3DRPA

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drpA05
3VQCA 1DTQB 1X1PA 5JXSA 4FVMA 3I5AA 2RKIB 4EBCA 1NHVA 4DQRA 3G6XA 1JLQB 1ZBLA 4CHZA 1XHXA 4ZP6A 3T19A 3VQPA 3SI6A 4CJPA 1HRHA 2Q3SA 3G6YA 2IA6A 2EC0A 3PX4A 3KK2A 4KBIA 3AVBA 3ITHA 3KKSA 1IG9A 4RW4A 4ECRA 2OPPB 2YNHA 3AVCA 3HPHA 3MECB 1JLFB 3OYHA 2ZQBA 1ZBIA 3HJFA 3QIPA 4RW9A 4ECVA 1S1VA 4O3NA 1LV5A 4ZP7A 2UVWA 4TQSA 4ED8A 1ZTTA 2FLLA 3TR8A 3LPTA 4LSNB 3OJUA 1FXXA 4DTOA 1MU2A 4MFBA 3TAQA 3DOKB 3K57A 4ZTFA 3QETA 1WSIA 4EO8A 3V4IB 4E7HA 4Q45A 3NH2A 4OKEA 4MIAA 3LWLA 3VQ5A 2D3UA 4OLBA 2D7SA 3V6KA 1TKXA 4K4YA 2BGGA 5T14A 1KHWA 3AVKA 1KLNA 1S0MA 1ZETA 2W7OA 2IC3A 4BACA 4QAGA 4CE9A 5KFQA 1RT2B 3PHEA 2P5GA 3DLBA 3C94A 3CJ2A 4ZP9A 4PQUA 3OY9A 1F21A 1BQNA 3NGIA 4DFKA 4M3ZA 3JSMB 1JIHA 2XGPA 4XPCA 4IRCA 5KTQA 2QKBA 1S9FA 1HQEB 4FLZA 2VG5B 5DGBA 3BGRA 5E41A 4FLTA 4CJWA 3KLFB 1T7PA 2R2RA 5DQIA 3VA3A 4ID5A 2ITGA 4KB0A 2YV0X 3T3FA 4IR1A 3QEIA 4PQUB 3I0SB 4FJ7A 1J5OA 1RT1B 1C0UA 4O4RA 4PWDA 1HYZA 4CHPA 3CM5A 4OLAA 4IG0B 3E01A 3OSPA 1VRTB 1S0OA 3SPYA 2JEJA 5KT2A 3CM6A 4I2QA 4DSLA 2W9BA 1HNVB 3MTKA 3C95A 5KG3A 1EKEA 4M3TA 5DLGA 5FDLA 3H40A 2QKKA 4HUEA 4AHCA 3NKYA 4LSLB 3HSTB 5DQGA 4E7LA 3DDKA 2X6NA 1IM4A 1S1VB 3ZT3A 4IR9A 3D45A 3RB6A 1SUQB 1B9DA 3OVNA 1TQLA 1K1QA 3AVAA 2UUWA 2UVVA 3L2WA 3OHBA 3WNEA 4OKJA 4EEYA 1RTDA 1VSMA 4ICLA 1N48A 4M3XA 4DL4A 3SNNA 4NYFA 4IFYA 3GV5B 5J1EB 4DU1A 4HKQA 3Q8SB 2XRIA 4F8RA 5DG7A 2B5JB 1RTHB 4Q0BA 5I3UB 4B9MA 1W0HA 1RT1A 5EU7A 5J2NA 2XWYA 4QWEA 1WSEA 3GIKA 3V9ZA 1C2PA 2XC9A 2E6LA 4F2SA 4ZVEA 1YTAA 3AVIA 3V1OA 1A5XA 3OYJA 1HQUB 4U6PA 5KFAA 3MXMA 1UAXA 4M41A 3OYIA 3NAIA 5C5JA 5J2MA 3O4QA 1IO2A 4FS2A 3OYGA 2UVRA 3LPUA 1VRUA 4B9SA 2W9CA 4BWJA 3HHKA 4QWDA 4FJKA 3I0RA 5KFMA 2HNYA 1S1XA 1BIUA 4KHNA 1TK8A 3CDEA 1RBTA 4CF9A 3CVKA 5HRNA 4TLRA 3LZJA 3OL8A 3D0PA 4JS4A 1XHZA 4ZHRB 1FKPA 4KHUA 4IDKB 4NLOA 2Z1JA 4PY5A 3DOKA 1VK0A 1T03B 4TY8B 1I3AA 4ECYA 4E7IA 4K4UA 5CY4A 2W8KA 2AGQA 1U45A 5KRSA 4UQGA 2OYQA 3LP0A 3KJVB 4M3YA 3OYNA 1RT6A 3SJJA 2X78A 4KRFA 2B4JA 2RPIA 4FCYA 2OPRB 3HVWA 4CF8A 3KK3A 1S4FA 4FM0A 3BQ1A 1RBUA 1ASWA 1BQMB 1JLAB 1XR7A 3NFAA 4CF2A 4RNMA 1CXQA 5I42B 3Q8RB 3C6UA 2E6MA 4CJEA 4FJ8A 4ECUA 4CFBA 4ID1A 4ZHRA 3KLIB 1CSJA 4MFBB 1WSGA 3HP9A 4NCAA 1VSIA 1IKVA 5DMRA 4O5BA 3QZ8A 3H5SA 1UWBA 3PJXA 4ELUA 3MFHA 4CJ4A 3QEXA 3OYCA 1S10A 2B6AA 3BDPA 4NRTA 1NOZA 3OLBA 4R8UB 3AO1A 3V81A 3TAGA 5HRRA 4DTNA 3SV4A 3SCXA 1S9GB 3CJ0A 4B9TA 2PYLA 3M8QB 1S1UB 2FJWA 5CZ2A 1QAIA 3LP1A 4NLRA 2W42A 5F8MA 5DG8A 4QWCA 4M3WA 4J2AA 1JLCA 3OYAA 3CYMA 3IRXB 4ECZA 4O44A 2OZMA 2OPQB 2YHAA 3SZ2A 5J2QB 4NCBA 2AX0A 1U04A 2ASDA 2W9AA 3ZSRA 5KFHA 5KFWA 4X2BA 3V81B 3TAPA 1WSJA 1NK8A 4IFYB 2ASLA 3S9HA 1D9FA 1I6JA 4DL5A 4NLGA 2HHQA 3DOLA 2KQ2A 3QZ7A 2FVPA 3QGIA 3VQ4A 4TXSA 3DRPA 5K14A 1KVCA 1NK0A 4ZP8A 2OA8A 4CERA 3PW4A 1D1UA 1IKWB 4CGJA 2O5DA 1JLEA 4RW8A 3IRXA 2P51A 2GIRA 1RDAA 4KKOB 2FVQA 3OL7A 1TGOA 4B9UA 1N6QA 3ISND 1TV6A 4J9NA 1N56A 3M9MB 4KAZA 4IG0A 3HL8A 4YR0A 5KFSA 3BGRB 2GC8A 4AHRA 4ED1A 2R8IA 2Z1IA 3OYLA 3V9SA 3PX0A 1OS5A 3OYMA 1U49A 3THVA 2F8SA 3M8PB 5FRMA 2G8KA 4I7FA 3LALA 3DRSA 4JV1A 1LW2A 1HMVA 2YKMA 3SQ0A 5L9XA 1XR6A 3ZCMA 2Z1GA 5KT3A 3JSMA 1NJYA 3PO4A 4CJTA 1NKBA 4F3OA 1HQEA 4IH5A 3L3VA 5DK5A 1EX4A 1HJRA 5C25A 3JYTB 4Z0UA 2HW3A 2I1RA 4HHTA 2AWZA 5KFJA 1C6VA 1B9FA 1SV5A 4XIUA 3KIOA 2IAJA 2BE2A 3DLGA 3EZUA 3S3OA 1RDRA 2YKMB 2W7PA 4O55A 2R2UA 5HP1B 3I8DA 1S6QB 2ASJA 4OJRA 2G8FA 2Y1IA 3T5HA 3NF8A 2OH2A 1C0TA 1N5YB 4K4ZA 2D3ZA 5F8HA 4BE1A 3DLEB 4CIEA 5I42A 4ECXA 2BQ3A 3HM9A 3GV7B 4IFVB 5KI6A 5F8LA 2AX1A 5F8GA 3AO5A 1RBVA 1VSLA 2XY8A 4J2EA 1TK0A 2IM0A 4RW4B 1N6QB 2YNGB 3BREA 2AGPA 5KT7A 5FDLB 4Q0BB 2BQRA 1UOCA 3RTVA 4RW9B 1Y97A 2V9WA 3DRPB 4FXDA 1S48A 3MECA 4R5PA 4W5RA 1RT4B 4RUCA 5KFVA 4O4GB 2YHBA 4RW8B 2BDPA 3KLGA 1TKTB 4DSIA 5KG5A 3C6TB 4Z4CA 1JLEB 4J9KA 4BE2A 3TI0A 4YNQA 2YNGA 3LP2A 1RT5A 4FW1A 1JLCB 2KW4A 3H4DA 1SL1A 1EP4A 2E9RX 4IH7A 4OKKA 4NLVA 2HHTA 4KV8B 2KTQA 2C28A 1C0TB 1N5YA 4KTQA 2QE5A 1T94A 4DTJA 4J9RA 5CZ1A 5HP1A 4ECQA 3N6NA 3CQ8A 3QEVA 1S1TA 4ED0A 4FM2A 4QOZB 3V1RA 4FJ5A 4NYZA 3UR0A 4ED6A 4O0IA 1DTQA 1HYSA 1ZBHA 1JX4A 2IS3A 4DFMA 5KG4A 4IRKA 3N6LA 3EZ5A 4Y3CA 1RCHA 3QO9B 3MF5A 4M3RA 4CGFA 3FDSA 4KAIA 3WNGA 3U6FA 1N4LA 4CJLA 2JC0A 1KTQA 2FJVA 5CYQB 4KPYA 1RT4A 3QEPA 1S0NA 3D5MA 4CEAA 3GIMA 3TARA 4ECTA 2AQ4A 4K4VA 1JL1A 1S1XB 2WONB 4M45A 4KO0A 4E1MA 1S6PA 3SUPA 3DLRA 1DLOA 4DG1A 3LAKA 3MFIA 1LWCA 4TYBA 3V9XA 2BR0A 3FQLA 4PWDB 4EP4A 3ALYA 4H8KA 3OS2A 3ZSXA 3EY1A 2BRLA 3VN5A 2R8GA 3MEGA 1G15A 4JRQA 4DU4A 5T7BA 3N6MA 1FK9A 2DFEA 4F4WA 2G8WA 4I2QB 4AILC 2HHUA 4FJIA 1RYSA 4HVJA 3RAQA 3GIJA 3OHAA 2A1RA 2HWHA 1HNIA 4HCCA 2A1SA 2ATLA 1WNSA 4MKAA 3ULDA 5C24B 4MH8A 4CJ3A 1KLMA 1FKPB 4PUOA 4I9LA 2UVUA 4Q8EA 3B6PA 3ZSYA 4NZ0A 1RTJB 3AO3A 3HPOA 5J2PB 4KHRA 2GBZA 4CEQA 4YMEA 1ZYQA 4XO0A 2JC1A 3MEDA 5KFFA 3C6TA 4FLXA 1JLGA 3B6OA 3AVJA 3LP2B 3KHRA 4DMNA 5HRSA 1S1WA 3A2FA 4ECSA 4KV8A 3SFUA 4W5NA 4DQSA 1S9EA 