ZPDA 4EBCA 2GUIA 3C6TB 3IS9B 4MQ3A 4K8XA 3V81B 2W8LA 4RW4B 1NK7A 4FLZA 4DSJA 3GILA 1RT7B 3PV8A 2E4LA 4R8UB 1KVBA 4ECQA 4CFCA 4J2EA 2Z1JA 4ZPAA 4J9RA 2C28A 4F4WA 3ASMA 1S1WB 4QWBA 1KLMA 1QSLA 2R8GA 4IRKA 4XPEA 3VQCA 3OS2A 3NFAA 4QWEA 3KK2B 4NYNA 4LSNA 1TK5A 3M8QB 2D0AA 1U49A 4J2BA 4TYBA 4DMNA 5FRNA 4M95A 4TY9A 2W9CB 4O5BA 3MXJA 3ZSOA 1RT5A 5KT2A 3T5HA 4NLOA 2X78A 3CO9A 4KHMA 5CYMA 5CYQA 1EP4A 1RNHA 2P1JA 5J2NA 3MEDA 3L3VA 4CJVA 3KK3B 4WZQA 4CGFA 4OL8A 3GYNA 1ZBFA 5KFHA 3QINA 3G6XA 4FBUA 1A5WA 2OZSA 1YT3A 4YP3A 3Q8RB 2XGPA 4F4KA 4QOZB 4B08A 4DTNA 3DI6B 1REVA 4IR1A 1Q9XA 2IDOA 3NCIA 4RW6A 1TKXA 4LQ3A 2XWYA 4KRFA 5EWFA 4H54A 4FLWA 1T05A 5L1LA 3TWHA 4CGGA 2OPRA 3U3GA 2FVSA 1C0UB 3QGIA 4R5PA 3A2FA 4CF1A 4ZHRA 2DTUA 2FJWA 2G8WA 2IM0A 3QETA 1BQNB 3QERA 3K5MA 2IA6A 3M9OB 2V4RA 3QNNA 1WSIA 2XGQA 2OPSB 1S49A 4Q8EA 2HHQA 4I7FB 4HYKA 3RRGA 2VG5A 4CIFA 1KFDA 3QZ8A 3QEIA 3KK2A 5KFSA 4DL5A 3M8QA 4KB0A 3VQ9A 2C2DA 5JXSA 2W9CA 4WZMA 3ALYA 4M3RA 1TKZA 1N6QB 4MK7A 4HCBA 3VQSA 3PX0A 1D1UA 2HB5A 1VRUA 3ZSXA 3HL8A 5KFEA 3S3OA 3SFGA 3SQ1A 4E1NA 5HLFB 2HVHA 4IG3A 4FYDA 2W7OA 4Y2AA 1U04A 1T94A 4ECWA 4K50A 1TKDA 4NRTA 3SNNA 4CFDA 3SYZA 3UR0A 4ECVA 3Q8QB 1R0AA 5KFAA 1NJYA 4KHYA 3RBDA 3AVCA 3H98A 2IM1A 3CJ5A 3BREA 5E41A 4JRPA 4IDKA 4BWMA 1Z25A 3SV3A 4DTRA 4I9QA 4ZP9A 4ED0A 4DQRA 3AVBA 1SL0A 3LP1A 4CHZA 4M3UA 5C42B 1ZYQA 1BI4A 1RT4B 1WNEA 1JKHB 4CGIA 2BR0A 1X9MA 1LW0B 3THVA 1DTTB 5I3UA 4PUOA 4O3QA 4DTOA 4KAZA 4NCBA 1JL2A 1KVAA 3I0SB 2YKNB 4B9UA 4DLEA 1GOBA 2V9WA 2B4JA 1IKXA 3CYMA 5DLGA 3ITHB 3HJFA 4LH4A 2J6UA 1TVRB 3ISNC 3HPOA 4B9SA 3SFUA 3KK1B 1RDAA 1WAFA 2IJFA 4CK1A 2CJQA 3ZT3A 3QO9B 4FJ7A 3OLAA 3BGRA 4FJGA 1XI1A 1N6QA 4KKOB 4ZTJA 3MECB 1RT6B 4W5TA 1TKTA 5HRRA 4YNQA 3NGYA 2YKMB 5HRPA 3BQ1A 4ECUA 1QE1B 3QNOA 4PQUA 1DLOB 1LWEA 1IG9A 4MKBA 3B6PA 4OKKA 3KLEA 1HRHA 3FRZA 1C2PA 4FM2A 4O44A 3HVRA 4FJNA 4R0EA 3EY1A 4WYLA 3V6HA 4PY5A 3I0RB 5T14A 5FRMA 3UPFA 4N76A 4PWDB 2E9ZA 4KO0A 3NGZA 3LZIA 2DFHA 3PUFA 2F96A 1S9GB 3MEDB 1RTJB 4FS1A 2R8HA 4G1QB 3AO2A 3PW5A 3QYYA 2YHBA 1C1CA 2NUBA 3L2QA 3DRSB 2C22A 2IBKA 4DLGA 3P83D 4CJUA 3D45A 1S0MA 1DTQB 5DMRA 4QWCA 4M42A 3ISND 1REVB 4ED6A 1RTDA 4M3TA 4E1MA 2YKNA 4F4ZA 1G15A 2IM3A 3V6DB 3RB0A 4QPXA 3DLEB 3RB6A 3CDWA 4BDYA 3M8PA 2WONB 4FXDA 1VSEA 1NK0A 2KFZA 5FROA 3RRHA 4M3XA 1S1UA 4KHRA 4FCYA 1HYSB 3QIOA 4K4UA 3QZ7A 1J53A 4CESA 5KT3A 4J9MA 4FJ9A 2IC3B 3V81A 3DLBA 3OHAA 4CEAA 2RDIA 1RTHB 3NF8A 4W5NA 4YFUA 3ULDA 2D41A 5JS2A 2AX0A 2OPSA 1DLOA 3OJUA 3H5UA 1D9FA 5C25A 4N41A 3DRRB 1RBUA 4FJ8A 1XR6A 3OY9A 3G6YA 3HPGA 4FZXC 4EP4A 3DRPB 1NNDA 3ZSWA 4K4TA 4PWDA 3RB3A 4KI4A 3MR3A 4LD0A 4CJFA 3GV7B 1IH7A 3UQSA 2XRIA
chains in the Genus database with same CATH superfamily
3V5RA 1VQPN 4CLWA 2CG8A 2E1RA 2QXLA 1GMVA 4FW1A 5M1NA 1X7VA 2FC0A 2D0OA 1QAJA 4K5SA 3VWSA 2CH6A 3NH0A 3AVKA 3WC0A 1NGJA 1RP5A 5E3PA 5ADXH 2HHWA 3HRGA 3HFKA 1K73T 2DIVA 1SL1A 5CE3A 2AKWB 3HPHA 5JS1A 3QJJA 2H51B 4CEBA 4ZIWA 4DCHA 1YDLA 3I5AA 2A42A 2AYMA 4BCAA 5ELZA 3EO3A 3RW7A 4FW2A 2ZKUA 4NYPA 2HFUA 4B3MF 2NSCA 4U8VA 1BMQB 2K1RB 4BC5A 2VBWA 4M45A 3TJ9A 4UW2A 3CIPA 5C2FA 2ZJPQ 2CQPA 3AA4A 4C8MA 2YKAA 1FXXA 1CJVB 2PC6A 3MCOA 4DSEA 2BE2B 3CJTA 3Q8YA 4KB1A 3AVMA 1X8DA 7FDRA 5KT4A 3QWUA 4ZIVA 1O0PA 3H1VX 2O8EB 3K17A 4FF2A 3V9WA 1K6YA 2MKJA 2VONA 3SCLE 3H0PA 2DYAA 1TMJA 2N82B 4K59A 2B4PA 3DGPB 4F3OA 3GIRA 3D0IE 3D2WA 2J9CA 5AJ3F 1LWFB 2XO6A 5ETMA 4EHTA 3HXMA 4HTJA 2D1KA 4DR5K 2NYHA 3P1GA 1V3RA 4PYDA 2CJYB 4F36A 4WF9Q 3EDQB 4PPDA 5HN0A 3FBBA 1WJ9A 4JB8B 4FKXA 2ZBQA 2IMOA 2DGOA 4PZVA 2RKIA 1T7PA 1M1KO 4IOBA 4JI7K 1VQYA 5MLCV 2ZZTA 2ASJA 3OTEA 3D0PA 1TKZB 2KDOA 4CJ3A 4BRGA 1X4DA 2MLXA 2DY4A 2YBVA 3P5JA 3KLHA 1Y5LB 4TXSA 3GSDA 2BEFA 5KPRA 1P27B 4B3SF 4Y0WA 1JNZB 1OVQA 3ZTQA 2XHCA 3DOLA 