3DRPA

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drpA05
2V0NA 3CM5A 5KGXA 4ZP6A 1HMVB 4FS1A 3HVAA 4X2BA 2VG7B 4WYLA 4QW8A 3GIKA 1QTMA 1T05B 5KT7A 4FK4A 4M3ZA 1BQNB 3VQQA 1UWBB 2F96A 2GV9A 4FLYA 3QLHA 4Q5VA 3CJ0A 3RMBA 4M3UA 2JEGA 4FLWA 1HYZA 1ZBHA 2XGQA 2YNFA 3TABA 2HNYB 2VG6A 3SQ2A 5EWFA 3QEVA 3N6MA 4DEZA 3OS2A 2HAIA 4N47A 3RB6A 4JRPA 3BSAA 4MKBA 5KFPA 5KG1A 3I5AA 3MECA 3PZPA 4CGDA 5HLFB 5KFAA 2X78A 1GX6A 3DYAA 3NGZA 2DPIA 4WFXA 3L2UA 3BREA 4CECA 3VA3A 3AVGA 3WNHA 4H4MB 5I42B 4ZPCA 3QEXA 3QEPA 4CF2A 1RT2B 1S9GA 2AX1A 4KI6A 1J53A 4BE2A 1SKWA 3DRPA 2W9BB 4FJMA 4CEBA 1REVA 1DTTB 1JLEB 4NCGB 1TKZB 5KFYA 2HVHA 3KKSA 2HNZB 3PO5A 4FJLA 2V9WA 3RR7A 5DQHA 4RU9A 3KHHA 4W5TA 3G86A 3DRSB 2JGUA 3I5BA 4Y3CA 2XY7A 1VSKA 4F2RA 4IH6A 3ASMA 1C0TB 5C24B 1JLCB 5KGWA 4CK3A 4PUOA 1TV6B 2AGQA 4LD0A 3E01B 2JC1A 2BR0A 4C8MA 3HSTB 2W7OA 1B9DA 4QWAA 1S5JA 4KV8B 1HYSB 4J9KA 4RUCA 1T03A 4FBUA 4EZ6A 1O1WA 1X9MA 1K1SA 3TVKA 2DY4A 4DL3A 4IBNA 4NLWA 3ITHA 3OYEA 1BGXT 1D0EA 4AHTA 2YKNA 3Q8PB 4DTSA 5HP1A 4NZ0A 3RBDA 1LWFB 3D28A 4YMEA 1WNEA 4CJ5A 2E9TA 3MEEA 1Y97A 2IM3A 3HP9A 1ASUA 3C6UA 2EX3A 4E7HA 4FJHA 1RDCA 5DG8A 4RW9B 1CZBA 1UAXA 3OS1A 2XWYA 4GC6A 1NKCA 1LWEA 3ISND 5I3UA 5KFHA 4RW7B 4E1MA 2OPQA 3K57A 1JKHA 3TAPA 4M3YA 1KHVA 4CF0A 4MFBA 2G8IA 1RT4B 3SUOA 1NK7A 2P5OA 3KLHA 2WONB 1ASWA 3QLHB 4NRTA 3L2QA 1HPZB 2BANA 3RAXA 2ZE2A 1VSJA 4OPJA 5J2NA 4B08A 1BI4B 1VSHA 3BGRA 4Y2CA 3QZ8A 3HPOA 1QHTA 4EP5A 2ZD1B 2IJNA 3K59A 4ECWA 4E7JA 3T3FA 4CF8A 4FK0A 3KD1E 4QWCA 1B9FA 1A5XA 3DLRA 1IKVB 3NFAA 2IAJA 3KHLA 1YTAA 4ZTFA 3ZSZA 2HHVA 4ID1A 1T94A 1RNHA 3ZSQA 2B4JA 4M41A 3T5JA 4CHPA 1S9GB 1LAWA 1Q8IA 1X9SA 3DI6A 2VA3A 1REVB 3V6DB 4FJ8A 4ED7A 1RT3A 5L1KA 3M9MB 3TAMB 1L3SA 5KFJA 2QV6A 4NRUA 2XC9A 3M8SA 4M3WA 4Q8EA 4KHQA 1C0UB 5T7BA 3QEIA 5FRNA 3H59A 1JIHA 4FJ7A 3D0PA 3DOLB 4IR1A 5HRRA 3PR5B 2YNIA 2AJQA 1JLBB 1IKXB 4J2DA 4CJSA 2R8IA 1RTDB 3OYDA 1WAFA 3F9KA 1ZETA 4J9LA 5CYQA 2C22A 5KFIA 2Q3SA 4CHNA 5L1LA 3KK2A 5KFZA 2LSNA 2KZMA 3OL8A 3MEGA 4JV0A 4YR0A 3AVCA 4E7IA 4WZMA 4DG1A 3NH2A 2YKNB 5CYMA 1VSLA 1TGOA 4JS5A 4R5PA 3OSPA 4J2AA 1BL3A 3IN5A 5KFKA 2WK4A 5T14A 5KFUA 1Q9YA 4ECYA 2E9RX 1BIUA 4DS5A 1LWEB 2HWHA 3UDLA 4JV1A 4CFCA 5I3UB 4DL2A 2OPQB 1S1TA 4PWDA 3TAGA 1XWLA 1EP4B 4G3IA 4MFBB 5DLFA 1HNIB 4ZP9A 2RDIA 1LW2A 4CE9A 1SL0A 2HW3A 4OVLA 1RT1A 3KLHB 2UVUA 5KT2A 4K4YA 1NK6A 5DQIA 4KAIA 3G6YA 2ZE2B 4LH4A 4OLBA 5J2NB 4FZZA 3KMSA 1NNDA 3P5JA 3MF5A 3H4BA 4K4ZA 1TL1B 1BQMA 1S9EA 2B6AB 4O5BA 2R8GA 2RF2A 4KPYA 2HWIA 4K8XA 2HMIB 2IAJB 1MMLA 5C42A 3NL0A 4KHNA 3EPIA 4I7FA 4WFYA 2WOMB 4IFYB 3KLFA 3MR6A 1SKRA 5D3GB 1EXQA 3SCXA 5F8IA 1VSIA 5FDLB 4HHTA 5CY4A 2R2SA 5HROA 1HQUA 4O3PA 5DGBA 3DI6B 1KCFA 1RILA 4DFPA 3MFHA 3O3FA 4H8KA 1TL3A 1RTHA 4WFZA 2F8TA 2HHWA 1TP7A 4RW6B 4B9UA 3OYFA 3DLHA 2G8HA 3M8QB 4MK9A 3HP6A 2FBTA 1VSFA 3KLIA 2ATQA 4M94A 1TQLA 1C1BB 1ZBLA 2YNIB 1HNVB 4EYIB 3TAFA 4B3OA 4NLTA 4M42A 1QSYA 3KK2B 4TYAA 3NGYA 5KG4A 2P51A 3MEGB 2IM0A 3NKYA 1TKXA 5CYMB 3T1AA 1BCMA 3GIMA 1LV5A 1VRTA 3V4IA 2A1SA 4K4XA 5J1EA 1R0AB 1S0OA 3M9NB 3FDSA 3K5LA 1TKTB 3RWUA 3VQBA 3KJVA 3NF8A 4CFBA 3NH0A 2PYJA 5F8NA 3CFOA 3QETA 5KFCA 1S1TB 4ZVHA 4DQIA 4QW9A 1QSLA 3KLGA 5EDWA 2X6NA 4KAZA 1IO2A 3EPGA 2KFZA 4Q0BA 4DS4A 2JEJA 4Z4HA 3MEDA 2ATLA 3V9WA 4CFDA 3V6KA 3U3GA 1IKYB 1QAIA 4ELVA 4IG3A 2V4RA 4LQ9A 5SWMA 3IG1A 1NJYA 3CJ2A 4O4RA 4M3TA 4CFAA 4CJ4A 1S1VA 3RMCA 4Q43A 3VQ6A 2RKIB 1HRHA 3QERA 4RW4A 5KFGA 1F21A 4ELTA 3TAQA 1Z4UA 2J6TA 4RNOA 3OYIA 1BQMB 1S9EB 3IGNA 2ALZA 4ECXA 3OYKA 3N6NA 1WAJA 4DU1A 1ZYQA 1EETA 5C42B 2J6UA 4NLUA 2I5JB 4PY5A 4J9PA 1U04A 4DQSA 3QESA 4CK2A 3O3HA 3KLFB 1U48A 3AVIA 4IR9A 1J5OB 2E6MA 4DQQA 2OPPB 4K50A 3MXJA 5HROB 4DU4A 2AGPA 3PY8A 4F4ZA 3GYNA 4EBDA 4AILC 4FZYA 5KT5A 1FK9A 3KHRA 3SZ2A 4DTXA 3VQ4A 3OHBA 5E41A 3THVA 4K8ZA 1TL3B 4NLRA 2XY5A 3EZUA 3M8RA 1Q9XA 4KHSA 1SL2A 3ZT4A 3PJWA 4B9NA 3NBPA 3G10A 4CIEA 4HUEA 2AQ4A 4DTJA 1XHXA 3GV8B 1S1WA 2FVPA 2BE2A 4IFVB 4YNQA 2BDPA 1LW0B 2R8JA 2D0BA 4CEDA 4KTZA 1QE1A 3NF6A 2HHQA 2WRMA 1J9AA 3B6OA 4KFBA 1NJWA 4TN2A 4E89A 3F73A 3TQ1A 4GMJB 1VSMA 3ISNC 4L8RB 4CEFA 4KB1A 3QGIA 4AH9A 4CJQA 1S6QA 1KHWA 4PQUA 4FLVA 2W9CB 3ICLA 2G8KA 4EBEA 3T5KA 3H40A 3VQ9A 3ZT3A 2B5JA 4MH8A 3GIIA 1N56A 3QGHA 4CJEA 1DTQB 1S1XA 2D5RA 3LP0A 3MAQA 3V4IB 4FM0A 1CSJA 4ED0A 4FLZA 4YFUA 4FJIA 1RYSA 1RT7A 1BHLA 2CJQA 3C6TA 3KJVB 3AA2A 3AVNA 1RA6A 3QINA 2IDOA 1RT6A 4TQSA 5JS1A 4EP4A 2YNHA 1JLQB 2XI2A 4O3SA 4FJNA 3LWLA 2C2DA 2HVIA 2FBVA 4F3TA 5DLGA 2YNGA 4DSFA 4I2QA 5F8MA 1JLFB 3CM6A 3OYNA 3HO1A 1RYRA 4C8NA 3RB4A 3KLEB 4NLQA 4OPKA 4H4OA 2BGGA 1TAUA 4IRKA 4IG3B 1N5YB 2C2EA 2XY8A 3IG1B 4DSEA 3LPUA 4BACA 1IH7A 3L8BA 3KLVA 3TAEA 4CJUA 4MK7A 1HQEA 1NHVA 4RW4B 1QSSA 2OYQA 4DWIA 1X9WA 5KFLA 3CIZA 3PR4A 4IRCA 4MK8A 3T19A 5C25A 1N4LA 4Q44A 3CFPA 4PA1A 3OSNA 1L3TA 1W0HA 3AA3A 4AHVA 2A1RA 4LSLA 4M95A 4DF8A 4AHSA 1A5WA 3CDUA 2P5GA 5SZTA 2QKBA 3VQAA 4ELUA 3LP2B 3FFIB 1TAQA 3TI0A 4LSNB 3RTVA 4O4GA 2ETJA 3K5NA 4DFKA 2HNDB 