3DRPA

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drpA05
1RBRA 3V6DA 5DGAA 3H5YA 4JV1A 1Q9XA 4OL8A 4KBIA 4E7KA 2OPSA 1NKCA 3V9WA 4FLYA 2ZQBA 4FW2A 4JS5A 2VA2A 4E89A 4B3OB 2QE5A 5F9LA 4LSNB 4NLTA 3QINA 4QWDA 3H08A 2Z1HA 4FLTA 2BRLA 2NUBA 4RW9B 4XPEA 3SQ4A 4DSJA 1CXUA 2FLLA 3LPTA 4CGDA 1JLQA 4CJ3A 5HBMA 1LW0A 3AO3A 3IRXB 4TYAA 3L2RA 3K2PA 1JLEB 4KREA 5KFWA 4G1QA 3ICLA 1C0TB 3M8QB 1FXXA 1ASUA 1UWBA 2O4IA 4FJ5A 1REVA 1GOBA 5I42B 3KLIA 1A5XA 4JS4A 5F8LA 4IBNA 4QWCA 1S1TB 5F8NA 1KVBA 1C0MA 3GIKA 4Z4GA 4NRUA 4J9LA 5EUHA 4CCHA 3KHGA 3GV5B 2OPRA 4CJKA 4ZP6A 5KFTA 3DRRB 3QIPA 4FLVA 4MK8A 1TKDA 4DTXA 1VSKA 2IAJB 3TAFA 1QTMA 3OYNA 4CECA 1BQMB 4NCBA 4PQUB 4CEFA 3S3OA 1EETB 3RB3A 3KLEA 4KPYA 4KKOA 3TAMA 5KT5A 1T03B 4KB0A 4ZVFA 4CFAA 4CIEA 3ZT4A 1I6JA 1WNEA 4KHRA 1U49A 3IS9B 5HRPA 5KG4A 4IG0A 2KZZA 4ZP7A 3H40A 3OS2A 2JEGA 1U48A 5SZTA 3NGIA 1JIHA 4Q8FA 3VN5A 1U4BA 2BQRA 4WYWA 3ASMA 4PA1A 3NF6A 4QWBA 4NLSA 4DMNA 4B3OA 4DL2A 4I9QA 4LSNA 1HMVB 1KTQA 3N6NA 4WXWA 5L1IA 4OVLA 4CF9A 3OYCA 4HHTA 2HW3A 4TY9A 3RMAA 3HL8A 4FLWA 4RW4B 1S0MA 4B08A 4J9NA 4KB1A 2IM2A 1C0UB 5KFFA 2KZMA 2W7OA 1WAFA 2FBXA 1D5AA 3IRXA 4CGIA 1JLEA 3UIQA 1MU2B 4QW8A 4XO0A 2IMWP 4FZYA 1C0TA 3M8QA 3MEDB 3LAKA 5I42A 2DY4A 5FROA 3V6JA 2F8SA 4B9LA 1KCFA 3C6UB 4CF2A 4DTSA 3QESA 4ED1A 4F2RA 4FJHA 4E19A 2B6AB 1LWEB 3NGDA 3N6MA 4ED8A 3B6OA 4ZVGA 4CF8A 1LWFA 2YNIA 4BE0A 3UQSA 3QLHB 4IR9A 3BSNA 4J9PA 4DU3A 3F73A 2IAJA 2D0CA 1KHVA 5EU7A 1BQMA 4CHQA 4PQUA 3AVLA 3CM5A 3LAMA 1EETA 4NLDA 1T03A 3D0PA 4EBEA 1Q8IA 2FVPA 3SUNA 2R7YA 4DEZA 4BWJA 4CHPA 4F2SA 3IS9A 2IOCA 1A5VA 1T8EA 4H4MA 1RT6B 4K4ZA 4ELUA 3OYIA 3LALA 3PO4A 3KIOA 3T1AA 3DRSB 5CZ2A 4M3YA 4MKBA 1R0AB 2FBTA 1NNDA 4KTWA 3WNEA 1XI1A 2KTQA 4FJKA 2CJQA 1EX4A 3I5BA 3MR3A 4YQWA 1N48A 4CGJA 1RT3B 3I0RB 2YNGB 4RNFA 2R2TA 3QNOA 4PUOB 2QKKA 1CZBA 4RW4A 4ID5B 1JX4A 2FVQA 1WSHA 4B8CA 2ASDA 4K8ZA 4Q0BB 1QE1B 4IH7A 3CFPA 3H5SA 3H4DA 2V4QA 1TP7A 1MU2A 2HB5A 4DSIA 1JLCA 3ISND 2HHTA 4EP5A 1WLJA 4EYIB 4ZPAA 1DLOB 3T5JA 1XR5A 2XC9A 2W9CA 4B8AB 3C6UA 3RR8A 1KVCA 1RT1B 5DQIA 2VG6A 4CIGA 5I3UA 4FK2A 4E1MA 3NDKA 3KNAA 1LWEA 2Y1IA 1X9WA 3KD1E 4OGEA 5HRRA 3KMSA 2WRMA 1B9FA 5L1JA 4ECYA 2AGQA 2ZE2B 4HVJA 4F4ZA 2WOMA 2UUWA 1TL3A 3V9UA 4NYNA 4YP3A 1ZTTA 5D3GA 4Z4IA 4DFJA 3OL6A 1SH0A 3SCXA 3KLFB 3CVKA 4DQQA 4WFZA 1U47A 2W9BB 4ZPDA 2EC0A 1N5YB 2QK9A 1RT6A 4CGFA 4I7FB 2RKIA 1HNVA 1U09A 3FQKA 3DRSA 2AJQA 4OPJA 1KLMB 1RDCA 3PUFA 3SYZA 1KSPA 4FVMA 5DMRA 3V9XA 2B4JA 4CGHA 5CYQB 1TK0A 1RT3A 5K14B 4DS4A 3I0RA 3IGNA 2HWIA 3T5KA 5KT6A 4PUOA 5HRSA 1JXEA 5KTQA 3C95A 4K50A 3OYAA 1J5OA 4F4WA 2ASJA 1JLGA 2AWZA 4Q0BA 4RUCA 4ZP8A 3C6TB 3HPHA 4XIUA 4FM2A 1GX6A 4ID1A 3QZ8A 3OSPA 1GOAA 1UA0A 1TV6A 4BACA 3AA2A 1IKYA 5JS2A 3MFIA 1W25A 3ZT3A 4TN2A 3PX6A 3IG1A 4CJWA 1HYSA 4Y2AA 1LW2B 4Q8EA 5SWMA 1SL2A 3DI6B 4BE2A 3GV8B 4BE1A 5KG5A 2G8IA 3KK2B 4YMEA 1TL1B 4DSFA 2XWYA 3HP6A 1VSMA 1JL2A 4Y2CA 4URSA 4B9NA 1QAJA 4ELTA 3OHAA 2E4LA 2FVCA 3BJYA 1HQEB 1NOYA 3FFIB 1HARA 4IR1A 3I8DA 1L3SA 4KRFA 3DMJB 2WCXA 2P1JA 1RT4B 3TI0A 2CKWA 4FJ8A 4AHTA 1TVRB 3VQEA 3ZSQA 2HNYB 1S9FA 1XWLA 4RW7B 4O3NA 3ISNC 2W9BA 4R0EA 3AO5A 3OYEA 2IM1A 2Y1JA 1LAVA 3VQSA 3M9NB 2FC0A 4NLWA 2HHQA 4Y3CA 4I7FA 3VQ5A 1D9DA 5DLFA 3OYDA 3VQ8A 2OPPB 3T3FA 4YR2A 3RTVA 3CJ3A 3OYKA 3KLVA 4GC6A 4YR0A 1JKHA 3MR6A 5KI6A 4ED7A 3BREA 4K4XA 3KKSA 4J9OA 4Q44A 4K4WA 4O44B 4DSKA 5CYQA 5K14A 4KTZA 2J6TA 1IH7A 1C1BB 2VG7A 1KRPA 2HHUA 4CHZA 2WB4A 2GUIA 5JXSA 2JC1A 5C25B 3D28A 4JUZA 4J9RA 4J2EA 4RNMA 3C6TA 1XC9A 3HKWA 4JRQA 2G8HA 1S6PB 3EY1A 4ECTA 4JV2A 3F9KA 5FDLA 4Y1CA 1JLAB 4EBDA 3MFHA 3GIJA 2DPJA 1RTJA 5KFHA 1NK7A 2YKMA 5KG7A 4C8LA 4IDKA 4I9LA 4F8RA 4CHOA 4JLHA 4B9UA 1BHLA 1LW2A 3OL9A 3VQBA 2IC3A 4O3QA 4PWDB 3Q8RB 1JL1A 3KK2A 1TL1A 5KFPA 4KHMA 3QIOA 3O3FA 3MEGB 3SFUA 3AVHA 4LSLB 3ZSXA 1VSLA 3K5OA 5F8HA 4M95A 3G6YA 2C2RA 3FFIA 4XPCA 3V81A 2XY8A 4WE1B 2V4RA 4LQ9A 3VQCA 1RT4A 4CJUA 3ALYA 5J2MA 3U3GA 1IKVB 1TVRA 4HYKA 4Y1DA 4FJNA 1Z4UA 4O4RA 3KHRA 2BE2A 1EP4B 2YNFB 2ALZA 2EX3A 3SFGA 3KLHB 4RNNA 3SUPA 4J9QA 4AHCA 4KB7A 1CXQA 1W0HA 4CJRA 1XR6A 4RW8A 3K5MA 2C2EA 5DG9A 3EYZA 1D0EA 3HVWA 2KQ2A 1RTDA 4AHRA 4Q45A 4NLQA 3HXMA 5J2NB 1S1WB 4W5QA 3AVGA 4FBUA 5KG1A 1C1BA 1WSGA 1BI4B 3I5CA 2V0NA 3TANA 2XO7A 2F96A 2Z1IA 4NYFA 2D3UA 4RNOA 3OY9A 5EDWA 3H2LA 5KFQA 4C8KA 4FJMA 2ATQA 1S6PA 4KE5A 4CEQA 4DFKA 2WONB 1BGXT 3ZSZA 3LWLA 3FSIA 4IKAA 1TQLA 2R8KA 4QPXA 5DQGA 5EWGA 1ZYQA 5DGBA 5CZ1A 4FYDA 1YTUA 5KFNA 4MK7A 2XY7A 2PYLA 2I5JB 1RA7A 3DLRA 4BWMA 4PWDA 1J54A 1FKOA 2DTUA 1XHXA 4ELVA 1ZTWA 1LWCB 3MEGA 4CF1A 4B9MA 3PV8A 2PZSA 2FVSA 1X9SA 3SZ2A 2IGIA 3O3GA 3DLGB 4W5RA 1RBSA 3TWHA 4KV8A 1G15A 4Y34A 2D0AA 3AO2A 4RU9A 5KGWA 2AGOA 2E9RX 1HYVA 5KG6A 1BCMA 1IKVA 1U04A 3M9MB 3PW0A 2YKNA 1UAXA 4O0IA 1EP4A 4J2DA 1BISA 4FW1A 1SL1A 3KLHA 4EP4A 2DFHA 4O4GB 1HRHA 3EPIA 3K58A 4CEZA 3U6FA 3PR5B 1IG9A 3QGGA 3OL7A 1OS5A 1D9FA 4K8XA 1TKXB 2XI3A 2XGQA 3T5LA 3QYYA 4FCYA 4MIAA 3OHBA 4Z0UA 3S3MA 3ZT1A 3NE6A 5KFDA 