2EWSA 3N28A 3CM5A 4NLYA 1VRQC 4USMA 2GEMA 2AEJA 4DFJA 1XNQJ 4MIAA 2CPZA 2HZAA 1D3WA 1RTIA 1T95A 4YR3A 3MR2A 1YI2S 1YTAA 1VK3A 4K41A 1X5OA 3O80A 5C25B 5LM7E 1HR0F 3MN7A 3CF5Q 1ACMB 2GMLA 2F4FA 1UVKA 1GQEA 4LF4F 3KLIA 2CQBA 3DXKB 1Q82O 3M2VA 4IO1A 2UXBK 2YKQA 4HWIA 1VFJA 5KT6A 3VOVA 1WC6A 1JCGA 3KFWX 3OYCA 3NH1A 1IKYA 1D8ZA 1HMVA 4OLBA 2FY1A 5GAHI 2VHGA 4F4XA 1E4GT 1WB9A 3ULEA 1JWWA 1FFSB 3UD3P 4KTWA 4DV7K 4DSFA 4ECTA 1NDCA 3M9NB 3JXOA 3M2UB 4I2PA 1RBOB 4JV1A 3OL7A 3DDKA 3KK1A 3M4XA 5HRNA 3KMQA 1FFWB 3TVKA 4LQ9A 2P9IA 4FJKA 1LXJA 2P9UA 1DQAA 3ZTOA 1FD2A 1S6PB 1S5ZA 3HO1A 4YOYA 4IBNA 4N5SA 2H4WB 3IGVA 2P6TA 4C8KA 5DM7Q 3GR1A 1MMNA 4PXDA 4FYVB 5LSOA 2W9AA 2P5GA 2DNLA 2CZ4A 2QXFA 1T8EA 4ES3A 4OPHA 4EEYA 4B8AB 1S0NA 3K59A 1RT3A 2DNQA 4Q2MA 3FSIA 2W8KA 3UNYA 2UP1A 4ETZA 1Q81O 3D6FB 1VQ7N 1MWKA 1H98A 1NHKL 4D3HA 2W1BA 1HBMA 1BGXT 2ZBCA 4RPFA 3UKUA 2V2QA 1TL7A 3G82A 3W8GA 4LF9J 3RMDA 4LF9F 4OPKA 4CO5A 1RAFB 1J27A 4FLXA 2WTUA 1TELA 2E1MC 2ZKTA 4TSXA 1JLFA 2B6AB 4H5WA 4Y34A 4RU2A 2G8KA 3CNQP 3ELHA 1QVGR 3T1YF 3RBEA 3CETA 2WSCC 1SQFA 1RTDB 1NB2A 4CNYA 3V6DA 4IR9A 2MKKA 2FLLA 5J2NB 1HKAA 2X1FA 3B4DA 4WU2A 3TYTA 4MFBA 5M1QA 4LFAJ 1GMUA 3F2KA 2P2CB 4AM6A 4Y1CA 1IJJA 4LR9A 3C6TA 5J2QB 3IRXB 2W40A 4IZ9A 3K9KA 3EE8A 1HNXK 4NCAA 3E3XA 5A2QY 2MEWA 2EKNA 2UV8G 3RMBA 2OI2A 2VJUA 3VGKA 4O3OA 3BYPA 4WE1A 1Q8IA 2MQOA 3R5DA 1RA7A 1NBEB 3JQMA 3DXBA 4LR7A 3CMAN 3L9ZA 1N88A 2RVJA 4B1YB 1A6LA 2FZCB 2YQ0A 3MGJA 1HPZA 3BKFA 2ROEA 4H5RA 2E1CA 2W24A 2X51A 4DX6A 2XI2A 3W1YC 4GMJB 3PW4A 4UT4A 5KOXA 3MOZA 3ZETA 4AM7A 3MCMA 5J2MA 3EGWB 5SWMA 3THYB 1CBKA 3QFWA 2CFXA 1H2TZ 4DV4J 4DFKA 3PTWA 1UMJA 3S41A 4C1NK 2BE2A 3C6HA 2AHOB 5EOYA 1NRKA 1CG2A 1FJGF 2ATCB 1IQZA 1G2EA 4H5NA 1YTUA 1N36K 1JLAB 5L46A 3VQTA 4BRAA 2I7PA 4HACA 5B0AA 2HAIA 1T05B 3MM9A 4DX8H 3CCVS 1FJGJ 3V6JA 3L8BA 2VG7B 1KFSA 1BUPA 2GVDA 3JAMO 2B4OA 3FE1A 3OA9A 4TU7A 1EWQA 1BISA 2YJEA 1JLCB 2Z2MA 1WEXA 1VQLN 4PXCA 2ZWOA 3EWGA 1WUAA 3HFVA 4H4KC 1DHMA 4CD1A 1ITPA 2IY5B 4Y2IA 1BA1A 3LPEA 3FCHA 3TVZA 1BA0A 1R89A 5HAOA 2ZH2A 3CJ2A 1M5SA 1DFDA 1HNVB 2HPUA 3UW1A 1OY9A 2KKHA 1HBUB 4DL4A 3HSZA 1A0OB 4DUZF 1NPKA 1B0PA 1N34K 3O9TA 5H9EK 1EETA 3SI6A 2OTJS 4ZCKA 1AUDA 3T6BA 3DLHA 3W64A 5A6WA 2KI2A 1VOMA 2D3O1 2WONA 4BVPA 4UZCA 3CM6A 2IFXA 4RW7A 3I9V9 2ZE2B 1HQ2A 3QJPA 3C0BA 3IS9A 3KK3A 3D6RA 5K20B 5AQUA 2CKWA 1YJNN 3TQ1A 5E0OA 4JS5A 2GELA 1XR5A 1JLAA 3L3UA 2M3DA 2LEAA 2JLFA 2BJ7A 1Q5VA 4BGAA 4XPCA 2UUBF 3CFOA 1I51B 2AYEA 3KLIB 4X64K 2O3DA 2Y9HA 4IKFA 2HK3A 3PG9A 1VK8A 1S1VA 4HHHA 3K57A 5C2CA 1M5KC 1UA1A 1NJZA 2NZ4A 4A8XA 1JLBA 2QG9B 2E5LK 5M2UA 3GIIA 3ULEB 3GZ7A 2XI3A 3LPTA 4IH5A 4LR8A 2XQCA 3ZLJA 1T3VA 2DJWA 1VQ9S 4MIBA 3HOSA 3MXHP 4Y3CA 2VQEJ 2VG6A 1PIEA 4FLVA 5L8RC 2PD1A 3SUOA 2PIIA 3PY8A 3KJVB 4YORA 1VQOS 1IM6A 1NKCA 1NPRA 4DL0C 4FF4A 1HW9A 4CF8A 3PZPA 1RGIA 3IWXA 2MJNA 3MAQA 1UWBB 1M90O 4LRFA 2CPJA 4P10A 1YAGA 2N3LA 1RAJA 2Q79A 1NKBA 2E9RX 3AV9A 4NXMJ 1HYVA 4HCCA 3R2DJ 4JI3F 3F41A 4H8KA 2ROGA 2WOMA 3BUZB 3E2EA 3SBMA 5FPDA 1CSJA 2VWBA 3KD5E 3W5ZA 4DL3A 2OEJA 2P9SB 5HATA 3O44A 1XEZA 1VLYA 3MEKA 2WB4A 2VBYA 4PKDB 1IBKF 2KT2A 4MDAA 2FJEB 1L3UA 5ETSA 3SIPB 2NUUG 1WOQA 2LDIA 4IKAA 1SH0A 2FLNA 3MZIA 2EPIA 4DTPA 2BANB 1N0VC 2L3MA 4ZVPB 3RYLA 2NPFA 3WNEA 2DRDA 1NOYA 1FF2A 3A4TA 5C10A 5EUHA 2QGFB 2G13A 4GO5X 2HNDB 4B8CA 2L41A 2I38A 5J2QA 1XNQF 4KHNA 3LM9A 2ZH8A 3R2CJ 4E7KA 3NWRA 3AJDA 1A5XA 3RVCA 4M5HA 1E6VA 4RW4A 2FC9A 3CDAA 5DG7A 1J5EJ 4WE1B 3UD4P 1ZBUA 3DGVA 1YGYA 4J9SA 3K58A 2LEPA 4BRCA 1LWEB 1GLBG 4DEZA 4NOHA 4WBFA 2MTLA 3N79A 4C97A 3PIPL 4B3OB 2ZH1A 4IEEA 2JH3A 1SKSA 4EBEA 1LW0A 4MKAA 4DS4A 1X3MA 1RLCL 4BHQA 1EETB 2RN2A 2N7CA 4M63A 2AIRB 5KG5A 3CCTA 1V5VA 4RNNA 2C2ZB 4YB6A 5D3GA 3ID8A 4RZRA 4X4QA 3D5MA 2UUWA 1FJCA 4I7FA 3JSMA 