3DRPA

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
b'SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drpA05
5KFQA 3AVBA 3H59A 3T1AA 4JUZA 3F73A 3MEGB 1SL0A 3D5MA 5L1IA 1RAJA 4JV1A 4Y2CA 2PYJA 4BE2A 1JLCA 4CGIA 3G6XA 3SI8A 2R8HA 2VG6A 1RT5B 3GV5B 5HROB 4KAIA 2XWYA 4E3SA 1CSJA 3ZT1A 4TYAA 2W7OA 2ALZA 2Z1JA 4OJRA 1S1VB 2HWHA 4KO0A 4ECYA 1UAXA 3NAHA 3RMDA 3P83D 1HPZA 1S0MA 3KKSA 3LPUA 3IG1B 4CGDA 2ASLA 4RW9A 3TANA 3QNNA 1MU2B 1QE1A 3QO9A 1Q9XA 4EBDA 4E19A 1DTTB 4QWCA 3TVKA 4FZZA 4YR3A 4CGGA 3FQLA 2XGPA 2Z1IA 4ZPBA 1TL1A 4FM2A 4GMJB 1A5VA 3BQ0A 1XR7A 2FJXA 5DG9A 3IS9B 4F4YA 3MECB 4G3IA 4J9PA 4RUCA 1CZBA 3HPGA 5DQHA 1LWEB 3P5JA 4C8KA 2DTUA 1Z26A 2UVUA 2BRKA 1RT1A 1J9AA 4Q43A 2NUBA 2FLNA 1C0MA 5JUMA 4DSJA 1N6QB 2IJFA 4AHCA 3LAKA 3TWHA 4CF0A 3H5XA 2Q3SA 4JRPA 2B6AA 4NLDA 3L2RA 3OYGA 2B43A 5F9LA 3GV8B 1BQMA 5KT6A 3AO1A 2XCPA 5HBMA 4M3RA 1C1CB 3NGZA 5J2MA 1WAFA 4WZQA 2AX1A 3DYAA 1U04A 2PZSA 1SH2A 4QWDA 2I5JB 3MXIA 4ECVA 2B5JA 3V6DA 1IG9A 4ICLA 3V6HA 3GYNA 4NLYA 1VSDA 1GOBA 4BWJA 1S4FA 3KKRA 4DU3A 3I5AA 2GUIA 4G1QB 1RCHA 1JKHA 4OL8A 1GX5A 4J9SA 4PUOA 1Q9YA 2VWJA 3LP1B 1FK9B 1JLCB 5SWMA 2G8WA 2VG6B 4B9LA 3IGNA 3CQ8A 3DI6B 1EXQA 5J2NA 1VSLA 1JL1A 4IDKA 3PW4A 1VRTA 3CIZA 1HPZB 4ED7A 2J6TA 3GIKA 5C25A 5CZ1A 3ALYA 5F8MA 2EC0A 1QE1B 3QO9B 3SZ2A 2D0CA 3MFHA 4FJ5A 4R8UA 3TARA 4PQUB 2UUTA 5KRTA 1TL1B 3AVFA 3CDUA 5CYQA 3SUNA 1VSEA 1QSLA 3CVKA 4HCBA 2JLEA 4QPXA 4E7LA 4DFJA 3PR5B 2DY4A 2YNHA 3AV9A 4FXDA 1RDBA 4CFBA 3NKYA 2W7PA 1UWBA 3A2FA 1KVBA 1TKXA 1Q8IA 1WN7A 5HRSA 3DRRA 3PW5A 1RT1B 1S10A 3OYAA 2IC3B 2FJVA 4JRQA 1B9DA 2D41A 2XI3A 3OSNA 4CEZA 3ZCMA 1BQNA 4CECA 3QETA 3AVNA 4FJHA 3AO2A 3KK3A 3K5LA 4M41A 3PX4A 1BQMB 4ED1A 4N76A 1HRHA 4I7FA 5J2MB 2KW4A 1RTHA 1LWCA 4EBEA 3CYMA 4AHRA 3KLFB 3OYJA 3LZJA 1N56A 2OZMA 4IRCA 3V6DB 4E7JA 5KG6A 3PZPA 4B3OB 1T03A 4ZMMA 5DG7A 2G8FA 1GOCA 4M94A 1Z25A 2G8UA 3HL8A 3DLEA 1S0NA 5DK5A 1NJZA 4NLXA 5KTQA 2AQ4A 1JKHB 4B8AB 1RT6A 4MQ3A 4PUOB 2IGIA 4U6PA 1NKBA 2BRLA 3QEWA 4KE5A 3SPZA 2X78A 4O3PA 2HWIA 1NK4A 1HNVB 5KT2A 2D0BA 1VSMA 4CJ3A 4CF8A 5J2NB 1ITGA 4DFKA 4IDKB 3PO5A 2I1RA 1VRTB 4MKBA 3QNOA 4YQWA 2BDPA 4Y34A 2P1JA 1TAUA 2YNFA 3LAMA 3HXMA 3SV4A 4URQU 3G6YA 