1ZBFA 4DWIA 4RW9A 2F8TA 4DFMA 3PW7A 2JEFA 1BI4A 2RF2B 3NMAA 4BDZA 2ATLA 4EZ6A 5KFXA 5KFMA 1K1SA 3BSOA 1HNIB 4DU1A 5EWFA 4QCLA 1WSJA 5L9XA 4OKKA 3L2VA 5KFOA 3LP3A 1I39A 2X6NA 2UVUA 1VK0A 4ZTJA 1CZ9A 3TABA 5C5JA 1S1TA 1ZBHA 2Z1JA 3QEWA 3PVXA 1JXBA 4J9KA 5HROB 4KHSA 3CWJA 3TAGA 4LH4A 2Z1GA 3DRRA 4ZPBA 4IG3B 5KG3A 4AHSA 4F4YA 2I5JA 2GIRA 2XI2A 3NAHA 1RT2B 3Q8SB 1S6QB 1YVFA 3TARA 1LWCA 4IH5A 2W7PA 3D45A 3DLBA 2F8EX 3LANA 2FJVA 4WXOA 4O3RA 4M3ZA 4TYBA 2HWHA 2YHAA 4N56A 3H5UA 4C8MA 2ETJA 3VQ7A 3LP2B 2VWKA 3NFAA 4CJSA 4OPKA 3OVNA 4CJLA 3L2QA 2UUTA 4E1NA 4ED3A 4CK1A 2BANB 2YNHB 4ZVEA 4N47A 4CEEA 3FQLA 3HVTB 3L3VA 4O4GA 3S9HA 4NLXA 4H54A 3AVMA 3VA0A 3I5AA 2BDPA 4TY8B 1S1UB 4IFYB 4R5PB 1TKXA 1HMVA 4BDPA 3E01B 2WK4A 3L8BA 4CESA 5DG7A 3CJ2A 4E7IA 1C0UA 4TQRA 3AA3A 2RF2A 4W5OA 2OA8A 3OYFA 4FJ9A 2HAIA 3AVFA 3VQ9A 3SUQA 5HP1B 3G6XA 1FKPB 4ZHRB 3PZPA 3HVRA 4NLPA 4CJQA 4F3OA 5KFEA 5F8JA 4DL4A 3EZUA 2HNDB 3RMCA 3MEDA 3KLGB 4FJ7A 3D5MA 4KFBB 4ECRA 2KFZA 3MR2A 1YTAA 5KFSA 3TVKA 3KK1B 1HJRA 4CK3A 5HROA 4MH8A 1S97A 3VQQA 4WFYA 2B6AA 2VG5B 4JV0A 4FM0A 4TLRA 1RT2A 4E0DA 3QLHA 4DG1B 1QSSA 3AVAA 5HLFB 3OYJA 1UOCA 4CF0A 4CK2A 3PO5A 2R2RA 3BR9A 3OLBA 4LY7A 4FJJA 4K4VA 4CEAA 4B9TA 1SKSA 2B43A 2OZMA 1MMLA 4K4UA 2QKBA 4CE9A 3DOKB 1RT7B 3LP2A 4CJFA 5KRTA 2X6SA 3KKRA 2RPIA 1VRTB 2HHXA 2FJXA 4AHVA 1QAIA 3LZIA 1RYRA 2YNHA 1T7PA 1S1VB 2UVWA 4RZRA 1R0AA 3PW2A 4DQIA 3MEEB 3JYTB 3LP0B 1JXLA 4TY8A 4G3IA 4IFYA 4N41A 4U7CA 1ZBLA 4NLYA 2XRIA 1SKWA 3KD5E 2YNGA 3NF9A 1RBVA 3QETA 1RTIB 4HUFA 3IN5A 4ID5A 1TKZB 4J9SA 1C1CB 4OKEA 3CJ5A 3LDSA 1SUQB 1X1PA 1QE1A 1S1XB 1WN7A 1JLBB 5CY4A 3SV3A 1VSHA 2R8GA 2AU0A 1FKPA 3DLEB 4ZHRA 3BQ1A 2OZSA 4NLOA 3AO1A 4DL7A 3WNHA 4URQU 2AGPA 3CFRA 3L3UA 4OLAA 5KFIA 3DRPB 2HNDA 3Q8PB 3KLGA 4GVMA 3NKYA 1DLOA 1W9HA 1ASWA 4OKJA 3G0ZA 4R8UB 3PX4A 1RT5B 4KSEB 1RT1A 4DL6A 5KFKA 3OYBA 5C42B 2OPQB 1SH3A 4FLUA 2E6LA 1VSJA 3ITHB 3AVJA 2BQ3A 3BGRB 4CHYA 2JC0A 2XY6A 1QUVA 4W5TA 3P1GA 4DTRA 2ZE2A 5HLFA 3M8RA 1BL3A 1TKTB 5HRNA 4CJPA 4NYZA 4F4XA 1BIUA 2DFEA 1XR7A 2ILZA 3SPZA 5KG0A 5J2PB 3KLFA 3THVA 1HQUB 1RTHB 3HP9A 1N5YA 1NJXA 3ULDA 1RT7A 3OLAA 1T05B 4ICLB 3ZSRA 4EZ9A 4EYHB 3DOLB 4M3RA 2HVIA 1VRTA 3SV4A 1TAUA 4DLGA 4FBTA 1KLMA 3KMQA 5EWEA 3Q8QB 3UR0A 5FRMA 1S1VA 4CJ5A 3HHKA 3HYFA 2DFFA 4QWAA 4YR3A 3KJVB 5T14A 4TQSA 3QNNA 4TXSA 2OPSB 1RTIA 2FLNA 4H4OB 4OJRA 3CO9A 3OJUA 1TKZA 3ZT2A 3QO9B 1C1CA 3PJXA 3ZSYA 3V1OA 4DFPA 1S1XA 1JLBA 2UVRA 4NLGA 1NJYA 3K5LA 2LSNA 3DLEA 2JGUA 3CFOA 1TAQA 4DQSA 3SNNA 3NF8A 3EZ5A 3ZSVA 1L3TA 4G1QB 1NJWA 3NBPB 4R8UA 1UWBB 1RT5A 5KFAA 3H5XA 4E7JA 2OPQA 3DI6A 4RNHA 1KFDA 3A2FA 4K4TA 3TR8A 3GYNA 1S10A 4QW9A 4NCGB 4B9SA 1N6QB 2C2DA 4LH5A 1D1UA 3GQCA 3O3HA 1HQEA 3QIPB 1VSDA 4WYLA 3LP1B 3HPOA 4FK0A 3DMJA 4LD0A 4UQGA 1TK5A 4CERA 2P51A 3VA3A 1ASVA 2HHWA 3NHGA 1XHZA 5J2PA 4CEBA 3SPYA 2HNYA 1HQUA 4Z4HA 4RW7A 4GC7A 1RTHA 2FVRA 4NRTA 5JUMA 1SV5B 5DQHA 3PJWA 1L3VA 1Y97A 1T05A 1GOCA 3H4BA 3NGZA 4ZPCA 2C22A 1EXQA 2R2UA 2OPPA 3PW5A 4W5NA 4Z4EA 1KLNA 4PY5A 2O5DA 5E41A 4Q43A 4O44A 1D8YA 2KFNA 4CEOA 3P5JA 1N4LA 4ED2A 3KJVA 1L5UA 2C28A 3PHEA 2FJWA 2FBVA 1HPZB 2BR0A 4H4OA 1BQNB 5KRSA 4DTNA 2GIQA 3DLHA 4N5SA 3QO9A 5C25A 3MAQA 3SQ1A 1NOZA 3I0SB 3DLKB 1RDAA 4DSEA 3V9SA 3NH2A 3M9OB 4CFCA 3SI6A 4LQ3A 1JLAA 2P5OA 2FBYA 4MFBB 4AHUA 4KO0B 2W8LA 1RILA 1F21A 4URGA 3RR7A 4O55A 5CYMB 5J1EB 1YVUA 4CJEA 4E7HA 3O4NA 1S4FA 3KHLA 3NBPA 4IRDA 3JSMB 1J53A 2QV6A 1S9GB 4JRPA 5KFGA 4M45A 4J2AA 2WHOA 4NLRA 1WAJA 1C1AA 4LSLA 4NCGA 4KAZA 1N6QA 3V9ZA 2IM0A 2IBKA 5T7BA 2GBZA 3NCIA 3CDUA 4WE1A 4ZTFA 3LP1A 2ITGA 3HK2A 1LWFB 2YNIB 4E3SA 1NK4A 3KK3B 4BDYA 3OYMA 4ZVHA 2E9ZA 1SH2A 4DTUA 2R8IA 3QZ7A 1SV5A 2Q3SA 2YNFA 1ITGA 3UPFA 5KFUA 1IKWB 4MK9A 4DF4A 4F4KA 2OH2A 4IFVB 1NK9A 4H4MB 1BIZA 4KHUA 3CG7A 2JEJA 3V6KA 2VA3A 4M41A 4KTQA 5J2QB 3OSNA 4FS2A 2PY5A 5J2NA 2RDJA 1S1WA 3FRZA 3O4QA 1RYSA 3ZSOA 1NKBA 2I1RA 2XHBA 1HPZA 5KFLA 3MF5A 1RA6A 1BQNA 4J2BA 4FXDA 2D3ZA 1FK9B 3AVNA 3BQ2A 3I0SA 3DLKA 4KI6A 3OYGA 4FJLA 3CDWA 1N56A 3ZCMA 4DSLA 2O4GA 1LAWA 4CFBA 4MFBA 2HMIB 2WONA 4KO0A 3HSTB 3TAPA 4OLBA 4C8OA 5CYMA 5J1EA 3MXIA 4FJIA 4F50A 5KFRA 4DQRA 1JLCB 2R8HA 4DS5A 2G8KA 3JSMA 2AX1A 1S9GA 1S49A 3PX0A 3NGYA 2ZD1B 4ECQA 1U45A 2D0BA 4ZMMA 2KW4A 1QSLA 4H8KA 2W9CB 1I3AA 3TQ1A 1WNSA 4M3UA 4NCAA 2VG6B 2GC8A 3KHHA 5I3UB 4ECXA 4O3SA 4OGCA 1J9AA 3DLGA 3HPGA 1X9MA 3EPGA 3PW4A 2ZKUA 3KK3A 1ZBIA 4ECVA 2PYJA 2AQ4A 2WOMB 5KFYA 1TL3B 1S0NA 3AVIA 3G10A 4MIBA 3V1QA 3MR5A 2OYQA 3WNFA 5D3GB 3CM6A 3BSCA 3BSAA 1DTTB 3E51A 4KHYA 4HCCA 3CJ0A 2D5RA 3OJSA 1IKWA 3CJ4A 4ED0A 3QGHA 4DL3A 4IFVA 3VQ6A 3SQ2A 4N76A 2D41A 4FZXC 2RN2A 3AVCA 2RKIB 3VQ4A 4HUGA 1HNVB 4EO8A 3K5NA 5J2QA 1NK0A 3MTKA 1S9EB 5C24B 4CIFA 3K59A 2R8JA 2XGPA 2E9TA 3GIIA 2R2SA 2IJNA 3H59A 4ECSA 3ZSWA 1S48A 4YNQA 3SQ0A 1JLFB 1KHWA 1QQCA 4KAIA 5KFCA 5FRNA 1T94A 3AA5X 2HHSA 2HNZB 1HNIA 1RCHA 3GILA 1FK9A 2G8FA 3GIMA 3AVBA 3AA4A 4FLXA 1QSYA 1J5OB 3CDEA 1DTQB 1JLGB 3RAQA 3L2WA 1WSEA 3BDPA 3TAEA 3LZJA 