3BH7B 4DQSA 5CR4A 4W90B 2FBVA 3J7ZO 3GV5B 1DTQA 1SH2A 3M1VA 2HRTA 3OVNA 4DR7K 3AVIA 3PEJA 3FKBA 5B0CA 4PHTX 1E3MA 1SKRA 2VA2A 3QAUA 5CD4H 1RWWB 3OYKA 1KKHA 3RAXA 1U4BA 4BR0A 1F5BA 5CD4A 2VB6A 2H5IB 4HL9A 1CQNA 3MM6B 2VODA 3CJKB 3W9HA 1NH8A 2YWGA 1Y9OA 4MLHA 3MAAB 3GIJA 2VUGA 3F56A 4BQZA 2WBRA 1UFLA 5KFLA 2O8BA 1V6HA 2A3JA 1RABB 3IWNC 3BS9A 4OLPA 4YR0A 3EVMA 2U1AA 3A0IX 4WXOA 3L6QA 3MCSA 2R7WA 1WEYA 3IR7B 3WBZA 1TTHB 2VGMA 3LGNA 9RUBA 3ZSQA 4OGCA 1VSKA 1YKWA 1VQMS 2ZFHA 5GAGP 2HHSA 4OQJA 3QGHA 5KOWA 5AQGA 5CH7B 1RT1B 3H1QA 3AVGA 1F2GA 4CLLA 4DX7A 1GXTA 1KHWA 4ED4A 3BSOA 4OHXA 3KLFA 2J9DA 1WKKA 4FS2A 3BBCA 3FSYA 2XS5A 2MSTA 2HQCA 2HRYA 3NMRA 5KI6A 3AO5A 1BOTO 3QGPA 4BRHA 4CFAA 2JHEA 1FI4A 4YR2A 2PMZD 1QDUB 2NRHA 3TP2A 4OZNA 1LXNA 3OXFA 5IWAJ 1JCFA 1Q86T 2W7PA 3CJ0A 3O9QA 2EVZA 4U95A 4CH0S 1W7WA 2YNGA 5A8KB 5IWAF 1JLGB 1KONA 4BWJA 3D28A 3HHNB 1SC1B 4RWTA 2R7SA 3SUNA 2YPYA 4BR4A 4U7UD 2B7BB 3GTYX 5LMNF 2JFKA 1S3XA 1MMDA 3BF1A 2MDAA 4OKEA 2AQ4A 4IEIA 2LA4A 2XMUA 1Y5NB 1ZM3A 2UUAJ 3FCVA 2PZSA 3KDNA 4PL8A 2HNDA 2NXUA 4LBIA 2P9EA 3H45C 5GMDA 4DU7A 5AJ3K 3IXQA 3VAJA 1N5SA 3EJMA 2ASDA 1TVRA 4E7LA 1RDCA 5LJVA 2ZH6A 3AQPA 4QJVA 3CULA 3SQOP 2P6SA 4JI6J 4EGLA 3TPQA 4CFBA 2CQ4A 1N4LA 4JS4A 4ZP8A 4DQQA 5DGBA 4RNHA 3UB5A 1TL3A 4YOWA 4QIFA 3O9UA 4OYBA 3S1TA 1Z4UA 3NNHA 3RSEA 3CQYA 2KW4A 3GYXB 3DGPA 2ITGA 4USJC 2D9PA 6FDRA 4NLWA 4CNZA 2E9TA 4ZPBA 3C14B 2EC0A 1W0HA 5D0RA 1S0VA 1X3NA 4B17A 2HNYA 1QVGM 1SV5B 3H5SA 3UDCA 4DX5A 4HUGA 2E44A 3HSJA 3TZXA 5KFZA 3RBZA 2QWNA 1GXUA 4JKHA 1S9GA 2GIRA 2R2SA 1S1WA 4WFBQ 4X62F 4BRFA 4FM1A 1JKHA 4FPAA 2NLWA 2VFUA 5KFDA 1YWXA 3DXMB 4JI4F 3U7JA 5F8MA 3KYLA 4BG9A 3Q7CA 3OYBA 4CJEA 3GB0A 3EPGA 4MKYA 1MWQA 3S7RA 2V63A 2YHYA 4WFNL 5ETVA 1S48A 2RF2A 4BR5A 3AOAA 2V0NA 1VQNS 1X9SA 2BE7D 3MXIA 1Z26A 1LOTB 2GC8A 2MZ1A 1GTHA 3QMLA 1N54B 1PG5B 4BDZA 1TAUA 3TA1A 4NLRA 1U45A 4L8RB 3O1BA 2MGZA 3HCXA 3W5YA 2HHVA 2F63A 2DHGA 4PG7A 3BR8A 2ZVIA 1SUQA 4QW9A 3FSXA 5B0GA 4Q0BA 1UVJA 3NHGA 3MXMA 1LW2A 3MEEA 1FA0A 3H4BA 1XIQA 4JKAA 3NAIA 3SQGA 4J37A 3DM2B 5F8LA 3PW7A 5JJBA 1EXQA 4DL7A 3CG7A 1OVYA 1PJ6A 4AXIA 2OIHA 4M5JA 4X64J 3V9ZA 5T7LA 2X1GA 2VGNA 2XS2A 1PBUA 3P31A 1I1GA 3OS1A 3C16B 3HM9A 3VTHA 3CEDA 4FWSA 5AQMA 4OZ2A 3DOLB 4P75A 2ZGYA 4RW7B 1YRXA 2XY5A 2BVZA 3MTJA 3O1LA 1N34J 1WF2A 2JZ5A 4JV2A 3OYFA 4MK9A 4OPJA 3OXGA 4B3TK 1A5VA 4GY2B 4RNOA 4W5QA 2NRTA 4ICLA 3OUYA 2E20A 1XHZA 3ZFVA 1HPZB 1JQGA 3CSKA 1HYSA 3Q22A 4MYTA 3JYTB 3IG1B 1HBOA 1D9DA 2P9PA 3G87A 1TL1B 1WKJA 3R8EA 1XMQJ 3JQKA 4DN0A 4UOHA 4LF6J 3FJ2A 3VQPA 3DYAA 3T1YJ 3TARA 1CLQA 2H5JB 1XC3A 3TAFA 2LDYA 1U2VB 4DR7F 2YTCA 3K5LA 2WVEA 2YX6A 4IOCQ 3TTCA 5M1OA 2EFQA 3ENWA 5GAGI 3KKSA 2JC0A 3BPSP 2VA3A 1FX2A 2BJ8A 1X4BA 1YJUA 1YJTA 2A0FB 5FPNA 4KGVB 2B6AA 3TSPA 2CNOB 2VPYB 1RGVA 5KG7A 4LRCA 3EGZA 4ZPWR 1KBRA 5HVHA 2D3ZA 3CCJS 3DU5A 3LP0B 2QK9A 3AA3A 1UOCA 1WHVA 5F0UA 3Q8PB 3VENA 1JLQA 3ZTSA 2DGXA 4DR3J 1FXLA 1S59A 1XNRJ 4C8LA 2OANA 3BBFA 1LWFA 1NB7A 2MZTA 1AA1B 1ZH5A 1NSPA 1T11A 4Z0UA 4CK2A 1UPPA 3DOMB 3SV4A 1OQ6A 4LFBJ 2ZH4A 3AFGA 2M8DB 1CEZA 1NGEA 3ZCMA 1K0VA 3EICA 1RI7A 1NJWA 5GAHU 2CJBA 2HRUA 4RKUC 1WSFA 1T6CA 3FNNA 5I3UB 4DTXA 2J6SA 2DGSA 2QYGA 3LAMA 1OQ3A 2JEGA 1HNZF 2FVCA 4A5AA 4IFYA 4ZVSB 2VASA 3CGIA 3KHLA 4DR1J 2UXBJ 2RPIA 3RJMB 2H65B 2KB2A 4FNHA 3CFRA 2DGWA 1I3AA 4CO3A 5KFOA 1OYEA 1RB0A 3DXSX 3I5CA 1HI0P 1CS4A 4LBHA 2P9IB 4HTUA 1SC6A 3X3UA 4OYXA 2YX1A 1U47A 4HACB 4OI3A 4DHVA 3TVYA 5A8KA 4RL1A 3KHHA 2GIQA 2CDRB 2IVPA 2AGOA 5KG2A 4M3ZA 2O5DA 4QQBA 2VOPA 2J7UA 1ZC6A 4GKKJ 1Q16B 4F8RA 1S12A 3NGTA 4DR6J 4EMDA 2R7QA 3BF4A 1RTHA 2V52B 3R6LB 4GVLA 4AXJA 2Q1NA 2O8FB 2NXEA 1R6YA 4RW8B 2LEBA 3VA0A 5L39A 1QM9A 1MU2B 2IOCA 5CA5A 1EX8A 1LKZA 1SIWB 2ZDPA 3THTA 2XEXA 1XMQF 3N6MA 1VQ9N 4B3RF 