2FVPA 3MEEB 2R2UA 4CJPA 2WONA 2QKBA 4R8UB 1JLGA 1NK9A 4F8RA 2DFEA 2AGPA 3THVA 4TYBA 4CJQA 3LPTA 2E9ZA 3KTQA 2ATQA 3TQ1A 4O0JA 4W5QA 5CYQB 4FLXA 3RAXA 5KFNA 3SQ1A 5KGWA 1CLQA 1JXBA 3V6KA 4WFZA 4NZ0A 4IKAA 3I0SA 5EWFA 5C42A 3L3UA 2KZZA 2V4QA 1EETA 5KRSA 4Z4GA 4F50A 2ZE2A 3OYNA 2CJQA 2EHGA 1UWBB 4WYWA 4J9MA 1YT3A 1TKXB 5HLFB 2G8VA 3AVGA 1EP4A 3DRRB 3NL0A 3OYBA 4KHWA 3SI6A 4Z4HA 3ZSZA 3Q8RB 1S9GA 3UR0A 4DSIA 4R5PA 3QGHA 3GIIA 5F8GA 4U7CA 3RRGA 3KJVB 3ZSVA 3V4IA 4RUAA 3DRPA 2HVHA 4NRUA 3AA3A 4HUGA 3WNGA 4IH5A 5KFKA 2YNIA 3KK3B 5L9XA 1YVUA 4CHYA 2QE5A 3IN5A 1VSKA 3TI0A 4I7FB 1RTHB 4RW4A 1LWCB 2YKNB 4ECTA 1NOZA 4NCBA 5KFFA 1R0AB 3H4DA 3HT3A 2KQ2A 2W9AA 4MK7A 1RBUA 1TGOA 4OKKA 5KFLA 3OHBA 3H40A 1TK5A 3M8RA 2GBZA 4IH6A 1TKDA 1HMVB 4CJTA 4DLGA 2VA3A 3CDEA 4CFCA 2WOMA 2C2DA 2IM3A 1SH3A 3HVWA 4NCAA 1XR6A 4RNHA 4ED6A 4DG1A 1S1TA 3WNHA 3KLEB 1CZ9A 4IFVB 3E01A 2C28A 1DTQA 3QLHA 2IJNA 3AO5A 2PYLA 1JX4A 2OH2A 2KFNA 1RDRA 4Z4FA 4TQRA 3O3HA 4DTSA 3O3GA 2ASJA 4CJKA 3BSOA 3PW7A 4H8KA 2OPQA 1S49A 1L3UA 1QUVA 1NJWA 4B9SA 2YNFB 2UVRA 3SUOA 1C0UA 5HRNA 2WONB 5I42B 3N6MA 2OPRB 3OL9A 3MEGA 2O5DA 3KMSA 3SV3A 4QAGA 4CK1A 1IM4A 2X74A 4IFYB 4KFBB 1NOYA 3Q8QB 3H98A 3PR4A 1X9MA 3QIPB 1WSEA 4LQ3A 2QK9A 4ZP9A 3OYMA 3PW0A 5JS2A 3RB6A 3AVIA 1EETB 4FYDA 1DLOB 4KI4A 3VQ5A 1S1VA 4Q8FA 3KHRA 2D0AA 2ZE2B 4HHTA 1KFDA 3LANA 4K8XA 4DTRA 4DSKA 3LZIA 1DTTA 5FRMA 4ZP8A 4K4TA 1HARA 4QW8A 1S9GB 3EPGA 2FBTA 2GIRA 4IRDA 1RYRA 4CJRA 1RBSA 3DRPB 3CWJA 3P1GA 4RW7A 2X6SA 2OPPB 3KLGA 4DTUA 5CYMA 3SFGA 3S3OA 4K4ZA 4GW6A 3IS9A 2YNIB 1ASUA 1VK0A 2UVVA 2V0NA 3KLVA 4JLHA 3L2UA 3BR9A 3OS0A 2F8EX 1JLEB 2WHOA 1SKSA 2JEFA 1LWEA 2JC0A 3NH2A 4FLYA 3DOKB 4DTXA 5DLFA 4J9NA 4DQSA 3M8SA 4Q8EA 4O44A 1TV6A 3D45A 3LP3A 5KFIA 2YNGB 2F8TA 3QESA 2QXFA 4NLQA 2XCAA 3DMJB 1N6QA 3K5OA 2Y1IA 1RYSA 2WOMB 1RDDA 3OYCA 1RT4A 4KHMA 3I5BA 2B4JA 3NFAA 4DG1B 1S1TB 3T19A 2AX0A 1N5YA 1WSJA 5KG1A 4DSLA 3FFIB 3DLKA 3OYIA 1C1CA 1WSFA 1SL2A 4ID5A 1YTUA 4RNMA 4B08A 3UDLA 2O4IA 2OPQB 2YHAA 4PWDA 3ZSQA 1HJRA 2IS3A 1S9EA 4BACA 4ZPCA 1SH0A 4YNQA 3NHGA 3OL6A 2XY7A 3H4BA 4G1QA 4CHZA 4CFAA 3OYDA 4HUEA 3EPIA 1REVA 3V9WA 5KG7A 4H4OB 3LP1A 4KTZA 3PVXA 3TAMA 1FK9A 3HVRA 3VA3A 3AVAA 