4FLZA 2HMIA 3UDLA 4K4YA 1QHTA 2HVHA 1CLQA 5KFVA 3WNGA 4I2QB 2A1SA 1TV6B 4IG3A 1IKYB 3AV9A 1NJZA 4HKQA 3KOAA 3T19A 1KFSA 1L3UA 4ECUA 2ZD1A 3IG1B 3TAQA 4HCBA 1S6QA 1HYSB 3V1RA 1YT3A 4I2PB 1NK8A 3LWMA 4Z4FA 3RAXA 1B92A 3MECB 2YHBA 4QOZB 1RBUA 3RMDA 4IRKA 4FZZA 1RDBA 4CHNA 4J9MA 4WZQA 4U6PA 1VSFA 3DYAB 4DLEA 5KT2A 4L8RB 2YV0X 4AH9A 2BRKA 4TSXA 4QWEA 4IH6A 2B5JB 2BANA 5DLGA 4ECZA 3RBEA 3CIZA 4HTUA 3HVTA 1DTTA 3G6VA 4DTJA 3K57A 4CJ4A 1K6YA 1S1UA 1SL0A 4NLVA 4R5PA 1NHUA 1BCOA 4IQXA 5KFBA 1ZBUA 4O5BA 3QGIA 1Z26A 1RBTA 4F3TA 3E01A 1JKHB 3NAIA 5F8MA 1S9EA 5C24A 3QEPA 4YFUA 4ED6A 1JLFA 2IS3A 5KT3A 1GX5A 2X78A 2BQUA 2HNZA 5HP1A 4IOBA 4QAGA 1QS4A 3SI8A 1VSEA 1A5WA 3AO4A 2VG7B 2W42A 3C94A 1S5JA 3V6HA 3RB6A 3RRHA 4DTOA 2FLPA 4RG8A 2E6MA 5KGXA 4FM1A 3RMBA 1DTQA 2D7SA 4EO6A 4KFBA 4DTPA 4RW6B 3P83D 2G8WA 1RDDA 3RWUA 2DPIA 4MKAA 3KK1A 3V4IB 1UA1A 5FDLB 1TGOA 4I2QA 3OS1A 2VG5A 4EBCA 1IKXB 3DM2B 3QEXA 3IAYA 1RTJB 2YKMB 1NHVA 4FJGA 4IDKB 4DG1A 4AILC 2HHVA 4Q5VA 4CFDA 3MXMA 1VRUB 1C6VA 1C2PA 2VWJA 3OS0A 4I2PA 3VQPA 4FS1A 4O0JA 4CJVA 2IC3B 3MECA 3CYMA 4E7LA 1EKEA 1KVAA 3DOKA 4K4SA 3DYAA 3T5HA 3V81B 5KT4A 2BGGA 4M3TA 4GW6A 1O1WA 4KI4A 4WZMA 2IDOA 2W9AA 1B9DA 3L2UA 5J2MB 2B5JA 3PR4A 2G8UA 3NAEA 3H98A 5F8IA 1WSIA 4Z4CA 2RDIA 3GV7B 4DTMA 3HO1A 3OYHA 2BE2B 3MEEA 3JYTA 3LP0A 2XCPA 3NF7A 4O3PA 4GMJB 3M8PB 1HYZA 3V6DB 4CEDA 3QIDA 2IA6A 1RDRA 3HVAA 3QERA 3G86A 2V9WA 2WTFA 4RW8B 4ZP9A 1NK6A 1RAJA 5KG2A 3U3YA 4NLUA 4IRCA 1RNHA 1T3NA 3CQ8A 4MQ3A 4DF8A 4CGGA 1RTDB 1SUQA 1Q9YA 3HJFA 3OL8A 1LV5A 2AX0A 3OYLA 4FJXA 4M94A 3QEVA 4M42A 1TK8A 3DRPA 1JLQB 4M3XA 2QXFA 5HBMB 1LW0B 4ECWA 4O3OA 3FDSA 1SKRA 3ZT0A 5F9NA 4RW6A 1S0OA 2IM3A 3NH1A 4KHWA 3RB4A 3NH0A 3MXJA 4X2BA 3RBDA 3BQ0A 3V4IA 1REVB 4WFXA 1IO2A 5KFZA 2XCAA 4NZ0A 1K1QA 3AVKA 5C42A 3KLIB 2EHGA 4B9VA 3LPUA 1VSIA 2A1RA 2ILYA 1IKXA 3DM2A 3ITHA 3IGVA 5F8GA 2JEIA 3PY8A 3BGRA 5KT7A 3B6PA 5DG8A 4KHNA 4DQPA 2OPRB 3M8SA 3N6LA 3QEIA 2GV9A 4RUAA 1VRUA 2J6SA 2IJFA 1TKTA 3VQAA 3VQDA 3SUOA 2UVVA 3KTQA 4CJTA 5L1LA 3DDKA 1FKOB 4DU4A 4HUEA 3NL0A 4DL5A 4KHQA 4M3WA 3RB0A 1IM4A 3KLEB 4KKOB 3TAMB 1Z25A 3S3NA 2JLEA 4ICLA 1CSJA 3HT3A 5DK5A 3DOLA 1ZETA 4C8NA 4KV8B 5KFJA 2P5GA 2ASLA 3RRGA 4EEYA 5L1KA 4FK4A 4IKFA 2J6UA 1WSFA 1NK5A 2G8VA 1NKEA 3HM9A 2YKNB 2X74A 4IG0B 2XY5A 3SJJA 2W8KA 5JS1A 3M8PA
chains in the Genus database with same CATH superfamily
4JV1A 1Q9XA 2BJ7A 4KBIA 4E7KA 2XS7A 4H4KC 3GONA 4LF9K 4HDHA 1YBUA 2VA2A 1CULA 5CCLA 3QINA 1B3TA 5B0CA 4QWDA 5FD1A 3H08A 1K44A 2J0QD 1NEEA 1Y0HA 3MD3A 3UNYA 2NUBA 4FWQA 3G4SN 2F9TA 4DSJA 2HIQA 4YHHK 2E7XA 3D68A 3WX8A 3AO3A 4I1TA 4K59A 2IRUA 2K7JA 3DHXA 3K2PA 5CCMA 2FHKA 3ICLA 3L09A 2P2CB 4KQZA 1VGYA 3KG4A 4BRNA 2O4IA 4FJ5A 3IAM9 5I42B 2RUSA 5F8LA 1HNXJ 3GIKA 4Z4GA 3SSSA 3KHGA 4CBWA 3ULHA 4V19S 5KFTA 2GQCA 1UWAA 3S8SA 2HF4A 1YXQA 3D1QA 4M5LA 4H03B 5HMXA 3PXGa 3S7RA 4UY8O 2RE1A 4WCEL 4YOVA 1R8BA 4X65F 5EY4A 2OFGX 3RB3A 4V19J 3KLEA 5KT5A 3CCMN 1T03B 1R6VA 4CIEA 4BVOA 1J6ZA 4ZK7M 3ENBA 4P6QA 1U49A 1T6CA 1GNKA 5KG4A 1CJTB 4HT7A 4JAXA 3H40A 3OS2A 2ACMA 1YJ9S 4JI2J 3M2VB 3NGIA 4Q8FA 1SJRA 1OVQA 1FE4A 3PCOB 3E9PA 3NF6A 4QWBA 1E4FT 4X65K 4DL2A 2HFSA 4G6VB 3BV8A 2P6SA 4A61A 4WQ4C 4CF9A 1Q7LB 3B8HA 2UXCF 1UVKA 4FLWA 4RW4B 2ZBCA 3IR6B 3P31A 4J9NA 5I4MA 3R5JB 2KZMA 3O6QA 5KFFA 1UVLA 2DO4A 2W7OA 1SB6A 2FBXA 3CCLN 2E2QA 3O9QA 2A40A 2Q2RA 3VEWA 3NMRA 2Z2MA 1IBLF 4BRIA 2H1YA 4QW8A 2IMWP 4NXMJ 3LAKA 1HBOB 5I42A 2DY4A 1RAGB 5FROA 4P7VA 3TU5A 1B99A 2CZ4A 3TR5A 1YG0A 3C6UB 2Q0UA 2VBWA 3FSXA 4B1UB 4DR1F 1YITS 2UXCK 4A8KA 2F8HA 3NGDA 4DR6J 4NO7A 2EWHA 2SXLA 2IRYA 2CQBA 1GLLO 1AXQA 4DU3A 5T7LB 4I56A 1AFIA 4BG9A 3GFYA 4QR0A 1IBLK 1GTHA 4NLDA 4AYBD 1T03A 1Q8IA 2W6KA 3TSQA 3THWB 2MSTA 1OVYA 4ITSA 3IBWA 2NR0A 4ZVRB 2IOCA 2KVIA 2LECA 1RT6B 2RRAA 3OYIA 2CG4A 1CJTA 3PO4A 1S0VA 1DFDA 4DR1K 2GV1A 3DRSB 3LGMA 1HQ2A 4LFAF 3M2VA 2MQ8A 2XSJB 2ZHBA 3DDNA 2HQFA 1M5VC 1XI1A 1ZAXA 3MR3A 4YQWA 1RT3B 4DV7J 2GWJA 3R5AA 4GO7X 4LR8A 2AEJA 4RNFA 4MIWA 3QNOA 2QKKA 1VS3A 1CC8A 4RW4A 2FZGB 4ID5B 2OTLN 1TUVA 3DWLA 5CHCB 4Q0BB 1QE1B 3QB0A 2FLOA 2DGXA 3H5SA 3H4DA 2WB1D 3EXCX 4IO9Q 2WC9A 4DSIA 2UV8G 3ISND 2NXJA 4EYIB 4ZPAA 4LFAK 2AJ2A 1HBOA 1GLEG 4GY2B 3TTFA 3BKTA 1DLOB 2RRBA 1Q82T 4Z7YA 1XR5A 4BRCA 2W9CA 3C6UA 1H6KX 2O8CB 4CIGA 5I3UA 4E1MA 1TL5A 1TL7B 2KFYA 4OGEA 3HHLC 5BN9A 4DV3F 3GFXA 5T7LA 4HVJA 3HKZD 1YZ7A 2F3JA 2O3DA 2E1AA 5GINA 1ZTTA 3DGPB 3CT9A 2FTRA 3VGLA 4DFJA 4OYWA 1M1GA 1SH0A 3SCXA 3CVKA 4JB8B 4DV6F 3QFWA 4NL5A 4ZPDA 4OYIA 4DX8H 3RBZA 1RT6A 4CGFA 1FD8A 2HHPA 2RKIA 2D4WA 1BLUA 2AJQA 3DRSA 1X5SA 2VZ9A 1NGIA 3SYZA 3CCJN 1QY7A 4DV3K 4LFCJ 1RT3A 2BW2A 5KT6A 3F5TA 3C95A 3P8BB 4OX9J 3OTCA 5IT9U 1KS2A 3VEOA 4DV6K 3CF5Q 4Q0BA 3H1VX 2NREA 3V4MA 5C2FA 1S5ZA 4JYAF 4USIA 3OSPA 4H0VB 1TV6A 1D09B 3NNHA 2B8QA 3LDOA 2VASA 3I32A 4X62J 2RJZA 3ZT3A 4FO0A 1NM2A 1VQLN 1JJ2R 1WKLA 2ZHOA 4EHTA 2UXDF 1WEYA 5SWMA 1NAQA 3BPSP 4PKIA 4BE1A 5KG5A 1P8GA 3HD2A 2YX6A 4URSA 2P8IA 4ELTA 3TJ8A 4YB7A 