3UCZP 3AOCA 2L9DA 4B9NA 1JJHA 2V8HA 3D9BA 1SL2A 3ZT0A 5CABA 3O3LA 1W97L 1KAZA 3IFEA 3SCIE 5AE3A 2O8CB 5KFFA 3OTOJ 3IS9B 4I6AA 5CYJA 4K8XA 5LMUK 2BKOA 1W2IA 4Y6IA 4F3MA 3GILA 1RT7B 2VDHA 3VEWA 4I4BA 4U7BA 2A2CA 1N5TA 1NUEA 3TEGA 3MAAA 2C3OA 2HIYA 2CJKA 4ECQA 1U8WA 3WZ0A 3EL2A 2EEYA 4MMOA 3O08A 4I0WA 1RU1A 2P9NB 1HLWA 3ASMA 1WEZA 1B64A 2R8GA 4IRKA 1UVNA 3OS2A 4JD2A 1SC3B 2HVDA 1LCUA 3KK2B 4LSNA 2D0AA 1U8SA 3NNCA 4DMNA 2W9CB 1G99A 3MXJA 3SSQA 1DRZA 2OTJN 5THWA 3CO9A 3EZOA 2O8FA 4C6AA 3K8WA 4M5GA 3CCQS 1HHQA 2LMIA 3MEDA 1OJ4A 1WC3A 2FTRA 3KK3B 4DPXA 2M2BA 1GMWD 1UWAA 4K2JA 2P9UB 2G0CA 4YB1P 1ZBFA 3QINA 3OTOF 5GAGU 1U02A 1RACB 3VPZA 3HHDA 4YP3A 3JTNA 3G4SS 4QOZB 3QATA 5IC6B 2BM0A 4AQYF 2HF4A 4CH7A 2V67A 5MAOA 1VR6A 4A46A 4DR3K 3UNGC 2V7YA 3U3GA 1H38A 5DO2A 3I55N 1SJ3P 1C0UB 2X3DA 4CF1A 2QTWA 1X4FA 3SQGB 3M6GA 5E3RA 1FD8A 2IM0A 3QETA 2PT0A 4YOVA 2UXDK 2M8HA 2J7WA 2V4RA 1R59O 2HHQA 4B3SJ 3BN7A 4YOUA 4HH0A 3RRGA 3A5OC 5GAEU 1KFDA 2A6MA 4I67A 2KXHA 3OQ2A 5HJXA 3HKZD 2F4VF 3GFYA 2B3TB 3ZXWA 1D1UA 1X4GA 2HB5A 2CRLA 4MT1A 3W63A 3ZSXA 1IQTA 3S3OA 1H3DA 4B3TF 4I6MA 2C3PA 2GQQA 4E1NA 2HVHA 3K89A 3P5BP 5LOQA 4ECWA 4NRTA 2DPNA 1YZ7A 4NMLA 5H9EJ 3Q8QB 3D0HE 3K5PA 1X5PA 5HK4A 2IM1A 2D69A 3CCMS 3CJ5A 3VAFA 2BYCA 3OFEA 4JRPA 4IDKA 4KGXB 4ZP9A 4OHZA 1Q53A 1SL0A 4FYWB 4DV2K 3FEZA 1BI4A 4DV0J 2BR0A 5JMNA 1LW0B 3THVA 2FF3B 1DTTB 1RUSA 4KGKA 2YKNB 3MDQA 4WCEQ 2V69A 4DLEA 2V9WA 1IKXA 3OW2R 3CYMA 4W4MA 2EXUA 1Q18A 3ISNC 1YHQS 3HPOA 3SFUA 3WT0A 1QTNB 3OBYA 2G4BA 4WFAQ 4CK1A 2IJFA 1NPPA 3UE5A 4P73A 4IXCA 4NPOA 2ERRA 3BGRA 3GR0A 4M8LA 2GO9A 1VQ6S 2J0SD 4FJGA 2DRAA 1XI1A 1N6QA 2F7TA 2DGUA 3MN5A 4GVEA 3L95X 3NGYA 5HRPA 1RLDA 3BQ1A 1DLOB 1V4SA 3IA0A 2G1HA 5HMWA 1JCEA 4ETXA 4CZMA 1RKIA 5T14A 4N76A 4PWDB 1LNQA 3ILJA 2E9ZA 2DFHA 2BA9A 5C2DA 1S9GB 1RTJB 1NSQA 1K47A 3H8YA 4ZJQA 2GWJA 1RTZA 1QQOA 1ILYA 2YHBA 2DR8A 3M6VA 1TL7B 1RWMB 2C22A 2QLBB 2IBKA 4DLGA 4FYXB 2PMWA 4C23A 3B6BA 2DNHA 4H0VB 2AD9A 2B8PA 2P9CA 1Q7LB 1PCAA 1SQKA 4M42A 1RTDA 4M3TA 2LVWA 5D4OA 2IM3A 1OPZA 3CCRN 1VSEA 3K9JA 1U6FA 5FROA 3RRHA 4M3XA 1M1HA 4KHRA 3QPIA 3J7AP 4QIGA 2HHPA 3QIOA 3FCWA 2XMWA 1J53A 2XS7A 5KT3A 3J80O 2RDIA 3WIVA 5LXRA 2XTJP 2J9EA 3EXCX 4LFCJ 1RTHB 1GLLO 1VJQA 4OO1J 2D41A 2AX0A 2OPSA 2G0JA 1D9FA 1IR1A 2ZJQL 4PKIA 1NSKL 4WK1A 3TUIC 3JSYA 4N41A 2EFPA 3ENQA 5D8HB 1YJWN 4OYZA 4DV0F 5ETNA 2XG8A 2FSKA 4A47A 1Q8KA 2OKQA 4GVBB 4JHDB 3MUMP 1RSCA 1WG5A 2FHJD 2VKZG 3SMZA 4CJ7A 5AFUA 1N36F 3K8VA 2HMPA 2O8EA 2MQMA 2OHDA 4DR6F 2E29A 2BANA 2AT1B 2ASMA 2ZITA 3M30B 3LP0A 1AFIA 4DUZJ 4TU8A 4J9KA 2ZZMA 5J2PA 3CCSS 1KDNA 2HVZA 2B56A 3ILIA 3KLGA 4OHWA 3OSNA 1KQSM 4JLHA 4ED8A 1YHQN 1PYTA 2JLEA 4GNIA 1RQ0A 1QQNA 4J9QA 3NVKA 2AP1A 2E66A 5IM0A 1ZETA 3M8SA 1FXRA 3JB9k 4CF0A 1FRIA 1GLEG 3LW5C 2RIJA 4JI4J 2MZJA 3OHRA 2F3JA 2VKRA 4PA1A 3M5RA 2IRYA 3C3LA 2CGJA 1NGGA 4BC7A 1AXQA 5F8NA 3NEKA 2GUPA 1A9NB 5DQGA 4BR9A 4O3PA 5A2QU 1TAQA 1FKPB 2HHHF 1IKWB 1DJ0A 2C3YA 3AVLA 4Q7AA 4OYWA 2ITMA 4AHSA 3QO9A 2DNOA 3E01B 5HMZA 2Z1IA 4JK9A 1JLEA 1TYQA 4I69A 4Y2CA 3BR9A 3H59A 3SDEB 4HLBA 4KBOA 2ATLA 1H72C 3P96A 4IQXA 2GMHA 3T5JA 4DUZK 1JIHA 3PJXA 4EBDA 3T1YK 2B0GA 4Q43A 1WDDA 4E3SA 2C2EA 1TL1A 1VJWA 4MFBB 3VVTA 4OI2A 3GDQA 3PYEA 5IT9U 1EQ0A 1SQGA 3NGDA 2B5JB 3IUCA 2O01C 3R5AA 4CJTA 1B9FA 4C7QA 1MN7A 1ZM2A 3VQ8A 3G10A 4MYUA 4B3RK 2OPPA 3VA3A 1OPIA 1F3FA 1F9HA 5E5NA 4CIGA 2Q6BA 4URQU 1OIAA 3HZ6A 3NKYA 4DV7J 2WHOA 1S1VB 2HLUA 3L2RA 1NHUA 4FF3A 4F3QA 2QA1A 2QM1A 4XK8C 4WQ5C 4JI5J 2CGKA 1YVNA 2P9LA 2HW3A 3AD9C 3TABA 5BRHA 3S3NA 2DR6A 1WELA 1FKPA 4KH1B 1C1AA 1WBDA 4IYQA 1GLJO 2FLPA 3ZSZA 4BGBA 3H5YA 4DDFA 2CQHA 1KC8O 3TANA 4BRIA 2XSFA 2HQ3A 3FDSA 4F02A 4LF2A 4DQIA 3QWPA 1YJWS 4I9LA 2IVNA 2GAGC 2DRBA 1ASVA 3WX8A 1NNEA 2JL9A 4KPCA 5HL7L 1MROA 