4IOBA 3G6VA 1WLJA 3DI6A 4N56A 2BGGA 5KT5A 3NH1A 3NE6A 3LP2A 2FJWA 2ILZA 4CJ4A 2R8IA 1BHLA 2XY6A 4CEQA 4KTWA 2YHBA 1Z4UA 2QKKA 2BQRA 3PX6A 1D9FA 2BE2A 3L2QA 3DM2A 1HQUB 3HKWA 4PQUA 1K1QA 4HKQA 5KG0A 3AA4A 3FQKA 4FW1A 2DFHA 4RW7B 3KLGB 5CYMB 3RAQA 4ED3A 4ECQA 2P51A 1X9SA 3BDPA 1A5XA 2IM1A 2RDIA 4IR1A 5F8NA 3K5NA 1RDAA 3BGRA 3BREA 3O4QA 3AVKA 4TLRA 2IM2A 3T5HA 4J2BA 4O44B 1TV6B 1T3NA 3L2WA 3ULDA 1S1XB 1EX4A 2IC3A 4EEYA 3RBEA 4DLEA 4CEOA 3AO4A 4EYIB 4Y1CA 1RT4B 3EZUA 1C1AA 4KREA 2FVQA 1ASVA 2W42A 4WFXA 1O1WA 1N5YB 1HYSA 1C1BA 4CF1A 5HRPA 5CY4A 4FLUA 1SV5A 3DLKB 2JC1A 3VQQA 4RZRA 4AHVA 4ID5B 3KLFA 4F4KA 2CKWA 3AVCA 4I9QA 1T05A 3OYEA 3FRZA 4PWDB 3C6TA 4ZVEA 4B3OA 2Z1GA 3N6NA 1S9EB 4DFPA 1XR5A 2BR0A 4XIUA 4FS2A 1SUQA 3QEVA 4CGFA 4TY9A 1OS5A 1REVB 3MAQA 1TL3A 4FJGA 2IOCA 5E41A 3NH0A 3VQEA 3C94A 3OJUA 2W9BB 1WNSA 3ISND 3TAMB 3B6OA 4WXWA 4DQIA 4CEEA 4ZTJA 1HNVA 3KHLA 3UPFA 4JS5A 1NHUA 1UA1A 2ASDA 1NKCA 4K4SA 4OGEA 3N6LA 4CERA 4W5TA 4W5OA 3LP2B 4DMNA 3MEEA 4TY8A 4DF8A 3NF6A 3IAYA 4F2SA 2BQUA 1L3TA 2XGQA 2BE2B 3DM2B 5KFOA 1LAWA 2R2TA 3PW2A 3KMQA 4FJXA 3VQAA 3WNFA 1D5AA 4HYKA 4OGCA 1FXXA 4EBCA 3ZT2A 4URSA 3V1QA 3BGRB 4AHSA 3RRHA 3KK2B 1ZTWA 4FJLA 2VG5A 1WAJA 5HLFA 2BANB 4KPYA 4JV0A 4FLVA 4CJUA 4OPKA 4EZ6A 3AVMA 1RA7A 2HB5A 3D28A 3KJVA 1LAVA 4DSFA 4FJ9A 1WSHA 4ZVHA 4J9QA 4HCCA 4BDYA 4ECSA 3AO3A 1QSSA 1HYSB 1C1BB 2IM0A 3GIMA 3CFPA 1JLFA 4KHQA 2HHUA 1JXEA 3CJ2A 4QOZB 1SV5B 2V4RA 1RDCA 4OVLA 4DL7A 1J54A 1LV5A 2YKNA 5EWGA 1R0AA 2FVSA 4WFYA 1T05B 2RPIA 2AJQA 5KFTA 2UVWA 3C6TB 1FKPB 3UIQA 4K4UA 3CFRA 1HMVA 2HHTA 4KHYA 2O4GA 1SUQB 3PUFA 4OPJA 1TAQA 4ELUA 1RILA 2GIQA 4K4WA 2V9WA 1BISA 1TL3B 4MH8A 3KLEA 3DRSB 4I2PA 4IFVA 5KFAA 4ED0A 3VQ6A 3VQ8A 4FZXC 3BQ2A 3V6JA 1KVAA 3AVJA 1N48A 4F3TA 4EYHB 1ASWA 1IO2A 1D1UA 4KB7A 3PX0A 3G10A 1XWLA 2J6UA 3DLGA 1NHVA 4B9VA 2XY8A 2JGUA 5L1KA 1NKEA 3HVTB 3B6PA 4DF4A 4CJFA 4H4MB 5I42A 3MR6A 2OPRA 4TY8B 4IKFA 3VQSA 1IKWB 2AWZA 3OY9A 1NK5A 4IFYA 4KFBA 3HP9A 5CZ2A 3QIPA 1TKTB 5F8IA 4K4YA 1NK6A 2FLPA 2R8GA 3KLIA 4HTUA 5KFCA 4KV8A 4E7HA 5DMRA 3K58A 3SCXA 1DLOA 5F8LA 3VQCA 1U09A 2XC9A 2C2RA 1WSIA 4K4VA 3K57A 4KAZA 1D8YA 4QWEA 3HPHA 2VG5B 2ZKUA 1C6VA 3V9UA 5K14A 4DQRA 1RTIB 1TQLA 