3OHAA 4JV5F 3BO2A 4HVZA 4BC5A 1WACA 1WELA 1NOYA 4PL8A 2CADA 4IR1A 4JYAK 5EX5A 3SBTA 4RUHA 2ZBPA 3DGPA 4AHTA 2AJ4A 4OI0A 3E9LA 3RYLA 3VQEA 2X1FA 5RUBA 4O3NA 1P8ZA 3AO5A 3OYEA 5AQNA 4GV3A 5C10A 2V8VA 2HHQA 2UXDK 1D9DA 3VQ8A 4OYPA 2OPPB 4BVPA 3DXBA 3BBBA 5KI6A 4FWRA 4JV5K 3SMPA 4CLTA 1OQ6A 4Y65A 5IZHA 1SVDA 4O8UA 1IR1A 1UPPA 4DV1F 4KTZA 1G3OA 1Q82O 3ZZUA 2HHUA 1VYAA 5KOXA 4GKJF 2JHEA 1VQKN 3MTJA 4CVNE 2DNZA 1UTAA 3BBFA 4OI6A 3U8XA 5LMNF 1FF2A 4B3SF 4J2EA 4PYAA 1XC9A 5HOOA 2Y1RI 3F9KA 5DRKA 4Y1CA 5IV3A 3UN2A 3MX5A 4A46A 4FWOA 5AFUH 2HQDA 5BYSA 3OA9A 2O01C 4YY3F 1YJ7A 1SJFA 1YBAA 1BHLA 2CQ3A 2LEPA 4DV1K 3OL9A 1ROFA 1RLDA 3I9ZA 1FVSA 5AQQA 5KFPA 4GKJK 3QIOA 2RE2A 2DPNA 3ZSXA 4B3RK 1JJCB 3MMVA 5LMNK 4B3SK 3ZXWA 3G6YA 2C2RA 2EG1A 4PYDA 1XJWB 4K2JA 2V4RA 3VQCA 4WCEQ 3OFFA 4CJUA 3BY5A 4EWTA 1IKVB 1VBYA 4A8QA 5M1NA 4O4RA 2BE2A 3G9CA 3IP0A 2CDRB 4YY3K 2ALZA 3SFGA 3KLHB 3CJ8A 2PBDA 3C15B 4OZ3A 1W0HA 2V6AA 4X4NA 3MM6B 3BF3A 1RWNB 5MLCQ 3D0GE 2VQFF 4Q45A 3HXMA 4FBUA 3WBZA 2GNKA 3I5CA 4FWPA 1VIXA 4CO4A 1X4GA 4NYFA 1I1GA 3OY9A 1JQGA 2ZJPL 4A62A 1GK8A 1RISA 2X51A 3GG4A 3GR1A 1BGXT 3QSIA 3LWLA 3D67A 4IKAA 2UXBJ 1ZYQA 3OR1B 1XTZA 4M5DA 2E8AA 3CDBA 1EJ7L 2VQFK 1H2TZ 1FJGF 5KFNA 4MK7A 5J1NA 3G71N 2PYLA 4JI6K 2I5JB 1B4SA 3DLRA 4A5AA 1RZMA 2IVOA 4DV2J 1DY3A 3ZLJA 1FKOA 3TUZC 2DTUA 2ZH6A 3JSRA 2DNYA 2JWLA 1X9SA 3SZ2A 4ISFA 4BR7A 3MMCA 3MURP 3GOIA 1YHQN 3EVOA 2DHAA 4Y34A 3CCRS 1FD2A 3IWLA 5D6GA 3AO2A 4RU9A 4J37A 2AGOA 3UI3A 5KG6A 1BCMA 1IKVA 3I6PA 2ZVSA 1UAXA 1JNZB 4IJNA 1FJGK 3FBCA 2HHHJ 3KLHA 4PPZA 1FVQA 4O4GB 3C15A 3L7UA 3EPIA 4WFAL 2KT3A 3IR7B 3MM6A 2YQ3A 5ADXA 4BQZA 2XGQA 5JMVA 4FCYA 3OHBA 3S3MA 3R8YA 4KBOA 4A8FA 5AQRA 3D2FB 2V8HA 4P71A 1ZBFA 2F8TA 2RF2B 4BDZA 1U1LA 2ATLA 4Y00A 1NSQA 4EZ6A 1HNIB 4GKKJ 4QCLA 4CI0B 4OKKA 4P2XA 3D3CJ 3IXQA 1I39A 3BPDA 1VQOS 3TABA 1VQPN 3N9UC 5C5JA 3CQXA 5AQJA 3Q22A 1YX2A 2Z1JA 2V2ZA 2ZH9A 1S59A 4XH4A 4DUZF 4FKYA 4TKTA 2VC1A 2I5JA 2GIRA 1FA0A 3ISZA 2HPUA 1Y4ZB 1ICEB 3CULA 3Q8SB 4K5RA 1UZHA 1SZ2A 1NPRA 2E1PA 2HLUA 1I3OB 4DPUA 2HBKA 1GTEA 2DNHA 3H46O 2F8EX 1Q79A 4DJBA 5B0BA 4G1IA 1WBBA 3FMBA 4PKDB 1S12A 3A8YA 1Q5VA 2W1BA 4OPKA 3OVNA 1FRIA 5HVGA 5IT9O 4J7CA 4CJLA 1K73O 3AA8A 4ED3A 4DUZK 4OJHA 4CEEA 2D0PA 2A3ZA 4R25A 4O4GA 3S9HA 4DU8A 2J9EA 4H54A 3VA0A 3I5AA 2O8BB 2WAQD 5LT5A 1Q0NA 4JI3F 3P5BP 4V19X 3E01B 2JFDA 1ATNA 1M5OC 1VQ9S 4ZLNA 3EZOA 3D2FA 4CM0A 1EAYC 1Y3JA 1FCAA 1PYTA 2RF2A 1U8SA 2P5VA 3TYTA 3MCMA 2EFGA 5HP1B 4ZHRB 3PZPA 3LGNA 2AYEA 3SCKE 3MEDA 3KLGB 4FJ7A 4ECRA 3TUJC 1FRLA 4WQ5A 2VFTA 3G96A 4JN4A 3CQYA 1HJRA 4CK3A 3OD2A 2GJFA 1S97A 3LPEA 3VQQA 3GG0A 2Q1LA 1G6BA 4UOCA 2P9PB 3THPA 1WKKA 3ZTQA 4MT1A 4E0DA 3ULEB 3SXLA 2H51B 5A0YA 1K9MO 1A6LA 1WC5A 2ZNZA 3U4LA 4C23A 4OYZA 1KEKA 4CK2A 2M8HA 4KH0B 3PO5A 4WK1A 2R2RA 4HH0A 3PYEA 4DV4J 1BWEA 3ENHA 3MPYA 2YBVA 4OYBA 4CLLA 2QA1A 3M1VB 3M30A 1MMLA 2XZWA 4K4UA 1Q8BA 2V7ZA 3KKRA 2RPIA 3WHIA 1FNMA 1HKBA 1FFGB 3GB0A 3WXKA 1WG5A 5ETKA 4AL7A 3KDNA 2UVWA 1R0AA 3MD1A 3DU5A 1VJQA 5AQXA 1X9JA 3D6TB 4NLYA 4U9RA 1YKWA 4RX6A 2XRIA 3NF9A 4I6YA 4HUFA 3J7A1 3IN5A 2NRRA 4J9SA 4ZLJA 1C1CB 2B8PA 1X1PA 3LOUA 1JLBB 2CNLB 1HD0A 1PCAA 2BOPA 4C0OC 5HJXA 4ZHRA 2OZSA 2LQ8A 3C14B 2AGPA 4U96A 3L3UA 2Q97A 3DRPB 3UWTA 3KLGA 4PG7A 4GVMA 1Z2ZA 1X3NA 3J80O 4R8UB 1PG5B 3OYBA 2OPQB 1SH3A 3TVZA 3CXCR 2E6LA 1O51A 2P9PA 3OBWA 3ITHB 3ZO7A 3OTEA 1QUVA 3ULEA 4DTRA 4DPTA 1UFKA 1KTVA 1TKTB 1L3KA 4CJPA 2EFOA 4ZCLA 3JXOA 4X64J 1RXOB 3KJQB 2HQ3A 3V5RA 2BJ1A 4QR1A 2DNOA 1YTYA 1N5YA 5AQIA 3OLAA 3CGIA 4EZ9A 3ZSRA 4F36A 3RAMA 5E3CA 1V3RA 2EW9A 3ENQA 1KLMA 5HVFA 3KMQA 3Q8QB 1NG9A 1BY9A 5AQYA 7AT1B 4BRFA 3HYFA 2FSJA 2DFFA 4QWAA 2CJXB 1FRKA 4P2SA 5C12A 3GIRA 1IJFB 1U7LA 5EXWA 1NNEA 5AQFA 3QNNA 4TXSA 3CJRA 2AHOB 4OJRA 2G1HA 1UVNA 3OJUA 3QO9B 1C1CA 3V1OA 1AW0A 1X31C 2HIYA 1JLBA 2RMLA 2DR5A 3MPWA 2VYPA 2FDNA 1NJYA 1FX4A 2XNQA 3EDRB 4JD2A 5L9NA 4UQTA 3I55S 2E44A 4DPOA 3WQUA 4DQSA 1VQMS 1W7WA 5B7WA 4TNOA 3VF6A 1NJWA 4BR4A 4R8UA 2FY8A 4IEIA 5KFAA 3H5XA 1KVJA 2PFFB 4E7JA 2OPQA 2J0WA 1PC4A 1KFDA 2IFXA 3A2FA 3TR8A 1NZ8A 1S10A 4QW9A 3VAFA 4B9SA 4YDUA 3GQCA 1SC3B 4HDGA 1HQEA 1VSDA 1RABB 2H5EA 3LP1B 4FK0A 1GMVA 4G9ZA 2QMXA 1TK5A 4NB4A 4CERA 2N3LA 1Y5LB 2AYMA 3DC2A 4GC7A 2CVIA 4NRTA 3M4XA 3QT5A 1XN9A 5DQHA 1L3VA 1Y97A 4M5KA 3ADAC 2RHSB 1NGHA 2LU1A 1DURA 1ZZNA 4NYOA 5L8RC 1NGCA 2O5DA 1GAOA 3N4PA 2MZRA 1KP6A 1D8YA 2RHQB 2N3OA 2KFNA 4LF9J 4OPAA 1WEXA 2QO3A 3P5JA 3UDCA 3D2EB 2CH5A 2FJWA 3R2CJ 2XNRA 2Z0GA 5ETVA 3QMLA 5KRSA 4DTNA 4HTJA 3QO9A 3BF4A 1Q81O 3I0SB 2PI5A 3R9LA 4BRMA 1M5PC 4YHHJ 4DSEA 3UCUP 5JLFA 3NH2A 3O9UA 2AF6A 4CFCA 4OYOA 2AJ1A 4KO0B 4QIEA 1B7YB 2Z30B 4PG5A 4O55A 3BGOP 2I7PA 4E7HA 1FXLA 2K06A 1S4FA 3KHLA 3DKDA 4B3TF 1WG1A 4Y2IA 1OIAA 1M1KT 4NLRA 4RLEA 1WAJA 4LSLA 4KAZA 3M32A 2IM0A 4LF7F 1XMOF 1VRQC 3NCIA 2CPYA 4A48A 4WE1A 3LP1A 2VD3A 4E3SA 3ZX0A 1YJ9N 2AA4A 3DAWA 4LJMA 3OYMA 3WQTA 4JI0F 1GQEA 3PRVA 3EWGA 4DTUA 2HKEA 1NGDA 2Q3SA 2YNFA 4BBYA 3H3NO 2HS0A 4MK9A 