1FWPA 1C0TB 3KTQA 2BV3A 3QFPA 3IM9A 4CBUA 2R7RA 4CI6A 3QNWB 1HKGA 3ZTPA 3I6PA 1RT4A 1YRTA 4ILRA 4V1Ak 2QYCA 3VESA 4CYUA 4LF8F 4DUTA 4JKBA 1HNIA 3NGKA 2W01A 4AL7A 4KAIA 3GIMA 5AXLA 5DK5A 5T41A 2QV6A 2BM1A 1M5HA 3H4DA 4DG1B 4P2FA 3PW2A 5CYQB 4K4XA 3NVMA 1EP4B 1W2BR 4JI8K 5AZIA 3ETOA 3PR5B 1ZBSA 2DIUA 4IJAA 2RILA 3IN5A 1T03A 3H25A 3A12A 1VSIA 5AQLA 2LCWA 1W2BM 1YIJN 1HBUA 2KT5A 2M0GB 3HVAA 3EZWA 4KPYA 5HROB 4NEYA 3DI6A 5DDRC 1HQEA 3KLEB 3DOKB 1EB0A 5LSLA 1VQKS 1ZM4A 3B8HA 4ALZA 2MY7A 5K5MA 4H4MB 3EMTA 3BP8A 5JMVA 2Z1HA 5DM6Q 4ITSA 2MZRA 3LF0A 2QL7B 4LUBA 5AXKA 3CD0A 1HPMA 3OYGA 3SXLA 5E3CA 4NLPA 5LMUJ 4FM0A 1VQSA 1U1MA 3ZTRA 4ZJLA 3LO3A 2UU9J 2UUBK 1PO6A 4TQRA 2DHSA 1ZBHA 3HHLA 2KVIA 3OL8A 2R7XA 2DGQA 2QSFA 4MO4A 4G6VB 1ESVA 4LF7J 1NK8A 1RZMA 3MEGB 4KV8B 3MM9B 3TA0A 1F3VA 2NXJA 1VGYA 2YHWA 2YNHA 3NMUA 2A18A 4E2FB 1RWPB 5F8HA 5J2PB 3TW0A 3QLHB 3KWGA 4QIVA 1U48A 2ZHBA 3IRWP 2G2OA 4B1VA 4OV1A 1GOCA 1CS4B 3IBWA 5DLFA 1FDDA 4OJRA 4PXBA 1KVJA 2UXBF 4FF1A 4USVA 3Q23A 2FJXA 1VISA 3THWA 5IZHA 2WBNA 2E1PA 3EZ5A 3KKRA 4GC6A 3MMCB 1HR0K 2ALZA 3AO1A 4EZ9A 4ZCMA 4Z4EA 1T3NA 1BHLA 4FWLA 2XSJA 2D3UA 4AHRA 3PSFA 4CD3A 1IWGA 2IVOA 4NEZA 2O8DB 3KLVA 2KN4A 5AQXA 4ZPCA 4EU0A 1QTMA 3W65A 3CVKA 2CZVC 2APOA 1AT1B 3NF7A 1O5JA 3H2LA 1IM4A 1B0TA 3OR2A 3I82A 4NLBA 2QTDA 1SPBP 3SCJE 3BGRB 2NNWA 2PI4A 1VBYA 2F8SA 3N6LA 5C15A 1OS5A 3M2VB 4ICLB 1CPZA 2C2RA 1IG8A 1S9EA 3MM6A 3CC4N 1PC4A 1SH3A 3LTOA 4OHYA 3I56S 1S4FA 2E1YA 3O9SA 4P2MA 4YDUC 3MPWA 2P9GA 3U1LA 2I0XA 4YHHK 1QQCA 2E2QA 2J8AA 1HNWJ 2MHNA 4RUAA 2O66A 3K7RA 3PNIA 4ISGA 4IO9L 3HKWA 2A40A 3O6WA 3E9PA 4DTJA 1HD0A 3ONQA 3NL0A 2YHAA 2AU0A 1IN0A 3FZHA 4CO2A 1UKUA 4HUEA 2XCAA 3G86A 4PUOB 5HBMA 2E2NA 2XZDB 5DG9A 3M8RA 4ILMA 4OI6A 3GJRB 3N4WA 2OYQA 1EHWA 4DN9A 2PY5A 4CM0A 1U1NA 2F9WA 2Y8WA 1RWXB 1JXVA 3L2VA 1B99A 1HNXF 1J5EF 1XTZA 4YDUA 1FRKA 2HVIA 3Q83A 3VGTA 2GVZB 2R9LA 4PYAA 1F1BB 1R8PA 5M2PA 1Y10A 1VQKN 2N4CA 4NLQA 4I6WA 2Z8QA 4OI4A 3D66A 1HWUA 1JLGA 2RSQA 2BRKA 2W2NP 1BI4B 2XY8A 4DZ6A 1SJFA 4FXWA 3R7SB 4DV5K 4ID8A 4CIEA 3VZIA 4IFVB 2VBXA 1VQ8N 1T9VA 4ANDA 2FBYA 2AJ1A 5I42A 2CQDA 3R8YA 4Y2KA 4FVUA 1S7HA 2F8EX 1U1QA 2QFJA 3C2PA 2YNHB 1ASWA 1D4XA 2IPOB 3QEVA 3H40A 3ZSVA 1HWLA 4A8WA 4QBUA 1MU2A 4F7VA 4DQ8A 2IYGA 2LXIA 1R8AA 3PO4A 1ZBIA 2G9OA 4USKA 2ACMA 3R9LA 3VGVA 2DR5A 1FRHA 3K0JA 2WAQD 4OZ0A 2HWIA 2DEIA 5FPEA 2QT7A 2SXLA 4URSA 4N8NA 4ZPVR 4DV4F 1RHUB 1BCOA 1N5VA 2AZ3A 3TI0A 2MKIA 1HQUB 2EW9A 2OPQA 4FXVA 2CQ1A 3C15B 2YNIA 2IJNA 4FJLA 4WTOB 4DSIA 3JTPA 1BC6A 2LFVA 1LW2B 3MEEB 4KHPJ 3E01A 2J0QD 3QSYB 2J0XA 1NGIA 2GV9A 1CULA 4RNMA 1U26A 5AQSA 2ZNYA 4IFYB 2BZ2A 2YH0A 4C3KA 3VEZA 2BKPA 3GBTA 2OTLN 1VRTB 3N0VA 3IM8A 2HBYB 2DISA 3ZZTA 5KT5A 3EZUA 5I3PA 3IR5B 1QS4A 3QBXA 4DV3F 3QBWA 5HQMA 3R5GA 3P3DA 1TK8A 1NK4A 1HKBA 2RQ4A 4C3MA 2DT9A 1FRMA 4PABA 2HQIA 2HVEA 1AUSL 2W2QP 1KRPA 4CLYA 1UVLA 3ET6B 2B9YA 4CJLA 4ID5A 2HNZA 3R5JB 4I56A 4ZLPA 2KXNB 3M8WA 1I94J 1FK9A 5HL7Q 3TAGA 4EZ6A 2QA4G 2UYTA 2CQCA 4FLUA 2W42A 2LU2A 4M5IA 2OPRB 4OMFG 2QLXA 4IJNA 3DM2A 4JI2K 5AXMA 3P5TL 1LQ9A 3WC2A 3OJSA 2A3ZA 2DY1A 1WOPA 1ZAVA 4CO4A 4TU9A 3FLCO 1RT2A 1GTEA 1EQMA 2PA8D 3W66A 1EZZB 3G8QA 4DB3A 4ZK7M 3C66A 2DNRA 3L4IA 2MB0B 4ID1A 3VCDA 3KIOA 1XC9A 4EWTA 4FJXA 2NS1B 2Y1IA 3W2VA 4DCPB 4NXNK 3TAPA 1NJXA 3O5BA 3HLUA 2IAJB 3MK6A 4FBTA 3R3LA 2V7ZA 2HGNA 3JS6A 3IP0A 1LAWA 2L9NA 1TKXB 2BTFA 1XNQK 1WC4A 3H90A 1BQMA 3I0RA 1J5EK 3EX7B 4HH1A 4OZ1A 3H3OB 3CMAS 2QA4S 4E19A 4PEOA 1NK5A 4B1UB 3W9JA 4CJWA 5U47A 4NZ7A 2DNGA 4X4UA 3NF9A 4ECRA 2VDIA 3CCSN 4JI0J 1OH5A 2K3IA 3TR5A 2W4PA 4ZVHA 3QMQA 3U1NA 4DR2F 4TY8B 1UJ4A 2XY7A 2DPIA 4Z94A 3VGLA 2CPXA 2RKIB 1URNA 2KTQA 2BRLA 3AA5X 3N5BA 4QAGA 2HHUA 1YJ9N 2EFOA 3MM8A 1RT5B 4CH1A 1S76D 1NMNA 3CJ3A 2VIHA 3VAKA 4CLKA 