3QIDA 4O3SA 4E89A 3GQCA 3GILA 4OLAA 2OPPA 2HHQA 1JLFB 2F96A 5DGBA 2D7SA 3G86A 1JLEA 3HSTB 4QCLA 5KT7A 3CG7A 2XI2A 1NJXA 3DOKA 4NYZA 1KHWA 2VG7B 3QERA 4NLPA 2YNGA 3BSAA 4CJLA 4OLBA 4YP3A 3NAEA 2KFZA 3WNEA 2HMIA 3DMJA 3VQ7A 4CHNA 1NJYA 4RG8A 3HK2A 2QV6A 4O3QA 5KFDA 3AA2A 4DTOA 3M9NB 3T5LA 2AGOA 3ITHA 4QWAA 4CEBA 2JEJA 4BDPA 1TVRB 4I2PB 1G15A 2E6LA 4XPCA 3OYFA 5DQGA 2GV9A 4KHSA 4CHOA 3H5SA 4NYNA 3RB4A 3FFIA 2W9CA 4Y2AA 3QGGA 1L3VA 5KFGA 5KFSA 5J1EB 2HHWA 4E7IA 3UQSA 4FLZA 3HVAA 4LH4A 4HUFA 3DLGB 1HNIB 1W9HA 4K4XA 4Q0BA 2Y1JA 4Q45A 1RT7A 4YMEA 4DL5A 1BI4B 5KI6A 3BQ1A 4AHUA 1RTDA 3JYTB 1QHTA 1RT3A 1IKYB 3VN5A 4XO0A 3F9KA 4H4OA 4CIEA 4ID1A 4FZYA 2D3ZA 1U49A 2IDOA 3SUQA 5EU7A 4O4RA 4E1MA 4FJJA 3KLIB 4C8OA 1RBTA 2RF2B 4MIBA 4KV8B 4KHUA 5DG8A 4CEDA 5I3UB 1SKRA 2G8IA 3VQDA 1B92A 1IKVA 1L5UA 4NLWA 1X9WA 3Q8PB 5EUHA 2RKIB 3U3GA 1D9DA 4M3XA 4PY5A 5DLGA 4O5BA 1VRUA 5C24B 1KLMA 5K14B 4DEZA 4O3NA 1S6QA 2RN2A 4LSLA 4NLTA 3OJSA 2ZQBA 4CIFA 3O3FA 5L1JA 1S6PA 1HQUA 5KFEA 3SPYA 4CHPA 2R2RA 4YR0A 1ZYQA 5KG5A 4NCGA 3IRXA 3U3YA 1BCOA 4NLGA 2G8HA 4YFUA 3HO1A 3HYFA 3C6UA 1S1UB 2E9RX 3OHAA 4DL2A 3CDWA 2HHSA 3OS2A 2IAJA 1JLBA 3QEXA 1S1XA 3QINA 4WXOA 2HMIB 4I2QA 3CM6A 2OA8A 3CJ0A 4CGJA 4NYFA 3TAQA 1KLNA 4GC7A 3U6FA 3ITHB 4OKJA 4LSNA 3CJ5A 4XPEA 4GVMA 4CEAA 3OLAA 3PO4A 2HNYA 1VSFA 1I39A 2ETJA 5HP1A 2W9CB 4IG0B 1ZTTA 1K6YA 2WB4A 4CESA 1LWFB 4HVJA 4DL4A 4NLVA 3OVNA 4Q0BB 4QW9A 4KBIA 3H08A 3RWUA 1HYVA 2OPSB 3SJJA 1RT7B 3TAGA 3RB0A 1U47A 4CF9A 2DFFA 4GC6A 1RTDB 4F4ZA 3PJWA 3I0RB 3QEIA 3T5KA 4FJ8A 1RT3B 2FBYA 4ZP7A 1J5OA 2W9BA 3OLBA 3KK1B 4W5RA 5JXSA 2P5GA 2HW3A 4ZVFA 1S97A 4ZPDA 3CFOA 4ZP6A 2OYQA 5FROA 5FRNA 4MFBB 3LP0A 4CJ5A 3RMAA 5KT4A 4DSEA 3KHGA 1IKVB 2W8KA 2F8SA 3PJXA 4BE1A 1NK0A 4TQSA 1VRUB 4RNNA 1KLMB 2UUWA 2ZD1A 3H5YA 1S6QB 4LSLB 4URGA 4MKAA 4E0DA 2LSNA 3OYKA 1S6PB 4AHTA 1UA0A 3NCIA 4NCGB 1C2PA 3AVHA 4FJIA 3IRXB 4TN2A 3RBDA 3EY1A 2G8KA 4PA1A 4CJWA 4EO6A 3C6UB 3V9SA 3NF8A 3RR7A 4MIAA 4BWMA 2XO7A 3V1RA 4CHQA 3KK2A 3FDSA 4CFDA 4L8RB 4RW8A 2BANA 1U45A 2IAJB 1JLBB 2XY5A 4J9OA 1MMLA 4DL3A 1KCFA 1C0TA 4I2QB 3QZ8A 2IA6A 4DS5A 4UQGA 1W0HA 2FVCA 2WTFA 1A5WA 2WK4A 4LSNB 4ZHRB 3MTKA 4FVMA 1ZETA 5J2QA 1KSPA 2HNYB 