3NE6A 3M8PA 3CJ5A 4DLGA 5K14B 1WAFA 3IG1B 4DTRA 4DL7A 1RDDA 2R8KA 3OS0A 4E1NA 5KFTA 3BQ0A 2R2SA 3OYEA 4LSLA 4NLQA 1UA0A 4C8KA 4K4TA 1QE1A 1RAJA 1TKTA 4C8MA 1SUQA 4WZQA 2WB4A 4FJHA 4RU9A 4AHUA 2FBYA 2BANB 4ZTJA 1Q9YA 1JL2A 4KSEB 4MK8A 4M3UA 5KFGA 2VG6A 1X9MA 2FJXA 1GX6A 4ZMMA 5KFEA 1IKWA 1O1WA 2Y1JA 2ZE2A 2IBKA 3ZT0A 1ASVA 1WN7A 4Q5VA 1C1CB 3HO1A 4CHNA 5D3GA 1C0UB 4QW9A 4Z4EA 1JLGB 1NJZA 5KG6A 2YKNB 4WXOA 2QK9A 3QLHA 1VSKA 2WCXA 5EWGA 3MEDB 4CEEA 5HBMB 3LWMA 2W9BB 4F2RA 4K4WA 3L8BA 1BGXT 1TL1B 3PZPA 1SH3A 1S9GA 3GQCA 1GOAA 5KGXA 3C6UB 4KB7A 1NK5A 4CGIA 3KLHB 1U48A 3QLHB 3OL9A 4OL8A 2RF2B 1VSDA 4QWBA 1KRPA 5KG1A 3VQ7A 2R8JA 1VSHA 3AVFA 3IGVA 4CJKA 4CK1A 2FBVA 3AVMA 2ETJA 4CEBA 4NLYA 1RNHA 4FLVA 1T03A 4TY8A 1UWBB 4RNNA 3MEGB 1T05A 4EBEA 4CEZA 4N5SA 4JUZA 1RYRA 5KFRA 4F4ZA 3FQKA 3T5KA 4JV0A 2GIQA 5KFZA 2OPSA 1RTIB 4LQ9A 4URGA 1RDBA 2W9CB 3ZSOA 3DLGB 1L3UA 1C1BB 3UPFA 3L2QA 4JLHA 1RBRA 3DYAA 4J9OA 2V4RA 5KFOA 4G1QA 3FFIB 3TAMB 3RMCA 4YFUA 3L2UA 5KG7A 3QNNA 4KE5A 1R0AB 1QSSA 3SPZA 2IJFA 2OPQA 4TSXA 1RTDB 4IDKA 3IS9B 1NK4A 1HPZB 3GYNA 3RB4A 2DPJA 2IM2A 3NH0A 2F96A 3IN5A 1TL1A 4I7FB 4ECWA 1CLQA 4CJUA 1KFDA 3V9UA 5KFLA 3GIIA 4L8RB 4CHOA 4WZMA 3DRRA 1GX5A 4WFZA 4BWMA 2YKNA 4XPEA 1WSFA 2R8HA 3H2LA 4I2PA 3LP1B 3KLGB 3QEWA 5HRPA 1KFSA 2G8IA 1VRTA 2AU0A 1TL3B 4FYDA 5J2QA 2WOMA 1XI1A 5HLFA 2FVRA 1W25A 3H4BA 2VWKA 3PW0A 3DLKA 5KGWA 1YT3A 3LANA 4C8NA 2YNHB 3G6VA 4O4GA 1UA1A 2C22A 5JS2A 4CGHA 4IG3B 3BSAA 3K2PA 1LAVA 2I5JA 5J2NB 2BRKA 4CESA 1RT5B 1REVA 2D0AA 1NHUA 1XR5A 1QE1B 3MEEB 4CK2A 1CZ9A 2AJQA 3VQDA 4FJLA 4QWAA 3MR6A 4Z4IA 4N41A 3D28A 3FFIA 5KT5A 4KB1A 2HVIA 1ZBUA 3V6DB 4J9PA 3KK1B 3IGNA 4DEZA 4AHTA 3IS9A 2E9TA 2O4IA 2F8EX 3VQ9A 4DTMA 3P5JA 3CFRA 1SL0A 1B92A 4R5PB 3NAHA 3NAEA 1JXLA 4MKBA 4RW7B 3L2RA 3I0SA 2E4LA 1J53A 3H5YA 2PZSA 2OPSB 2HMIA 2KFNA 2ZD1A 4WE1B 1DTTB 5F8JA 1FKOA 3NF6A 2G8UA 4CGGA 4DLEA 2VWJA 2RF2A 3KLEB 4B08A 4F4XA 4N76A 4ZVHA 2IMWP 4IBNA 3QERA 4B3OA 3SQ1A 2XCAA 4WYWA 2XO7A 4Y1DA 3E51A 1S1WB 3MXJA 5SZTA 4LQ3A 3HK2A 4ZPAA 5SWMA 4FK0A 3T1AA 3UDLA 4IH6A 1VRUB 2XCPA 2HHWA 3SQ2A 3JYTA 4CF0A 4CFDA 2WRMA 3M9NB 5CYMA 5KRTA 2JLEA 4MQ3A 4KHYA 1Z25A 1NK9A 2OPRA 2IAJB 4GC7A 3TVKA 1JXEA 5F9LA 2HNDB 4OPKA 3NDKA 3PR4A 3FRZA 3V9WA 5KFIA 1HARA 4IOBA 5FROA 2HHSA 3HVTA 5KFCA 1QTMA 4GVMA 1IKXB 4RZRA 2BANA 1I39A 3ISNC 3RMAA 3I0RB 4CEFA 2X74A 3ZSWA 4FJNA 2R2TA 4NCGB 2V4QA 1JLFA 1NKCA 2NUBA 1C1AA 1LWCB 2E9ZA 2PY5A 3KOAA 3IG1A 3HT3A 2C2RA 1KCFA 1S5JA 4E7JA 2XY6A 4ICLB 3G10A 5KG0A 4NYNA 4FJXA 5HROB 4FJ9A 4DF8A 1QSLA 3E01B 3MAQA 3DMJA 4NRUA 4TQRA 4FBUA 1L5UA 3ITHB 5JS1A 1KSPA 5HLFB 4ED2A 4F4KA 3CIZA 1K1SA 2ATQA 5KFDA 2BE2B 4FJGA 1RA7A 1QAJA 1JXBA 1QUVA 4RW6B 4PUOB 4CEDA 4FLUA 3DI6A 2RKIA 1RTIA 1L3TA 3ASMA 3KMQA 3FSIA 2ILYA 1IKVB 3KMSA 2DFHA 5KFUA 3PW2A 3BR9A 3KD5E 3G86A 3RR7A 1Q9XA 4M42A 4WFXA 2HAIA 5L1LA 2AGOA 4NLSA 3AV9A 1VSEA 1R0AA 5KFXA 2HB5A 4EYIB 2YNFB 2DFFA 1D8YA 3OJSA 4CJQA 4MIBA 1QQCA 3AO4A 3MR3A 4KFBB 4O0JA 4CEOA 3LDSA 2WTFA 3KLIA 3HXMA 2XI2A 4F4YA 3TABA 2IC3B 1K6YA 4ZVFA 5C42B 4FZYA 2RN2A 4RW7A 4H4OB 3MXIA 2D41A 1DLOB 5J2PA 2VG7B 3DM2A 3O3GA 4O3QA 1LW2B 4IFVA 1TKDA 3CWJA 3BSOA 3KNAA 1IH7A 3SUQA 3AVGA 4LSNA 5KT4A 4BDZA 3OSNA 2KZMA 1WLJA 2GV9A 1MU2B 4HTUA 4I9QA 4HUFA 4QPXA 4NLWA 3I5CA 3VQAA 4ED7A 4KHSA 4ID5B 4Q8FA 1ITGA 2QV6A 1L3VA 3RBDA 4C8OA 3VQBA 4FBTA 3VQ8A 4FLYA 4DU3A 3T5LA 3HVRA 4URQU 1T3NA 1XWLA 1REVB 3ZT2A 4DG1B 3NBPB 3NL0A 3ZSQA 2W8LA 1SH2A 5F8IA 3SV3A 4EBDA 3DOLB 3K5OA 1TL3A 4DSFA 3VQ6A 4DTPA 3EPIA 1HQUA 3NGYA 1RT3B 3ZT4A 3RRGA 5C42A 1YVUA 3BSCA 1RTHA 1SKSA 4RW6A 2HNZB 1U4BA 4F3TA 1TAUA 3HPGA 4LH4A 1S1TB 5D3GB 3EPGA 3KLHA 3O4NA 4HCBA 4CF1A 2LSNA 3DI6B 3F73A 4KKOA 2XI3A 2IM3A 1X9WA 3Q8QB 4H4MA 3CFPA 3NBPA 3QIOA 3CJ4A 3CDWA 1TK5A 3SI8A 4LD0A 4QW8A 4H54A 5KFNA 3KHLA 1TKZB 4OGEA 3DRRB 3OYDA 4YQWA 1IKYB 4W5TA 4DTUA 1J9AA 3G0ZA 4ZPDA 4B8CA 4CJVA 4LH5A 4CFAA 1X9SA 4Z4FA 3AO2A 1U47A 3SFGA 5KFBA 4JV2A 4RUAA 1Z4UA 3DMJB 3CG7A 2F8TA 4NLTA 4R8UA 4GMJB 4IG3A 1HNVA 4RNHA 3PW5A 5KT6A 1L3SA 3SUOA 1S9EB 2R7YA 3LP3A 4DS4A 5EWEA 3LZIA 4G1QB 4PA1A 3ZT1A 1QHTA 2CJQA 1GOBA 4FLWA 4CHQA 2VG7A 3HYFA 4GC6A 2VA3A 1EETB 4E19A 3KLFA 4DTSA 2FBXA 2O4GA 1RT7B 1RT3A 1IKXA 3NF9A 4LY7A 1TP7A 3LP0B 3KJVA 2CKWA 1D0EA 4ZPCA 3UQSA 3KHGA 4CIFA 4HUGA 4KHQA 1KLMB 3TANA 4U7CA 4B9VA 2P1JA 3DLEA 3H98A 2FVCA 3QINA 1S1UA 3CJ3A 4BDPA 4AHVA 4J9LA 4RNFA 3KLVA 4DF4A 4F50A 4KTWA 3PV8A 1RT7A 4EO6A 1A5VA 4NLUA 5F8NA 2HWIA 3O3FA 2YNFA 1RILA 2IJNA 2B43A 1FK9B 1SH0A 1SV5B 5EUHA 4OPJA 1HNIB 2RDJA 1J54A 4E7KA 3NF7A 2GUIA 4RNOA 3QGHA 4B3OB 4AH9A 1RBSA 2G8HA 1HMVB 2HNYB 3QO9A 4YR2A 5JUMA 4IKAA 4N56A 1YTUA 1Q8IA 3KK1A 3H5UA 1BQNB 1LAWA 3OLAA 3PUFA 1ZBFA 2D0BA 3MR5A 4KREA 5EDWA 3I5BA 2DTUA 3TWHA 4TY9A 5DGAA 4DL2A 3DLKB 4FM1A 4J9MA 4W5QA 2WHOA 2FVSA 2WONA 4DQIA 2FC0A 3AA3A 2DY4A 2PYJA 2FLPA 4Z4HA 1C1CA 3AVNA 4BE0A 3RRHA 2VG6B 1LWEA 3VQSA 3L2VA 2C2EA 1GOCA 4FJJA 1NK6A 4CCHA 2HHXA 5DLFA 4EYHB 4YR3A 5KG2A 3QIPB 3ICLA 4CJ5A 