5CYMB 3QIPA 2V51B 4HHTA 1MWYA 4LRBA 4HR2A 3TAMA 4A8SA 4NWBA 1X31C 2CQ2A 1G7CB 3VHQA 2KG1A 4CZKA 3J7A1 2B5JA 3TO8A 5B09A 3POTA 4B3TJ 2NREA 2MZSA 3GCXP 2R7TA 2F40A 2HFNA 1SV5A 1VQ6N 4HKQA 5A8RB 2X6SA 1ZM9A 1PAEX 2BDPA 3V6KA 2IRUA 1ATSA 2PAVA 4QU6A 1VK0A 2HBQB 4KTQA 3C6UB 4J9NA 3OL6A 3SJJA 3MUTP 4KFBA 2ASYA 4BE0A 2YNFA 1K8KB 5L1KA 3T3FA 4OJ1A 2D1CA 4EYHB 3EDRB 3MN9A 4Z4FA 3GE9A 3AXMA 2XYGB 3VAMA 3PFEA 3FEYB 3OHBA 4IG0B 5L9XA 1UP1A 3MM7B 4X62K 3CD5A 1VSLA 2GGPA 3AAWB 5IFMA 3MM8B 4K2XA 2LSNA 3OFHA 3FRYA 1WSRA 5HP1B 4CQ1A 1VRUB 3CD6S 5HVFA 1XWLA 3N01A 5BR9A 3O3HA 3PRDA 4I1TA 4I6MB 1FK9B 1HNXJ 3L7UA 4QIEA 4L75A 3T5KA 1I94K 1YF5L 3BB5A 3BEGB 2KHOA 1WOOA 1RHQB 4CYUB 2NZCA 1L5UA 4O5FA 1H6KX 1U1RA 4LRDA 1WI8A 3NMAA 4DCJB 4KH6A 1N33J 3PJ9A 2DY9A 5ADXA 5EWEA 2FPHX 2Q3SA 2CJAA 1U2RA 2ILYA 3HI9A 3TTDA 5F9LA 2P9NA 2YNIB 3M9MB 4TKTA 1L3VA 3PLAA 3ZSYA 1RILA 3MM5B 2Q66A 3OYDA 3CERA 4RBVA 1QLNA 1DTTA 6AT1B 4JI2J 1S77D 2BW2A 1VHIA 3GG4A 2GIFA 3EVOA 2VQEF 3SCKE 1BIZA 2J4RA 3O3GA 3FZBA 4YHHF 3MN6A 2R7OA 4BVOA 4IG0A 1PYSB 2YHXA 5BRFA 4IOAL 1E6YB 4QPTA 4RX6A 3U4LA 3DLKB 3QLHA 2O67A 1C0GA 4AILC 1J2VA 3C19A 1WHXA 2JLGA 1UEVA 4AE5A 5T7BA 1FT8A 3MECA 2KG0A 1AYEA 3QGGA 4CT9A 2J76E 3CF5L 2OA8A 4OX9K 1G6BA 2D74B 3OR1A 4YEAA 2ZH7A 4UY8O 2DNMA 3OFFA 2NQPA 2WTFA 3JSRA 1K9MO 2IIRA 4FZVA 5M2RA 2QZ8A 1BXNA 3FZ2A 4O44B 5ETPA 1IUJA 3C95A 2FGOA 4M94A 4O8UA 4ELUA 5EDWA 4Y0FA 1RHJB 5CXTA 1VSDA 3Q2SC 1FDNA 3W2WB 2ZH3A 4L3NA 1YJVA 5GVQA 4AL6A 1TV6B 3DDIA 1ZAXA 3M6WA 1YJ7A 4LF8K 3ENAA 2VZ9A 3V9UA 3GG1A 4EO8A 4JEPA 2MQNA 3FK4A 4K7QA 1IBKK 2M9KA 2ZC4A 1JJ2M 1N8RO 4P74A 2Z2YB 3V4IA 3AARA 3LL3A 2I2YA 3IAYA 2W6LA 1VQLS 4IFEA 1JL1A 3GV8B 2LQ9A 2UZAA 1K1QA 2CPHA 2YWEA 3S9HA 3QT5A 4UQTA 2Z58B 1EX4A 4UUXA 4FJIA 5IM0B 4YQWA 5KRTA 3TQEA 3LP2B 2G8FA 2IC3A 3W7BA 3KHRA 3KKFA 4NASA 3O2IA 2MSSA 4C2MA 1KR4A 2Q6CA 2J5AA 5K14B 2JNJA 1M1GA 1TR0A 1ZPWX 4BREA 2UV8A 3CWJA 4I2QB 5LL6Z 3WXMB 1ROFA 3PM9A 1SUQB 4R79A 1XMOF 3B82A 3PHEA 2JEFA 4O3SA 2HFSA 5EXWA 3HD2A 2GJ2A 5KFJA 2D0BA 3WNFA 3B78A 5CZ2A 1T03B 2RDJA 4DTMA 2V5HG 1R43A 4LFCF 2QO3A 3KLFB 2HBLA 4ZPTR 1FFGB 1WSJA 3FZLA 3CO0P 5DG8A 3GE1A 1NZAA 1RCXB 4FVMA 1RA6A 1JXBA 1RHRB 1YVFA 5GADU 3PDNA 1SKWA 4KKOA 3S3MA 1U0HA 3O8WA 5FD1A 1WSVA 1QD1A 1YITN 3OVBA 3NLCA 4LF6F 3G96A 2B4UA 4NZ0A 2FIUA 1YBTA 4M7YA 4CZHA 3UVJA 2DCUB 2G0IA 2H48B 3D68A 1BWEA 1HNVA 5DQIA 3BKTA 4BE1A 4ILLA 5KFQA 5HMXA 3X1LB 5ETLA 3CDUA 2VFSA 4DV7F 2QWMA 4Y28C 2RS2A 3MFHA 1ASUA 4NCGB 2WC9A 2CJ9A 2QWQA 1FESA 4A48A 1U6BA 5IT4A 5A0YB 2AW0A 1LK7A 3NGIA 3A8KA 4M41A 3UCUP 5AQQA 2AGQA 3VQ7A 4LF4K 2RD5C 3GFXA 3SCXA 4DR2J 3HHLD 1HARA 1C1BA 3MWBA 2GZOA 3ID6A 4CF9A 4ID5B 3P49B 3SUQA 2VBZA 1YTYA 5A2QO 1GT8A 4WCEL 2MLYA 2E5LJ 5E3QA 3GFZA 2D3OR 4F2SA 3NY0A 3AB2B 1HWIA 1S22A 1BU6O 1B92A 4F0MA 2RU9A 1J5OA 1H2UX 3DU6A 2DPJA 2HBKA 1X0FA 3DJCA 2LXUA 1N32J 3NWGA 3FBEA 4PAAA 4J9LA 4WYWA 2AJ2A 2P8IA 2R42A 3HX9A 3SAHA 3DRYA 5FDLB 4ZMMA 2R2UA 3AVNA 1S6QA 3HSTB 2HHTA 4OJ3A 4CVNE 3BDPA 4H0OA 1S97A 3ZT2A 2R2RA 2HGLA 1R31A 3B6OA 2RRAA 1RYSA 1UTAA 4GV6A 1RWNB 5KG6A 4FNIA 4AHUA 1HHSA 1T6DA 4CHPA 4J9PA 3PYFA 2GS8A 2I8EA 4Q45A 1KC8T 2FSJA 1OH6A 3EM1A 5TKYA 2NYIA 2RQMA 3ITHA 3SMSA 4HTIA 3UO0A 4DPOA 4WJBA 1AB8A 4MQ3A 1VI7A 2XLJA 3V81B 1NK7A 2Y8YA 2PFFB 5LJWA 4FLZA 4DSJA 2E4LA 2KT3A 4R8UB 3THXA 7FD1A 4ZVRB 4ZCIA 3ENOA 2Z1JA 3EEQA 4A2BA 4CO0A 1RAAB 3C7NB 2C28A 7AT1B 2A10A 5DM7L 4DV6F 1KLMA 1QSLA 5F2RA 1DKGD 4XPEA 3OD2A 4H03B 3NFAA 3UI3A 4QWEA 3CD7A 4JI8J 2E5GA 1RXOB 1IWAA 1TK5A 4NYNA 2DR7A 4J2BA 4TYBA 5FRNA 4TY9A 4O5BA 3ZSOA 1RT5A 3I55S 2XULA 4CWBA 4FKYA 1EP4A 1EAYC 3R7NB 2XYPB 2AEMA 3CB4A 3QRQA 4A59A 1OWXA 4WZQA 1HBNB 3PXGa 1JNRB 3M1VB 5KFHA 3A3OB 4KH4A 3TUPA 1RCOB 3HHLC 4F4KA 4O23A 4OLOA 4PL7A 1VQ5N 2YX4A 4IR1A 1Q9XA 5GINA 