4DF4A 4CZKA 4B3TK 3G6EN 2Q36A 2X1GA 4IFVB 4HWIA 3UVJB 1O0PA 4KTQA 4NA1A 3CJ9A 4FS2A 1HI0P 2RDJA 1PO6A 1S1WA 1XMOK 1KDNA 4PG4A 3D2EA 4X65J 3SQOP 5E3AA 3ZETB 5KFLA 4JI0K 4FXDA 3RJMB 3HBTA 3C65A 3I0SA 3GYXB 2XMJA 3CJCA 3OYGA 4BGAA 1G7CB 4FJLA 3W0LA 1N56A 2HSTA 4RJVA 2VPWB 3NLCA 4I6MB 2WONA 1BA0A 4KO0A 2DIUA 2BTFA 3HSTB 4QIVA 4BC3A 4FJIA 4NLBA 3X3UA 2R8HA 2PEHA 2UUBF 4F26A 3KWGA 1QDUB 4H5RA 4ZVQB 1FJEB 2D0BA 4ZMMA 2UXCJ 2YXLA 2AZ3A 3TQ1A 4M3UA 2MJNA 3L7OA 3DLGA 2RIJA 1RK8A 1NMNA 3P4IA 4CH7A 1CBKA 4FF2A 4B1WB 2ZKUA 2C3MA 1IBLJ 2YQ0A 3HFVA 3IFEA 5KFYA 1TL3B 3AOCA 1S0NA 5LJVA 3AVIA 3G10A 3MR5A 3EKSA 5D3GB 5AQOA 2HSEB 1UZDA 2GEMA 3BSAA 3RRKA 1DTTB 2UUBK 3E51A 4KHYA 2D5RA 5D4LA 4OZ0A 2P9IB 3FRYA 4DR1J 1CJKB 3QGHA 3RW7A 4MO5A 4IFVA 1OSDA 3CMES 2D41A 2VWBA 2RN2A 3CD6N 3VQ4A 1GT8A 4C3LA 3K5NA 3MTKA 2ZNYA 2OO4A 1N5VA 3BB5A 3ZETA 4ECSA 2P6TA 1QTNB 1K8AT 3HRGA 3FZLA 4KPCA 3GIMA 3AVBA 1GLFO 1WTFA 3QSYB 1DTQB 1JLGB 3Q7BA 4FLZA 1HPMA 4I6MA 1DARA 2GZOA 3FGVA 5KFVA 2XS5A 4LFAJ 3T9NA 2PIIA 3GYGA 5IQQA 1GXLA 3VWSA 3PIOL 3CERA 3VOVA 1FRXA 1NO8A 2CG8A 1T3VA 4ECUA 3PSFA 3IG1B 1HYSB 3AXMA 4CP5A 2JLFA 1JNRB 1YT3A 4FWKA 2I38A 3LWMA 4DOZA 3RAXA 3TJ9A 4ZOSA 4A59A 2YHBA 2V69A 2MZSA 2OTJN 4CHNA 4WZQA 2MQOA 1IG8A 4AH9A 2BRKA 3AD7C 5HSPA 3VTIA 1TU0B 2NRXA 4ECZA 2QLWA 4HTUA 3HVTA 1DTTA 3G6VA 2DNQA 4DTJA 2NRWA 1Z1ZA 2IVNA 1CJKA 1HFEL 2DIVA 3K0SA 1X5PA 4R5PA 2ZKTA 4USTA 2H3EB 5KFBA 1WB9A 2RDDA 1G99A 3NAIA 4DV3J 4JK9A 2Y0BB 1EZZB 2KXHA 1BO5O 4A8OA 4QAGA 2WTUA 5EHHA 4C3MA 4DV6J 2W42A 5E2QA 3QAUA 3RB6A 3RRHA 5KGXA 2E6MA 3AOAA 1DTQA 2D7SA 4EO6A 1U6ZA 4FYXB 3P83D 3SDEA 3MCSA 3RWUA 2WVFA 1UA1A 4IO1A 5A2QY 2MMYA 2OD4A 4BR0A 3W61A 3ZZ0A 3DM2B 2V4JA 4GMKA 3IAYA 1RTJB 4I0WA 3HHLB 1QQNA 1VC0A 1ZOTA 4FJGA 1FRJA 1TELA 4KH5A 5LL6d 1C6VA 2HVZA 1C2PA 3BYRA 4FS1A 2CPIA 2IC3B 4RKUC 5ETOA 4FOIA 3PG9A 2GIFA 4JYAJ 1NJIO 4ATNA 3T5HA 3V81B 4GW6A 3FNNA 1QHAA 5KQ8A 1U02A 4KI4A 2IDOA 2RQCA 1M90T 1P90A 3THTA 3EGVA 2IMOA 1WSIA 2RDIA 2EI5A 5H9EK 2UXDJ 2YPYA 1T9YA 3JYTA 8AT1B 1VQ8S 1G4CA 5E0OA 4CEDA 4N7TA 1RHRB 2ROPA 2V9WA 4JV5J 4USKA 2IRXA 1RWOB 4BR2A 3G2XA 5DM6Q 5KG2A 1YRUA 3A8JA 4NLUA 4IRCA 1VQNS 1JJ2M 3UCZP 3LDQA 1SUQA 3T69A 3WXIA 5A8RB 4KYZA 3HJFA 2WUSA 1EKRA 2AD9A 4FJXA 4Y0WA 4M94A 1ILYA 4CWBA 2QEXN 3HDSA 9RUBA 5JICA 2QXFA 4O3OA 1XMQK 1SKRA 4H0YB 5F9NA 1BUXA 4P2MA 1R43A 3MXJA 3NH0A 2Q6BA 4X2BA 3W7BA 3P3DA 1AA1B 2KN4A 5H9FJ 2HURA 4WFXA 1F3VA 1K1QA 3SSRA 3G25A 1WOPA 3GZ7A 3DM2A 2LQ5A 4LF5F 3HHLA 1QAXA 4DV1J 2OPRB 5KQDA 3N6LA 2GV9A 4RUAA 4GKJJ 4CLWA 3VQDA 4X84A 4DKWA 2A10A 1ZPVA 2A1BA 3SSQA 3PFEA 1F2GA 5A8WB 4CBUA 4XEIA 5LMNJ 4B3SJ 3OUYB 2V51B 1ZZFA 4K25A 3ZX2A 4M3WA 2YHXA 1GLDG 4KKOB 5JMNA 1E6YB 3DOLA 4C8NA 4KV8B 5KFJA 2HQCA 3M8YA 1PJ6A 1NPKA 4IKFA 5IM0B 4YY3J 2K7KA 3ZTSA 3THYA 4I4BA 1WSFA 4LF5K 2DNKA 1Y64A 4F9OA 2H3GX 3K0JA 3SJJA 1R8PA 2W8KA 3MXHP 3HLUA 1HBNB 1RBRA 3H5YA 2PEBA 2W4CA 4OL8A 3MCOA 3QFHA 1NH8A 1R8CA 3W5ZA 3V9WA 2ZQBA 4FW2A 4JS5A 2UU9F 4M1KA 5F9LA 3TPQA 4O8KA 3H90A 3ZZRA 5A8RA 2NRVA 2BRLA 3SQ4A 2FLLA 5BRHA 3LPTA 4NA3A 2YQ1A 4FZVA 2VKZG 2MQPA 4KREA 4OZ1A 1X4FA 4G1QA 3O08A 1ASUA 1FEEA 2VQFJ 2W24A 4KIAA 2COLA 2G2ZA 1T3OA 5EUHA 2UU9K 2OPRA 2FPHX 4CJKA 4ZP6A 3DRRB 4JKCA 3NEKA 2CPJA 3G4SS 2WFBA 1RDUA 2M9KA 5A8WA 3HCXA 4MAKA 4Q7AA 3OUYA 4IOAL 2IAJB 2VDHA 5BN8A 3TAFA 4RCHA 4PQUB 4AUKA 4X4QA 3MM7A 4KKOA 2PA3A 4FWNA 2Z57B 4KB0A 3K8VA 2EBGA 3HULA 4ZVFA 3IO1A 3R5DA 4L6V3 5DS7A 2MLXA 4BC4A 5IM0A 3UE5A 1WNEA 3IS9B 1FJGJ 2AIRB 3R2DJ 1E6VA 1U1OA 4ZP7A 1U1NA 4BRPA 2JEGA 3H2VE 1JIHA 2DNLA 3VN5A 1U4BA 5AT1B 2XYPB 5IWAF 4NLSA 2ZITA 3PNIA 4I9QA 3CCMS 1EX8A 4WXWA 4OVLA 3HHLD 1HBMB 4TU8A 3O44A 3HMJG 1S0MA 4LIRA 1C0UB 2GJIA 1GXTA 2KYZA 4CGIA 1BQXA 1EO1A 1MU2B 2QFIA 1KC8T 3MM9B 4UT4A 1UFWA 4S0MA 3KK7A 4M5HA 2ZVIA 4DX5A 2H4WB 2B4OA 3FVYA 5IWAK 4DTSA 3F9MA 3HI0A 2C2MB 2V2KA 5G0RB 1HW8A 3U7JA 3WUHA 2B6AB 4JI5F 2NUHA 1LWFA 3SBMA 3W60A 4CI6A 3UQSA 3QLHB 3CCLS 4ILHA 1SQFA 2IAJA 2D0CA 5EU7A 3ZC4A 2PMWA 4CHQA 4PQUA 3AVLA 3CM5A 4GVBA 4USUA 4YOXA 3A4TA 1U25A 3D6MB 4NPOA 2YY3A 3D0PA 2FVPA 3QDKA 3SUNA 1VQ9N 1KQGB 4DUZJ 1WHWA 4F2SA 3IS9A 4UOFA 2E88A 4DBQA 3DOMA 2OMLA 4NZ6A 3OHRA 4OHVA 4DR4F 4MO4A 4JI5K 4M5JA 5CZ2A 3VAIA 2NZ4A 3QT6A 2C2KB 3I8BA 1GLBG 4KTWA 2KTQA 1VQ4N 4CNZA 2CJQA 1EX4A 5F0UA 1Q78A 1N48A 4ED5A 4ZVPB 2YNGB 2A0FB 3J7YU 4AQYF 2R2TA 1BMQB 2CPDA 2FVQA 4OHXA 5GADU 2ASDA 5IQ6A 3ZEUB 5M1KA 3MM8B 4IH7A 4ILMA 3CFPA 3L6QA 2V4QA 2F5GA 2PFDA 2G0IA 4HHJA 1TP7A 5SUHA 4DR4K 1MU2A 2HB5A 2YI1A 3MM9A 1JLCA 3O9TA 4M5NA 2HHTA 1JCEA 1FWPA 2IDLA 2OCEA 5DETA 4JI3J 3SAHA 1CJUB 1N0VC 4B8AB 3BR8A 2DR9A 1RT1B 3FBFA 5DQIA 3D7SB 1Y7PA 2I2YA 5AQSA 4FK2A 4JKDA 2LEBA 2OTLS 3NDKA 4AQYK 2Y1IA 3IUCA 4AF1A 5L1JA 2ZE2B 5F3TA 4NWBA 4DDFA 2AW0A 1Q16B 5EGYA 2MKIA 4FP9A 5ETNA 1V9OA 2KJWA 3OL6A 3HHEA 2GS8A 3KLFB 2BJ8A 4EI2A 2VOOA 3ZYYX 4QYZJ 1RAHB 3FGUA 4OX9F 1R0CB 2U1AA 3JTOA 4WWSA 2K1RB 1ZAVA 3PUFA 1UW4A 4ZJOA 2NPFA 5CYQB 1TK0A 5K14B 2CWKA 4DS4A 1EWRA 4RPFA 2CH6A 