4QCLA 3EYZA 2JGUA 2VA2A 4K4XA 2FBTA 3GILA 2WOMB 1KVBA 4NCGA 3BSNA 4GW6A 4I2PB 3NCIA 5DG9A 1ASUA 3AVHA 1EP4B 5C24A 5I3UA 1BI4A 1NKEA 3M8QA 2UUTA 5EWFA 3NH1A 4DFPA 3QNOA 3PY8A 3PVXA 4EZ6A 3H59A 1LW0A 4Q43A 1JKHA 5KFPA 3DLHA 1WNEA 3OYFA 5HROA 1CXUA 4O3RA 3HVAA 3AA5X 1JLBA 2ILZA 4CJRA 1NJWA 1BCOA 2J6UA 3U3YA 4TYAA 4K8XA 4CJSA 2RDIA 3NGDA 2P5OA 2XHBA 1BHLA 4W5OA 1SKRA 1HPZA 5KFYA 3NHGA 4IQXA 5DQHA 3S3MA 4MK9A 4N47A 1BQMA 1JLAA 4J2BA 4KTZA 4CECA 4G3IA 4DL3A 4KO0B 4DSJA 1S49A 4H4OA 4NLXA 1C1BA 4EP5A 2DPIA 4DL6A 4O3SA 3V1QA 3AA4A 3K59A 4KHWA 2IGIA 3DYAB 3M9OB 2ZD1B 4E0DA 1U09A 3TAMA 3PJWA 4E3SA 4KI6A 4JS5A 2HMIB 2HVHA 3V6HA 1HYSB 1EETA 3VQQA 1ZTWA 5J2MB 1RT6B 4B8AB 4ELVA 3BJYA 1BCMA 4DQQA 3O3HA 3CFOA 1SL2A 1QS4A 2G8VA 3PW7A 4K50A 3NMAA 1T05B 3K5MA 4B9NA 3RMDA 4IRDA 3KTQA 3DM2B 2XGQA 3SUNA 1TVRB 3NGZA 1S97A 3SYZA 1SKWA 1LW0B 3DRSB 3OS1A 4EZ9A 4FS1A 4DFJA 3UIQA 4R0EA 1RT2A 3Q8PB 3HP6A 1KHVA 3MEEA 3K5LA 3PX6A 5C25B 2X6SA 3M8RA 1W9HA 3TQ1A 1Z26A 4Z4GA 3CDUA 1EXQA 2JEGA 4ZVGA 1IKYA 5FRNA 4K8ZA 3HKWA 2VG5A 4KFBA 4KI4A 3AVLA 1BISA 4CK3A 1BIZA 2J6TA 3KHHA 2ZKUA 4CGDA 1BI4B 3RAXA 2FLNA 2B5JA 4J2DA 5L1KA 4OVLA 3RB0A 2HNZA 1VSJA 2XY5A 4Y34A 2ALZA 2I5JB 4NLDA 4ELTA 4J9QA 1TV6B 4NLPA 2OZSA 5J1EA 4O44B 2KFZA 3GV8B 4DQPA 4O3PA 3VQEA 3RMBA 2WK4A 2KZZA 4B9LA 4OGCA 3OYKA 3VA0A 2J6SA 3KD1E 1D9DA 3V6DA 3ZSVA 3PO5A 3S3NA 3P1GA 3RWUA 4FK2A 3PR5B 2D5RA 1T8EA 3LAMA 3WNFA 3OYBA 1J5OB 1A5WA 4Y1CA 1S6QA 4TN2A 2C2DA 4DS5A 3L3UA 3T5JA 4BDYA 4CIGA 1JLQA 3U3GA 2JEFA 1CZBA 3H5XA 4CJFA 3BQ2A 4FK4A 2V0NA 3CO9A 4Y2AA 4DWIA 3HVTB 2JEIA 4FZZA 1D5AA 1RTJA 3SQ4A 1XC9A 2QXFA 1WSHA 3ZSZA 4IKFA 1RA6A 4FZXC 2YNIB 5CYMB 3KK2B 3V6JA 2B6AB 3RR8A 4Q44A 2BQUA 1LWEB 1NOYA 2XY7A 4K4SA 4H4MB 2HNDA 2Z1HA 3H08A 1TVRA 4Y2CA 4WE1A 4YP3A 3KK3B 4KHMA 4ZPBA 1VSFA 1LWFA 3KKRA 1FKOB 3TAFA 1NK7A 3KLEA 1NNDA 2IOCA 4DTXA 3MR2A 2EHGA 5HBMA 4J9SA 1C0MA 4CFCA 4WXWA 3QGGA 3V4IA 5CYQA 3OL6A 2HHVA 2D0CA 3IAYA 1S6PB 1TKXB 4WYLA 4URSA 1QSYA 4JRPA 1MMLA 4AHSA 3QYYA 2EX3A 1LWFB 1BL3A 1RDCA 3M8SA 4M95A 4HYKA 1DTTA 3TAEA 2IDOA 4ED3A 3RBEA 5F9NA 1YVFA 2ZE2B 5L1JA 2IM1A 4DSKA 4C8LA 1JLBB 4DSEA 4MK7A 4FW2A 3WNHA 1TKZA 4O3OA 1KVAA 4CHYA 3QESA 1TAQA 1WAJA 3P83D 4WFYA 5KFKA 3AA2A 3K58A 1HYVA 4RG8A 2YNIA 4E89A 5L1IA 1NJXA 3F9KA 3RB3A 4M94A 4FJMA 1JKHB 2OPPA 3QIDA 3K5NA
chains in the Genus database with same CATH superfamily
2ZJRQ 3ILLA 4LF4F 1X1PA 5JXSA 1MWKA 3DGVA 2RKIB 7FDRA 4DQRA 1KS2A 3CMQA 1PC5A 1ZBLA 2QA1A 4QIVA 4GVLA 2V2VA 1XHXA 5FPMA 5CHIA 1I5OB 3VQPA 3SI6A 4P73A 4CLZA 3G6YA 4P2XA 3PX4A 3AVBA 4KH0B 2Z30B 5HAOA 1IG9A 2OPPB 2E1RA 2DVIA 3MECB 4CO3A 3HJFA 4YB7A 4RW9A 4FWQA 4ZIVA 2HZVA 3I33A 3TJAA 4ZK7M 1ZTTA 3M32A 1QAYA 3TSQA 3OJUA 3O80A 4DTOA 1MU2A 3FBEA 3IO1A 3MM9A 1HKGA 1SAZA 4ZTFA 4HEA9 3QETA 4A8KA 2ZHAA 1KAXA 3SDEB 4RCHA 5JJBA 4Q45A 5K8OA 3LWLA 2D3UA 2D7SA 4LBIA 4A57A 2CZVC 2CPYA 5T14A 1X9JA 2A6AA 4M5HA 3O1WA 4CE9A 1QVFM 1RT2B 3C15B 3DLBA 2J8SA 4ZP9A 4PQUA 1UP1A 3HLUA 4I6YA 3Q23A 3CCLN 3JSMB 1KONA 1JIHA 1SQFA 4IRCA 1N54B 2VOPA 3QFPA 4FLZA 3PSFA 2VG5B 1HWLA 3OQ2A 2C3OA 1T44A 5DQIA 1S7HA 3VA3A 1NEEA 4KB0A 6FDRA 3PYDA 6AT1B 3T3FA 2MZTA 4LF8K 2R42A 3SJHA 3I0SB 4FJ7A 3CD6S 1VOMA 4QOTA 4DI6A 3SSRA 4BC9A 4CHPA 3I32A 3CM5A 1OYDA 2LCWA 3OSPA 2DR5A 4PG4A 3CCSS 3WBZA 3SPYA 2KVIA 3CM6A 2ROEA 3UN2A 5SUHA 4BROA 1X5PA 1LK5A 3MTKA 2O8BA 1CPZA 5M1OA 2QKKA 4AHCA 3QATA 5G0RB 4NWBA 4E7LA 2XZWA 2P9KA 3ZLJA 3I56S 3RB6A 2ZWOA 1SUQB 4ZVSB 2CPFA 4CI6A 2RH3A 3M6WA 1K1QA 3L2WA 4OKJA 3P5TL 4KH5A 4M3XA 3SNNA 5M1PA 3FNNA 3G71N 1N32J 2XRIA 4ISEA 2G2YA 4Q0BA 1HD0A 1RWNB 4B9MA 4ED5A 5HMWA 5HL7Q 1W0HA 5AQXA 1OJ4A 4TKTA 5J2NA 5C2CA 4DR3K 3JAMY 1SJ3P 4PKHA 2UXBK 4F2SA 3FZKA 5EVZA 1OY9A 2G0JA 1UCNA 1VQ8N 4ZCMA 2GMHA 4CD1A 3U1NA 1P27B 4QYRA 3OYIA 2EFNA 4WQ5C 4FS2A 1Z2ZA 2N7YA 4UOHA 2GS8A 3UN3A 4EGLA 4BWJA 5AE1A 1Q86O 1X4HA 3U4LA 1ATSA 2UUAJ 1BIUA 4JI1J 1QD1A 3CVKA 3U9ZA 3S7RA 3U02A 4FYYB 3VEXA 3LZJA 3OL8A 5E26A 4DUZF 3EO3A 3TVZA 2VGNA 4KHUA 4NLOA 2Z1JA 3VAIA 1VC6A 4PY5A 2OCEA 1VK0A 4TY8B 1FXRA 1SXLA 2BACA 1XJWB 3HD2A 2A0FB 4M3YA 5M2UA 1JJ2R 2B4JA 2RPIA 4CF8A 1S4FA 3Q7BA 1RBUA 2GEMA 1AUSL 4CF2A 2OD6A 1CXQA 5I42B 5H9EK 3Q8RB 3O9SA 2KHOA 4CJEA 4ID1A 3KLIB 3UWTA 3J81j 3SMSA 1VHFA 3L4BC 3T1HF 5GINA 4NCAA 2QLBB 1VSIA 1Q53A 5F0UA 3H5SA 4ELUA 5AQMA 3HKZD 2ZH7A 4WBFA 3BDPA 4G65A 2R9LA 2GHVC 2K3KA 4MO4A 3OLBA 4WYBA 1NRKA 5A8KB 2CJKA 4V19X 1M5OC 2DISA 5IT9U 1RCXB 3TAGA 3WIUA 5HRRA 4DTNA 4F4AA 5E84A 4H5NA 3CJCA 2FJWA 3GONA 1YRTA 2NSBA 4BRLA 2L3MA 3PYEA 3CMEN 2W42A 1WKLA 4DPXA 1NNEA 3Q8VA 4NL5A 4B3MJ 1JLCA 3OYAA 3CYMA 4O44A 4EUVA 1IJJA 2OPQB 1CVJA 3SZ2A 5J2QB 3G4SS 1EWQA 1X4AA 2ROGA 1UPPA 3V5RA 4X65J 3ZSRA 4X2BA 5FIIA 1WSJA 1WC0A 3S9HA 4JI7J 4DL5A 3DOLA 2KQ2A 1TTHB 4K43A 3VZHA 3VQ4A 4L75A 4PKIA 4ZP8A 5D6GA 4OYXA 1NDKA 4JI3K 2O5DA 3J80U 3VGKA 4CP5A 2QC3A 2HLUA 2MJUA 4KKOB 2AA4A 1M5VC 4MKYA 3OL7A 3UR3C 2HS4A 3ISND 2LFVA 2HK3A 1TV6A 4A8MP 4A8FA 3I87A 2AJ2A 3HFVA 3GL1A 4DV1F 1RI7A 2YH0A 