1YVFA 1FKOA 2HVIA 5SZTA 2R8JA 4O3OA 5HP1B 1TK8A 3NBPB 4ECXA 4M95A 3SNNA 5JS1A 3DOLA 1T94A 5DQIA 5KFVA 3HPOA 1EKEA 4YR2A 1WSGA 4RW6B 2D3UA 2Z1HA 1FKPA 4ZPAA 4IG3B 3ZT0A 2XHBA 2FBVA 1CXQA 4Y3CA 3OSPA 4IRKA 1TKZA 2W8LA 2ITGA 4NLSA 3DRSA 1J5OB 1L3SA 2E4LA 3ZSXA 3VQ4A 3JSMB 4NLRA 4FJNA 4N47A 4N41A 4CJVA 2WRMA 3HM9A 4CK2A 3MF5A 3LP0B 4Q5VA 4FK4A 3RR8A 5KT3A 1JIHA 3HVTA 4J9RA 2ZD1B 1VSIA 3HJFA 4H4MA 2VWKA 3NGYA 4M3YA 1IH7A 4J2DA 3MR3A 4DTJA 3I8DA 4MK9A 4BDZA 1IKWA 4X2BA 3TAPA 1YTAA 4KO0B 5KG4A 1Y97A 2KZMA 1TKTA 1UOCA 4B9NA 4RW9B 1BIZA 3C95A 3ISNC 5KFRA 2FVRA 1T8EA 3MR5A 4J9LA 1XHXA 4K8ZA 3PHEA 4WYLA 3BSNA 1I6JA 5C5JA 4CCHA 3MEDA 3QIOA 4Z4EA 1S9FA 4M3UA 4EO8A 2X6NA 2HNDA 4N5SA 3MXMA 4RW8B 1D0EA 5F8JA 2R7YA 4ELTA 4CJEA 4IH7A 4AH9A 1C0TB 2IMWP 1RTIA 3L3VA 3S3NA 5D3GA 3BSCA 2ATLA 4F4WA 3RTVA 1KTQA 4WE1A 1SL1A 5J2QB 1FKOB 2P5OA 1KFSA 3ZT4A 1W25A 4FW2A 4FJ7A 3K59A 4B9UA 4IBNA 3GV7B 3DOLB 2VG7A 2R8KA 4C8NA 1S0OA 2B6AB 2EX3A 3DDKA 3TABA 2JEGA 1KVCA 5F8HA 4FLTA 4C8MA 4FK0A 4ZVGA 5HBMB 4DQQA 2OZSA 3M8PA 1KHVA 4LQ9A 3ZSWA 1TKZB 3DYAB 3M8QA 3KLHA 4NRTA 1LW0A 1TVRA 5KFUA 3MR2A 3L8BA 1RT2A 2B5JB 4ECZA 5FDLA 5KGXA 4ICLB 1BIUA 3HP6A 4ECWA 1K1SA 2D5RA 4F2RA 5KFWA 2BQ3A 5KFHA 3SUPA 2WCXA 5J1EA 1J53A 4FK2A 1JLQA 4IR9A 1HNIA 3DLHA 3LALA 3PY8A 4M42A 4LD0A 1BCMA 4FJKA 3QYYA 5EWEA 3K2PA 1N4LA 3KHHA 3S9HA 1BI4A 3DLBA 4EP5A 3EZ5A 3JYTA 3S3MA 1IKYA 4NLUA 4Z4CA 3EYZA 3CJ4A 2HAIA 1KRPA 3CO9A 5C25B 4JS4A 2C22A 3NGDA 4DTNA 3QEPA 1IKXA 2RF2A 5KFYA 3NMAA 3MEDB 5I3UA 1RBVA 4B9TA 3MXJA 3QZ7A 2J6SA 1NK7A 4O0IA 4C8LA 2RKIA 1HQEA 1NNDA 4R0EA 2HNDB 5C24A 4FS1A 4KI6A 1XHZA 3NAIA 5HRRA 4FLWA 3ZSOA 1TK0A 4FBUA 4FCYA 3E51A 2YNHB 2IBKA 5L1LA 1ZBIA 2FBXA 2YV0X 2HNZA 4FM0A 1QSYA 5D3GB 4O55A 5KG2A 4O4GA 4WE1B 3LWMA 3BJYA 4KKOA 2R2SA 1XC9A 2RDJA 4Z4IA 2XRIA 1QTMA 5J2PA 1VSHA 1RNHA 3SQ2A 2ILYA 1S1UA 4TSXA 1X1PA 1QAIA 4DFMA 3VQ9A 1QAJA 3SFUA 2YKMA 3TAEA 4DTPA 1BQNB 4ZTFA 4DWIA 3TR8A 3OL8A 3RMBA 4LY7A 4CF2A 4ELVA 2E6MA 1S5JA 4B9MA 4H54A 1VSJA 4F4XA 1WNEA 4LH5A 3NGIA 2PY5A 3M8PB 1GOAA 3V81A 5KFPA 3M8QB 3KLHB 1S1WA 1LW0B 4Y1DA 3L2VA 3LDSA 3ZSRA 3Q8SB 3TAFA 1RT2B 2A1RA 4J9KA 5FDLB 5KG3A 1T03B 4IG0A 4FBTA 4TXSA 3DLEB 1LWFA 4KB0A 3G0ZA 