3CQ8A 4J2BA 4G1QB 1X1PA 3KNAA 4Y1CA 4NLSA 2IMWP 3ZSOA 2XRIA 4E7LA 3EY1A 4ED8A 3NF9A 3IS9A 4W5OA 4KRFA 3FSIA 1S6PA 2GBZA 1I3AA 4BE1A 4IKFA 3NBPB 3MTKA 4HYKA 2G8UA 2EC0A 4RNMA 1S1WB 2BE2B 1QQCA 2OPRA 4AHUA 1A5VA 3NAHA 4NLDA 4EO6A 2R2UA 1JL2A 3ULDA 3VQ7A 2W8KA 2VWKA 3HVTA 4DTMA 3U3YA 4DSJA 5K14A 4U6PA 3KHGA 4FLTA 1LWCA 5CZ2A 3SV4A 4FZXC 3MFIA 3V1QA 4OGEA 2DTUA 2W42A 1S6QB 2ILYA 3DDKA 4FVMA 3AVHA 1RA7A 3CO9A 3ZCMA 1KRPA 2Y1IA 2P1JA 4HUGA 4B9MA 4GW6A 1S1XB 3LP0B 5EU7A 4O0IA 4BE0A 1NK4A 3V1OA 3V81A 3BSOA 4K4VA 4FW1A 4NLOA 2YNFB 3CWJA 1RT7B 4Y34A 5KFMA 3OYJA 1FKOA 2VG6B 4CEAA 4Q45A 3C6TB 4IG0A 2OPSA 4E0DA 1RT6B 2YNHB 3ZT2A 4ICLA 4NCBA 1SV5A 2ASLA 2YNGB 2AGOA 2KZZA 3DLBA 4KO0A 3MECB 3HPHA 2RPIA 4KTQA 4O3RA 3DYAB 2ZQBA 1UA0A 1CZ9A 2Y1JA 3VQ5A 3HL8A 5EWEA 3OY9A 1TK0A 1SH2A 3PX6A 4IH7A 1JLGA 3SI6A 3KK3A 1KLMA 4ZP7A 4W5RA 1GX5A 3DRPB 4O3NA 2XO7A 4LY7A 2F8EX 3H98A 5J2MA 4J9RA 1D8YA 4O3QA 3V9ZA 1K6YA 1ZTWA 4LSLB 1FKPA 4LQ3A 2AX0A 4RW8A 3MR2A 5KG5A 4C8LA 4J9OA 2QK9A 4KB7A 2OH2A 4O4GB 4KHWA 4ZHRA 2XY6A 4F50A 3G6XA 3AVFA 2R8KA 3P83D 2EHGA 4PUOB 4E3SA 3TARA 4R8UA 3M8PA 4IDKA 3NF7A 1KSPA 4URSA 2JEFA 2XGPA 4M3XA 1YT3A 1T03B 5CZ1A 2AWZA 4R0EA 4JV2A 1S6PB 3LALA 5KFSA 3M9OB 2I1RA 4NYZA 4NLGA 3ITHB 2DFFA 4RNHA 2PZSA 5HP1B 1KFDA 1WSEA 1SH0A 3PW2A 4Z4CA 2QXFA 4ZPAA 3MEEB 4ID5A 2JC0A 3KMQA 4Y2AA 4DQPA 3AVAA 3C6UB 1S10A 3HXMA 2VWJA 3AVBA 5HRPA 1SUQA 4IKAA 4EZ9A 4NLPA 4ECTA 2IS3A 1JKHB 2E9ZA 2DFEA 4KI4A 5KFWA 3CDEA 5F9NA 2PY5A 2D0AA 4TQRA 3TWHA 4I2PA 4DL7A 4M45A 4CGFA 3PX4A 4ZVFA 3V81B 1KFSA 4CIFA 2BANB 3FRZA 1FKOB 4JS4A 3ZSWA 1WLJA 3T5LA 1JXEA 3LDSA 3BGRB 3LP1A 4CJTA 4RZRA 4ECUA 4B8CA 4EO8A 3DM2A 1S9FA 4ICLB 2JLEA 4YQWA 3ZSXA 3DRRA 2BQRA 2O5DA 2RDJA 1D9FA 4KO0B 3NH1A 4JRQA 4DSLA 3NMAA 3AO4A 3DLKA 4Z4GA 3AVKA 3PVXA 5KI6A 2GIRA 1NK8A 3H2LA 3QO9A 3K5MA 1DLOA 3L2WA 3QNOA 2UVRA 1B92A 3PJXA 4FCYA 1KLMB 1GOCA 2D7SA 3SQ4A 1VSEA 4W5QA 3JYTA 1WSHA 1RT3B 4U7CA 3OHAA 2FJVA 5EWGA 2Z1IA 3I8DA 1HYVA 4TY8A 4OKEA 3I0SA 1IM4A 2OA8A 4RW8B 3GILA 1D5AA 2C28A 1C2PA 4QPXA 3RMDA 4CGGA 3V9XA 4F8RA 4ZHRB 1ZTTA 4F4YA 4O44A 3JSMA 2X74A 3LAKA 3CJ3A 3D5MA 1C0MA 3KK1A 2WCXA 1YTUA 2R7YA 3LZIA 1RBTA 2W7PA 5CYQB 3H5UA 2RN2A 1XR5A 5KTQA 5J2PA 2GIQA 4AHRA 4KHYA 4K4TA 1RAJA 4FW2A 5DG7A 3I0RA 4DSIA 1QUVA 3S3MA 4RUAA 2FJWA 4DG1B 3NDKA 1I39A 4DL5A 4R5PB 3QGGA 3OVNA 1WSGA 3WNGA 5KFXA 1TVRA 3QZ7A 1XR7A 4FJGA 1HMVA 4Y1DA 4CJ3A 4BDPA 3AVJA 2VG7A 4ECQA 3VQEA 2FVSA 5L9XA 4DTNA 2ASDA 2R2TA 4PWDB 4ZMMA 3NGDA 3SPZA 1UWBA 4CJFA 4NYNA 1JXLA 2FVRA 4HTUA 1HARA 1G15A 4CJWA 1LW2B 2HNYA 1RT1B 2YV0X 1HJRA 4I2PB 3MXIA 4DFJA 4Z4EA 2UUTA 4CEQA 4DTUA 5L1JA 3BQ0A 3C94A 1NOZA 4XPEA 3SFUA 4QCLA 4H54A 5KG0A 1J54A 2WTFA 1ZBFA 3SUNA 1RDAA 3DM2B 2AU0A 3UIQA 1CLQA 2RF2B 3IRXA 3AVLA 4QWEA 3UQSA 1T7PA 2OZSA 4YR2A 3QIPA 4H4MA 5I42A 5FRMA 3DLKB 4I7FB 5KFQA 1RT2A 5C5JA 3RAQA 1WSIA 2VA2A 1DLOB 2W9BA 4XO0A 1JXBA 2KW4A 4CEEA 4TYBA 3OYMA 4NCAA 1DTTA 1JLEA 3KIOA 4OLAA 4EEYA 1HQUB 4DTRA 3DLGA 3DRSA 3AO5A 3K2PA 1RTHB 2BRKA 2ASJA 2WB4A 4TY8B 3I0SB 4JUZA 1C1AA 3U6FA 3VQDA 1ITGA 1U4BA 1S1UA 5FROA 1TV6A 4TLRA 3E01A 5F8JA 5F8GA 3KLIB 5KFEA 4B9SA 1I6JA 1NKBA 1WNSA 4O44B 2ITGA 3JSMB 2KTQA 3CJ4A 4B3OB 1RDRA 4DSKA 4B9VA 4HCBA 5J2PB 4CJLA 3T5HA 3NHGA 4NLXA 3DMJA 1GOBA 1KTQA 4ZPDA 4KHUA 4CGJA 1TKXB 5KRSA 3HYFA 4M3RA 5DK5A 3RR8A 3SUPA 4RW9A 4I9LA 1VRTB 1S4FA 5DGAA 3CVKA 2FLPA 3V6JA 4ED1A 4DLGA 3MXMA 1K1QA 5J1EB 1TVRB 1T8EA 1RDBA 4RW7A 4FLXA 4CESA 4CJRA 1KLNA 2G8FA 4TSXA 1RT4A 3H5SA 2XCAA 5KG7A 1NK5A 3LANA 1RBRA 2IC3A 2WONA 2G8VA 2XCPA 2G8WA 3KLGB 2HHUA 4FJJA 4FJ5A 4DFMA 1HPZA 4Q0BB 5KG6A 3ZT1A 4O3OA 1UOCA 1VRUA 3RMAA 3MEDB 1BI4A 3LWMA 4WE1A 2IGIA 4AHCA 3OL9A 1BIZA 4C8OA 2ZD1A 1N48A 3AA4A 4O55A 4FK2A 1S1VB 4OJRA 1NKEA 5KFBA 3OYGA 3PW4A 4YR3A 1IKVA 4FS2A 3HM9A 3PX0A 4OL8A 1MU2A 3IRXB 4MIAA 4CHQA 1XC9A 1EETB 2XHBA 3QIPB 5KFNA 5F8HA 4TXSA 4FM1A 1VK0A 4ZTJA 1JX4A 1RTIA 4J9NA 2FVQA 4EBCA 1NK9A 5KFOA 3V6DA 3TAMA 3KD5E 4K4SA 3ALYA 3PV8A 1JLAA 1ZBIA 4F4XA 3C95A 1FK9B 3QIOA 3FQKA 3DLGB 4CIGA 1C0UA 3RRHA 3H5YA 3VQSA 3PW0A 4DF4A 4CK1A 3EYZA 4CHOA 1RT5A 1XI1A 4QAGA 3DOLA 4HCCA 1ZBUA 1JLBA 1S1UB 3HVRA 1IKXA 1XR6A 2BRLA 3H4DA 4ZVEA 3LP3A 1RTDA 5KT4A 1C1CA 3CYMA 2Z1HA 3IGVA 3Q8QB 4HKQA 4FJXA 4NLVA 1QE1B 4ED6A 4ED3A 3RB0A 1S97A 3O4QA 3AVMA 4KFBB 3EZ5A 2FLLA 4OKKA 3AO2A 3L3VA 2UUWA 4QWBA 4DTPA 4PQUB 4IH5A 4URQU 1YVUA 1NOYA 1L5UA 3DMJB 2B5JB 3KKRA 4DL4A 4HUFA 1N6QA 1ASVA 3IAYA 3K5OA 1TK8A 4KHMA 3S3NA 3A2FA 4K4WA 3LPTA 2ILZA 2E4LA 3HHKA 2W8LA 1CXUA 3RRGA 1EP4A 1FXXA 1NJZA 1OS5A 1LAVA 1HNIA 3OLAA 3DOKA 4CCHA 1IG9A 2IC3B 1BISA 4UQGA 2IOCA 4I2QB 4Z4FA 4DMNA 4CF1A 5KFFA 4CJKA 1U47A 1JL1A 1VRUB 4F4KA 3H5XA 3CDWA 3B6PA 3SI8A 4IOBA 4WE1B 4KE5A 4H4OB 4N41A 3V9UA 1CXQA 1TL1A 4KTWA 2B6AA 3BQ1A 4KB0A 1HQEB 2KFNA 4ZPBA 1S49A 2HMIA 3BSCA 3HJFA 1RBUA 3NCIA 3BQ2A 5C25B 1MU2B 3BDPA 4DQRA 2WOMA 3HVWA 3GIJA 4IFYA 2IM2A 1WSFA 3ZSRA 3N6LA 5D3GA 4Z4IA 1WSJA 5DQGA 3KTQA 4GVMA 5FDLA 4J9SA 4WYWA 1EX4A 1C6VA 2XI3A 