2MYFA 1XEZA 3U9DA 4K50A 4JNEA 4OJGA 1J5OA 3I56N 4PABA 2ASJA 1D9AA 4PL7A 3ID8A 2ASPA 2HRYA 1S6UA 4XTTA 3E8OA 3ZEUA 3MM8A 3HPHA 3L0QA 5DO2A 1CS4B 3KJFB 2MZJA 1C0FA 4ZLLA 5FPDA 4BC7A 1HHQA 3KUGA 3S41A 1E3MA 1MN9A 1ZS6A 2DBBA 3AA2A 3CCJS 2HWTA 3BGFA 1W25A 2ZJQQ 1HUXA 2BE9B 1CJUA 3C7NA 3WXMB 2P9SB 2G8IA 1TL1B 2XWYA 4CO0A 3OW2M 1JL2A 1QAJA 3PIPL 2GX9A 2E66A 2HEKA 3Q8YA 1HWJA 2B4UA 3DMJB 2WCXA 1TFWA 2MHNA 2CKWA 2GHVC 1VBKA 2C1EB 4C1NI 1TVRB 3GJSB 1VQLS 3BZQA 3ZSQA 2HNYB 1HWKA 4F02A 4BY9C 1MN7A 2IM1A 3AA9A 3JB9k 5C2DA 5BR9A 2DHXA 3A3NB 4NLWA 3J80Y 4YOWA 3WQPA 4YR2A 2KG0A 2M52A 4DZ6A 4YR0A 3VEYA 2K1RA 4X4VA 3BREA 1J2VA 4K4XA 4Q44A 2V2VA 4O44B 5CYQA 2EXUA 4PWUA 5K14A 5HANA 3CXCM 2J6TA 3K9JA 5KPTA 2YKOA 1C1BB 2ZM6K 5DM7L 2WB4A 3HX9A 4DR5F 2GUIA 2CJ9A 5K8OA 3MUTP 3D28A 4UW2A 4J9RA 2ZH5A 2OD6A 2X3GA 1CS4A 1A9NB 2NSCA 2G8HA 1S6PB 3EY1A 3RZAA 2F9JA 5FDLA 1JLAB 3MFHA 3GIJA 2QI2A 2DPJA 4U7UD 4ANEA 3JQMA 5KFHA 1NK7A 2YKMA 2EEYA 4PQAA 5BRFA 4IDKA 4I9LA 1FESA 1XMBA 2CPZA 4L74A 1VQKS 2RU9A 3Q8RB 3J7YP 1JL1A 2P9SA 3VPZA 2E7VA 1TL1A 4KHMA 1NUEA 3MEGB 5GADP 2W41A 1NM1A 5IT4A 1YK9A 4XPCA 2HK3A 2E1CA 4CLUA 3TEHB 4IOAQ 3MGJA 4LQ9A 4FPRA 3VAJA 3VGVA 2MZTA 3EXYA 1I94F 1TVRA 4HYKA 4Y1DA 1Z4UA 1UJ6A 3MUVP 4LBPA 4A5BA 3KHRA 1TR0A 3R27A 1HKAA 4RNNA 2V8GA 3KG0A 4J9QA 4AHCA 5BXIA 4CJRA 3VAGA 2RQKA 2F9WA 5JVHL 4JKBA 1XR6A 4RW8A 2C2EA 2F7TA 3FZFA 1JB0C 1Q86O 2CGKA 4CDIA 4I64A 2KQ2A 2WBMA 2CJKA 4AHRA 4HTLA 4NLQA 2L08A 4CZIA 2VJVA 4W5QA 3AVGA 3R1HA 5KG1A 3SLCA 1C1BA 1WSGA 4NXNF 4OYXA 2XO7A 2F96A 3DCAA 2HBRB 4LVOP 4RNOA 1I94K 5AQKA 4F4AA 3KG1A 4JKFA 4GRSA 3H2LA 4C8KA 4LFBF 1F5AA 4F0MA 4FJMA 2AP6A 2ATQA 1S6PA 1YSJA 1C4AA 4CEQA 4FOEA 4DFKA 4TLQA 2VGMA 1IBKK 1TQLA 4R0JA 3GL1A 5EWGA 1FE0A 2J8SA 4JKGA 2P9UB 2CUYA 4AM6A 3TUIC 2Q79A 1NDCA 1FEHA 2AYGA 2OSRA 3HJVA 4NXNK 1J54A 2IYIA 2H48B 1LWCB 3G8TA 3MEGA 4QR2A 5FLXY 2CIMA 3OXGA 2FVSA 4LFBK 1LQ9A 1RBSA 3TWHA 2B9WA 4Z94A 4L75A 2D3OR 3DJCA 2NLWA 2E9RX 3I9V9 1U04A 2E29A 1IWGA 4IJAA 3MWTA 3G71S 1WI6A 4B3TJ 1NLVA 3TTCA 2P9KA 4J2DA 1MW7A 2DFHA 2R7OA 5B8HA 2YKPA 4CO3A 1IG9A 3OL7A 4LF7J 1OS5A 1C0GA 4QS7A 1UEVA 1XMOJ 1KVKA 5HK4A 1TKXB 1RGIA 3FZKA 3M6WA 3T5LA 2BW7A 2EBEA 4MIAA 1YHQS 3ZT1A 3NE6A 4JI0J 3MK6A 3P96A 1HKCA 4RW9A 4DFMA 4UF4A 1VAZA 3GSDA 3NMAA 1XC3A 1PBAA 4R79A 4JI4F 1O8BA 2GVZB 3BSOA 2IIRA 3H8YA 3S1TA 3CUNA 5M1FA 3MI7X 1WSJA 3L2VA 3NS6A 5KFOA 4B3MF 1UVMA 3CCWA 2X6NA 3HFZB 2MKKA 2QN6B 2UVUA 2ZH7A 5LMUF 1CZ9A 1S1TA 3FUYA 3AAPA 2M7SA 4KHPF 4J9KA 4IOCL 5HROB 4F3QA 1YJNN 5BRDA 3CWJA 1NSPA 3TAGA 2P9UA 1YF5L 4ZPBA 1NRKA 4F4YA 3NAHA 4JK7A 4L73A 4FL9A 4UTGA 1NGEA 1S6QB 2GW8A 1LWCA 2MQQA 2E5HA 5F3ZA 2YWEA 4HEA9 2P9GA 3CMEN 2FJVA 4B3MK 4WXOA 3VGMA 2VU5A 4O3RA 4M3ZA 2HWHA 1VQPS 4N56A 1H0HB 4C8MA 2HVEA 2F63A 5GAEU 2CVEA 3NFAA 2UUBJ 2LDYA 9ATCB 1U1MA 4KHPK 2UUTA 4B02A 3P5TL 5IV4A 4U8YA 2ZZNA 4ZVEA 4DR2F 1VQ6N 4PEOA 1WTBA 4LF6F 1MWQA 4ZVOB 2QL5B 1OWXA 2VIHA 2BDPA 1S1UB 1XQIA 1Y3KA 3NGKA 1TKXA 2KI2A 4CLPA 1HMVA 5CD4H 2DD8S 2WK4A 3L8BA 2XZTB 4CESA 4MMOA 3CJ2A 2A5XA 3R7SB 1HI1A 5E3RA 4IUFA 1VHFA 1RQ0A 5E5NA 4KT0C 3PKYA 3D6RA 5E33A 1MLAA 4LF6K 1RHKB 3D5MA 4KFBB 1O6XA 2DRDA 2V67A 5KFSA 3CI5A 5GIPA 3WEEA 3T41A 5HROA 1W7AA 2H9ZA 4JV0A 2UV8A 4H5NA 3NCPA 1URRA 1RBOB 1U1PA 4JEPA 3NVMA 1VLYA 4DG1B 4PHTX 1Q8LA 2OUGA 5DZ7A 1UOCA 4I68A 4B1ZA 2HFZA 4FYWB 5AXNA 4NA2A 4CEAA 1Y5IB 4B9TA 1SJ3P 4YDUC 3DOKB 1RT7B 4NEYA 1B70B 2LQBA 5BPNA 2Q6CA 1QAIA 3SBGA 1F1BB 5D15A 1T7PA 2HS3A 7FD1A 1JK9B 1RKIA 3MEEB 3EKUA 4G3IA 5E26A 3EVWA 1NDPA 4DB3A 2KG1A 4ZN3A 1WG4A 3IA0A 1RBVA 2KM8C 4CW7B 1TKZB 3LDNA 1D8ZA 3MOZA 4OKEA 1BWFO 4UY85 2XLKA 3GP9A 5AQUA 3RSEA 1FRMA 1WN7A 1FFSB 1ZA1B 3SV3A 5DM7Q 3NCQA 2AU0A 3BEXA 3BQ1A 4DL7A 4URQU 5EVZA 2D0OA 2FGCA 2K2PA 2MLYA 4IO9L 4CM2A 1R8AA 1NBWA 1WUUA 1X60A 3EGWB 1RWPB 3A8EA 3R5CA 1W9HA 1ASWA 4ZDNA 2GTDA 4OI1A 3J81Y 3G0ZA 4N77A 4KSEB 2V9KA 4DL6A 5KFKA 3H42A 2BX6A 2KRBA 3AVJA 2LYVA 3TX0A 2V8DA 3N4QA 1Q1KA 2XY6A 4DV0F 3KZBA 3P1GA 2R7XA 4YOEA 2J9CA 1DHMA 3QJJA 3AH6A 4NYZA 4J9VA 4F4XA 1BIUA 2DFEA 1R3NA 4OJ1A 5KG0A 1HNWF 1B0TA 3PLAA 4QIWD 3B78A 3LM2A 2CAJA 1H38A 3EO3A 3ULDA 1RT7A 1P6TA 4ICLB 4M3RA 1JWWA 1GFWB 5LSRA 3SV4A 4K5SA 4USWA 2CA9A 1TAUA 2XTJP 4DLGA 3J7ZO 4FBTA 4X4PA 2LFVA 2FXUA 3B4DA 2LXUA 4DV0K 3HHKA 3IRWP 2NYIA 2P9LB 3MN7A 2ITMA 4P73A 3GFZA 3RVCA 1YJVA 2LVWA 5C15A 2FLNA 4H4OB 3CO9A 1N36F 1TKZA 1RWVB 4MKVA 2GCFA 3AD8C 4WKRA 2VV5A 2B7CB 4OIXA 4Z37A 3JQJA 3CF5L 4ZPWR 5GAEP 5EN1A 3K5LA 5CH7B 4NOHA 1U2VB 2DGUA 1QJHA 5A2QU 6FD1A 2EFVA 1TAQA 3MMAB 2OFHX 3EZ5A 4LF8F 3NBPB 4LRAA 1LKZA 1NB7A 3DI6A 2HZAA 3MEKA 4HACB 3GPAA 1N36K 3AOBA 1N6QB 2BXJA 3C19A 4ED4A 1QLNA 1D1UA 2NRHA 2GGPB 4BR9A 3O3HA 4U7UK 4B1VA 4K7QA 3PYGA 3VA3A 1R7IA 1Y11A 2HHWA 3NHGA 4RW7A 2QX0A 4W92B 3LM9A 2YX7A 3K89A 1W26A 3PJWA 4LF8K 4HLBA 1NGGA 2CXEA 4LF5J 1GOCA 3PRBA 2GWKA 1SPBP 2KLAA 1KLNA 4GV6A 3EL2A 5E41A 3IMQJ 1PIEA 1OH7A 4Q43A 3VV2B 1HBUA 2P9LA 2F7VA 1KAYA 2I9SA 2E5IA 2QLJB 2C28A 1HPZB 2BR0A 4JP8A 