1U4BA 1RT6B 1JLQB 3MFIA 2GC8A 4B8CA 4FM1A 4E1NA 4KB1A 2C2EA 1ZBLA 3PV8A 2OPSA 3ASMA 1CXUA 3NF9A 3I5CA 3T3FA 4ED2A 4QWBA 1TP7A 3HHKA 2AU0A 3VA0A 3I0RA 1LW2A 3VQPA 1RTJA 3NDKA 3K5MA 3V9ZA 1JLAA 3H5UA 4BE0A 1NK8A 3KK1A 4I9LA 3KD5E 1U48A 1QQCA 4RNOA 1ZBFA 3KOAA 2DPJA 4KHRA 2E9TA 1HYZA 1IKXB 5DGAA 1ZBUA 3OYLA 3GIJA 4M45A 3SQ4A 3SQ0A 3RB3A 4KHNA 3QGIA 4MK8A 1JLGB 3FSIA 4MFBA 4DU4A 4K50A 4E7KA 3AA5X 1S48A 3KIOA 3OYHA 1HQEB 4CEFA 4J2AA 4KRFA 1RT5A 4FJMA 5HROA 3OS1A 4Z0UA 4O3RA 3I0SB 5C42B 3DLRA 5T14A 2HNZB 2FLLA 3M9MB 3RMCA 4EP4A 2DPIA 2HHVA 3IG1A 4O4GB 3LWLA 1EP4B 1MU2A 4KKOB 3IGVA 4ECRA 4DL6A 5J2PB 4OKEA 1XI1A 4R5PB 4KTQA 3OL7A 4DS4A 4IQXA 3ZT3A 5KFZA 3V4IB 3M9OB 1ZBHA 2VA2A 4J2EA 2YKMB 4WZMA 3V9XA 4Q44A 1I3AA 1GX6A 1SKWA 4CGHA 3D0PA 3CJ3A 3MECA 3T5JA 1BL3A 3SYZA 5KFBA 4JV2A 3VQBA 1BGXT 4DQPA 4RW4B 5T7BA 3V81B 2KTQA 4M3ZA 1T7PA 4ZHRA 1S1WB 4CE9A 2JEIA 4EZ9A 2FC0A 3H2LA 1F21A 3NBPA 4M3WA 3KNAA 3O4NA 5F9NA 4KSEB 4CIGA 5KFMA 1JXLA 1JL2A 1RA6A 4ECUA 2A1SA 4W5NA 4RW6A 4AILC 4CK3A 3E01B 4IG3A 3ICLA 4ED8A 1DTQB 4RNFA 3QLHB 1RBRA 5KFXA 3ZSYA 3V1OA 3CM5A 4DU1A 5EDWA 4NLOA 2HHXA 2AGQA 1QS4A 1LW2B 1RTJB 4CJSA 3KD1E 2I5JA 1JLAB 4DTMA 4M3TA 5KFJA 1B9FA 3AVLA 4RU9A 3JSMA 3NF7A 1C0UB 4F3OA
chains in the Genus database with same CATH superfamily
2PDAA 3H25A 1JXVA 3AVBA 3MMBB 4YOYA 1TL7A 4UF4A 4DMZA 1QVFR 2BJ8A 3B78A 4JUZA 3F73A 1VQ7N 3ENOA 2XHCA 5E33A 1JLCA 4JV5F 3MMCA 1R0BG 4I69A 3R7NB 4IOAQ 2XWYA 4OI1A 3KWGA 3WQTA 2PFFB 1S1VB 4KO0A 3ILLA 1FF2A 4DV0K 1HPZA 3K5PA 9ATCB 2RDDA 2ZH8A 1LQ9A 1QE1A 2H3EB 4EBDA 4E19A 1DTTB 4QWCA 3TVKA 5AZIA 4Z2XA 2V4JA 3FQLA 3RG6A 3PRDA 4A8XA 2CJBA 2XGPA 2MKIA 2ASPA 1RKJA 2F5GA 4FM2A 4DHVA 1B3TA 1R31A 1GMWD 1UJ5A 1XR7A 2VQEF 3QFPA 2FJXA 1U1LA 2W4PA 4RUCA 2CPEA 3P5JA 4C8KA 3WC0A 2UVUA 3A12A 4Q2MA 3JTOA 2O8DB 2O01C 1WG1A 1TUGB 5JUMA 2F4FA 4J7CA 4CF0A 3HRGA 3CJSA 3HHEA 7FD1A 1S72S 4NLDA 2X1GA 3OYGA 4USJC 5F9LA 3GV8B 2JWNA 5KT6A 5BJRA 3AO1A 1NHKL 2DCUB 2MLYA 2DJWA 4M3RA 4MO5A 3NGZA 5J2MA 1WAFA 2GEMA 2AX1A 2V2ZA 1U04A 2V51B 1VQ7S 3LGNA 4ECVA 2O8EB 4OJHA 3GYNA 4USUA 3DAWA 4U7UK 3I5AA 2GUIA 4G1QB 1D09B 3CC2S 1G99A 3OTDA 2O8FA 2G8WA 3MPVA 2WVBA 3BF4A 2Z2YB 3IGNA 3EGVA 2DEIA 2JRSA 