1RTIB 1L3VA 4NYFA 1KVBA 1GOAA 3ZT0A 3K58A 3I5CA 3AO3A 4BDZA 4KREA 3VQCA 1JLAB 5KFVA 5J2QA 2UVVA 2QKKA 4RW6A 4Z0UA 1YVFA 5DMRA 1L3UA 5JUMA 3M8QA 2KQ2A 4BWMA 3DLEA 3IS9B 1D9DA 3BR9A 4E19A 2HHXA 1RT5B 2C2RA 1C1BA 4CGHA 1HNVA 4J9QA 3CG7A 1U09A 3OYBA 1C1CB 2OPRB 4QWDA 2GUIA 4WXWA 4RG8A 3SUQA 1SL1A 1TKDA 3G0ZA 4DU3A 3E51A 3GV5B 4ED2A 4CGIA 4KBIA 3HVTB 4MKAA 4ECRA 3BJYA 2HB5A 5K14B 4KHRA 3RBEA 5JS2A 1LWCB 4IQXA 1BCOA 3OJUA 3SQ1A 2X6SA 3RB3A 3NE6A 1R0AA 3SFGA 2V4QA 1TKTA 2B43A 4ZP8A 1N6QB 4NLYA 5F8LA 3G6VA 1RBVA 3LZJA 2FLNA 4URGA 4CERA 4IG0B 2OPSB 2YHBA 4FXDA 5HRSA 3UPFA 2VG5A 3DOKB 2WHOA 2E6LA 1SV5B 3HPGA 1SKSA 3HKWA 1IKYA 2CKWA 3OJSA 3O4NA 2OZMA 5KG2A 4KKOA 2IM1A 2D0CA 3S9HA 2RKIA 3L3UA 3H08A 2D3ZA 5KRTA 3VA0A 3GQCA 2D41A 1JLGB 3KK3B 4CJPA 4XIUA 3SNNA 3NAIA 5KG3A 1T3NA 1KVCA 3SQ0A 3MR5A 1D1UA 4EYHB 4Q8FA 4E7KA 1S0MA 1TK5A 4C8KA 1RTJA 4CEZA 3CFRA 2I5JA 5J2MB 3O3GA 1IKWA 2FVCA 3ZSVA 4FBTA 1J5OA 1FKPB 2J6SA 2PYLA 2OPPA 4N76A 3L2VA 1RBSA 4F4WA 4F3OA 5KFDA 4B8AB 3SJJA 2O4GA 3PUFA 4RNFA 4B9LA 2ZKUA 4ECSA 5KT6A 4R8UB 3M8PB 5J2QB 4IDKB 3PW5A 4E1NA 2YKMA 2IJFA 3OL7A 3VQ8A 3ZSYA 2FC0A 3NAEA 4RNNA 4OKJA 3QEWA 3DLEB 3SPYA 4IFVA 2DFHA 1LW0A 5HBMA 3NGIA 1Z25A 1W25A 3P1GA 3WNEA 4DL6A 2O4IA 3L2RA 4BWJA 2Z1JA 3VN5A 4ID5B 1U49A 2BQ3A 3SYZA 4WXOA 4IRDA 3QNNA 3OYCA 2R8HA 3HT3A 2W9CA 2UVWA 4CEOA 5EUHA 1SUQB 2JEIA 2HHSA 4N56A 3SV3A 1T05A 5F9LA 1BQNA 2FBXA 3TANA 1DTQA 1RCHA 3OS0A 5L1IA 3OYAA 4ECZA 1NHUA 4JLHA 4LH5A 4QOZB 2R2RA 1KVAA 1W9HA 1S0NA 3VQPA 3V9SA 1JLQA 2Z1GA 2QE5A 1QAJA 3LP1B 5KFRA 4FYDA 2HHTA 1JLFA 3HK2A 4F2SA 5HLFA 2FJXA 3UR0A 2VG5B 1VSDA 1WN7A 2D3UA 2YHAA 3DRRB 3KLEA 3KOAA 2BQUA 4CHYA 3V1RA 1N5YA 3TR8A 3AV9A 5KFTA 3AO1A 4KKOB 3QIDA 2IBKA 4FM2A 5JXSA 3MR3A 3QO9B 4W5NA 3WNFA 4HVJA 4J2EA 4J9MA 4NCGA 1TKZA 4O0JA 5HRNA 1XHZA 2HNZA 4KSEB 1RDDA 3JYTB 2DPJA 1Z26A 1RTJB 3OYLA 4ECVA 4CHZA 4CJVA 4DLEA 1IKWB 3AA5X 4FJ9A 3D45A 3PW7A 3LP2A 3OLBA 3FFIA 4MQ3A 4LSNA 4DTOA 1C0TA 5C24A 4WZQA 1JLCA 2HNDA 4N5SA 4G1QA 3GV7B 4FJKA 4FLUA 5DG9A 3V6HA 2F8SA 4I9QA 3S3OA 1NJXA 2GC8A 4TY9A 4KV8A 1HYSA 3LAMA 2FBYA 5KT3A 1U45A 3QYYA 3PO4A 3CJ5A 3FQLA 1S48A 1NK0A 4K4UA 2YKMB 4XPCA 3KK1B 1UA1A 4YP3A 3Q8SB 3BSNA 3Q8RB 5HBMB 4MIBA 4ZVGA 4GC7A 2W9AA 1LWFA 2NUBA 3PHEA 4CF9A 3I0RB 3OYHA 4B9TA 3OL6A 1QS4A 4BDYA 2IA6A 1EKEA 4OGCA 1SH3A
chains in the Genus database with same CATH superfamily
3O8MA 4DU7A 1RBAA 3TO8A 4ZP6A 2FZGB 3TYTA 5C2FA 4JI7K 4FPBA 3I6PA 3P8BB 2GV1A 4QW8A 8RUCA 3ZEUB 3KVGA 4DMZA 2EPIA 5HI7A 3O5BA 5KT7A 1T6CA 2R42A 4BBYA 1N88A 5SUHA 1UWBB 2GV9A 1TL7B 1YSJA 3Q86A 2CPJA 3RMBA 1K73O 1PBUA 4YOEA 4JKBA 3SQ2A 3QEVA 3W3DA 2JL9A 2D9PA 2LXIA 4LF7K 4JRPA 3BSAA 4DKWA 4UOFA 4LRAA 1F9EB 1GLDG 3I5AA 4JI1J 1GX6A 3CCRS 3NGZA 2DPIA 2B7CB 4LF9F 2DGQA 3DHWC 5AQGA 4H4MB 4ZPCA 3R8YA 3QEXA 2CJKA 3QEPA 3THYB 4ANCA 2W4PA 1S9GA 3W5YA 3P38A 1J53A 4CP5A 3DRPA 3ZZYA 3H0PA 4FJMA 4DUZF 2LU2A 4LF4K 2AKWB 1JLEB 4NI2A 3KKSA 2V9WA 2VDHA 3H3OB 1HBMA 4RU9A 4OZ0A 2XY7A 3GU0A 1VSKA 3ASMA 1H98A 3UI3A 2A6OA 1FDNA 1UZDA 3E01B 2Y0SD 2BR0A 2IIRA 3EE8A 1S5JA 4IEEA 4CT9A 4DV5F 3M6GA 2C2NA 1M1KT 5E33A 4EZ6A 1O1WA 3W8PA 3CJRA 2DY4A 1RU1A 2UXCJ 4RR5A 3ITHA 3OBIA 1D0EA 4DTSA 1ICEB 3ILJA 2N3LA 3QJJA 3O08A 4CJ5A 4CNZA 4RUHA 3MEEA 1S77D 2FHKA 2DGOA 2QLJB 4RW9B 4NXMF 4LBHA 1QVGM 1NKCA 3ISND 4E1MA 4RW7B 2OPQA 2CWXA 3C6AA 4MFBA 2RDDA 4PXBA 3SXLA 3SUOA 1NK7A 5GAEU 3E9PA 4JK7A 1BD6A 4ILHA 1Q53A 1VC5A 1XUPO 4QJVA 4NRTA 4FWQA 1HPZB 3HOTA 1VSJA 2VWBA 2MJUA 4OPJA 1F9FA 4Q2MA 4DCJB 3MMJA 4QR2A 5MLCQ 1FERA 4PG7A 1NM1A 2EI5A 4DPXA 3M6WA 4DR3F 4BHQA 2MGZB 1B9FA 3MXHP 2R7QA 1FFWB 3UCGA 2HHVA 2BA9A 2C3UA 2B4JA 4ZCKA 2QM1A 3D66A 1NGIA 3WZ0A 1N33F 4BC7A 1FVQA 4UZCA 4CHPA 1S9GB 1Q8IA 2V69A 3O1LA 1ZS6A 3THWA 1HKAA 3CC4N 2VA3A 1NSQA 1SS6A 2HIQA 1RT3A 5RUBA 7FDRA 3M9MB 4NMLA 2GX8A 1KQSR 3DHXA 3L4QA 4M3WA 1W26A 4KHQA 5IZHA 3VVUA 3H59A 1JIHA 1RLDA 5M2PA 4WP3A 1SB6A 2VJUA 1IKXB 2ZNZA 2R8IA 3JTOA 3FUYA 3PSIA 3ZZTA 2UUBJ 2ACMA 5B0DA 4M63A 1IJJA 4X4VA 3MCAB 3CCVN 4M5LA 3PYEA 5KFIA 2MDAA 2DY9A 5KFZA 3AXKA 2KXNB 2LSNA 2LQ8A 2BABA 3OL8A 3MEGA 4QYZK 3AVCA 4E7IA 2GCFA 1UPPA 2CDQA 3MMVA 3SBTA 4DUYK 3NH2A 3LPEA 4AF1A 3CIMA 4OX7A 4BRGA 3NNCA 4TLQA 3MHYA 3VZIA 4J2AA 5GAHI 3CGIA 5KFKA 1NH8A 5KFUA 1X4HA 2E1PA 2VGNA 4K2JA 3NNAA 4JV1A 2HWHA 1ZM3A 1IR0A 2OPQB 3TAGA 4USUA 1XWLA 1WKLA 5LMNF 3CO0P 1VOMA 4MFBB 3KWGA 3I32A 5FLXU 2RDIA 2EXUA 4CE9A 4OVLA 3RW6A 2UVUA 1U26A 1OSCA 4TU7A 1K9MO 3MOJB 4OLBA 1G99A 1M90T 5D4OA 1WEYA 4FZZA 3KMSA 2J76E 3MF5A 2WC9A 2E5LJ 4N7TA 3QQCD 4CO2A 2HWIA 1NMNA 1UW9A 3NL0A 3P4IA 3J81j 1VS3A 3EPIA 4I7FA 1BLUA 5ETMA 3DOMB 3J7Z5 4GKKJ 1QJHA 2V8VA 2W2PP 3M6UA 3MWTA 2UUAK 1VSIA 4HHTA 5H1SV 3D2FA 1M5SA 5DGBA 4CM2A 1IBLK 2DTJA 4ZVPB 2R9LA 4DFPA 2HF4A 1DQ8A 3HBTA 2E7VA 4JKEA 3O3FA 2P6SA 2VFSA 2AYGA 1TL3A 3IO1A 1NLVA 1TP7A 1V4SA 1SXLA 2AF6A 2G8HA 3M8QB 1KP6A 2GWJA 2JWNA 1VGYA 2AP1A 2XSFA 3G4SS 2WTUA 4FVCA 3O8WA 4M42A 4DV4J 1TZ0A 3Q2SC 4JKFA 3NGYA 2DCUB 5HANA 2P51A 3MEGB 