1AROP 5KFSA 4WKRA 2EPIA 4AHRA 4ED1A 2UP1A 2IHR1 4ES2A 2EWHA 3FBCA 3OXLA 3GFZA 3PX0A 4K5SA 2HBMA 1U49A 1VQLS 5FPNA 2V67A 5FRMA 3ZZUA 4DU7A 2YKMA 3QMLA 1NMDA 2Z1GA 2KI2A 2NCKL 4MDBA 2UUBF 1NJYA 3LDNA 3BV8A 3UVJB 4IUFA 1XMOK 4CJTA 3G2XA 1SCJB 1GQEA 3L3VA 4GKJF 2WVCA 3CCJN 3JYTB 2HFSA 2QIFA 4HHTA 2AWZA 2NSCA 1C6VA 1KKHA 1J5EK 2RNEA 2VC0A 5AR0A 3A8YA 4GRSA 3D66A 3J7YU 2R2UA 2VCPA 5HP1B 3GP9A 2UUCF 1S6QB 2ASJA 2Y1IA 3T5HA 3RBZA 4K4ZA 5F8HA 3DLEB 1FJGK 5GIOA 5KI6A 2QN6B 5F8GA 1VGYA 3C6HA 2Y9HA 5AQVA 3BREA 2AGPA 4Q0BB 2BQRA 1UOCA 2Q97A 3RTVA 3NGKA 5LM7E 2KT5A 3BO3A 3MOJB 9ATCB 3AOCA 3TO8A 2IRUA 2WZ1A 4DR4K 4O4GB 3ET6B 3MMCB 2BDPA 5CYJA 4FOIA 2J0WA 1O51A 4B3SJ 3F0NA 2K8GA 4J9KA 4BE2A 3TI0A 5BR8K 4YNQA 3D6MB 3W5YA 2YX6A 2B4VA 1SL1A 1FWLA 1UFWA 4U7UD 2NZ4A 2E9RX 4NLVA 1PYSB 2QZ8A 2ZH8A 5AE2A 4JV5K 3I6PA 5HK4A 1Q82T 1VLYA 1C0TB 2DIUA 3LH2S 2QE5A 3GYGA 4DTJA 5CZ1A 4BRQA 4YOXA 2DHXA 4OHVA 2CPEA 1SZ2A 3QEVA 3IUCA 4A62A 3W2VB 4QOZB 2L9NA 2W4CA 4ED6A 4O0IA 1HYSA 3P38A 2G1DA 2IS3A 3EZ5A 1OH5A 4H0PA 4OX9J 2XLKA 4BC3A 2QLJB 4M3RA 4CGFA 3WNGA 3U6FA 4JAXA 1KTQA 4NA2A 2FJVA 5CYQB 2I6WA 3D2FA 3TARA 4MLEA 2AQ4A 2E8AA 2X1GA 4K4VA 1JL1A 3ZX0A 3VGTA 3O4WA 3TZZA 4M45A 2RU3A 3BZCA 4TYBA 3V9XA 4B3SF 4M5JA 3TQEA 1S6OA 4H8KA 1CC7A 4WF9L 2J7UA 4JRQA 5C2GA 5T7BA 3N6MA 2G8WA 4AE5A 4I2QB 4AILC 4S0MA 1RYSA 1I94F 3SDEA 1YIJN 1QTNB 1S6UA 2HWHA 1HNIA 2OJ3A 2XSJA 4MKAA 4YUDA 1FKPB 4M5LA 5AQNA 2UVUA 5GAEI 1OVYA 1U2VB 1B3TA 4CZFA 4NZ0A 4YHHJ 3LDPA 3HPOA 2CQGA 2ZOGA 5J2PB 5A2QY 4XO0A 3K9KA 4L3KA 3RUBL 4JV5J 3LDOA 4FLXA 4DPTA 3B6OA 4WFBQ 3ILIA 4WCEQ 1IBKJ 4ECSA 1SQEA 1NZ8A 4CRJA 1FE0A 3CJ5A 3L9ZA 3JXUA 5D4OA 3OS0A 2Z2LA 3A3PB 3CC7S 5AZJB 3BQ0A 2R2SA 5LY3A 3CQXA 1URNA 5IT9O 2P9LA 2NPIA 2CWXA 4K4TA 5E3CA 3NLCA 2NXJA 3EJMA 1U6ZA 1TKTA 3VGUA 3MN5A 4C8MA 2WB4A 3DOMB 1LQ9A 3AQOA 2EFGA 4DV4F 4JI4K 2FBYA 2BANB 2GA7A 1WB9A 1JL2A 3JSBA 4M3UA 2FHOB 1YLXA 5IWAF 2FJXA 4YS2A 1T9UA 3HHLB 1GX6A 5KFEA 2IJRA 1ZAWA 3G82A 4CYUA 4DV6K 1WN7A 4Q5VA 1C1CB 4CHNA 4IJAA 2MKCA 2OI2A 3OPKA 5HJYA 1VJQA 3TA0A 4DV1K 2YKNB 4BQLA 1N34F 2CQBA 4TU9A 2UU9J 3CCMN 3RG6A 5JVGL 2VB6A 2ZDOA 2MLZA 1OH6A 5EWGA 3E1YA 4DR5K 5HBMB 3LWMA 4NXNF 2Q79A 2XNQA 3SMZA 1TL1B 2CPIA 2F4VF 1GOAA 5KGXA 4MYTA 3CULA 1HLUA 1QVGM 4ZLLA 3D2EB 1F3VA 1VQOS 3JB9k 4PWWA 4J91A 4GY2B 3P39A 1Y00A 4QWBA 1NH8A 5KG1A 2DNOA 2QL5B 4DCJB 2XNRA 2IVNA 1PSDA 2FBVA 2E5LJ 3JXOA 4NLYA 1JJCB 1Q79A 4FLVA 5GAGU 2QYGA 2EBGA 3EVWA 4KGMA 4YY3F 3GCXP 3MAAB 3ZX3A 2W2OP 1RYRA 4OHXA 4F4ZA 3FQKA 5KFZA 2OPSA 2ZBIA 3U9DA 3W0LA 1RDBA 3UPFA 4MIWA 2HF4A 1E4GT 1O8BA 2H9ZA 1PJ6A 1XQIA 3CJSA 4A8QA 4G1QA 3FZHA 4YFUA 4FN5A 3L2UA 3NMUA 3LW5C 1R0AB 1QSSA 4WP8A 1RTDB 3MMAB 2JFKA 1NK4A 1HPZB 3RB4A 2H3GX 2DPJA 4NEZA 4FPIA 3NH0A 2ADCA 3IN5A 3K8VA 3D6RA 3OFGA 1ZM4A 4ECWA 2C1EB 3V9UA 1CS4B 3GIIA 4LRBA 2NRRA 3DRRA 1XQSC 2WBRA 4BWMA 2YKNA 4DL0C 3RSEB 3T1YJ 3H2LA 4C8YA 3CJKB 5HRPA 2OKQA 2G8IA 1BWVA 1VRTA 2WOMA 5BR8J 2FVRA 2A5XA 3LANA 2BW2A 9RUBA 4GVEA 3EGZA 2C22A 2IVPA 4USHA 1UVNA 1S5ZA 4BG8A 3VAGA 5J2NB 2BRKA 4CNZA 1VQPS 1X5OA 3ULEA 4U7UK 1IG8A 3US5A 3PYFA 3AHPA 2VD3A 4QWAA 4F67A 2ZC4A 3D28A 2KG0A 2GX8A 1U1NA 3V6DB 4J9PA 3BYPA 3IGNA 2LEBA 1RXOB 2F8EX 1DEJA 3GU0A 1SL0A 3ZO7A 3BY5A 3L2RA 1M90O 5M1NA 2HMIA 4AL5A 1H7WA 1CQNA 1FKOA 4DV3F 4DLEA 3WXIA 2VWJA 4F4XA 4U9RA 2BUPA 2IMWP 4IBNA 3JSRA 2D69A 4B3OA 1WTFA 2KM8B 2IPOB 3MX5A 3AY0A 2WVEA 3J81Y 2KB2A 2X1BA 3RGIA 4Y1DA 1K9MT 4PYAA 4FK0A 3KUHA 2XCPA 3SQ2A 5A8WB 2GTDA 1ILYA 5LMUJ 3M9NB 3QDKA 4RX6A 4AXJA 2V63A 1Z25A 1Q81T 2N7CA 2JLFA 4B1UB 1S99A 2KYZA 2ITMA 2QA2A 4IDHA 5KFIA 1HARA 2P9PA 4MLHA 4WCEL 1U2FA 4GVMA 4USWA 2ZZNA 4I6MA 1LEOA 4F0KA 3G9CA 1UWAA 2F8HA 3I0RB 2M3DA 3OXFA 2DIVA 3W9HA 3ZSWA 4JI6J 4NCGB 2QRRA 2J4RA 2I38A 1LFWA 1NKCA 1C1AA 4AM7A 1KD1O 1XNRK 3KOAA 3IG1A 4N8NA 5CAAA 1S5JA 4E7JA 3B78A 5HJXA 4FJXA 1IBKK 5IWAK 4FJ9A 1LFPA 4DF8A 1N5VA 3A8KA 1J27A 2LYVA 1KQKA 1RAOA 1Q16B 4TQRA 3ITHB 1Y11A 1KSPA 2DO4A 2MQMA 3ZTRA 2ATQA 1K1SA 2BE2B 2WSEC 2NYHA 2CDQA 1QAJA 2EVZA 2ZWHA 4BGBA 1RTIA 2E1PA 3CC7N 3ASMA 3U8XA 2ILYA 2B3TB 1IN0A 2CQHA 2DFHA 2UXDF 2E7XA 2ZM6K 3M30A 2GVDA 3PW2A 3BR9A 1RISA 3O44A 3G86A 3RR7A 1HR0K 2RQKA 4ES3A 4M42A 2CUYA 5L1LA 4NLSA 5FD1A 1RWOB 2A40A 5EOYA 4EYIB 2HFUA 2MTLA 1QQCA 2D0PA 3OA9A 2JDJA 3CCWA 3KLIA 2XI2A 5CH7B 2BYCA 5JMNA 1RFQA 1K6YA 4ZVFA 5C42B 3T1YK 3R1HA 4X64F 2H1YA 4EHUA 5LJWA 4DV5K 4UZBA 4RW7A 4H4OB 2CJBA 5T7LA 3MXIA 1RKIA 2D41A 1DLOB 5AQQA 3P6YC 1HWKA 3O3GA 4FF1A 4IFVA 2ZJRL 1YI2N 2NLXA 1FRLA 3QBWA 3VPZA 1WLJA 4F9OA 3OVSA 4HHJA 4NXMK 4NLWA 3I5CA 5ETSA 2V8HA 2RT3A 1YDLA 4Q8FA 4I6WA 4QZVB 2YX7A 2Q6CA 3I4PA 2Y0BB 4C8OA 3DHXA 3MUVP 4WPAA 4FBTA 5K5MA 1NZAA 3T5LA 2AYBA 4HLBA 4ZCKA 1REVB 3NBPB 2WBMA 3EEQA 1SH2A 4H5TA 3L09A 4EBDA 3DOLB 3ZETA 3K5OA 3HRGA 3QNWB 1F1BB 3NGYA 3ZT4A 3RRGA 4PABA 4KHPJ 1YVUA 3BSCA 2O8FB 3N5FA 4F3TA 3HPGA 1P1LA 3O4NA 1FHTA 4CF1A 3F73A 4KKOA 5E3PA 2XI3A 3MHYA 1PG5B 3CXCR 2IDLA 2QWNA 2ZHOA 3CFPA 3AAWB 4LVNP 1U8SA 4P10A 4YOEA 