3DLLL 5ITHA 1VC0A 4LQ3A 5AZJB 1RFQA 4KRFA 5EWFA 3TWHA 4CGGA 2QX0A 3QT8A 2YKPA 2MY8A 3ILLA 2KKZA 4ZHRA 4AT1B 2FJWA 2DHAA 1FJGK 1BQNB 1KAXA 3K5MA 3ILOA 3M9OB 2YQ3A 3QNNA 2XGQA 4Q8EA 5L38A 4JN4A 4I7FB 5AE2A 2YJFA 4LFBF 1S79A 4DV3J 4CIFA 1TYQB 2HF3A 3KK2A 4PR6A 1KQFB 4DL5A 4YDXA 5ETKA 3M8QA 2H1YA 2OMOA 1PYOB 3MCPA 3VQ9A 4KB0A 3W8PA 5JXSA 4C0BA 1C0FA 4WZMA 4M3RA 3OBWA 1YLXA 4JI0K 4HCBA 2L9WA 3ZYYX 3PX0A 3QRRA 4NA3A 1YBAA 3HL8A 3K2YA 2OGUA 3CJ1A 2OEKA 4CLUA 3SQ1A 3B4MA 5HLFB 3BF3A 4IG3A 2DK2A 4A8KA 3LDOA 4K42A 4ZVOB 2V8DA 1U04A 2QWRA 1T94A 4K50A 4CFDA 3UR0A 4ECVA 1SVDA 1NJYA 3RBDA 3H98A 5FJ4A 2XMKA 1FDAA 2F4VK 1MROB 2GCFA 5B0FA 3CJCA 3KNGA 2JDJA 3GJTB 4CHZA 2NXNA 4IQMA 3CW2C 1ZYQA 1WNEA 1K8AT 1BY9A 1FNXH 3DXMA 2ABYA 3CDBA 4ISEA 5I3UA 4PUOA 4O3QA 5ADZA 5M1FA 1GAOA 3PEHA 2VPWB 3HJFA 2EBEA 1K44A 4LH4A 2NPIA 2RB7A 1GFWB 4B9SA 5LXYA 1HIYA 3H42A 3KK1B 1RDAA 2JRSA 4RLEA 1TL5A 2HFZA 4NE9C 2QWLA 1P6TA 3THXB 4L74A 3CC7S 2OMLA 3R1HA 4ZCLA 2JJ4D 3MECB 2UUAK 2YX7A 1KTVA 2C2OB 4DUYJ 3RSEB 1M1KT 2VJVA 2HQDA 1Q79A 4UOGA 4OKKA 3FRZA 3OTOK 4O44A 3HVRA 2YH1A 3EY1A 5CCMA 4KYZA 3CD6N 1TFWA 1SQEA 3V6HA 4X64F 4KY3A 1UVIA 3CJ7A 5FRMA 4X4OA 2EFNA 5G0RA 5BYSA 5LT5A 3MUVP 1UVMA 2KH9A 3M32B 1UZDA 2FLOA 1MNEA 4Y65A 3DRSB 3JS9A 4ZVUB 4CJUA 1LK5A 3DNCA 2ACYA 3A3PB 3TA2A 1S0MA 1QZ6A 2A6AA 1XUPO 2YKNA 4F4ZA 4DZDA 3RB0A 4USUA 1IBKJ 3DLEB 3VAHA 3CDWA 3RB6A 4BDYA 1M0SA 3I56N 2WONB 1UJ5A 4FWKA 2VV5A 4FXDA 4MAKA 1S1UA 2ZOGA 2B51A 3CCJN 2F9DA 2W2OP 3I32A 4CESA 4FJ9A 3DLJA 3OHAA 2XMAA 3IDHA 2R3VA 5FLXY 4PWUA 4EK2A 3ULDA 4FWOA 1DLOA 1N52B 3P45B 5C25A 5IT9O 2YY3A 1XMQK 3DRRB 3M3ZA 1BUXA 3OY9A 2X1BA 3ZC4A 4B3SK 4CIOA 3VTIA 3G6YA 4FZXC 1J6ZA 3DRPB 2D0PA 1TMMA 4K4TA 1YXQA 4PWDA 1N32F 3RB3A 2UXDF 4KI4A 3MR3A 5T7LB 4LD0A 1K73O 4BRNA 5F41A 4CJFA 4J90A 3LALA 2QKKA 1HNIB 5J2MB 5AQTA 3AO4A 4WU3A 4QWAA 1TU0B 4S0MA 4DV1J 1R0CB 2YI1A 3BQ0A 1TUYA 3FR0A 1N0UA 2KFYA 3O4WA 3BSCA 1WSEA 3SBTA 3OTDA 3P4IA 3L4QA 1REGX 4P52A 2B43A 2GMJA 4P72A 2HSEB 3K5OA 3RAQA 1CXQA 3C7NA 2P5VA 3HSDA 3BSAA 5HMYA 5HVGA 4E1JA 3OL9A 1OY8A 2AV5A 2ZBPA 3DYAB 4HUFA 2VD3A 5JLFA 2Y0BB 5D0EA 1BQMB 2Q97A 1O51A 1YRUA 3HVTA 1VSFA 2JGUA 2ZWPA 1UCNA 3MCAB 2BQRA 1KCFA 2RE2A 2ZOFA 1HFEL 1X0PA 2G1DA 2ZDOA 4P2XA 2B9EA 2BABA 4W5OA 1SXLA 5F8IA 4EFHA 2UUBJ 2UU9K 1VRTA 1YK9A 2C2MB 5DDPC 1Y97A 4QYZJ 4U7CA 3D7EO 4J8FA 5BPMA 4LF6K 1VBXA 2CWXA 1Q4RA 1FTRA 3LP2A 4ZVFA 2QMWA 3DWLA 1DT9A 2ZE2A 3SJHA 2A6OA 5FLXU 1NJIT 4LF9K 2FBXA 2Z2ZA 4CEQA 1CVJA 1NO8A 3OYJA 3HOTA 1BWVA 3U1MA 3D1HA 3Q8SB 4TLRA 3DFEA 4WFAL 4LF7K 2XO7A 1WN7A 3ZT1A 1YX2A 4C48A 4F2RA 4AFFA 3OFGA 2OTLS 5C42A 3MR6A 3THWB 3DMJB 3T6JA 3KJNB 2WVDA 1S1XA 2QL9B 2XB2D 3OTCA 1B4SA 3UE2A 1VBZA 1WG1A 4KHQA 5H9FJ 1RAHB 3KK7A 1RCHA 4X4NA 5AQNA 2XSJB 3VQ6A 2Z56B 2HS3A 3ZX3A 4PPZA 4JKGB 3TAMB 4KBIA 3EPIA 4DFMA 3H5XA 2BJEA 2ZUAA 4J7CA 4OIXA 4CEOA 4HI1A 2R2TA 4K4WA 3LDPA 3RUBL 4JYAF 3TJAA 1RDDA 4W92B 4W98A 1RAOA 1LEOA 1U2FA 2NR0A 4LJMA 1EKRA 3DRRA 2O1PA 4KSEB 3P6YC 4G3IA 1T9UA 5M1PA 4GVBA 2ZQBA 1U1LA 1S9EB 1WSGA 4ZN3A 1J54A 3HHKA 3LQVA 2O8BB 3NF6A 4U6PA 1RDUA 2RJZA 3R7BB 3SI8A 2AMCB 5E7OB 2QWPA 4FWMA 4GW6A 1F21A 2QEXN 3K2PA 1RBSA 3E66A 5KTQA 3VEYA 5KFBA 3L3CA 4NA2A 4W5RA 5F1XA 4O4GA 1D0EA 1Q82T 3TEHB 3UWTA 2FUG9 4N47A 4QW8A 5FLXO 2KLAA 2LU1A 3VEVA 3HVWA 3PW0A 2MQQA 4ZS6A 4BE2A 5J1EB 3ATVA 2GQ2A 3J81O 1OY6A 3RTVA 3VMFB 1AROP 2Z1GA 1HA1A 1WF0A 1QVFR 3KJFB 4CGHA 2KXFA 3BEXA 1JLQB 4OYIA 4C0OC 1JJCB 1MA9B 1VIOA 2DNZA 2XNQA 1SZ2A 2FGCA 3AO3A 3ZX2A 4DCOB 2FHJA 1YJ9S 1IV0A 4AQYK 2G2YA 3CPEA 3P4UB 1C4AA 2M52A 4M7XA 4M1KA 4MK8A 4NYOA 1SJ1A 4EIAA 3U02A 1UL3A 4FJMA 4JI4K 1Q9YA 3BDEA 1FW6A 2ZJRL 3NCPA 3LM2A 3PRBA 3A8EA 4ELVA 4B9TA 3OYHA 3VALA 2WCXA 4BRPA 2GW8A 1QZ5A 4NLVA 3CPWR 2RS8A 4IFVA 4ED2A 2VPZB 5JLHA 