2IRYA 1VSLA 3UNYA 3MMJA 1FTRA 4LUBA 3HTVA 1X4AA 2A2CA 3UVJB 5C25A 5FPNA 4FOIA 2V2QA 1WD6A 3QO9B 4DR7F 3IBWA 4R8UA 2XMVA 3TARA 2JL9A 1ZXOA 3SBMA 4DR2K 4M8LA 5FLXU 4PQUB 2EXUA 2QXLA 5EOYA 3VEYA 5KRTA 3CDUA 5CYQA 2P9GA 4BRMA 1AZSA 3CVKA 1UZHA 3WXJA 1Q7YT 1XNRF 1ZM2A 2O66A 4LRCA 2HF3A 4FXDA 2GJFA 4CFBA 2V63A 1KVBA 1TKXA 1Q8IA 3OQ2A 3GOIA 1RT1B 4LBHA 3LGMA 1S10A 3OYAA 3FSYA 4I4BA 1Y11A 2RH3A 1RCXB 2KHDA 4OX8A 1QAYA 2RAQA 2H4WB 4R0JA 4MYUA 3ZCMA 1U24A 3QETA 1S7IA 3KK3A 1BQMB 4ED1A 4L3KA 1HRHA 4FYYB 3H3OB 1RTHA 3RAMA 2NREA 4ALZA 3LZJA 3VZIA 3OYJA 2OZMA 4IRCA 1QZ6A 1HNXJ 5KG6A 3MMAA 2GO9A 4H5WA 3B54A 5DK5A 2H5JB 3MWBA 2M8HA 2HG4A 2AJ1A 2MJNA 3QSYB 4FWPA 3DJCA 2HBZB 3CO0P 1OH8A 2XYPB 2BRLA 3QEWA 1S6OA 3SPZA 4O3PA 2HWIA 3ET6B 1S0VA 2ZNYA 4YB6A 4CJ3A 4CF8A 3W64A 2JZ5A 2L9DA 1ITGA 2JHEA 4DFKA 4IDKB 2I1RA 1VRTB 2KM8C 3D2FA 3QNOA 1KVKA 2UUCF 4URQU 3G6YA 2FVPA 3MEEB 4CJPA 2X3DA 2WONA 2D9OA 2QKBA 2AJ0A 4P74A 2FJBB 3LPTA 3KTQA 4HVZA 3CJ1A 4YDUC 3ENAA 2FY8A 2CUYA 5E3PA 3TQ1A 4ILHA 3RAXA 3SQ1A 1CLQA 1JXBA 3A3NB 4WFZA 1RAFB 2X1FA 2V4QA 1EETA 1CJKA 2OSRA 3OYNA 4L3NA 3FBFA 2A6MA 1VQYA 1YT3A 2G8VA 2EI5A 3DRRB 2DH7A 5A6PA 5AQVA 4RCHA 2YH0A 1U2CA 4RR5A 3ZSZA 2VGMA 4GVBB 1OIAA 3CJBA 5F8GA 1N34J 1EQYA 3RRGA 1D8ZA 4K8RA 3ZSVA 4P9SA 2ZH7A 3U02A 4FNHA 3AA3A 3WNGA 5KFKA 4JI3F 4DR5K 3IN5A 1IQZA 3TI0A 2YX4A 4CT9A 4JI6K 2MDAA 4CM2A 3HHNB 1RABB 4RW4A 1ZS6A 4LF9J 2YKNB 1NOZA 1W2BR 1OQ6A 1K0TA 3ZZRA 1RAOA 1TTHB 4KRWA 5L39A 2WVFA 4OX9K 1YAGA 5KFLA 3OHBA 1TK5A 4NLBA 3M32B 3CDEA 4OLOA 3C65A 2IM3A 1SH3A 1XR6A 1HR0J 4JI4K 1S1TA 3CNQP 4IFVB 5CR4A 1UEVA 2OEMA 5CD4A 3E01A 2FF3B 5EY4A 4ZPTR 2D3OR 1JX4A 2OH2A 2QGFB 3O3HA 4DTSA 2APOA 4CJKA 1SJ1A 2LMIA 1L3UA 1QUVA 5KPTA 2J7UA 2OKQA 4LF6J 2YNFB 4PL8A 1C0UA 3Q22A 5HRNA 1M5PC 2E29A 2VDIA 5I42B 3N6MA 4ILJA 1K47A 2VPWB 3W2WA 3MEGA 3KMSA 4QAGA 4WFAL 2KT5A 1KONA 3HSGA 1NOYA 1OY8A 3A5OC 3OVAA 1FVQA 2CPHA 2C2ZB 4Q7AA 1JJCB 2QK9A 3PW0A 5JS2A 2LLZA 1YI2N 2BOAA 2VQFF 4JI0J 1WF2A 3KHRA 2P9CA 1PKUA 5E26A 3FJ2A 3L9ZA 4DR4F 3QRPA 1QDUB 1KWMA 2ZJQL 1OSCA 1HARA 4NA3A 2FBTA 3EN9A 1NGJA 3ZX0A 3OFGA 1RYRA 1SZ2A 2WFBA 4CJRA 4EI2A 1TYQA 2A3ZA 2IYIA 2K7JA 1YJTA 3SFGA 1IG8A 4AXIA 1VK0A 2YNIB 4K42A 3KLVA 