2VFUA 5FLXU 3CDWA 3M2UA 1XNQJ 1TK5A 5AQKA 3SI8A 4LD0A 3KHLA 4G6VB 3EUNA 3PJ9A 3OYDA 4AL6A 2GWJA 1CJTA 4LH5A 3WIVA 2ZM6J 1WG5A 2O8DA 1U47A 3SFGA 4JV2A 2RQMA 4RUAA 5ETLA 1VMBA 3DMJB 2ASYA 3RYLA 4R8UA 2D0OA 3WXJA 4B3TJ 4IG3A 1D09B 1F60B 4JI1F 4RNHA 1XMQJ 4WU3A 3PW5A 4PEOA 2NRHA 2MJNA 3G25A 3S01A 3NEKA 5EWEA 4Z37A 2FYXA 3B6BA 3BN4A 3DGPA 5KQDA 4HDHA 4G1QB 1WHXA 4PA1A 4N8OA 1GOBA 1MA9B 5C2FA 2VG7A 3CT9A 3HYFA 4BRGA 2VA3A 1EETB 2CXEA 5B7WA 4E19A 2ZBCA 4L72B 4N77A 5M2RA 1GLLO 2O4GA 3MI7X 2E88A 2XB2D 5BPMA 1IKXA 3ENAA 4LY7A 1TP7A 4OYAA 3FR0A 4YORA 1IBMJ 3E3XA 4IFEA 3F9MA 3H98A 2WW4A 4PPZA 2FVCA 2Q0UA 3PKYA 4IO1A 5KPZA 3QINA 1S1UA 3MTJA 4J9LA 3C7NA 4DF4A 3MM7A 2F1FA 4F50A 4KPCA 1B99A 2MQOA 3TEHB 1RGVA 5FPDA 4NLUA 3ZZPA 5F8NA 4ZN3A 4W92B 2FF6A 2KU7A 1RILA 2B43A 4RL1A 5BYQA 5EUHA 5HN0A 3GFYA 2YJFA 1GTEA 1J54A 3IFRA 4E7KA 2GUIA 5LMUK 4LFCJ 4RNOA 4OJGA 1RBSA 4C7QA 1W2BM 2G8HA 1HMVB 5BN8A 3NG8A 2NZCA 4I1TA 2HKEA 4CLPA 1S7IA 4LVOP 1ZM2A 1YTUA 4DXLA 1UAWA 3W8GA 3GWCA 4FVUA 2D0BA 3LDLA 3I9V9 2PEHA 1XNQK 4DL2A 4TLQA 2WHOA 4DQIA 2MKJA 1N33F 3AA3A 1Y10A 3L2VA 2C2EA 3GFXA 3MCPA 2KH9A 1AT1B 2K2PA 3IWXA 1HKCA 4OI2A 3QIPB 3S41A 2ALYB 2VA2A 2EFQA 4DCHA 3PYGA 4B02A 1HWIA 1HNZJ 2VQFJ 2HS3A 4I2PB 2E5HA 3Q89A 1ASUA 2L41A 5M1QA 1H7XA 4IO8A 4CO5A 3LDQA 1E4FT 1JB0C 1NKEA 1EARA 2UUTA 3QNOA 1MWZA 1SS6A 1XBWA 3PVXA 1FVSA 1MWQA 1AZSA 4Q43A 3VEYA 3P31A 2XS5A 2IYIA 4AXIA 1CXUA 1VQMN 3SCLE 5GADU 1RWUA 3O1BA 2DXDA 1JLBA 5D0HA 4CJRA 2CQCA 2UUCK 3U3YA 3FCHA 4TYAA 3CMAN 4CZMA 3NGDA 3WX4A 1JCFA 1SIZA 1UFLA 2MZ1A 3QBCA 3CHWA 1Y5NB 1JLAA 2VHGA 5HSPA 2PMWA 4KTZA 3CXCM 4G3IA 2ZJQL 1UETA 4YOTA 1S76D 4KO0B 2CQDA 3D2FB 1S49A 4NLXA 2A3ZA 4DL6A 4O3SA 5RUBA 2HFNA 4OPHA 2YQ3A 2ZD1B 3CSKA 2CQ2A 3NRBA 3TAMA 2Y1RI 1RAHB 3RAMA 5ETPA 3VEZA 5BXIA 2D3OR 5D78A 2IVOA 1CZAN 1NGCA 5AFUA 5B8HA 3VQQA 1ZTWA 1RT6B 1HPMA 4UY85 2CQ1A 1OVQA 2LXUA 4K50A 4HHUA 3CCES 3O9TA 1HW8A 1KR4A 4OX8A 3MX2A 1ZA1B 3DM2B 1ATNA 3AARA 1SKWA 3AAQA 3TUPA 3OS1A 4HT7A 2CQ4A 3I8BA 3UIQA 1T0TV 3PX6A 4DMZA 5C25B 2X6SA 3M8RA 4HH1A 3TQ1A 1W9HA 3BDEA 2F9JA 1EXQA 1VQ5S 4WQ4A 3PIOQ 4OPAA 1T6DA 2H5JB 1IKYA 3HKWA 3UCZP 2JH3A 2R7TA 1RHMB 5KPRA 3ZNJ1 2LQ8A 1BIZA 2J6TA 2KKZA 5D4PA 1TFWA 3HZGA 1UTAA 4CGDA 1BI4B 1WC5A 3SBMA 1VQ7N 3RB0A 2HNZA 2FC9A 3VQTA 3IDHA 3K0SA 2I5JB 2IBOA 3HHLC 4BCAA 1KXPA 4J9QA 2VICA 4JKHA 2ZNZA 4RBTA 4A5AA 4NLPA 3UE2A 3GBTA 5J1EA 1BQXA 4WP3A 2GAHC 4OGCA 3OYKA 3VA0A 2NUUG 1D9DA 4XH5A 3PO5A 4QR0A 1N52B 1NMEB 5G0RA 1T8EA 1HI8A 4DUTA 4YOVA 1J5OB 1FERA 1S6QA 1QQMA 4DS5A 1TL7B 4BDYA 3MPVA 1ZXOA 5DZ7A 3U3GA 4BRHA 4XK8C 4FK4A 4K8RA 5D0GA 3BH7B 4CNYA 3CO9A 4Y2AA 4DWIA 3DU6A 3HVTB 3JAMO 2PI5A 3ELHA 2UV8G 2RUGA 4PKDB 2J5AA 2VBXA 1XC9A 1RA6A 5CYMB 3KK2B 5LMNJ 5BRHA 4WFAL 3AAPA 3JQKA 1X4GA 3AOBA 2OD4A 5L9NA 3L7UA 3E9PA 1NOYA 2B8PA 4DR5J 3FE1A 2J0XA 1M5KC 3QGPA 3PG9A 1E6VA 1R7IA 4WE1A 3TA2A 2FSNA 4YP3A 2FJBB 5ETQA 3IWLA 2RB7A 4QR2A 1FKOB 3TAFA 1XERA 1IR0A 2FHJD 2FDNA 3U27A 3THWA 3K17A 3IC1A 2IOCA 3VAKA 5D15A 3MR2A 1WC6A 4C0HA 3ENOA 5K20B 2XEXA 3ATVA 3OR1B 3V4IA 4DV2K 3NS5A 3MAHA 2CQ3A 2MZSA 5DJBA 4URSA 3D0GE 4JRPA 4P52A 2EX3A 4JOUA 3M8SA 4M95A 1DTTA 2IDOA 4BG9A 2DEIA 2MQPA 1NPPA 2ZE2B 4J7CA 2IM1A 5AXNA 1ZH5A 3QRQA 2QWPA 4LFAJ 2X1AA 4LF5K 1YF5L 3VEWA 2V4JA 3RBXA 3M6XA 1WAJA 3P83D 4WFYA 5A0YB 4W98A 4E89A 4O0NA 5CABA 3OW2R 1NJXA 4FO0A 4KY3A 2JVOA 1MMDA 2OPPA 3QWUA 3J7AN 3GJTB 4AM6A 3R9LA 3QFHA 2BKPA 1DTQB 3G96A 2QTDA 2F4VK 3I5AA 1WF1A 2P8IA 2YWKA 1M0SA 2KLAA 2XO6A 1JLQB 5KQ8A 4ZP6A 3CPWM 3T19A 3NGTA 3THTA 2Q3SA 1HLWA 1LK7A 3O8MA 3KK2A 3IA0A 4RW4A 4NASA 4OYZA 3HPHA 2RQCA 3OYHA 1S57A 2B4UA 1ZBIA 2HFOA 2P2CB 3CCUS 1KVJA 3HD1A 2V2QA 3CD0A 4O3NA 4DR2F 4X4VA 4P2FA 4ZP7A 1SC6A 2DEJA 4P7TA 2PMZD 3IMQJ 3LPTA 2BMBA 3D1OA 2MKYA 1T9WA 1U2RA 4K42A 4DZ6A 4AQYK 4IZ9A 4ES1A 3K57A 1PILA 3H46O 1HUXA 4EO8A 3V4IB 4DR1J 2ZJQQ 3W3SA 1VQ9N 4OKEA 4MIAA 1WF2A 3VQ5A 1CG2A 4K4YA 1KLNA 3AVKA 2C42A 3TSUA 3KJQB 3EX7B 2OMOA 5BPLA 4RLEA 1IVZA 2K06A 3FVYA 5J1NA 2P5GA 1NBEB 3C94A 3CJ2A 4NB4A 5KOWA 2ATCB 3E8OA 2V7ZA 3OY9A 3C3LA 1FDAA 4OX9K 4I6MB 2XGPA 4CO4A 4XPCA 5KTQA 1DJ0A 1HQEB 2XLJA 1YJWN 5E41A 4FLTA 3FEXB 4ZPTR 1HI0P 1T7PA 3H6EA 4ID5A 3UDCA 3MM8A 5M1FA 2YV0X 2FJEB 4IR1A 3QEIA 3WQTA 4B3TK 1RT1B 2HZAA 4JI3J 1AA1B 4BC7A 4X4SA 1VQ9S 4IG0B 4JKFA 2R3VA 5AQZA 2AHOB 3E01A 4HI2A 4LT6A 1RHRB 1VRTB 3TU5A 3K5PA 4I2QA 3NOGA 4DSLA 1VIOA 2QLWA 3AGRA 4F02A 5AE3A 2EK6A 4FYXB 1NXIA 4M3TA 2E1AA 2AJFE 1CJUA 3NP5A 3NKYA 4LSLB 2DO0A 3DDKA 2X6NA 1IM4A 3D67A 4LUBA 1FT8A 3W9IA 5M1KA 4U8YA 3OHBA 4JI2F 3M2UB 3WNEA 3LGMA 3AD9C 3ZTOA 2RS2A 5C2DA 1YJTA 3C19A 4DL4A 2CNKB 1CULB 2UUBJ 3MWBA 2KT3A 3ZYYX 1OYEA 4HKQA 5DG7A 1RTHB 4K59A 1KBRA 4Q7AA 3M1VB 3VETA 3MK6A 2XWYA 2HBYB 3M4XA 3VGVA 4QWEA 1WSEA 1WACA 2XMUA 3V9ZA 2XC9A 3OT9A 2FZCB 2W41A 3O6QA 1RDUA 5IZHA 1YTAA 3V1OA 4JI4J 4X62F 1W2BR 1JCEA 2FTRA 2QLXA 2VOOA 3D1QA 1IO2A 2FY8A 3EM1A 2LECA 2CJ9A 2P9IA 1RWWB 1YX2A 2IIRA 1P90A 5B0BA 2QWRA 2VV5A 1QAXA 3H2UB 4QWDA 4FJKA 