5D4PA 2COLA 1RYRA 2FYXA 3VEXA 2LQ5A 2OH2A 4CTAB 1S4EA 1H74A 3CC7N 5LJ5Y 3NXZA 2XHBA 4CECA 5C0YA 1WLJA 1E6VB 1GX6A 3QSIA 3AOBA 3J81Y 1JJ4A 1IJFB 4QZVB 1HNWF 2IAJA 3FGVA 3CC4S 3KDOA 3VN5A 2XWXA 1P1TA 3GL1A 1D5AA 4NLSA 2ZZNA 3JSBA 3JYTA 4JK7A 5EWGA 5B0BA 4L6V3 3AA8A 2DNYA 3H20A 1RT2B 3T9NA 1V3ZA 3C8YA 2QLFB 5D3GB 2XMJA 2HBJA 3N4PA 1NZ8A 5I3QA 5HQLA 2WOMB 1DQ9A 2MKHA 3C16A 2DO4A 2D7SA 2HS4A 1VBKA 1RTIB 2XM3A 2DFFA 1Q86O 3IR6B 1ZS6A 3NAEA 3RAMA 3D6TB 3UN5A 1SIZA 3FQLA 4NRUA 2MQPA 5AQWA 2ZH5A 2HHXA 3TWZA 4ECSA 4XO0A 5KG0A 4QR1A 2GBZA 2HG4A 4JI6F 1T3OA 4FLYA 2MKCA 2BE9B 1NDLA 2MGZB 3KHGA 5A6PA 3IKMA 3J8AA 2OAUA 2UVRA 1U0HB 4JUZA 3RG6A 1U09A 3N9UC 2BW7A 4HDHA 4LF5F 4Q0BB 3MPYA 2ATQA 4A5BA 4LF8J 3ULHA 1U24A 5F8GA 1LWCA 1RAIB 5AR0A 2DXEA 4CLFA 3MMJA 4YOEA 4NZ6A 3SSSA 1FRLA 1B0VA 1B7YB 3NCRA 4GC7A 2YXLA 2Q31A 2YWHA 5AQRA 5IV3A 1VIXA 4NLGA 3JAMU 1HL6A 3MTKA 3D1OA 2HEKA 3HSCA 3E9OA 3VR1A 2LQBA 5AQVA 3JSMB 1Z6RA 3QEPA 1LWXA 4KIAA 4PG5A 4R8UA 4UQGA 5AQOA 3LOUA 2B8QA 3D2EA 1X4AA 1K1SA 2V8GA 3SK3A 1S57A 4GKJF 1PAUB 4RUBA 1DARA 1NLVA 4CLTA 4CZGA 4M5NA 2UVUA 4OZ5A 5E33A 1AFJA 1PJ5A 3I31A 4OGEA 4JI5F 2YV0X 1NGCA 2QW9A 4LF5K 2P9KA 1Y4ZB 3KJQB 5AQIA 1SB6A 2XCPA 1EKEA 2D9OA 2HNYB 2DGVA 1PSDA 5HOOA 3PKYA 3QIDA 4O0JA 1G4CA 3EE9A 3WQUA 1RDRA 3RR7A 3IRXA 1VMBA 3HTVA 3NE6A 3MF5A 4G1IA 1UZHA 3RR8A 1HJOA 1KWMA 4BDPA 3T7ZA 4X4VA 1CJKB 3R1XA 4AHCA 3LANA 2A41A 2PFDA 1N32K 3VQ5A 2NLXA 3IMXA 3T1HF 3KWIA 3O3FA 3OV7A 2O4IA 1YG0A 2V4JA 2GWKA 2MQ8A 4BC3A 4NI2B 4C98A 2DEJA 4A62A 2E7XA 2BMBA 3C14A 4X4SA 3BH6B 1R0BG 3GLJA 4O4RA 1IJEB 1NGFA 2V8VA 1UW4A 1L3SA 4IWVA 2KL8A 3UVJB 3CCLS 2MLZA 3BGOP 4DV5J 2ZBRA 2XHWA 2FBTA 4GO7X 5KFXA 2C2NA 3L2UA 3ZEUA 4HVJA 2GJIA 1WAJA 4E7HA 3HT3A 2K3KA 3LP3A 4XTTA 1RE1B 4B3RJ 2XY6A 5CZ1A 3I33A 3IMQJ 1UJ6A 4JD2B 1HNWK 3A5NC 2IHR1 1LFWA 4ER8A 3MD3A 4LF4J 4UOFA 5FPMA 1Z05A 2WK4A 4CZLA 4JAXA 4OJGA 2W25A 3IBFB 3SQ4A 2WZ1A 4G65A 3AXKA 2ZD1A 4RW9A 4AHVA 2BJ3A 1DZ5A 4IRDA 4DV4K 1KVCA 1U2CA 3NDKA 3VQQA 3MM7A 2PMHA 4CLPA 4JP8A 3UDEA 1I39A 1BIUA 4F4AA 3I5BA 4X66F 4CGDA 3JXUA 2HMIA 1VC6A 4CERA 5D6GA 2QKBA 2RHSB 1CXUA 1YVUA 3CMQA 5E26A 1CC8A 2ZM6J 1QAIA 2LECA 4RUCA 4RNFA 2HHHJ 3PJWA 2V2KA 3MR7A 5IS2A 3D2FB 1JLFB 5KT7A 4OHVA 2E6MA 1HQUA 4FLTA 1N33K 4Z4CA 1APSA 1IKXB 1S6QB 4Q8FA 1X4HA 3FBFA 3J81j 2YVSA 3FZFA 3ZEUB 4ECYA 3VGUA 1F5AA 1ITGA 1TUUA 5EX3A 3SAGA 3CJAA 1RDBA 1QVFM 4AH9A 3T41A 3T1HJ 3DKDA 2E1AA 1U6ZA 3DRXA 3C94A 4IH7A 4ZVEA 4F9OA 2AA4A 4MLEA 1X5TA 1KXPA 1RT7A 3LDLA 4FPBA 2Y1LB 3OS0A 5KGXA 4KFBB 4RWWA 4DR4F 4EO6A 3UD5A 1FEHA 2NRVA 2W2MP 4HI2A 3M32A 5ETRA 2NUHA 2ZHOA 2G8IA 4FVCA 5DM6L 3G2XA 5F0WA 5KAKA 1MWMA 2HLTA 3OYNA 4NLUA 3NGUA 1ATNA 3ATUA 2V94A 4H4OB 2EKYA 4KE5A 4DL6A 3LDSA 3MMAB 2X7IA 3H08A 4NXMK 4QOTA 4CEEA 4ZITA 1R27B 1VCTA 5C2GA 4A57A 4U9RA 2AWZA 5LMNK 2FJAB 4MKVA 3F9KA 1WHYA 4WXWA 5KFCA 4WYBA 2J7KA 1RADB 3AT1B 1YQHA 2OPPB 5GAEI 4DR4J 2VQFF 3SAFA 1FTCA 1VQ7S 2E5IA 3RB4A 1FHTA 2KRBA 4O3NA 3CE8A 4CCHA 2KFNA 3ENHA 4ZP7A 4HTLA 4N8OA 2JX2A 3BM7A 1S1XB 4QU7A 4K4VA 3GG0A 4KHPK 2C1EB 2KHCA 3NH2A 4IRCA 3FQKA 1RBVA 5BR8F 5EGYA 2CDQA 5IQQA 1E4FT 4Z7CA 4DUYK 4CF2A 3EUNA 4O4GB 2E5JA 3HK2A 1R7IA 4ILHA 3C6AA 2VWJA 2IS3A 3RMAA 1IO2A 3ZZ0A 2JVOA 3PSIA 1YI2N 1A7GE 2J6TA 1S1TB 2PN6A 4B1WB 2HBRB 3CJ4A 5E3AA 2JWKA 4A61A 4KHUA 4RG8A 1WORA 2XLKA 5CHIA 2UUCJ 4DI6A 2C3MA 2OD6A 4RU9A 3U9DA 3VQ4A 2AJ4A 1HX1A 3QRPA 2F1FA 3DOKA 4F0HA 3WEEA 2BJ9A 5AFUH 1FVSA 3KMSA 3CFPA 1UA0A 1BHNA 5IV4A 4Z4IA 5CZXA 4DV6K 5CY4A 2F4VJ 5AQJA 1NK9A 1TGOA 4N7TA 3MI7X 2V6AA 4CK3A 2X74A 4XDCA 3SPYA 2LYVA 1RK8A 3HD1A 1WUUA 3RU0A 2W6KA 1HI8A 3GCWP 4BS2A 2QSWA 3MHYA 2E7WA 3KWMA 5CHCB 2VL1A 3O9RA 2V4QA 1C1CB 2W4DA 4MJKA 2IMWP 3UDLA 1VSJA 5BYRA 5F9NA 1DURA 3P8BB 5H1SV 4YUDA 2CJXB 3SQ0A 4ED5A 4IO8A 4BRQA