2EFVA 4A2BA 2W41A 1SQGA 4C48A 3NKYA 1T95A 4OZ3A 3CPEA 3GIMA 3G6ES 5AQUA 2A1SA 1CJUB 4OX9K 3CJ9A 3WC0A 2XMUA 3MPVA 4YB6A 3CMES 2CH6A 3CI5A 3OBWA 3IMQJ 3K89A 1FX4A 3QETA 1U1LA 4ZVHA 4DQIA 2QWMA 3P3DA 1QSLA 2H65B 3KLGA 2EG1A 1IO2A 1S4EA 3EPGA 2HZVA 3OFHA 4PYAA 2CRLA 3DC2A 4ZCIA 1KN6A 2DBBA 4DS4A 3UD4P 1VIXA 3MK6A 3V9WA 2WVDA 4CFDA 3SCIE 2P9LA 3V6KA 3NNHA 2BYCA 1IKYB 1QAIA 2K1RA 5DDRC 4OYIA 4O4RA 4M3TA 4CJ4A 1S1VA 2XZDB 3ZETA 2F8HA 1PCAA 1VQ9N 4C4WA 1OH7A 1Z4UA 2J6TA 1IG8A 4RNOA 3OYIA 3OYKA 1VHXA 4JOUA 1VQLN 2I5JB 3N0VA 2CPHA 3DGPA 1GTEA 4DQSA 3EZOA 2JFDA 3O3HA 1VYAA 2IYIA 4IR9A 1J5OB 4USHA 4K5SA 2OPPB 2MQMA 2ALYB 4K50A 4F0KA 3D2FB 5A8WA 4F4ZA 4EBDA 3ZC4A 2PIIA 3ZTSA 1K44A 4FSVA 4U9RA 3IWXA 3VQ4A 3PXGa 3JAMY 2XLIA 4K8ZA 1TL3B 2E5IA 2X1AA 4CLUA 2GVZB 3ZT4A 5GIOA 3G10A 4CIEA 1LFPA 1FDDA 4DTJA 2P5VA 5A2QY 4IFVB 4QIFA 4YNQA 1MWKA 5CZVA 2R8JA 1N32J 2YCHA 3R5BA 3PTWA 3TA2A 3QJLA 3VENA 1NJWA 5AQRA 4JI1K 5B0AA 1VK8A 4GMJB 5ETRA 4CJQA 1KHWA 2Z56B 2W9CB 4ED5A 2G8KA 4EBEA 1RABB 3H40A 2B5JA 4KY3A 2MMYA 1Q81T 4B3MJ 1S1XA 4FM0A 2P9NA 3O2IA 2R7WA 1GEHA 3D1OA 3MMCA 3C6TA 2QRRA 4Z2XA 3P39A 2ZOGA 3AVNA 2IDOA 2E7XA 2XI2A 3LWLA 2FBVA 2Y3YA 4X62F 2W6KA 4I2QA 5F8MA 3PFOA 5JJBA 2ZZNA 2E2NA 3R3TA 1RISA 3BGFA 3OTCA 1RYRA 5M1QA 3ZZRA 2HQFA 4PG4A 3LF0A 4OPKA 4RBTA 1TAUA 2K1RB 2YPYA 2XY8A 1RAIB 1CJTB 1JK9B 4DSEA 4BACA 1IH7A 5E26A 1UWAA 3ZETB 1NHVA 4ZVTB 2UXCK 2OYQA 2F9TA 1KAZA 2BTFA 3PR4A 4IRCA 2WW4A 2OANA 3JS6A 3NS7B 3NP5A 3HHEA 3OSNA 2EFPA 2MQPA 1L3TA 3D7SB 1N5TA 2HBZB 2A1RA 2FSKA 4M8LA 3MPDA 3CCLS 3DGPB 2BJ8A 3MAHA 3FEZA 1NPRA 2VPZB 2QKBA 3BEGB 4ELUA 3SAHA 3FFIB 1TAQA 4O4GA 1X7VA 4DFKA 4R25A 1ZA1B 4OZ5A 1YZ7A 2R7TA 1JJ2M 1WUAA 2IMWP 3ZSOA 4QU6A 4FVUA 1I5OB 3CHWA 3NF9A 5F41A 1SAZA 4QOTA 3HI9A 1I3AA 4JV5J 1OH6A 4NOHA 1F5AA 2OPRA 5LXYA 5E2QA 3GIRA 1GXUA 1FNOA 1K0VA 3TUZC 2ZH7A 3DNCA 4EO6A 3D6RA 3ULDA 2KH9A 1X5TA 3HVTA 3D3CJ 1FRHA 1LWCA 2OD4A 3OBYA 3FCVA 2ERRA 4GY2B 1UJ4A 3DDKA 2F7TA 5FPMA 3FEXB 3VEYA 1KRPA 2P1JA 2XHCA 1S1XB 1DHMA 4PWWA 3HSJA 3BSOA 4LF5J 4FOEA 4M5DB 4NLOA 2WVCA 3CWJA 3C6TB 2VKZG 4I4BA 2OPSA 1YBAA 1UEVA 2XNRA 4JD2A 3A12A 1JWWA 2KDOA 1SV5A 2ASLA 4GKJF 3VR1A 3CCQN 1NGJA 1FXRA 2ZQBA 4JYAJ 1UA0A 1FDBA 3TW0A 2MB0B 1VQ6S 1VQPN 2M7SA 5EWEA 2P2CB 3O80A 4WPAA 1V3SA 4IH7A 1E4GT 1R7IA 2DNLA 4W5RA 2GJIA 1O13A 3MN7A 4EU0A 4LY7A 1QY7A 3R5CA 1KAXA 4J9RA 3BP8A 4JI8K 3CJKB 2DNPA 3KWMA 3OR2A 2HVEA 4LQ3A 2MHNA 5D77A 2KVIA 4F02A 1WDDA 4A8XA 4J9OA 2D4WA 4CRJA 4O4GB 4KHWA 1VQMN 1IWGA 3G6XA 2R8KA 2KLAA 2EHGA 2HRTA 2R7VA 5CCMA 3TARA 3X1LB 2BVZA 1FTCA 4LF9J 3M4XA 2XGPA 1C0FA 1T9WA 2MQOA 2J4RA 4JV2A 4HDHA 3M2RB 3WUHA 4DUZJ 4UY8O 3MMBA 2KVQE 5LMUK 3NWGA 4EK2A 1N0UA 1IBKF 3PW2A 2QXFA 3P5BP 4IFEA 4Y2AA 4V19X 4DQPA 3SSSA 3AVBA 1FKAF 3ZLJA 5HRPA 2CQHA 1KVJA 3OV7A 4GKKK 1HNXF 2LA4A 3ENOA 3QWUA 2E88A 4DV5J 2D0AA 3TEHB 5JLFA 1TUYA 3A0IX 3FRZA 4C9DA 4JS4A 1U2RA 1WLJA 3T5LA 1JXEA 3LDSA 3ULEB 3LP1A 5B0CA 2PEBA 2GMJA 4ECUA 4B8CA 1W7AA 3TA0A 1S9FA 2CJYB 2CGLA 3DRRA 2BQRA 1BXNA 5AE3A 4JI4F 1NGGA 4NXMJ 4DSLA 2MTLA 1FXLA 2U1AA 4Z4GA 3W5ZA 2RAQA 5KI6A 3QO9A 3L2WA 5CD4A 3BUZB 4FCYA 4DV4K 3D2WA 1GOCA 3N28A 4C0HA 3GJTB 2HFZA 2U2FA 1SQFA 1NG9A 4FF2A 4KHPF 2Z1IA 3MOZA 2E1YA 1NMEB 1WHYA 4HT5A 4JI3F 3OR2B 1WG5A 4DR2F 2PE8A 2BKNA 4WQ5C 2OA8A 4NXNK 5AXLA 3BZQA 3CEDA 3QT5A 5IT9O 1YJ7A 1UTAA 4DR3J 3TWZA 3JSMA 4N77A 3CJ3A 2AD9A 2KI2A 3KK1A 3VF2A 2WCXA 2KJVA 2R7YA 1RBTA 5CYQB 1N33J 2RN2A 5KTQA 1GQEA 3ENAA 4JBCA 2GIQA 4KHYA 5DG7A 3D2EA 3FVYA 1LCUA 4RUAA 5CABA 4B1VA 2DNMA 4MMOA 2BBEA 4DL5A 4M1KA 3QGGA 3CNQP 1Q86T 1T9VA 2C2MB 3OVNA 3ZO7A 1TVRA 3QZ7A 3P31A 1WUUA 3LGHA 4CJ3A 2RE2A 1MLAA 5L9XA 5EOYA 4DTNA 1KKHA 4DDFA 2R2TA 2QWOA 4PWDB 1CC7A 4DXLA 4X64F 3NGDA 5AJ3K 2EFGA 4NYNA 1JXLA 2DGSA 2IVNA 2HNYA 4MYTA 1RT1B 1RE1B 1R8PA 4DX7A 2W40A 1QVFM 2NZCA 2LQ9A 3MXIA 3CCSS 3MM5A 1Y4ZB 4Y28C 2XS5A 4CEQA 3BQ0A 4UZBA 3EICA 3Q2TC 4F0HA 2JDJA 4QCLA 3QFWA 1RAAB 2CJBA 2P8IA 3IP0A 5B0FA 3EWGA 2CZ9A 2WSEC 3UIQA 5GAHP 1CLQA 4L3KA 4L74A 3DLJA 1T9UA 5D0EA 2H48B 1GLFO 1JCEA 2RUGA 4YR2A 3QIPA 5FRMA 1QAYA 4DV0F 3RAQA 1MN7A 5DDPC 4XO0A 1SJQA 4TYBA 5LMNJ 4U8VA 3OYMA 1R0CB 1HQUB 3ILLA 4AL5A 3VAIA 4B3MK 3W65A 4UW2A 3T6BA 2JWLA 4NZ7A 2V7ZA 4ZVSB 3VQDA 1U4BA 3PIPQ 2J7WA 2MKJA 4BY9C 1TV6A 4TLRA 2NRXA 2YHXA 4FPIA 5AXMA 2P9KA 1SVDA 4DL0C 2MQQA 1NKBA 3G8SA 3CJAA 3W2WA 3JSMB 3ENHA 3CMQA 4B9VA 1S6OA 4HCBA 3BO4A 1WD6A 2CJ9A 1SJFA 1KTQA 4KHUA 1TKXB 3CC2S 3C66A 5DM7Q 4LRBA 4I1TA 4PG5A 3FMWA 1U24A 3F44A 1RKIA 4RX6A 2HK2A 5J1EB 5AQVA 1TVRB 2E20A 4H5RA 2HS0A 4N8NA 2ZWHA 3LTOA 1M0SA 4BRDA 1XNRK 1RT4A 2VBXA 3O6QA 1NK5A 1EWRA 2RMLA 3LANA 2IC3A 4H4KA 3UN5A 2ZJQL 3H3NO 4NASA 2HHUA 2NSCA 2DRBA 3B78A 3AJDA 1VRUA 1RLCL 3MM5B 3LWMA 3BF4A 4GVBB 2ZD1A 1VC6A 1NH7A 2CPIA 2L9DA 2M52A 4X4TA 4C1NK 5KFBA 2KN4A 3OYGA 3GJQB 5BYQA 5IV4A 3C6HA 4JV5K 3AFGA 4J9UE 1MU2A 2CGJA 3FZKA 1WDTA 1EETB 4DR5F 3QIPB 2IRUA 4Z7YA 2AW0A 2QEXN 5LL6d 4J9NA 4EBCA 3KD5E 4K2XA 1FE4A 3OVAA 1PC5A 5HVHA 1Z05A 3C95A 