5KFMA 3PACA 2HNYA 4I69A 2CG8A 4CVNE 3D3CJ 2GV1A 1HBOA 4OYIA 2D74B 2D9OA 3MUTP 3D0PA 1XHZA 4DR3F 3VESA 4BS2A 4CLKA 3DOKA 3A8EA 1IUJA 2NXEA 2MGZA 3R8EA 4ECYA 4NA1A 2AGQA 2OYQA 3LP0A 2F4FA 5AQRA 1Q18A 2VC1A 2YPYA 5BR9A 3HVWA 2GW8A 3WEEA 4YDDB 1JLAB 1XR7A 4OZNA 2RHKA 4H0YB 4LF6J 3C6UA 1UVMA 3CO0P 3IKMA 2R4FA 3HI9A 2E5LK 2AEJA 3A13A 4OZ3A 3HP9A 2C3MA 4IOAL 4O5BA 3DXMB 4C8ZA 1HNZK 4ZS6A 3UKUA 2GVZB 2VJVA 2G13A 4CIOA 4ZJLA 2V52B 4ZCLA 1NGDA 3SV4A 4PPDA 2MQLA 1R89A 1S9GB 2DNPA 3R5BA 3AJ2A 4EK2A 3M8QB 1H1VA 1O0PA 3PRBA 2Z2YB 5F8MA 4X66K 3HHEA 2OTJN 4QWCA 3IWNC 4DX8H 5LSRA 3TYTA 3T1YF 3A3NB 1B7FA 2YHAA 4NCBA 2V8GA 5D77A 1EWRA 2W9AA 3R5JB 3SAHA 2GQ2A 5KFWA 3V81B 2UU9K 1NK8A 4YOUA 4IFYB 5E5NA 1I6JA 3AODA 4NLGA 3ZZYA 3SQGA 3M6UA 2R7SA 3DRPA 5AT1B 4C4WA 1KVCA 4CERA 3PW4A 1D1UA 1PJ7A 2H4YB 1SC1B 1YSJA 1IKWB 3J7Z5 3JTNA 2P9LB 5GMKa 2G9OA 4RW8A 3C16A 3O2IA 1TU0B 2JWKA 1KAZA 2ZNYA 2YKQA 2K7JA 3ISZA 3UO0A 2ZH6A 3M2VA 4EI2A 4OZ0A 1N56A 4KAZA 1IBMK 4U95A 2DNQA 2FHMA 3DCAA 4BY9C 3BGRB 1PYOB 1WHVA 4JKCA 1H98A 2R8IA 3F41A 3BGOP 3ETMA 5T41A 1S3XA 3THVA 2F8SA 4M1KA 5F2RA 2FHKA 3FGVA 3SQ0A 3N79A 2VKZG 5KT3A 1X7VA 3D3BJ 3OTOF 4XDCA 4LMZA 2CQIA 2HQDA 2CZ4A 4F3OA 1EKSA 1R8CA 3D1HA 5DK5A 4OYMA 4LFBK 1HJRA 4Z0UA 1X8DA 3FMBA 2I1RA 2E2QA 5KFJA 1SV5A 2D1CA 3HZ6A 3QRPA 4DV7J 3KIOA 2IAJA 2BE2A 3DLGA 3EZUA 3S3OA 1DARA 1UW9A 1VC5A 2W7PA 2QEXN 1KC8O 3H1QA 2B7BB 1Y5LB 4OJRA 1N8RT 3L7PA 2QA4G 2DHHA 2BQ3A 3HM9A 5BJRA 5JVGQ 3AJDA 3CCVS 4FZVA 4K5RA 3DDNA 4WTOB 3P4IA 2DNMA 4B1XB 1U26A 3SQOP 5KT7A 5FDLB 1ZZFA 2RMLA 2YXLA 2WFBA 2BZ2A 4H03B 3O5TB 4YOYA 3DRPB 4FXDA 3K0JA 1GK8A 3SSQA 4JI2K 1GH8A 1NU0A 1RDWX 1RT4B 2CJXB 4RW8B 3C16B 3K7RA 1J5EF 3KLGA 1WDDA 4K7QA 1TKTB 2KFYA 2HGNA 4PXDA 4ERDA 5KG5A 4Z4CA 1U7LA 2YNGA 3ILOA 3LP2A 3MM6B 2ZHBA 4KR0B 4P2SA 2V94A 2CFXA 4QIEA 4IH7A 3KFWX 1OH8A 2KTQA 2C28A 2P6SA 1T94A 3VZIA 1LXNA 1CS4A 3DKDA 4ECQA 4GKKJ 3TZWA 3CQ8A 2DH7A 4FYWB 1VQ4N 3O9QA 4FM2A 3RSEA 3E66A 3UR0A 1BA0A 1DTQA 2VDIA 4DR4F 2VASA 1RAAB 4IRKA 4Y3CA 3BR8A 1RCHA 3MF5A 4KH6A 1Y7PA 3FDSA 4CJLA 4WF9Q 4KPYA 3TX0A 2PFFB 3QEPA 1S0NA 3DXKB 3GIMA 4DR7F 4ECTA 2BE9B 2HHHF 4AFFA 4EIAA 4QYZJ 1S1XB 4A47A 1NWKA 1ICEB 3QRRA 4KO0A 4O23A 2HBKA 1S6PA 1F2GA 3DLRA 1PJ5A 4DG1A 5IM0B 3MFIA 2EK1A 3D54A 5HOOA 1LWCA 3E9OA 4LFAK 3ALYA 3OS2A 1K73O 2ZBQA 1KVIA 3VN5A 1G15A 3A8JA 2MY7A 4JNEA 1HD1A 5D0RA 2MZRA 2Y1LB 1CJKA 3PRVA 2OTJS 5B08A 4DUYJ 3QT6A 4ILJA 1UVIA 1B0TA 3FSXA 4C98A 4HCCA 2DRDA 2M4MA 3DLLL 2OIHA 1RK8A 3C14A 4BRKA 4CJ3A 1KLMA 1Q0NA 5D4LA 4I9LA 1YZ7A 2BJ1A 5F1XA 4F04B 4USMA 3GFHA 2D1KA 2B9YA 4V1Ak 3WXKA 3N28A 1N0VC 1RTJB 1AB8A 2VQFF 1PBAA 4KHRA 5AJ3F 2GBZA 4CEQA 3BS9A 2JC1A 3VOVA 4LF9K 5KFFA 1JLGA 2ZFHA 4YB1P 2GJIA 3BUZB 5D0EA 2BJ9A 3A2FA 5LSLA 1FDDA 3SFUA 2FXUA 4DQSA 1FJEB 1SVDA 1S9EA 1VK8A 3OTEA 1WAFA 1MWYA 4DL7A 1RDDA 2H51B 5KFTA 2B51A 5B0FA 1EAYC 2BX6A 1I94K 4WIIA 1UA0A 2YX4A 2B9WA 1X31C 1FDBA 1WC1A 2VQEK 3J7YP 4WZQA 2C2ZB 3DHWC 4CO1A 2M2BA 2DT9A 3SAFA 2DITA 4ZTJA 3UNGC 4CDIA 2QWLA 4MK8A 4QBUA 3ZZRA 3IXQA 3TR5A 1ZBTA 4CI0B 1HKAA 2DR7A 3EGNA 4ZMMA 4K2JA 3TZYA 1Q86T 1YHQN 1FO1A 2IBKA 4E98A 1Q1KA 4UZCA 1C0UB 3MD1A 4Z4EA 3ZEUB 3W66A 1NJZA 5IXUA 5HATA 2WVDA 3JTPA 1IXKA 1Y3JA 2HVEA 4IOCL 3MGJA 4CEEA 5ADXH 1K73T 4F3QA 2W9BB 1CJKB 2DK2A 2RS8A 1BGXT 1PBUA 3UD4P 3PZPA 1S9GA 3OTOK 1NK5A 3G8SA 1S4EA 1U48A 4OL8A 3WHIA 1VSDA 1S0VA 2E1YA 1HWJA 2Z2ZA 3TOQA 4LRAA 4CK1A 4CW7B 3AVMA 3SBGA 5AXMA 1VC0A 2VPYB 4TY8A 1UWBB 3MEGB 3NNAA 3OXGA 4CEZA 4J9UE 1ZZNA 1XEZA 1KWMA 2HSTA 2XHWA 2NZTA 4USIA 2GIQA 4GKKK 4LF2A 4LQ9A 4URGA 1YRXA 1L3UA 1C1BB 3UN5A 2BM1A 1HNWJ 1X4FA 3DYAA 1U24A 4Y65A 1J2VA 2J9DE 4A46A 1PAEX 3R7SB 2XMTA 5E0OA 4HWIA 3FZLA 3SPZA 2NXCA 4C3LA 4TSXA 5HANA 3IS9B 3I82A 1YJ9N 3E2EA 4KT0C 1VHIA 4L6V3 2IM2A 1S22A 2DGWA 1FNOA 4K0KK 2QGFB 1NMNA 1TL1A 2I0XA 3CI5A 3D6HB 4WZMA 1MDUB 5IV3A 4WFZA 4XPEA 3W1YC 1R43A 2R8HA 3ULEB 5C15A 1WC3A 3B54A 3LP1B 2QWMA 1WJ9A 2AU0A 5J2QA 3VAHA 2EW9A 2W6KA 1NSPA 4OO1J 4C8NA 1V4SA 3G6VA 2O8FA 4O4GA 3GOIA 5JS2A 2DY1A 2F7VA 4IWVA 1U1MA 3BBBA 4FNHA 4JK7A 2D0AA 1CBKA 1NHUA 1XR5A 1QE1B 4WQ4C 1X3NA 2OGUA 2AJQA 1CZ9A 5DDQC 4B3RF 3VQDA 4FJLA 2BXJA 4P7VA 2CPXA 3ENVA 3TTDA 5KT5A 1OPZA 4OYWA 2DH8A 2CAJA 4H4KA 3O6WA 3ZZ0A 4C6AA 1WOQA 3QT8A 3CFRA 4PZVA 3NAHA 2MPUA 5CHCB 1JXLA 3A3OB 4RW7B 3I0SA 1J53A 2O8EB 1C4AA 2PZSA 2OPSB 5HQLA 2KFNA 1DTTB 5F8JA 4CGGA 2YKOA 3UVJA 2RF2A 3KLEB 3TWZA 3CDBA 4CLFA 4N76A 2X1FA 3PCOB 3NWGA 2C2NA 2CJAA 4DHVA 1EHWA 4FWLA 2Q66A 1F2HA 4WYWA 4Z2XA 3CIMA 3E51A 2LXFA 2C2MB 2DPNA 2CNOB 4LQ3A 4ZPAA 2N82B 1UFKA 5SWMA 3T1AA 4IH6A 1BY9A 2HHWA 4A8XA 2WRMA 5KRTA 4MQ3A 1H2UX 2P5VA 2VJUA 2N4CA 2HGMA 1FE4A 4XTTA 3LM9A 1JXEA 5AJ3K 2O8CB 5F9LA 3BPSP 4OPKA 2RE1A 3I55N 3CJQA 5A8RA 3KJNB 4ENOA 4GNIA 3C7NB 2PFUA 2AYMA 3I4HX 4IOBA 5FROA 3AT1B 4JKEA 3HVTA 1H0HB 2VPZB 2E5IA 1EQ0A 1UKUA 4NI2B 3X3UA 3ZTPA 3DRYA 2DCUB 3AXMA 4QJVA 1I39A 1YIJS 2GAGC 3RMAA 3PXGa 4WFAQ 2JWLA 4LC9B 2R2TA 1CQMA 1LWCB 2E9ZA 2MEWA 2PY5A 4OZ5A 5F0WA 