5H1SQ 4H4OA 1RAFB 3G8SA 1KOOA 5C25A 1X4EA 3MAQA 3SQ1A 2JVOA 1F6TA 3JQKA 3ZZPA 5AQWA 4RO0A 3V9SA 5C2CA 3O8MA 1OY9A 1RJJA 3CCUN 4IYQA 3FR0A 2G13A 3OFEA 3CPEA 3SI6A 1U2VA 3I87A 4P75A 2Y8YA 2W8LA 3U27A 1F21A 3C16B 3MMAA 3Q0AA 2BOAA 4I6AA 1UFLA 3NBPA 4GO5X 2UU9J 4A2AA 1S9GB 4JRPA 3CC7N 2Z2LA 5KFGA 3TWZA 2R4FA 2WHOA 1PBUA 4HACA 4IOCQ 4A8YA 4QOTA 3QRPA 1N6QA 3V9ZA 3LQVA 3ENWA 2GGPA 5KPRA 5T7BA 3K5PA 2QT7A 1V3SA 1RI7A 2XLJA 5HI7A 3KK3B 4LR7A 3CD5A 4MDBA 1SH2A 1VK8A 2OLWA 4PKHA 4TVAB 3FC9A 1EB0A 1SIZA 1T9WA 5F2RA 2E5JA 1WC4A 3UPFA 5KFUA 1ATSA 2OH2A 4ZPVR 1BIZA 4ZCMA 2JEJA 3V6KA 2VA3A 3AY0A 3VGSA 3BF1A 5J2QB 3OSNA 2AJFE 1EQYA 2PY5A 5J2NA 4BGBA 1MWKA 2LMIA 1ZA2B 2ZH4A 4CZLA 1HPZA 1VI7A 4C6AA 3A3PB 3MF5A 4XAKA 1FK9B 3BQ2A 2VPZB 4KI6A 2QJ3A 1F2HA 1CPZA 3ZCMA 4DSLA 5JVGQ 3PJ9A 1OH5A 3G6ES 1LAWA 2QGFB 3L7PA 3BBCA 2FC8A 3GJRB 2AZ1A 3L4BC 3C16A 2GHWA 3MXIA 5MLCV 1CLFA 4F0KA 2W2PP 5IWAJ 1S9GA 3PX0A 2ZD1B 5F41A 5AXLA 1QSLA 4H8KA 2W9CB 4ZIVA 1I3AA 1WNSA 2CQGA 2GC8A 4O3SA 5I3UB 3R5BA 2D1CA 1V6HA 3KVGA 2DHSA 2QM1A 2QFJA 2CQ0A 1X9MA 2RQMA 4W4MA 2C2OB 3PW4A 3CJ7A 5B09A 3KK3A 4L3NA 4ECVA 4B9QA 1WWHA 3V1QA 3WNFA 3FMWA 3CM6A 5CXTA 4G1PA 4V1Ak 2AT1B 2HRTA 2W2QP 4JI5J 4DL3A 2W6LA 1FJCA 4OYMA 3SQ2A 3M5RA 2RKIB 4EO8A 5J2QA 2YWWA 1NK0A 3TO8A 2XMUA 1UCNA 5LSOA 3K59A 3N0VA 2E9TA 2DNRA 2R2SA 1JLFB 2ZH2A 5J1PA 5KFCA 1B64A 2BJEA 1FW6A 2Z58B 5A6WA 2G8FA 1FK9A 1ZM2A 4ZLPA 1VBZA 3GSIA 2BJDA 2L41A 3H45C 3CDEA 1T11A 3BDPA 3TAEA 4DR4J 3J7YI 1GLAG 5DDPC 1QZ6A 3CD6S 2KHOA 1BDGA 5GADI 1OH8A 4I2QB 2OANA 4A8XA 1TV6B 3NGUA 4IG3A 3KOAA 2WW8A 2Q0RA 2ZD1A 4AQYJ 3TAQA 1YI2S 3P49B 1Z05A 3ENAA 5CQGA 4Z4FA 3MECB 4QOZB 1RBUA 1PJ7A 2F4FA 3TEGA 4IRKA 1VC5A 2VQEF 4J9MA 3BUZB 2YV0X 4L8RB 3SMZA 2E1ZA 3Q7CA 3Q23A 2BANA 2C42A 1RHJB 2I8EA 3AFGA 4JI8F 3Q24A 4IFEA 2R7RA 3TW0A 3A5LC 3CW2C 3HZGA 4ZCKA 1Q18A 1RB0A 5A2QO 1SL0A 4NLVA 3HHDA 2NZTA 3FCWA 3CCQS 1BCOA 1T6DA 1VR6A 5DDRC 1P1LA 1HLUA 1ZBUA 3VF4A 1ZBSA 4UUXA 4U8VA 1RBTA 3H2UB 4CD1A 2JWNA 2OTJS 3QEPA 4ED6A 1RLCL 1JLFA 1KQSM 1R27B 5LM7E 2O66A 1X4DA 5KT3A 2VQEK 4IOBA 2YWHA 3SI8A 4BS2A 2QYCA 4AL6A 3PEJA 2FLPA 2XMWA 3DHWC 1MMNA 4JI8K 2VHGA 1HNZF 3VAMA 4DTPA 2G8WA 4CT9A 1RDDA 2YJEA 2A6MA 2DPIA 4MKAA 3KK1A 4X62K 3WC2A 1VQ7S 1TGOA 4I2QA 3MCPA 3OS1A 2VG5A 4EBCA 2EK6A 3DLLQ 1NHVA 2HS4A 1LOTB 1X0FA 4AE5A 4AILC 4Q5VA 4NE9C 2OELA 1VRUB 4LIWA 2VWJA 3OS0A 1X0PA 3MECA 1F60B 4PXBA 2EKNA 1EKEA 1HNZK 1V4TA 1HWIA 4K4SA 4ZPTR 2F4VF 2BMBA 2W4PA 3LPYA 2W9AA 3L2UA 5EX0A 5G4DA 2DGQA 3PR4A 2HGLA 2G8UA 3NAEA 3GTYX 4A57A 4DTMA 3ZZOA 5AZJA 2BE2B 3LP0A 3NOGA 3US5A 3RW6A 3A8KA 3HVAA 5B0EA 1U8WA 3G86A 2PN6A 5THWA 4EAHD 1QD1A 1U1RA 1RNHA 1NBEB 1IBMF 1UEKA 3OT9A 3L4IA 5HATA 3JS9A 4CGGA 3VZHA 1Q9YA 2GJ2A 1TFYA 2AX0A 4RUBA 3Q2TC 4DL0C 3OYLA 2F4VK 1M5KC 4XH5A 2PGCA 2OHDA 2KT2A 2H65B 1JLQB 1QQMA 2XMMA 4OZ2A 4MTPA 5HBMB 3CB4A 3H1QA 3ZT0A 4B3RF 2B4VA 3NH1A 3EE9A 2IVMA 3RBDA 2CQCA 2UP1A 3POTA 1SQKA 4K43A 3CD0A 1IO2A 3P39A 4NZ0A 3AVKA 5C42A 2EHGA 2QRRA 2R7QA 3LPUA 1VSIA 2A1RA 4LVNP 2DT9A 3BGRA 1F9FA 5DG8A 1IBMK 4KHNA 4DQPA 3M8SA 4M5DB 4ZKAA 1U0HB 5AZIB 4DR5J 1VRUA 1WSVA 5IOLA 3VQAA 2QEXS 4MYUA 3Q2SC 4YEAA 3E1YA 1PC5A 2XZDB 3W63A 3PYDA 3CPWM 1FKOB 3ATUA 4WP9A 4FDFA 3NL0A 3O1LA 4KHQA 1IM4A 3KJNB 3TAMB 3MMJA 4O5FA 2JLEA 3MMCB 5DK5A 2D9PA 2ASLA 2E7WA 2D9OA 3J80U 3TA1A 3MDQA 1Y9OA 1WI8A 3VVUA 1NGBA 1NKEA 3M05A 1EQMA 2NXUA 3OFGA 4FVUA 5JS1A 2OJ3A 2FIUA 3M6UA 2OPSA 1NKCA 4FLYA 1WBDA 2QL9B 1YJWS 4E89A 3CC2N 1JMTA 4C9DA 3U1MA 4LSNB 3OV7A 3THXA 1I94J 1S7HA 4JI6F 1YQHA 3Q8VA 3DXKA 4XPEA 1CXUA 1U2FA 2YPZA 1K73T 3BO3A 1JLQA 4CJ3A 5FPMA 3VENA 5HBMA 2WSCC 3IRXB 2ZH8A 2GAGC 4USMA 3CCVN 3K8WA 2MQLA 3M8QB 4DHYA 3QBXA 1UWBA 2LA4A 5F8NA 3R97A 3CEDA 2X1AA 1C0MA 1FERA 4NRUA 2ZDOA 2HOEA 2XMAA 2AKWB 3BGUA 2HZVA 4U95A 4NXNJ 2N7YA 2QSWA 1U0HA 5AZIA 2LCWA 3QIPA 2W01A 4FLVA 4MK8A 4DTXA 4CTAA 3NNAA 2MEWA 4LFBJ 1W2BM 1VSKA 1GMUA 4AXIA 2VFSA 1QTMA 2CPEA 4WU2A 4CECA 4NCBA 4EHUA 3S3OA 1HR0F 3TAMA 2HYIB 2UUCF 3MX2A 4HL9A 4CFAA 2WVEA 3D66A 3ZT4A 2BV3A 2N4DA 2GELA 3BKUA 1N33F 2DO0A 2MDAA 2Q43A 2HHHK 4QS8A 1Q7YO 1TL4A 2KKZA 4K0KF 3LO3A 3BP8A 1K9MT 5MAOA 1H7WA 4WYWA 2D3O1 3ASMA 2V5HG 4PA1A 4O23A 1AZSB 2L48A 4CT8A 1S6OA 3KUHA 4LSNA 3W2WB 3N6NA 4HHTA 2HW3A 4CIOA 1HR0K 1PILA 2UUCK 3RMAA 3HFKA 1VOMA 2PI4A 2IM2A 2R7UA 4BROA 1N33K 3GJQB 4OHYA 1D5AA 2CGJA 5BR8F 3IRXA 2XHWA 3EJMA 3ZX3A 5IS2A 4FWSA 3P4UB 4K0KK 1OH6A 4FZYA 3M8QA 3L3CA 3MEDB 1KONA 2FGOA 3JAMY 1BA1A 2CPXA 3V6JA 4ZJQA 2F8SA 4B9LA 1KCFA 4CF2A 4CZJA 4ED1A 3E2EA 4FJHA 2BUPA 1LWEB 3ZTOA 5FLXU 1PGZA 3N6MA 4JI4J 4PWWA 4WBFA 4ZVGA 2RHKA 4CF8A 2YNIA 4BE0A 3PDNA 5A0YB 5AQPA 4B3MJ 4PCQA 3F73A 4OYAA 3J7AN 1HD1A 4KJIA 5BR8K 2VC0A 1UPMB 3LAMA 5LMUJ 5L46A 3TJAA 4A2BA 3OR2B 4BRDA 4KHPJ 1IQZA 2DKOB 1X4BA 3M30B 4BWJA 3AAQA 4CHPA 5T41A 1WC6A 3T1YF 1FJ7A 1T8EA 2WSFC 1YUWA 4H4MA 4FVCA 4FPBA 4K4ZA 4ELUA 4C4WA 3KIOA 1WF2A 1ULRA 5HN0A 5GAEI 4M3YA 2LLZA 2HRUA 3KNGA 1R0AB 3WNEA 8ATCB 1A0OB 4FJKA 1VCTA 3I5BA 4CGJA 1AZSA 