2DGXA 3QIOA 2AP6A 2VQFF 1X31C 4DF4A 3VGKA 1BWEA 5HAOA 1FRKA 5EX5A 4E98A 4CHOA 1RT5A 1XI1A 3ID8A 4B1WB 4LF5K 3HHLA 4HCCA 1JLBA 4ZITA 5ELZA 3HULA 4HKQA 1QVGR 4FJXA 4FL9A 3DXKA 1CJVB 1QE1B 4ED6A 5FD1A 3I55N 1B4SA 4KFBB 1BA0A 4DN9A 4NMXA 2FLLA 4OKKA 3A3NB 2VQEF 1HR0K 3MM8A 1XMOK 1G1XA 3AO2A 1YJTA 3MCNA 5ADZA 2EC2A 5JMNA 1IR1A 3C15A 5J1PA 1QHAA 2DH7A 1ASVA 3K5OA 1EHWA 2YQ3A 2ZH9A 3HHKA 2APOA 2W8LA 2BACA 1EP4A 3ZNJ1 1LAVA 3EKUA 4DPUA 3D0IE 3DOKA 4OZNA 2IC3B 4WU2A 1Q1KA 4DMNA 3R2CJ 2JRSA 5KFFA 2HHHK 4CLYA 1VRUB 3CDWA 4IOBA 4UT4A 1ULRA 4JI5K 2I38A 4KTWA 2KFNA 5LL6Z 2XMVA 1K8KA 1S49A 3HJFA 1RBUA 2NXUA 3M6XA 1MU2B 3GIJA 4IFYA 2IM2A 3ZSRA 4JB8B 3N6LA 4Z4IA 5FDLA 3D67A 4CO5A 1RAHB 3IFEA 2B8QA 3WHIA 4WYWA 4J37A 1NU0A 1X5PA 2HBLA 1T11A 4CWBA 5E5NA 4NYFA 4X62J 4YDDB 5GMDA 3CC4S 3ZT0A 2VBYA 3NEKA 2MXYA 4O8UA 3K58A 3PACA 2Q2RA 3VQCA 2E5GA 2QKKA 4DR1F 3OTOK 1MW7A 4Z0UA 5EY4A 1BHNA 4BR7A 4A8WA 4DV5K 2KQ2A 3IS9B 4WFNL 5GVQA 1RT5B 3G87A 2YJFA 2J7UA 4J9QA 4WBFA 2LA6A 2NCKL 3KKFA 1YG0A 1TKDA 3G0ZA 2UUCK 9RUBA 1UKUA 3CCVS 4MKAA 3LDNA 4CO1A 3AGRA 1UZHA 3R5GA 4KHRA 3W2VB 3FLCO 5JS2A 2AJ1A 4DPWA 3EUNA 4CLPA 3QBXA 2PO4A 1FWKA 4JP8A 3QMQA 3SQ1A 2G13A 3M8WA 5L9NA 3C15B 5AQQA 2B43A 4G1PA 4U96A 4NLYA 3NCQA 3SQOP 2CQBA 1HFEL 2BXJA 3G6VA 3ENQA 3FSYA 2ZH3A 2YHBA 1WI8A 2CQ1A 3GTYX 2HIYA 2HRYA 3R7SB 3F5TA 2VG5A 3DOKB 4NA2A 1CZAN 5DO2A 1YKWA 5A8RA 3HKWA 1FRXA 3H2VE 1FHTA 5KG2A 1NZAA 3H08A 3AOAA 4GV9A 1JLGB 4HLBA 5KG3A 3VEVA 4E7KA 3WT0A 3HDSA 4HTLA 2C3PA 3MX2A 5IT9U 1IKWA 4Y65A 3E8OA 4PKHA 1WHXA 4X65F 1LOTB 4ZS6A 2BJ3A 1QD1A 3SJJA 3AARA 2CH5A 4GKJJ 4CQ1A 2O8EA 2GMLA 4M7XA 2QYGA 4JN4A 3AD9C 2ZKUA 3THTA 4CYUA 4MLEA 4IDKB 1OSDA 4USIA 5ETNA 1LOUA 4OKJA 3QEWA 2ZOFA 1U7LA 2COLA 2G4BA 2DFHA 2ZH2A 3QRRA 1IN0A 1RAFB 3TSUA 2AJ4A 4IUFA 3MCPA 2P9EA 4ZPVR 2GHWA 2RSQA 4QIEA 3WEEA 2A41A 3L2RA 5D4NA 1KEKA 3M2UA 2Q3PA 4ID5B 1U25A 3E66A 1HHSA 1WEZA 2J8AA 1ZZFA 3QATA 4IRDA 2R8HA 3IC1A 4CEOA 1LXJA 2HHSA 5M1NA 5D0GA 1T05A 1BQNA 2V34A 2B4VA 5A0YB 2DXFA 4Z7CA 1VDHA 4QOZB 3ZZUA 1W9HA 5EVZA 3NGTA 1S0NA 5AQLA 3ILIA 1VISA 3VQPA 3AH6A 1OQ3A 3SMPA 3W0LA 1QAJA 1RK8A 4ENOA 4KIAA 4P75A 1TR0A 3HK2A 4USVA 2VG5B 2PMHA 1IBKJ 1VSDA 2WFBA 1WN7A 4NWBA 3UN3A 5A8RB 2ADCA 2BQUA 4CHYA 3TR8A 3AV9A 2L9WA 3AO1A 2BMBA 5AZIA 2IBKA 3PYFA 5H9FK 3CULA 2OELA 3MR3A 2VBWA 2MZRA 1HNXJ 1VQ9S 1JXVA 1SC6A 3G2XA 4J9MA 2YX1A 2Q36A 5CYJA 1U6ZA 2EG2A 2NXJA 2DPJA 1XBWA 3OYLA 1IKWB 1MMNA 2B9YA 3U1NA 4FJ9A 4B3SK 3J7YI 2HFOA 3TVZA 3HSDA 4LSNA 2VH7A 4F3MA 2HNDA 4N5SA 4G1QA 1OPZA 4FJKA 3GYGA 2F8SA 4A8YA 4IOCL 4JI4J 3S3OA 1KVKA 2KYXA 2O8EB 2NUHA 3PO4A 2HS3A 4QU7A 1KD1T 3GWCA 1FWLA 3OR1A 4XPCA 1RDUA 4IEIA 3VEOA 3LL3A 1NDKA 2WVFA 3KG0A 1M5OC 4HHUA 3ELHA 3Q0AA 3D68A 4ZVGA 2CGKA 3PHEA 2A5XA 3I0RB 1FA0A 1IQZA 2MHEA 3OL6A 2VUGA 2IA6A 3KUHA 3H6EA 4AD6A 4KHPJ 4CT8A 3S6EA 2V0NA 4ISGA 4PYDA 4JI3J 4DR2J 1AT1B 2HFNA 2YWGA 3A4TA 3GIKA 1QTMA 1ILYA 1T05B 4FK4A 4M3ZA 1BQNB 3VQQA 1UJ6A 2QWNA 3QLHA 4PRFA 4Q5VA 2YNFA 4YDUC 1EQ0A 3TABA 2Z57B 2VG6A 2QTDA 1R8AA 5EWFA 3IBWA 4DEZA 3OS2A 2HAIA 2NUUG 5IFMA 3W9HA 4KQZA 5F1XA 5JMVA 3HZEA 5KFPA 4Y2KA 5KG1A 2RQ4A 1HKCA 3FZFA 3MECA 3C3LA 4ZLPA 4Y6IA 5KFAA 2X78A 3DYAA 3R2DJ 1KS2A 3GG0A 3L2UA 5AQNA 2QIFA 3S01A 2WB1D 4CF2A 2AX1A 3GMGA 1JJ2R 3TOQA 2ZGZA 3TZZA 1YGYA 4OYBA 2YKAA 4X64J 2A3JA 4ILRA 4CLFA 2Q0RA 1DTTB 1DQAA 2HFUA 5DQHA 3KHHA 4IO9Q 1UL3A 4W5TA 3G86A 3DRSB 4Y3CA 4ZLLA 4ZVQB 2AT1B 4F2RA 2MQLA 2KKHA 3HHDA 4YHHK 3VEXA 1N36K 3J7ZT 4CK3A 4PUOA 2PFDA 3NVKA 4CI6A 2JC1A 4C8MA 4C6AA 2EK1A 3HSTB 2W7OA 4QWAA 5DM6L 4RUCA 2N82B 1U8SA 5DZ6A 1T03A 1S7IA 1N5SA 2F1FA 3TVKA 4DV0J 2RIJA 4OFZA 3DXSX 4NLWA 5U47A 4OYXA 4CTAB 4WFAL 4W92B 2FQQB 4AHTA 3B4DA 5HP1A 2AEJA 3D28A 1WNEA 2XTJP 3UWTA 4WIQA 5GADI 2FGOA 3E9OA 1WOSA 1ASUA 3HP9A 3C6UA 1T6DA 2EX3A 4FJHA 1RDCA 1SIZA 3R6GB 1J27A 3ENVA 4V1Ak 3FC9A 1LWEA 5KFHA 5F0UA 2B9XA 4M3YA 2Z2LA 1KHVA 3MD1A 1HBOA 2OMLA 3W61A 4DOZA 2WONB 2NREA 3AGKA 2HVZA 3FJ2A 1NB7A 2RHKA 3QLHB 2I0XA 4L3NA 1FWPA 4YY3F 4X62K 2VFRA 2QMWA 2P9UA 3L2QA 2MY8A 3RAXA 3WXLA 1BI4B 3BGRA 2DHSA 3QZ8A 5E3CA 2HGLA 4NL5A 2IJNA 5DS7A 1FNMA 2R3VA 3T3FA 4FK0A 3KD1E 2IAJA 3RZAA 3KHLA 3CCQS 5LT5A 4OQJA 2XYPB 2A1BA 1RNHA 3ZSQA 3Q83A 1DKGD 2IDEA 3AD8C 3M2VA 1HNZF 1VQPS 3T5JA 5L46A 1NM2A 2DK2A 2QXLA 1LAWA 1FD8A 3DI6A 2XZWA 4I6MA 4FJ8A 4AM6A 1OY8A 3UCZP 2J0WA 5KFJA 3NWRA 4PQAA 5C7PA 2XC9A 3SSRA 1C0UB 2HQGA 3PKYA 1W2IA 1XQIA 2AYMA 4F36A 3D0PA 4Y0FA 3MX5A 1VQNN 3DOLB 3PR5B 3G8TA 1K8AO 2AJQA 1MWYA 1VQMS 2WBNA 5B09A 1RTDB 1XNQF 2A6MA 5B0EA 2IJRA 4J9LA 4ZJOA 4DR5J 4PKDB 3KK2A 4IOCQ 1KQSM 4JV0A 2F9WA 1OY9A 4PG6A 1R8BA 2R7SA 3I56N 3MTJA 1XERA 5CYMA 3A5MC 4CZHA 4R5PA 3H42A 5BPLA 3CIPA 1HI1A 2Y1RI 2VQFJ 4P72A 1Q9YA 2N7YA 2NNWA 4HL9A 1DFDA 1LWEB 4G65A 4KH4A 4DL2A 2XYGB 3T7ZA 3GLJA 3IXQA 4A2AA 5BPNA 2UU9F 2G2OA 1R3NA 1HNIB 5IC6B 2QL5B 3T69A 1LW2A 2HW3A 3DWLA 5K8MA 2RHSB 3QFPA 4XEIA 2DR7A 4GKJK 4K4YA 4C3LA 4KAIA 3CCJN 4JI0K 4L6V3 3T1YF 2VQEJ 4HVZA 2J7KA 5KPTA 4LFAF 2Q43A 