4HVZA 1QZ5A 1OQ6A 4NYNA 3ADAC 2P9SB 4DN9A 1YHQS 2P9UB 1QSLA 3DMJA 4CLWA 4FBUA 3N4WA 4OX9F 1Q7YT 3U7JA 3VVTA 1RA7A 2FHJA 2LDYA 3ENHA 4LF7F 1QUVA 4RW6B 3MURP 4FLUA 2RKIA 1L3TA 1T11A 1IKVB 2MLXA 1M5HA 3R5DA 4DPYA 1TZ0A 3KMSA 2AW0A 5H1SV 4ZVQB 5KFUA 3EVMA 1RWVB 3NS6A 1Q9XA 2HAIA 1T9XA 4H4KC 2I8EA 3GSDA 3AV9A 4JK9A 1R0AA 4ZPVR 3VTIA 5KFXA 1J5EJ 2HB5A 1TR0A 4NPOA 4CJQA 2A41A 2Q36A 2XSFA 2WW8A 1QQOA 4CT9A 4KFBB 3HSCA 4CEOA 2AZ1A 1BG3A 4JI5F 3TABA 2IC3B 1T9YA 3CDAA 1IM6A 2J76E 2QI2A 4N7TA 1WUUA 4O3QA 2OHDA 4ZKAA 3BYRA 3CWJA 3CE8A 4JYAJ 2KVQE 2VF3A 3ENBA 3SUQA 4LSNA 2DR6A 1VIXA 1KEKA 5KT4A 2V7YA 3OSNA 4GKKF 2VPWB 4WU2A 4MDAA 2GV9A 1MU2B 4HTUA 4I9QA 4HUFA 2LEPA 1HR0F 3VQAA 2RDDA 2EXUA 2DGXA 1X5SA 4KHSA 1VISA 1H2TZ 3HSGA 1ITGA 1KVKA 2NXUA 2QV6A 3NS7B 3RBDA 3B8HA 4C48A 2A2DA 2VFSA 3VV2B 1IR1A 4JBCA 3VQ8A 4FLYA 1NGBA 4ZCIA 2KG1A 5JMVA 3HVRA 4URQU 1CJVB 1T3NA 1HNWK 3ZT2A 4DG1B 3BB5A 2W8LA 1MMNA 2JWNA 4A48A 4DV2F 4FWRA 2DRAA 3Q8YA 1TL3A 1RLCL 4DSFA 4DTPA 4JI0K 4W90B 4X62K 3GZ7A 1BMQB 4P9SA 5C42A 2E2PA 1RTHA 1VBZA 1SKSA 2DGUA 4RW6A 2NRWA 1VQ5N 1TAUA 1S1TB 2ASOA 5D3GB 3EPGA 3CJ7A 4KH4A 4HCBA 2LSNA 1EIYB 3UCGA 4H4MA 3CCRS 3GMGA 4XDDA 4NXMF 3MMCA 3QIOA 3CJ4A 1OKJA 2KHDA 4DR1F 3PEJA 3J7A1 2MMYA 1W26A 3O08A 1IKYB 2GVDB 4CM0A 1YJ7A 2UXBJ 3G0ZA 2YWGA 4ZPDA 4B8CA 3TX8A 3MM6A 2QFIA 2E2NA 2LA4A 2AT1B 4Z4FA 3A5LC 3VALA 3M05A 4DV5J 3N5BA 3FCWA 2QA4N 3QICA 5IT4A 1L3SA 1S9EB 4DS4A 2BJ3A 3BBCA 4HTIA 3MPDA 4BR2A 2KHCA 2NLWA 3BGUA 3ZT1A 1HBOB 1QHTA 1SJRA 2WAQD 1WG4A 1PKUA 2ZUGA 5THWA 3KLFA 4JP8A 3JQJA 1RT3A 4NE9C 2EBEA 1XNRJ 2C3PA 2CPHA 3LP0B 4ZPCA 3J7YI 1D0EA 1FJGF 3UQSA 5LJ5Y 2F3JA 2XSJB 2ZH5A 3ZFVA 3TANA 4PG8A 4B9VA 3DLEA 2AJ0A 4RKUC 3BBFA 2DHGA 2XQCA 4I68A 4BDPA 2YPZA 4KTWA 1RT7A 1BDGA 5C12A 3IM8A 5JVHQ 3M5RA 5IV4A 2YNFA 3HHDA 2IJNA 1SH0A 3VENA 3PLAA 1SV5B 4OPJA 3T6BA 3KG4A 1JCGA 1HNIB 3DGPB 1S72S 1HIYA 4X4PA 2CQPA 4R25A 2IVMA 4B3OB 3C8YA 4UT4A 4HACA 5E2QA 3QO9A 2BV3A 4YR2A 3EZOA 4R79A 4IKAA 4ILMA 4OV6A 3UKRB 4JB8B 4C1NK 1LAWA 1ZBFA 4DU8A 2W4DA 3MR5A 5EDWA 3I5BA 2QFJA 2DTUA 4RJVA 4M5GA 1XN9A 4Y2MA 3BKUA 4TY9A 5DGAA 1G1XA 5CCMA 4B3MK 4PXBA 4J9MA 4W5QA 3GTYX 2WONA 1UPMB 2DY4A 3ZZTA 4DV6J 5DM7Q 4CYUB 2VG6B 4DDFA 2HHXA 5DLFA 5ITHA 4OIXA 3FK4A 2QO3A 1PO6A 1HBMA 4CJ5A 5L38A 1N36F 4K4XA 1FKAF 4UTGA 2FBTA 2LKZA 2WOMB 1KVBA 4OMFG 1E3MA 4DX6A 4NCGA 3BSNA 4GW6A 5DG9A 4Y2IA 2M88A 3S1TA 5C24A 5I3UA 2H4WB 5H9EJ 8ATCB 4LF6K 3H59A 4DB3A 3DLHA 2J0SD 3CPWR 3OYFA 1NGHA 3AA5X 2ILZA 1NJWA 1BCOA 2IRYA 3K89A 2HF3A 2XMJA 2RDIA 4KHPK 2XHBA 3N9UC 1FDNA 1BHLA 1MLAA 3ONQA 1YVNA 3NHGA 3FCVA 3NGRA 4CBWA 2XMKA 3GJSB 1BQMA 2VFVA 4FKXA 2QA4S 2CGJA 3QB0A 3W63A 4DV4J 1ROFA 1WG1A 2DPIA 1U8WA 3K59A 3AA4A 2IGIA 2HFVA 3M9OB 4HTJA 2OUGA 3OFHA 5ETTA 2CPDA 2OO4A 3A5MC 3UKRA 3D7SB 2LU2A 4QPTA 4B17A 4LF7J 1Q7YO 3M1FA 4OX7A 2ZVIA 2F9TA 4ELVA 3BJYA 4DQQA 3O3HA 4F0MA 4DV3K 1SL2A 3MAAA 3NXZA 3K5MA 5GAEP 4BVOA 5EXWA 5A8WA 3KTQA 2XGQA 3IP0A 3SUNA 1P8ZA 4EU0A 3KG1A 3FZBA 1S97A 3TSPA 3JTOA 4F36A 1YITN 1LW0B 2OEKA 2ZBPA 3DRSB 4EZ9A 1FRHA 1SQGA 4CJ7A 2RRNA 1RSCA 2CADA 2F7TA 3HP6A 1KHVA 3FKBA 3MEEA 4JI0F 4LR7A 1Z26A 3QJPA 3CDUA 3NCQA 4FDFA 3VGLA 4C3MA 2Z57B 2P9CA 2VZ9A 4K8ZA 4PCQA 4MMOA 2GGPA 4IEIA 3DLLQ 4KFBA 3M6VA 4WIQA 1QDUB 4FWMA 1BISA 1A6LA 2E5LF 1IJFB 3KHHA 2LQJA 2Z8QA 1VLOA 1N34K 1M1HA 2F9DA 2B5JA 2B9XA 5L1KA 4BC4A 1VSJA 1O6XA 2XY5A 4Y34A 5HMXA 4DR7K 2ALZA 4NLDA 4YHHF 2GIFA 2ZGYA 3VQEA 2KDOA 3ILJA 1ZA2B 4ZLNA 2LQBA 3HX9A 4NYOA 4K41A 5CQGA 4B1YB 2DXFA 2FSJA 2FLOA 2ZEJA 4AF1A 4C0BA 3W2WB 4ZOSA 3PR5B 1R6VA 2HK2A 2D9PA 3OYBA 4FWOA 5EX5A 3RJMB 5IOLA 2HRTA 3T5JA 1TFYA 1NG9A 3Q8UA 4DBQA 3JQMA 3H5XA 4C2MA 3AJ1A 1PIEA 3TVYA 3J8AA 3O3LA 4TVAB 2JEIA 2E20A 5F3TA 4JI7K 1DRZA 2VPXB 1OPIA 2QXFA 1WSHA 1NU4A 2PEBA 3HSZA 4Q44A 3ID6A 4Y0FA 2XY7A 3DRXA 2UYTA 4DV3J 4H4MB 2EC2A 2Z1HA 1QQNA 2KM8C 3MEKA 1ATRA 4A8SA 3KK3B 2CZ9A 1MG7A 1VSFA 2HBQB 3KKRA 2G2ZA 2RVJA 1BXNA 3M7VA 3KLEA 2PSZA 1KQSR 1NNDA 4DTXA 4J9VA 2PA3A 3VTHA 5AQGA 2PO4A 4J9SA 4NXNJ 2F5GA 4RUBA 3OL6A 2D0CA 3IAYA 2CA9A 3BPDA 1TKXB 3PSIA 2JRSA 1BUPA 1LWFB 1BL3A 1RDCA 4HYKA 4BRIA 3H45C 3CCQS 4UUXA 5F9NA 5GAGI 3R6MA 3MCAB 1WI6A 3M8ZA 1JLBB 1MROA 4DSEA 3C2PA 1TKZA 1KVAA 3HOSA 2MGZB 2Q0RA 3HT0A 1V9OA 5FLXO 5KFKA 3AA2A 5CZVA 2YNIA 4BBYA 1HHTP 5ADXA 3AD7C 2CYYA 2Z58B 4CLUA 4RU2A 3LM2A 3MM5A 1YJ9S 5GMEA 1VYAA 1T6CA 3DAWA 1G3OA 3VQCA 2GNKA 4I0WA 4FVMA 5DDRC 3UW1A 1U2VA 4IO9Q 5AQPA 1CLFA 4CJPA 1N32F 1HKBA 2IA6A 4UY8T 2EC0A 1BUXA 5M2PA 2RD5C 4FL9A 4KBIA 5ELZA 3ITHA 3IR6B 3C65A 4OZJA 3C46A 3AB2B 5F0XA 2D4WA 3AVCA 3I56N 1JLFB 5DM6Q 2ZQBA 3P3DA 4NEYA 4NO7A 3CCJS 3QIPA 4ECVA 1FTRA 5HQMA 1DGKN 1LV5A 4QIGA 3WXLA 1GLDG 3OTCA 1WC4A 4CZGA 1NUEA 4ED8A 1FRKA 2E44A 2FLLA 2J9CA 1R8PA 4PAAA 4CTAB 3M2RA 1FXXA 4ZVOB 4MFBA 2QMWA 3TAQA 1NH7A 3HSDA 4NXMJ 3N4QA 1R6YA 3AXKA 3AOAA 1HNXJ 3NH2A 1Z1ZA 3V6KA 1TKXA 2BKOA 4PQAA 4M5DA 1KHWA 3KDNA 2HHHJ 5H1SQ 4WK1A 3CTRA 2W7OA 2IC3A 4QAGA 3AQPA 3PHEA 3R1XA 5BN9A 4OJ1A 5I3PA 1F21A 1BQNA 