3I0RB 3W2WA 4LC9B 4Z2XA 3CJBA 4PUOB 3OBIA 1SI9A 4QYRA 1CZBA 2GHPA 4K8ZA 3BN4A 1HI8A 3BH6B 2IVYA 4DR2J 1KD1O 3T1YK 4LF6J 3UO0A 3VF2A 4K42A 3W3DA 5LJWA 2YKAA 4EP5A 4ILLA 3ILLA 4RL1A 1VQ4S 1GLCG 2O8FA 5HL7Q 2ZOFA 3OXFA 2XC9A 1MA9B 5D78A 1I51B 1KAXA 3TVYA 3RR8A 2YX1A 2VG6A 2JFKA 1RP5A 1LWEA 1X9WA 3KD1E 2LDIA 3J81j 5U47A 1IN0A 2AGQA 3AARA 4BREA 5AE2A 3ATVA 1D3WA 4QU6A 4F4ZA 4CBXA 2WOMA 2UUWA 3B6BA 3V9UA 4NYNA 4YP3A 1JCFA 3OTDA 2Y0SD 4CD3A 4WIQA 3OR2A 4NYPA 2HBLA 1WEZA 4DQQA 1U47A 3LL3A 1N5YB 1S72S 3O9RA 4CZFA 4JOUA 2HK2A 3MN5A 4I7FB 5AQGA 1HNVA 2V2QA 4OPJA 1KLMB 1C4CA 3JTPA 4WFNQ 1FDAA 2DHGA 1ITPA 4FVMA 4C8ZA 4CGHA 3C8YA 3I0RA 1NGFA 3IGNA 2F9DA 2HWIA 2YVSA 3T5KA 3CMAS 4PUOA 1Q4RA 2HGNA 5KTQA 2BM1A 4F4WA 2GFFA 4FXVA 2AWZA 4RUCA 2CJYB 3C6TB 2KHCA 4FM2A 2YH1A 1GX6A 2VBYA 2ZZTA 2J76E 1AFJA 2FUG9 1GOAA 4JD2B 2MXYA 1UA0A 4ER8A 4WF9Q 2DY9A 2GQ2A 1IKYA 2VPXB 5ADZA 5I3PA 5JS2A 1UAWA 3PX6A 3MUMP 4J9UE 3MHYA 1UW9A 4W98A 2KXNB 4BRQA 1ACMB 3W3SA 1Q81T 1SL2A 1U24A 4BE2A 1HLWA 3ONQA 3I56S 1NZAA 3HP6A 1N34F 1VSMA 4B9NA 3NP5A 2E4LA 3F0NA 2FVCA 5CAAA 3BJYA 4LMZA 3BM7A 1HQEB 3FFIB 3I8DA 1H73A 4D3HA 2KDOA 3C46A 1N8RO 1MWZA 3FKBA 2IDEA 1SKUB 1XK8A 4FJ8A 1QVFR 4QZVB 1XWLA 1S9FA 2DR8A 3VR1A 2NUUG 4N8NA 3CJKA 2ABYA 4OPHA 5BYRA 3VQSA 2M5YA 3M9NB 2FC0A 1Q53A 4Y3CA 4I7FA 5DLFA 1RAEB 2R7TA 4DV0J 3RTVA 2H4YB 3KLVA 3O8WA 1JKHA 2KM8B 4ED7A 3VZIA 2ADBA 1N34K 2KH9A 3KKSA 2OI2A 5C0YA 4B1YB 3O80A 4DSKA 4NMXA 2BKOA 3M2RA 1HNWJ 3I4HX 3KWIA 4CLSA 2VG7A 2ZJRQ 1KRPA 5AQMA 4CHZA 2CRLA 4CZCA 1YGYA 4CRJA 4RR5A 4DR7F 4RNMA 3C6TA 4B1XB 2XM3A 1RAAB 1SJ1A 3D4JA 2VONA 3J81U 4EBDA 1KKHA 3MR7A 2BJ3A 4B17A 4Z7CA 4BRGA 1FFWB 3A0IX 3NCRA 2E5LF 2W2NP 2JX2A 4C8LA 4AXJA 4BRLA 4CHOA 4JLHA 2UUAF 1N36J 3VEXA 2G0CA 3VQBA 2LU2A 5ITHA 4PWDB 4YB1P 2HG4A 4QS9A 3SFUA 5KAKA 4LSLB 2Z2ZA 4DR7K 3M32B 1VSLA 2XBPA 5F8HA 1YRXA 2CFXA 4M95A 4DN0A 3FFIA 5BPLA 1NGJA 2XY8A 4WE1B 3K7RA 2ZEJA 5J2MA 2XMKA 1R0BG 4LF8J 3U3GA 1H2UX 4I6WA 4FJNA 3KYLA 4WU3A 1MWMA 2E5LK 1EP4B 3VETA 2YNFB 1AUSL 3BS9A 4LSZB 1Y00A 2EX3A 2UUAK 5D8HB 3SUPA 2QA4N 4M63C 3K5MA 2MJUA 1UEUA 1FWLA 2YWFA 1D0EA 5DM6L 3OQ2A 2VJUA 5IT0A 1RTDA 1S1WB 4KH4A 3H6EA 2IVFB 3O3LA 2V0NA 3TANA 2Z1IA 5FLXO 1RAIB 2RT3A 5B08A 5D0RA 3NGRA 4CLZA 2HAFA 5FJ4A 4J91A 3VEZA 2WONB 3OXLA 3ZNJ1 2J5AA 5K8NA 1IR2A 1Q8KA 3TSUA 5LY3A 1YTUA 4KGVB 2XY7A 1RA7A 2M4MA 2ZOGA 4BWMA 4PWDA 3TQEA 2YWGA 3VGTA 2XG8A 1QVGR 4ELVA 1XHXA 1ZTWA 2HBZB 4DCOB 3PV8A 2ZF5O 2PZSA 2ZUAA 2IGIA 2RSQA 3DLGB 1YLXA 3BKFA 4ETZA 4Y2KA 1G15A 2EWSA 2DGTA 2D0AA 1UL3A 3N5BA 3RUBL 3G82B 3GCWP 1HYVA 1H7XA 2ZDPA 2V8PA 3TA0A 3M9MB 1CQNA 1VBXA 2YKNA 4ANCA 4O0IA 3EX7B 4J90A 1EP4A 2H5IB 4DN9A 4KY3A 2G2YA 3AJDA 1N5QA 1J5EF 3MAAB 4FW1A 1SL1A 3L95X 1O5JA 2NXNA 3AD9C 3MPDA 1HRHA 3K58A 3O1BA 2XULA 3A8IA 3QGGA 4HHUA 2L9WA 3NWRA 5HQMA 3QYYA 3UB5A 4Z0UA 2AEMA 5F0XA 4DWIA 4H5VA 4USHA 1Q95G 2B9YA 3ZFVA 1ZC6A 2PD1A 2FY1A 1Z2LA 2PA8D 4FNIA 1P1TA 4O0NA 1Q5YA 1EARA 2A6AA 3LW5C 5BJRA 3C0BA 1J5EK 2FJEB 3VVTA 3A5NC 1ZAWA 4CO1A 3FJ2A 2VPYB 1TUGB 5HMZA 2RUGA 2EVZA 1JXBA 1RU2A 1DKGD 4KHSA 1JXVA 5AJ3F 2RS2A 4LH4A 4L76A 2J7UA 2HQGA 3AT1B 1D4XA 4AHSA 4OQJA 4ANDA 3H7HB 2XI2A 2GAHC 1SJQA 1AYEA 2NSBA 5CYJA 3R6GB 2OP5A 3TARA 4PKGA 4IH5A 2W7PA 3CHWA 1UJ5A 3DLBA 3CJSA 3LANA 2QG9B 4ZCIA 2PO4A 5CZXA 4FN5A 4TYBA 3TTDA 5GIOA 3G82A 2ETJA 1YJNS 4CJSA 1VIOA 4X66F 2J4RA 3L2QA 2MHEA 5AJ3K 3CETA 3HVTB 3MAAA 3L3VA 3VF0B 2X7IA 4NLXA 3D7EO 3AVMA 4TY8B 4R5PB 5ETQA 3QT7A 3K2YA 2DGSA 4ZS6A 2QIFA 3O5TB 1NJIT 4LRBA 4WKYA 3QMQA 4W5OA 2OA8A 3VQ9A 3SUQA 1YI2N 1U2RA 1FKPB 4X66K 3LF0A 2GQQA 1VQ6S 4F3OA 1FRHA 1S7IA 5KFEA 3NVKA 4DL4A 3EZUA 3RMCA 2QWOA 4N8OA 4BRAA 2NXCA 3FBEA 3SDEB 4F25A 3MR2A 3GBTA 2MGZB 3TVKA 2QMUB 1K47A 4BRHA 1NDLA 2QC3A 3FZMA 2V4JB 4FM0A 3IAS9 3GJTB 2R7SA 1QSSA 3AVAA 5LOQA 2XMTA 3C66A 3OYJA 3VEVA 2FC9A 3Q83A 4CF0A 2E2OA 2E1RA 3CCQN 3R5GA 4Y6IA 3BR9A 2VF3A 3OTBA 4K4VA 3ZTRA 3THWA 3QWUA 1SKSA 2B43A 2W25A 4CE9A 2MKHA 4CJFA 5KRTA 1LK7A 2X6SA 1RHQB 2HHXA 2V34A 2M70A 2FJXA 4AHVA 3LZIA 1RYRA 3PACA 1CEZA 3CJTA 4DQIA 2XSJA 3J81O 3JYTB 1JXLA 3P38A 4TY8A 2P9CA 2ZUGA 4N41A 5A6PA 5CZVA 4U7CA 1ZBLA 1T95A 3FZ2A 4QU7A 3HD1A 2KU7A 3QETA 1RTIB 2VQEJ 1VQ7N 3PTWA 4ID5A 1S3XA 3CJ5A 3CTRA 1SUQB 1QE1A 1S1XB 5CY4A 1VSHA 4XK8C 3FLCO 3EE8A 4JI8J 1FKPA 3DLEB 3WNHA 4ZJLA 3F44A 1YVNA 4JBCA 3R8EA 3CFRA 4OLAA 5KFIA 2A18A 2NNWA 3Q8PB 2Q3PA 3NKYA 1E4GT 1DLOA 2DXEA 1NPPA 4CNYA 1LWXA 2MGZA 1WSRA 2O8CA 1N5TA 5E84A 2C3UA 1SIWB 4C8YA 4PXDA 4WYBA 4XDDA 1TL7A 4FLUA 1VSJA 1DEJA 2BQ3A 3A12A 3VAHA 2JC0A 4W5TA 3UKRB 1AUDA 2WW4A 2QA4G 2G4BA 2QZ8A 5HRNA 3L9ZA 3KDOA 4WPAA 1HNZJ 3ENOA 1XR7A 2ILZA 2BVZA 3SPZA 3QFUA 5M1PA 5J2PB 2C3OA 3THVA 1YBTA 2WSEC 3PYFA 1NJXA 3M2UB 1T05B 4EYHB 3DOLB 2DH7A 5JJBA 2HVIA 3MMBB 1NSAA 2NRZA 3QFPA 1WD6A 5I9EB 6AT1B 3THYB 3NWGA 3SJHA 5EWEA 3UR0A 1XMQF 2RNEA 4CJ5A 2M3DA 4L3KA 4YR3A 2LQJA 4JKHA 2E1YA 3IBCB 1CVJA 4YDXA 4ES1A 1RTIA 3R3LA 3BDEA 2F4VJ 3ZT2A 2QMWA 3PJXA 1CQMA 1T0TV 2ZFHA 1S1XA 2CNNB