1NNDA 2XLKA 3H4BA 4HDGA 1TL1B 4EFHA 3GFYA 4O5BA 2RF2A 4GNIA 2CQ4A 1PYTA 3UDCA 4KPYA 1HKGA 5F0WA 1JNRB 1YHQN 2IAJB 5C42A 1F6TA 4W98A 4WFYA 2WOMB 3VVTA 1SKRA 2RT3A 5D3GB 4A5BA 2NLXA 1EXQA 3SCXA 4DV2F 5BR8K 2Q6BA 2X3GA 5HROA 1R8CA 4O3PA 3DI6B 1RDWX 4DV6F 3K0SA 5DJBA 5GAEI 4DUTA 2CZVC 1YRXA 1RTHA 2J0SD 4CBUA 2HHWA 2BJDA 4BVPA 4D3GA 4RW6B 3DLHA 2CQ2A 1ELOA 4P71A 5EX3A 1NGCA 1H6KX 1I94K 1B7YB 1VSFA 3C8YA 2DNZA 1MROB 5CAAA 5IS2A 4M94A 3FR0A 1TQLA 1ZBLA 1AXQA 4W90B 1HNVB 2ZBRA 1UVLA 1XN9A 5G4DA 4RCHA 3H2UB 4EYIB 2HLUA 3HFVA 1NGAA 4B3OA 1NDCA 1ZAWA 4BC9A 1Q8LA 1IBKK 2MZTA 3GE1A 3KK2B 5KQDA 2YHYA 5KG4A 2IM0A 2NRWA 5CYMB 2H5JB 2MYFA 5JICA 6AT1B 3V4IA 2RILA 4CW7B 4DR1J 5AZJA 3K5LA 1TKTB 5LSRA 3NMRA 2HWTA 2V2QA 5CR4A 3KJVA 1VIOA 4CFBA 3Q23A 2PYJA 5F8NA 4FKYA 3EGVA 4JKHA 2QLXA 4NZ6A 4KAZA 3KXDA 3U1MA 1B0TA 2H5EA 4Q0BA 1TMJA 1X4EA 4X4OA 1Q7LB 1XMQK 4P74A 3MEDA 1CULA 4JI4K 4OYWA 4BCAA 1VLYA 4YB1P 3IG1A 1NJYA 1FFGB 3LA0A 3QT7A 2QFJA 3RMCA 3SAGA 2PEHA 4OI0A 2CNNB 1HRHA 3QERA 5KFGA 2XMJA 3PDNA 3NOGA 5K9FA 4ECXA 4USTA 1Y11A 3UKRA 2DNYA 4WKRA 2HK3A 5C42B 1NEEA 4LSZB 4XK8C 5B08A 5AQXA 3TRGA 4CK2A 4KHPK 1U48A 1R31A 4I56A 4DR2K 5HROB 4DX8H 3PFEA 3AJ1A 3GYNA 1VR6A 3AB4B 4AM7A 4FZYA 2YWHA 2KHOA 4DTXA 2QA1A 2N4CA 5E41A 4ATNA 4JI6K 1X4GA 1Q9XA 4KHSA 3TX8A 4B9NA 1IBMK 3Q8VA 4HUEA 1XHXA 3GV8B 2DGUA 4FYWB 1J5EF 4KTZA 4L72B 3NF6A 5GAGP 3FK4A 3B6OA 1RACB 2Y0BB 1PG5B 4EGLA 4TN2A 4WF9L 3DRYA 4L8RB 4CEFA 4X65J 1GNKA 3QGIA 4F04B 1S6QA 1UVKA 4ETZA 2L3MA 4MH8A 3GIIA 1FJGF 3Q7BA 3QGHA 1JCFA 3JXOA 4CJEA 4IOAL 4YEAA 3NGRA 1DTQB 2KO1A 4H0YB 3LM2A 4PPDA 3LP0A 3MAQA 3V4IB 5DRKA 1VQ8N 1KC8T 3CF5Q 4ED0A 5AZJB 3EX7B 4O8KA 4FLZA 1RT7A 3KJVB 1PAEX 1AA1B 1RA6A 3QINA 1RT6A 4TQSA 3QPIA 5JS1A 2YNHA 4I68A 4O3SA 4FJNA 2HVIA 1ZOTA 4F3TA 4CLZA 2RVJA 5K8PA 2YNGA 4FOIA 1JLFB 4DZ6A 2KM8B 2YQ1A 4KH5A 3OYNA 4L76A 5DZ7A 2ZHAA 4C8NA 1FRMA 1RI7A 3KLEB 2EK6A 4H4OA 1N5YB 1FW6A 3TJ8A 3IG1B 4DV3F 3KLVA 2UXDF 3TAEA 1B0VA 4MK7A 1HQEA 5AQIA 3B6BA 5D4PA 4DWIA 1X9WA 2FJAB 4OYZA 3O6WA 2WBMA 1Q79A 4ANDA 1N4LA 1YJRA 4K8RA 4U8YA 4PA1A 3VALA 1W0HA 4F4AA 5H9EJ 3BF1A 1BU6O 4LSLA 4M95A 2VONA 5KPRA 3BV8A 3CDUA 2P5GA 4I0WA 3UD3P 3KJNB 5B7WA 2QEXS 2RB7A 3LP2B 3TI0A 3TZYA 3K5NA 4IJNA 3CQ8A 4J2BA 1WELA 1FRJA 2CNOB 1X1PA 1S3XA 5AE1A 1T3VA 4NLSA 2O8BA 3N4QA 4E7LA 3EY1A 4ED8A 1IWAA 3RRKA 4W5OA 3FSIA 2ZH1A 2B3TB 4M5GA 2GBZA 4BE1A 4RTFD 4HYKA 4BVOA 2YX4A 3MM9B 4RWXA 1FNXH 3CMAN 3P45B 4AHUA 4LRCA 3IMXA 2OTJN 5A8KA 3KJQB 2GEMA 4NLDA 2R2UA 2G9OA 3MMAA 1M1GA 3TUIC 2W8KA 3I55S 3FMBA 4DSJA 4O5FA 3J7YP 3A8KA 5CZ2A 3SV4A 3MFIA 1S6QB 1GLLO 4FVMA 3AY0A 1RA7A 3CO9A 3ZCMA 4NB4A 3HKZD 4B9MA 3LP0B 5EU7A 4O0IA 1NK4A 3V1OA 2E7WA 3ZYYX 1WKKA 4FW1A 4LF6K 4K25A 2LEPA 1RT7B 1U6BA 4Q45A 4IG0A 4E0DA 3BH6B 1RT6B 4MKYA 2YNHB 4ICLA 3ZFVA 2C2KB 2YNGB 2AGOA 4XDDA 4KO0A 2RPIA 3T41A 4DCPB 3DN9A 3IDHA 1CZ9A 2Y1JA 3IUCA 3KK3A 4DR5K 2GELA 1GX5A 2XO7A 1DY3A 2V63A 4P7TA 4O3QA 3F9MA 5DDQC 1O0PA 2GJFA 4K59A 1VQOS 4LSLB 1FKPA 1K73T 2QWQA 4C98A 2QI2A 2VQFK 4OI2A 1N5QA 3M32A 3MM6A 2LCWA 4C8LA 3VTHA 4WFBQ 4JKDA 2KFYA 4H0TB 4LFBK 3R7BB 4F50A 3AVFA 2LP4A 2QSFA 4R8UA 3M8PA 3NF7A 2MZSA 3I9ZA 1JNZB 2JEFA 4DQ8A 1H2VZ 4M3XA 2LLZA 4R0EA 2QW9A 4USJC 1AZSB 2YWEA 2I1RA 4NYZA 3LPYA 4NLGA 1EKRA 3QSIA 2DFFA 3SQGB 3N4PA 3UR3C 2NRZA 4FN5A 1SH0A 2FHOB 2GHPA 4Z4CA 3NOCA 2OUGA 3JB9k 1V5VA 3SMSA 5TKWA 3MMAB 5IWAF 3WXKA 5ETQA 4DU8A 1YK9A 4IKAA 1JKHB 2E9ZA 3MN6A 5BXIA 5GIPA 4KI4A 4LF8F 1LQ9A 3CDEA 3LDQA 1KQFB 3BO3A 5F9NA 2PY5A 4M45A 4CGFA 5E84A 1KFSA 2BANB 2DH9A 1I3OB 1NJIO 1HLUA 1YF5L 4EO8A 5GADP 4ICLB 2JLEA 3ZSXA 5AQSA 1X5OA 2HZCA 2RDJA 2OLWA 1D9FA 4KO0B 3NH1A 2KB2A 2QZ8A 3TVYA 1BWVA 1Q78A 3GCXP 4EI2A 3HTVA 4OI4A 3UE2A 4JHDB 1KDNA 4EFAC 4G1IA 3OTBA 3SQ4A 1VSEA 4CZMA 2HGMA 1SC1B 4AE5A 3JYTA 3WX4A 3T1HF 4YY3J 2FDNA 3EGWB 1TUWA 4BR4A 3OD2A 4MT1A 5EWGA 3I8DA 1IUJA 2MZ1A 1H7XA 2E1AA 3I0SA 4DR1K 4DR7F 3L6QA 1D5AA 4KH0B 4QR0A 3MM6B 1C2PA 1F2GA 2M2BA 2YX7A 1MG7A 4BGBA 3FBFA 4MJKA 1GLCG 4X4RA 4WQ4C 2QLFB 1Z1ZA 4F4YA 4ETXA 2EWSA 3LAKA 4BRPA 1GXTA 3UKUA 4LBPA 1BG3A 1X4AA 2ZC3A 3TZWA 3LZIA 1G3OA 1HNZJ 3P96A 4A8MP 5J2PA 3EM1A 4K4TA 2BX6A 1HWKA 1A6LA 4M5MA 3GBTA 3CTRA 2FJWA 4DG1B 3QT6A 2I7PA 1I39A 4QR1A 3UVJB 2CA9A 2ASMA 3J81U 3WNGA 5AQWA 3JTNA 2XZTB 4Y1DA 1YJVA 4IQMA 3AVJA 2A10A 3SDEA 3IAM9 4M5HA 2DCLA 3VQEA 3ZEUA 2Q97A 3QDKA 4ZCLA 2IDLA 1FF2A 4OO1J 2XMWA 4ZMMA 1AUDA 1UWBA 1XNQJ 4E8UA 3CJ8A 4K42A 2GIFA 2VPYB 5B8HA 2OSRA 3ID6A 4CJWA 1G15A 4MKVA 3US5A 3SSQA 3IR5B 5FPEA 4LF7F 2UUTA 2MKHA 3C94A 1NOZA 2WSFC 3P49B 3A3OB 2H4WB 4H54A 5KG0A 2RU3A 4AT1B 1ZBFA 2J0QD 3SUNA 4OHZA 1RDAA 3DKDA 4GRSA 2AU0A 2MEWA 3V4MA 2DRDA 1KAYA 2AJFE 1BO5O 2MZJA 2OZSA 3P6YC 1HA1A 4H4MA 4TVAB 1U2CA 5C5JA 5HN0A 1Q8KA 2IA0A 3CW2C 1Y3KA 1OVQA 2UU9J 1JLEA 1ATSA 3JQKA 3MAAB 4C3KA 2K7JA 5KPZA 2C3MA 3AO5A 4K43A 2YY3A 2BRKA 2HPUA 2ASJA 3T1YJ 1R0BG 2LKZA 4X4NA 3I0SB 4LFAJ 4JUZA 1C1AA 3U6FA 3LM9A 1ITGA 1W2BR 1RWWB 1S1UA 4OLOA 5FROA 2E5HA 3E01A 5F8GA 3KLIB 