3NGIA 3W3DA 4DFKA 4M3ZA 2DGTA 5BYSA 2P9PB 8RUCA 2QKBA 1HBNA 3LUYA 4DR2K 2GHPA 3HJVA 3BGRA 1DAXA 3LPYA 3KLFB 1H73A 5I4MA 2R2RA 2ITGA 3MN7A 4AQYF 3CF5L 4ZJOA 4MO5A 1GLCG 1J5OA 5E7OB 1C0UA 2R7RA 3EE3A 1HYZA 2HGLA 4OLAA 2V50A 5DO2A 4A8YA 1GLJO 5LMNF 3J80O 2W9BA 3PNIA 1HNVB 3CERA 3T7ZA 3CCVN 3H40A 2UXDK 2FD2A 4HUEA 1HA1A 3BN7A 4F0HA 2ZH4A 3HSTB 5DQGA 3HULA 4YHHK 3AH6A 4C11B 4LF9F 3ZT3A 3D45A 2R7XA 2QW9A 4DV0F 8AT1B 4D3HA 4R0JA 3WX8A 1TQLA 3O8WA 2LXIA 2VL1A 2EG2A 3OUYA 4HACB 4EEYA 1RTDA 1DURA 2GMLA 3MMAA 3VF6A 1VSMA 4FXWA 4YDUA 2PAVA 1FVQA 2XG8A 4IFYA 3GV5B 1HX1A 2BEFA 2RUSA 2G4BA 4JD2B 2N3LA 3CJTA 4XAKA 1FJ7A 4F8RA 3K2YA 2HAFA 1T95A 4JI0J 2FIUA 1RT1A 3IBCB 5EU7A 3J81O 4AQYJ 4KBOA 2IA0A 4CBXA 4QS9A 1SB6A 3GIKA 2Y8YA 2YCHA 5HMZA 4CQ1A 2WTUA 4ZVEA 2BUNA 1EQYA 1A5XA 1HQUB 2EKNA 3DC2A 1FI4A 3BZKA 4ZIWA 3MXMA 5CXTA 4OI1A 3NAIA 2A1BA 5C5JA 3TA1A 5J2MA 3O4QA 2ZJPL 1DHMA 2R7OA 2RRAA 3OYGA 5BRFA 1UZHA 2PC6A 4E2FB 5A0YA 1H72C 1NM2A 2KT2A 2DCLA 5MAOA 1YITS 1H2VZ 2IVYA 3LGHA 1YJWS 3Q2TC 3I0RA 2PI4A 1F9FA 2QL7B 4CF9A 1VHXA 5HRNA 2UXCK 3B4MA 5AQWA 3VAJA 2IDEA 3MM9B 3KNGA 1T03B 1FTCA 3SCIE 2NS1B 2LEAA 4E7IA 5CY4A 2W8KA 3TNVA 3QQCD 1YAGA 4UQGA 3UD3P 3KJVB 2JX2A 5K9FA 3CD7A 3OYNA 2RSQA 3SJJA 4KRFA 3BO2A 1D9AA 4FCYA 2OPRB 3WQPA 3BQ1A 3CB4A 2YKPA 1HBUA 1ASWA 1BQMB 3NFAA 3CNQP 4RNMA 2A3JA 3GG4A 3PIPL 2E6MA 4CFBA 4ZHRA 2ZJPQ 1CSJA 4MFBB 1Y64A 1WSGA 2EFVA 2M9KA 3P96A 2Z56B 1UWBA 2M8HA 1Z2LA 3QEXA 3OYCA 1S10A 2FZKB 5GADI 1FXLA 1FRIA 4QU6A 1Y3KA 1NGAA 4R8UB 2CH5A 2NRXA 3V81A 3RU0A 4IYQA 1EB0A 3IR5B 4B9TA 3CJ0A 3KG0A 2PYLA 2DNKA 1X0PA 2V8DA 5CZ2A 1QAIA 2VQEJ 3G4SN 3MCOA 5DG8A 1GLEG 4FPAA 3DXSX 1NHKL 4J2AA 4X4NA 4DV6F 1DQAA 3ZXWA 1U04A 2FQQB 5KFHA 1M90T 3TAPA 2E29A 2ASLA 1D9FA 2HHQA 5D8HB 3QZ7A 2FVPA 3BP8A 3OHRA 4TXSA 1NK0A 2OA8A 1NDPA 2W2NP 2LQ9A 3UE5A 3K9JA 4CGJA 1JWWA 4JHDA 1JLEA 2DB1A 3IRXA 4HL9A 4C23A 2X3GA 5E3AA 2B0GA 1TGOA 1VBKA 1N6QA 2MSSA 3THYB 4J9NA 4ATNA 2UXDJ 4XH1A 3M9MB 1U6FA 4IG0A 2ZZMA 2AP1A 1NDCA 2SXLA 2WSCC 2GC8A 1FESA 4M5IA 2RU9A 2P6TA 5B0GA 1OS5A 3TTFA 2K1RA 4A2BA 1HNXK 4RPFA 1Q8BA 4I7FA 4WP9A 3F56A 1LW2A 4RBUA 1HMVA 5CZXA 1XR6A 4BRPA 1ZAVA 3JSMA 3PTWA 3VEVA 1CJVA 4OQJA 3CCLS 1NKBA 4A4JA 4IH5A 2MSTA 1VRQC 3TEGA 2MXYA 2X3DA 4KGXB 5L8RC 4BC5A 4CH1A 1B9FA 4DR2J 4XIUA 1N8RO 2GVZA 2OFHX 4WFBL 1RDRA 3CPEA 4O55A 3CCTA 2POKA 1IBMF 3I8DA 2CJYB 3PFOA 1BU6O 1H3DA 5GVQA 3VR1A 1N5YB 1E6YB 2D3ZA 4BE1A 4A8WA 4UQTA 1U1PA 1GMWA 3PKMA 2KXHA 2F8MA 2NUHA 4AT1B 5F8LA 1IV0A 1C0GA 3AO5A 2W1BA 1RBVA 7AT1B 1VSLA 4J2EA 1OMSA 3M2VB 3HTVA 2YNGB 4LF8F 1A7GE 4X66J 4JD2A 1N0UA 4M5KA 3NWRA 5I9EB 1U02A 3N4PA 4LF5F 4RW9B 2XWXA 4GVBB 4R5PA 3MMBA 4W5RA 1G99A 2HQ3A 5KFVA 2H3EB 4ZN1A 2ZVSA 4DSIA 4GV9A 3ATUA 2W7AA 3F44A 3C6TB 4QS7A 1HJOA 3OBIA 2MB0B 1NM1A 1RT5A 2KW4A 6FD1A 1SJQA 1EP4A 2ERRA 4P71A 2Q1NA 2GX9A 4OKKA 3BO4A 1VI7A 2HSEB 4YY3J 1S12A 4KV8B 2QWQA 3R3LA 1FRJA 4Z94A 5HP1A 3CCMS 4Z7YA 5EX0A 2MLYA 4FJ5A 3GB0A 1ZBHA 2HQCA 1JX4A 5C7PA 5KG4A 5C0YA 1PC4A 1G2EA 3N6LA 1JJHA 1VS3A 3CJAA 5L39A 4D3GA 2JC0A 4X65K 3EXYA 1RT4A 3THPA 3BM7A 2HOEA 3D5MA 4NMXA 4BVPA 4BHQA 1KQGB 1ZBSA 4OV1A 4E1MA 2C3YA 3LAKA 1FWPA 3QSYB 5A6PA 2BR0A 1M1KT 4PWDB 4EP4A 4G1IA 5ETNA 3EY1A 2BRLA 1LOTB 3MEGA 4ISFA 1FX4A 1SIWB 4F4WA 1SC3B 3QSIA 3GIJA 3OHAA 1D8ZA 2E7VA 4EFAC 1IQZA 3J7AP 2OTLS 1WNSA 3ULDA 2UXCJ 2VBZA 5CA5A 4ZVTB 4Q8EA 5JLHA 3ZSYA 4DR5F 5C10A 2O66A 2P9EA 2W40A 1ZM9A 4KRWA 2FSKA 2PA8D 4PL8A 3MEDA 3MD3A 2HVDA 1WWHA 1TUVA 4ZDNA 1CC8A 3LP2B 2DJWA 4DMNA 1BA1A 5HRSA 4YN3B 5K8PA 1OSCA 4F7VA 4KV8A 1RBLA 2BJ8A 4KHPF 3NE6A 5JLFA 3IG1B 2DHAA 4DTRA 2V5HG 4MKVA 2LDIA 4IOAQ 2R8KA 4CLSA 4A2AA 3OYEA 1F5AA 4C8KA 1CJTB 4BQZA 1RAJA 1H6KX 2AJ1A 5AQLA 1T3VA 1SUQA 2AMCB 3FUYA 1SJ1A 1NJIO 4FJHA 3MCSA 2OEMA 5D4NA 5A2QU 2W25A 2ZM6F 1Q9YA 3MPYA 5KFGA 2ZH1A 1X9MA 3VGMA 1BHNA 5JICA 2Y1JA 1O1WA 3CW2C 4DOZA 3LQVA 4NZ7A 3HO1A 4ALZA 1WHYA 4QW9A 4ZLJA 1JLGB 3M8YA 3IMXA 3MWTA 2FGCA 1BOTO 2WCXA 3KWGA 2G0CA 1KQFB 3R3TA 3H25A 3ZX2A 4F2RA 3M8WA 1WOPA 1VQ8S 1VQNS 2BVZA 2LP4A 5CD4H 3MMBB 4BR5A 3MM8B 4W4MA 4WFNQ 1DKGD 5DM7L 2JFDA 1KC8T 1RHUB 3QLHB 3OL9A 5ETVA 2RF2B 2JHEA 4OI6A 4LBPA 3AVFA 2CNNB 2A10A 4JI8K 2ETJA 4CEBA 1HHSA 2KXNB 1RNHA 2HFZA 3F5TA 4RNNA 1T05A 3D6FB 3NGUA 3D4JA 3R2DJ 4N5SA 1JNRB 3I9ZA 2NYIA 3T5KA 2UUBK 4JV0A 4OLOA 5IS2A 1V5VA 4G1PA 1I94J 1M1GA 1NGEA 3NCPA 4I67A 4CBUA 4J9OA 1UMJA 2V4RA 4H0XB 3FFIB 2GJ2A 3TAMB 1TL7A 2H48B 4J90A 2XLIA 5KG7A 3TW0A 3AA9A 2EEYA 3BGFA 4MT1A 1D3WA 2FUG9 3KUGA 4CZIA 4QU7A 2IJFA 3P4UB 2FJAB 3OBYA 3H90A 5MLCQ 2V69A 3ULHA 4I7FB 4JI7F 3EL2A 3NMRA 5A8KA 4M8LA 2OP5A 3X1LB 1WBBA 4L8RB 4CHOA 2YI1A 2E66A 4B3MF 1WSFA 2XMWA 2A6MA 3ZZZA 4BR9A 4I2PA 3EICA 1I51B 4DUYK 3OUYB 1EQMA 1TL3B 4FYDA 1XI1A 1CULA 1VQLN 1W25A 3WXMB 3H4BA 3PW0A 5KGWA 2YNHB 3ZTSA 3R7BB 1DQ9A 2HRYA 3VHQA 4CGHA 1DFDA 4IG3B 3J7ZT 2FPHX 3K2PA 5AZIB 5IFMA 2I5JA 4XH4A 2CWKA 4K0KF 1XUPO 3TUZC 3MEEB 5E3RA 3PM9A 4L3QA 4LIWA 4X65F 4P72A 4L73A 3TJ8A 3TUIC 4KB1A 4KH1B 1ZBUA 5CE3A