3QICA 4B9SA 1I6JA 2Y1LB 1KNZA 1E6VB 3M3ZA 1I1GA 5M1PA 2KTQA 1LFWA 1SJ4P 3UKUB 6FDRA 4ZN3A 2MQNA 4QIGA 1RJJA 3AA9A 4DV2J 5J2PB 4CJLA 3NHGA 3BKTA 3SJHA 4YOWA 4NLXA 3S7RA 3DMJA 1GOBA 1VQKS 4DV6J 4CGJA 5KRSA 5GAEP 3HYFA 3RR8A 3CCWA 4RW9A 4OYOA 4I9LA 1VRTB 1S4FA 4WCEQ 4JYAF 4V19S 4ED1A 3MM7B 4DN0A 1RDBA 4RW7A 4NLCA 4FLXA 4CESA 4CJRA 2F65A 3SDEB 2IY5B 4A61A 3HX9A 2OP5A 2XCAA 4F3QA 5L8RC 1C4AA 2Q1LA 2G8VA 2G8WA 1RB0A 4ZIVA 2B8PA 4KR0B 1HPZA 2YH1A 5ETLA 4CIOA 5KG6A 2PD1A 4O3OA 2F9DA 3MD3A 3IA0A 1ZC6A 4WE1A 2NZTA 4C8OA 3OL9A 1N48A 4LR8A 4CZJA 2XWXA 1T0TV 1U2FA 4FK2A 1LKZA 2KJWA 4OJRA 4BS2A 3UDVA 3PW4A 2MGZA 2DY1A 2GTDA 4FS2A 2CJXB 2KM8C 1XC9A 3MCOA 2XHBA 2HMPA 1WORA 2YWFA 5KFNA 2HBRB 4TXSA 3O9TA 1IQTA 1RTIA 4NO7A 4F9OA 2RE1A 1S99A 3K7RA 4H5TA 3L0QA 1YLXA 3IBFB 1UETA 3BZCA 4F4XA 1J2VA 5HATA 1FK9B 3AT1B 2WBRA 5C12A 3O9RA 3E2EA 3RJMB 4CK1A 2A40A 3WBZA 2NLWA 4RWWA 4I6YA 1S1UB 1XR6A 1IKXA 2BRLA 4CLSA 3H4DA 1TYQA 3IGVA 2B4PA 2LQBA 3J80Y 2NYHA 4DCOB 1OWXA 4ED3A 1SJRA 2VIHA 3RB0A 2DNRA 2HFSA 2VASA 1A7GE 1S97A 4CZKA 2YKQA 2HRUA 4DUYF 2OFHX 1S57A 2NSBA 2JLFA 1YDLA 4DTPA 4PQUB 1EO1A 3DMJB 2CUYA 4ES2A 2M4MA 4HUFA 4A8FA 1N6QA 3V5RA 3A1YG 2JNJA 4K4WA 4C2MA 3LPTA 2JVRA 2ZBCA 3CC7N 2E4LA 1NCLA 1CXUA 3RRGA 4IZ9A 1YI2N 5M1KA 3OLAA 3WXMB 1J5EJ 4G9ZA 2RJZA 4CCHA 3WC2A 2F8MA 1PO6A 3QAEA 5F3ZA 5D0HA 2QT7A 4CJKA 1JL1A 3B6PA 4X66K 3SI8A 5MAOA 4WE1B 3OXLA 5E3RA 3QWPA 2EFOA 3D6HB 3CD0A 4M5NA 4KB0A 3BQ1A 3L7PA 2NPFA 1FJGJ 2ATCB 4ZPBA 4DR4K 1P1TA 5C25B 4OLPA 4FWMA 5AQTA 3CJ1A 4BGAA 3BDPA 4WQ5A 5AQFA 3DOMA 2C3OA 4TU9A 4YN3B 1RAGB 2UUAF 1CJKB 6FD1A 1WSJA 3KTQA 4J9SA 1YVNA 1RTIB 1ATRA 3H1VX 4ILGB 1IBLF 1S22A 1KVBA 1GOAA 3AO3A 5I4MA 2UVVA 4CNYA 3SLCA 4EIAA 2WVEA 4DV3J 1L3UA 2GO8A 3M8QA 4ZJLA 2QA4S 2UXDJ 3JQJA 2C2RA 3UB5A 1TFWA 1WC0A 1NBWA 3CG7A 1TYQB 1SI9A 1VQNS 3HSCA 3OYBA 1E3MA 2DKOB 2GUIA 4WXWA 1PC4A 1Y10A 3SUQA 3GDQA 1SL1A 1KOHA 3GOIA 4CGIA 4KBIA 4ECRA 2HB5A 5K14B 3RW7A 3RBEA 2PMWA 5THWA 4CO3A 4ZN1A 4IQXA 3VF0B 2LDYA 3I56S 1BCOA 3OJUA 3NG8A 2X6SA 3QBCA 1CJUA 2O01C 3M8ZA 1RP5A 2V4QA 1P90A 1ZM4A 4PPZA 4H5NA 1N6QB 3QAUA 5ETTA 1OIAA 1SC3B 5F8LA 1RBVA 5CD4H 3QBWA 2L41A 3J7A1 3JXUA 4ZVUB 3GR0A 1H1VA 1M5KC 2BJ1A 1IKYA 3OJSA 1Q0NA 1FO1A 4KKOA 4OJHA 3L3UA 2ZZTA 2XM3A 3RBXA 3CCJS 1REGX 1YJNN 2D3ZA 2D41A 1HNZK 1HQ2A 1ESVA 3SQ0A 5DDOC 1D1UA 4EYHB 1TK5A 3WXIA 2R7UA 1RTJA 2I5JA 5J2MB 3ZSVA 1RHMB 1B70B 4FBTA 3LO3A 3B4MA 3PLAA 1J5OA 2J6SA 2PYLA 2B9WA 1UEUA 2OPPA 3VOVA 1SPBP 4RO0A 1RBSA 4F4WA 1Q7YO 4OX6A 3QGPA 4YDXA 2M9KA 3L95X 3AJ2A 4YB7A 2BOPA 1CPZA 4F7VA 2GVZA 3PW5A 2R7RA 1TTHB 2IJFA 3VQ8A 2FC0A 3NAEA 2F4VK 2YKPA 3HT0A 2CWKA 2BKPA 2KHDA 3PSFA 1U1KA 4NA3A 3SPYA 1NPKA 4IFVA 1N8RT 4V19J 1A9NB 1Z25A 3R5DA 1F9HA 3G6EN 2O4IA 3N79A 4AUKA 3IKMA 3IFRA 4FKXA 4OHXA 2ZJPQ 3VN5A 2WVBA 3SYZA 1S0VA 3VPZA 3AQPA 3D9BA 2W9CA 2ZZMA 3KUGA 5EUHA 3VF4A 1SUQB 2JEIA 2W2QP 4N56A 5LJ3Y 4M5KA 2FBXA 3NGKA 2X1GA 1FT8A 1AUSL 4PAAA 4ECZA 1NHUA 4JLHA 3CJ7A 1RHUB 3W9IA 1RSCA 4E2FB 4DX6A 2R2RA 3D4JA 2HFVA 4F25A 2A2DA 2HVDA 5J1NA 1FFSB 2H3GX 2Z1GA 1CVJA 4K0KK 4UTGA 3OTEA 2DO0A 1JJCB 5KFRA 4LFAK 2Z0GA 4F2SA 3TP2A 3PHTA 4UY8T 5KOWA 1U02A 5BYSA 1FEEA 3V1RA 5IWAJ 1CJTA 3JAMO 5GMKa 4KKOB 1UVMA 3J81Y 1NBEB 5CHIA 3BGUA 3M7VA 4W5NA 8ATCB 1OYDA 4NCGA 4DV2K 5A2QO 1TKZA 4O0JA 4LF8J 5HRNA 1XHZA 2HNZA 5I3PA 4KSEB 3UN2A 1U6FA 1Z26A 1RTJB 1HKBA 4DV6K 4CHZA 1YJ9N 3D45A 2C3YA 3MPYA 3PW7A 5BPMA 2IRXA 2K7KA 3FFIA 5C24A 1JLCA 4EHTA 1T3OA 1XIQA 3M1FA 3GV7B 2OEKA 5DG9A 3V6HA 4AFFA 2GC8A 4KV8A 5M1OA 5KT3A 1GFWB 3QYYA 1S48A 4ED4A 3FBBA 3ADAC 2K2PA 4PL7A 5F0XA 2MJNA 1ITPA 1ZBTA 2NUBA 1YJUA 4CF9A 1QS4A 3T1HJ 1EKEA 4OGCA 1WTFA 5EGYA 3TA1A 2H54B 1F5BA 3CM5A 5KGXA 4DR7J 1HMVB 2CNLB 4CH0S 2DJWA 4FS1A 1QZ5A 3HVAA 1XTZA 1U1MA 4X2BA 2VG7B 4WYLA 4P73A 2YX6A 4BRCA 4J5OA 4FLYA 4P2FA 3OVSA 3NCPA 4A47A 5IM0A 1VQ8S 4M3UA 2JEGA 4FLWA 4M5DA 4WWSA 1ZBHA 2XGQA 3HSZA 3RB6A 1FX2A 4K7QA 2F9JA 1NGEA 2M8HA 2EEYA 2KT3A 3RAMA 5CE3A 1QQMA 4WFXA 2SXLA 3BREA 3VA3A 2OSQA 3AVGA 1OPIA 3CCLN 2PAVA 5I42B 3G8QA 1RT2B 4KI6A 1SKWA 4BE2A 1NGBA 2W9BB 4CEBA 2PA3A 1OJ4A 1REVA 4FO0A 3HLUA 4NCGB 4JI8F 1TKZB 3O1WA 2HVHA 3VF6A 2HNZB 3PO5A 4FJLA 3CJKA 5IT4A 3KNGA 1YBTA 2PI5A 4LF7J 3O4WA 3I5BA 3GL1A 3N9UC 4FP9A 4A5AA 4KGXB 3MWPA 4DBQA 5C24B 1JLCB 4P2XA 5KGWA 4P2MA 4CD1A 2D69A 2AGQA 4LD0A 1QQNA 1KTVA 1VAZA 1GMVA 2GWKA 2XSJB 1B9DA 2GS8A 4KV8B 3OW2R 3CCZA 3P5TL 1K1SA 3TJAA 3VAGA 3EVMA 1OMSA 4EWTA 2WZ1A 3M2RA 4IBNA 2Q79A 2DXEA 2JLGA 3OYEA 1BGXT 3ZX2A 5LMUF 1WG1A 3Q8PB 4NZ0A 3VGVA 4Y0WA 3MDQA 1WJ9A 2ASPA 1QM9A 1PILA 4U67Q 3CMAS 4YMEA 4OHVA 2YVSA 2NS1B 2OTJS 2MKCA 4JK9A 1R6VA 5MLCV 1CZBA 1UAXA 2N7CA 2W1BA 4GC6A 2GVDA 1RU2A 4FF4A 1RWOB 3TAPA 2GGPA 2G8IA 4CZLA 4PXEA 2UYTA 5HMWA 5LJ5Y 2P5OA 3D3BJ 2AEFA 1AW0A 2XG8A 3SMZA 5G0RA 4FNIA 3GG1A 5IM0B 2Z8QA 2DIUA 3UD5A 2ZE2A 2KRRA 5J2NA 1VSHA 3BN4A 3ULEA 4Y2CA 4HT7A 3HPOA 3WX8A 1QHTA 4EP5A 1V3ZA 2P6TA 5AXNA 1V3RA 3K59A 3D6TB 3OHRA 4CF8A 1X60A 3S8SA 3GFZA 3DLRA 1IKVB 3NFAA 3FSXA 3KK7A 4ZTFA 3VTIA 3ZSZA 4OPAA 2UUBK 1T94A 3FGUA 1U0HB 1S7HA 2D1KA 2J8SA 1N8RO 1URNA 1CQMA 4M41A 2O3DA 3CPWR 3L3CA 3JS9A 1EARA 5HQLA 1X9SA 4UOHA 1REVB 3V6DB 4ED7A 2OCEA 3TAMB 1L3SA 3PIPL 4NRUA 3ZNUA 2AZ1A 3HZ6A 3C0BA 3M8SA 4NXNF 4Q8EA 2XBPA 2M88A 3VV2B 5T7BA 3QEIA 5FRNA 2CPDA 2MKIA 2UZAA 2CPEA 4IR1A 2YNIA 4M7YA 2VV5A 4HACB 4CH1A 4J2DA 4CJSA 3A13A 2DITA 3OYDA 3F9KA 3F41A 3H46O 3DDNA 3OVBA 4RWTA 1NU4A 5CYQA 2Q3SA 5L1LA 5DM7L 2ZITA 2A3ZA 4CI0B 5E3QA 4GVEA 1URRA 4KGKA 4YR0A 1CBKA 4WZMA 3TR5A 4JS5A 3MURP 2PFUA 2GQ2A 3OSPA 1BL3A 2E5LK 3HMJG 2F7VA 3R27A 5T14A 2E9RX 4J8FA 4DS5A 2GVDB 1HWLA 4KRWA 3UDLA 4CFCA 2GUPA 2X1FA 2HBMA 4WYBA 4PWDA 4BR2A 1SQEA 1NDPA 5AJ3F 2GGPB 4G3IA 1DGKN 1QQOA 1UVIA 1RT1A 5KT2A 3ETOA 2O8DA 1KBRA 5G0RB 4NYPA 5DQIA 4QYZJ 3G6YA 2ZE2B 4LF2A 4LH4A 5J2NB 1VBXA 4DUYJ 1R43A 3GR1A 2DD8S 3P5JA 3CCEN 4LRFA 1RWKB 4K4ZA 2R7OA 4IO8A 2BJ9A 2FC8A 2B6AB 2R8GA 3L09A 1FJCA 3A8IA 1EKSA 4MAKA 2NR0A 2HMIB 2HKEA 2BUPA 3FZ2A 5LSOA 3GJRB 1JMTA 3KLFA 3MR6A 3EO3A 3SCKE 4YORA 1WWHA 5F8IA 5CY4A 1TELA 2NXCA 4A4JA 4XAKA 1U8WA 1HQUA 4ZK7M 1KCFA 3S41A 1RILA 3NGSA 2BE9B 3MFHA 1QAXA 2Z4PA 3EZWA 2QG9B 2DNGA 3EDQB 5FLXY 2F8TA 1MWZA 4B9UA 5TKYA 3OYFA 2GX9A 2AA4A 4MK9A 2FBTA 3AAPA 3VAHA 1ZXOA 1NB2A 2ATQA 2VD3A 1NUEA 1C1BB 2YNIB 1NDLA 3KG1A 2WAQD 1MNEA 3L9ZA 3TAFA 3TTFA 4NLTA 2ZH8A 4IYQA 2UUAJ 1QSYA 1HWJA 1GMWD 1VQ4N 4HTIA 4TYAA 1BDGA 3TUJC 2LXUA 1R6YA 1IBLJ 3G71S 1TKXA 1KXPA 2RH3A 4YDUA 1UFWA 2I6WA 1LV5A 1UW4A 4O23A 5J1EA 1R0AB 3FDSA 4AXIA 3RWUA 3LW5C 5EHHA 4LF8K 4FPAA 3CCSN 4CO0A 2ZVSA 3VQBA 4DV1F 1KR4A 3NF8A 2V2VA 4FF1A 1XNRF 4FWSA 5JVGQ 3KYLA 2HZAA 5C10A 5KFCA 1F5CA 4QW9A 1G2EA 2BM1A 3G82A 5EDWA 1NO8A 3H20A 2W24A 3OFGA 2KFZA 2D9OA 2VF3A 4Z4HA 2O8DB 5ETPA 1AB8A 3TTCA 3I87A 3U3GA 4GVBA 3RGIA 5SWMA 4LQ9A 3PEJA 5AR0A 3CJ2A 4DR6F 2RKIB 4LUBA 1F21A 4P10A 4ELTA 1NGHA 3GPAA 2MKKA 2XS2A 2ALZA 3N6NA 1N32K 4JAXA 1EETA 5T7LA 4LMZA 2J6UA 3FBCA 4NLUA 3T1HK 2M8DB 3QESA 4KGVB 5HMXA 4LR9A 3KLFB 3DAWA 1VRQC 2E6MA 7AT1B 4DQQA 4YOTA 3TQEA 3MXJA 1F0XA 1NZ8A 3PY8A 4FNHA 4AILC 4FWKA 3AOCA 3BYPA 3KHRA 3SZ2A 2Z2MA 2EFQA 2ZOMA 3THVA 2XY5A 3DXMA 1SL2A 3PJWA 3NBPA 4BLGA 2AQ4A 1S1WA 2FVPA 2ADBA 1ZA2B 2BDPA 3T9NA 4H03B 1LW0B 4CLKA 1CJVA 3VAJA 3NRBA 1QE1A 4QYRA 1S79A 2HHQA 3I33A 1J9AA 3CJTA 1YQHA 4KFBA 2YWKA 2UP1A 3F73A 3N4WA 3TQ1A 1HR0F 1XMOF 1VSMA 4KB1A 2N3OA 1FTRA 1HUXA 3T5KA 2VYPA 3VQ9A 1NGFA 4Y2IA 1N56A 1GXLA 3I8BA 3A3PB 2GAGC 1RWNB 3ZZ0A 2A6AA 2D5RA 3BR8A 1CSJA 3AXMA 2GNKA 2G0CA 2ZFHA 2O8FB 2QA4G 4YFUA 1RYSA 3LGNA 2QL9B 1BHLA 1NAQA 2BW2A 2UV8A 3MPWA 1G6BA 4ZPWR 2PMZD 1JLQB 2XS7A 5DLGA 4DSFA 3G82B 1YAGA 2HHHF 1BA1A 3K9KA 3CM6A 2KHCA 2FB0A 4JI5F 9ATCB 4NLQA 3P4UB 2POKA 2BGGA 2C2EA 2CG8A 2OEJA 3L8BA 4J7CA 2FF6A 4CJUA 4ZVRB 3CXCM 1M5VC 2A0FB 5KFLA 3CIZA 3VMFB 2ZJRQ 1OQ6A 3ZTOA 2DNKA 1CEZA 1MSWD 1ZZNA 5HO4A 3FKBA 1WI6A 3KZBA 4QS9A 2GMHA 3AA3A 2ZM6F 2P9SA 5T7LB 4AHVA 4A48A 5C2DA 3FGVA 3UO0A 3U4LA 1KONA 3R9LA 1PAUB 3I9V9 3EE9A 3RTVA 4ANEA 1X4DA 3FBEA 1HBUA 4CZFA 3BKFA 5BREA 2JHEA 3OTOF 3UE5A 2ZC4A 2XRIA 4H5WA 5CA5A 2P9GA 4H0XB 2FD2A 3IS9A 1HW9A 3DXMB 1S6PA 3J7AP 2XLJA 4IKFA 4FYXB 3NBPB 3R97A 1HHTP 1QTNB 3MTKA 1S59A 1HJOA 1S1WB 4ZVOB 3BPDA 1YBUA 4DI6A 1A5VA 2UUCF 3BBFA 1VJQA 2CQ0A 5IV3A 4WIIA 3VQ7A 3U7JA 4A8KA 2VWKA 3U3YA 3F56A 2Q1NA 4U6PA 3W2VA 3V2UC 3ZZPA 4JYAK 3T6JA 1OO0B 2DTUA 2W42A 2ILYA 2VOPA 1GK8A 2Y1IA 2K3IA 4HUGA 2C2OB 2ZH5A 3R5AA 2FGCA 4P9SA 4AQYF 4Y34A 3OYJA 3BM7A 4CEAA 5AQKA 2CDRB 3CC7S 3PIOQ 3OXFA 2Q31A 3TU5A 1YI2S 1Q18A 3ZT2A 5LY3A 4NCBA 1J6ZA 4C8YA 1YUWA 2E2PA 3NY0A 3BZKA 4PABA 5ADXA 4QS8A 3OQ2A 1QLNA 3VQ5A 2E8AA 4LF9K 3OY9A 1TK0A 3O3LA 3DLLQ 3SI6A 1JLGA 3U9ZA 2ZH4A 3MN5A 4ZP7A 1Y5LB 3DRPB 4O3NA 1UAWA 1ZH5A 4DUZK 2FF3B 1VJWA 2AJ2A 1D8YA 4NI2B 4PHTX 4U7BA 1K6YA 3W63A 2P9SB 1LNQA 5AXKA 1HBMB 2HLTA 4CZGA 3QRPA 2AX0A 1UJ5A 4RW8A 3DGVA 2Q6CA 3THXA 1HWIA 3MR2A 3N5FA 5KG5A 2BKOA 1LWXA 2FJBB 4QZVB 4QQBA 2QK9A 3N5BA 4LFCF 4KB7A 4ZHRA 2XY6A 1HBUB 4ZJQA 4E3SA 3EN9A 4IDKA 3BBBA 4FYYB 3EKSA 2V94A 4EUVA 4OV6A 5CZ1A 2DVIA 3TNVA 1S6PB 3LALA 2ZUAA 3M9OB 2XMAA 2CYYA 3ITHB 4RBVA 1SKUB 4NE9C 4RNHA 3Q22A 2D3OR 4JI8J 3EXCX 4DJBA 1KFDA 1WSEA 4PWUA 3MEEB 4ID5A 3KMQA 3AVAA 4ZA1A 2VWJA 3U8XA 4NXMK 3O1BA 4H0VB 4C3MA 1RCXB 2MLXA 5AQMA 4NLPA 3R9PA 2MPUA 2WUSA 3OFEA 2ZEJA 3TTDA 1D9AA 3WXJA 2VC1A 2QSWA 2QN6B 5A0YA 2DO4A 1PJ7A 3W64A 3RUBL 4TQRA 2E44A 4DL7A 3PX4A 1Y5NB 4ZVFA 2QFIA 1XEZA 2DYAA 3PYDA 4CIFA 2ZVIA 3ZSWA 1XJWB 3PNIA 2VODA 4CJTA 1RCOB 5LMUJ 4RZRA 5CCLA 1FJEB 3OTDA 3DM2A 1AROP 3SBMA 4YQWA 4FF3A 2O5DA 4DR3K 2HS4A 1P27B 2QWPA 2VCPA 1DARA 2AIRB 5E3AA 3DLKA 3AVKA 3PVXA 4CZCA 3QMLA 1BUXA 2EFNA 3K5MA 3LUYA 2UVRA 1YJNS 3PJXA 4P6QA 2ZGYA 1N33K 4IO9L 2OIHA 2HG4A 4PZVA 3THWB 4W5QA 2MQ8A 1NRKA 1RT3B 3AODA 5BRFA 4BC5A 4B3SF 4F0MA 3A5LC 4OKEA 4BR9A 4RW8B 2C28A 2CZ4A 3THXB 2OAUA 1HNWF 2H5IB 3V9XA 4F8RA 2DISA 4LC9B 4ZHRB 4OHYA 4I69A 4HWIA 1ZTTA 1EAYC 2RRNA 4O44A 2MKSA 5AQYA 3LOUA 1MA9B 4FWLA 1C0MA 1YTUA 1W7WA 1P9YA 2JJ4D 2NPIA