1R0CB 3N01A 3BR9A 1JLEB 3I8BA 2JEFA 1LWEA 1NSAA 5DLFA 1TELA 4Q8EA 3PYFA 5LL6d 5F3TA 2X1BA 3LP3A 2FHOB 2RQCA 4B3MJ 5EGYA 2Y1IA 1Y5IB 1VQOS 4FF1A 3JSRA 1RT4A 4YEAA 2ASMA 4DV6K 4Y6IA 2B4JA 3P96A 4MDBA 3GBTA 3M2RB 3QFUA 4A2AA 5KG1A 3VENA 3DLKA 3UCUP 3OYIA 1C1CA 4C8YA 1GMWA 1YTUA 3AJ1A 2OPQB 2R7UA 4PWDA 1WJ9A 1HJRA 2QA4S 4ZPCA 4BC4A 3NHGA 4DV0J 4CHZA 4CFAA 3GJSB 4NXMK 4H4OB 1FK9A 1VAZA 2ZH9A 2BW7A 2CQ4A 2LEPA 1IV0A 5E3RA 3DI6A 1N32K 4CLPA 5KT5A 1LK5A 4RUHA 2M4MA 3AQPA 3SCLE 3LP2A 1MLAA 1O0PA 2VDHA 2ILZA 4CJ4A 2R8IA 5HQ8A 1EWQA 1Z4UA 3PX6A 1LNQA 3VGUA 1D9FA 2BE2A 3L2QA 3DM2A 4F3QA 4A5BA 2CPYA 4HKQA 1VK3A 4FW1A 2DFHA 3HULA 3KG0A 5CYMB 3VGTA 3IRWP 4ED3A 5AXLA 1N5SA 3PIPQ 2IM1A 1U2FA 2RDIA 1OH5A 5CYJA 2YKAA 3BREA 3AVKA 4TLRA 2MQMA 5C2DA 3L2WA 3ULDA 4P2SA 2IPOB 4C98A 5M1FA 4EYIB 2E5HA 4Y1CA 3T1YK 2KI2A 4WFXA 1N5YB 1JJHA 2EG2A 2PI5A 3RU0A 5HRPA 5CY4A 2ZHAA 3MAAA 2PO4A 3LDLA 2CZVC 3VQQA 1WEZA 1R8BA 4AHVA 3MN9A 2MZSA 3KLFA 3HHLC 2CKWA 4KH1B 3HHLB 4BS2A 3QNWB 1S9EB 1S12A 1SUQA 2B51A 3QEVA 2HGNA 3D1OA 4CGFA 4GV9A 4FKXA 2F40A 3GONA 4Z7CA 4TY9A 1S6UA 3ZLJA 2HURA 2UP1A 3UDVA 5E41A 3NH0A 2W9BB 4DUYK 3A8YA 5HAOA 4YHHK 4QOTA 3VEWA 2DTJA 2MZ1A 3PJ9A 1DURA 2WSCC 2BA9A 2XLKA 4ZTJA 4DR2J 5ELZA 3LW5C 3UPFA 3Q7CA 4JS5A 3AJ2A 4K4SA 1S99A 2HRUA 4CERA 3OR2B 3JSBA 4W5TA 4JYAK 5SUHA 4F0KA 4A57A 5BR9A 1MWYA 4TY8A 4OHXA 3G96A 2V8VA 1RWMB 1EX8A 3IAYA 2DITA 3BGOP 1VQ6N 3D9BA 1LAWA 2ZHBA 3R8EA 3PW2A 3KMQA 2CZ9A 3VQAA 5D0EA 2QG9B 4PRFA 7AT1B 1D5AA 4PR6A 2ZBCA 1VIOA 3R5AA 1F5BA 3V1QA 3RRHA 2GHPA 3LDQA 1ZTWA 1WAJA 5HLFA 3QRRA 3CMEN 2HBKA 3CJCA 4CJUA 5CZVA 2QMWA 1QY7A 3AVMA 3I4PA 4KT0C 4FJ9A 4ENOA 3JTPA 4ZVHA 4ECSA 3K2YA 2IM0A 4KHQA 1JLFA 3UN3A 4PG4A 4ZPVR 1SV5B 2V4RA 1KQSM 1GLFO 4OVLA 4JKCA 1EJ7L 2VL1A 1R0AA 4CZIA 2IVMA 3D54A 1KS2A 3M30B 1KKHA 2RPIA 4NLCA 2DKOB 3CFRA 1HMVA 2HHTA 4KHYA 3FGUA 1VHXA 2IRXA 2HK2A 3ILJA 4OPJA 2DHAA 3G25A 2GIQA 5HMXA 5HMYA 4JKFA 2UUBK 1K0VA 1TL3B 2GQ2A 3DRSB 3R5DA 4OPAA 3VQ6A 1BWFO 2XYHB 3BQ2A 3AVJA 1Q95G 1N48A 1ASWA 1IBCB 2F4VK 1T9XA 3G10A 1VQ6S 2BTFA 1T44A 2HMPA 3V2UC 3HVTB 1WHYA 4HT5A 5CE3A 2HS3A 1TFYA 3VQSA 3C6HA 4NX9A 1AUDA 2AWZA 1NK5A 3OXLA 4WBFA 4IFYA 3CSKA 4ANEA 1MWZA 2VB6A 2FLPA 1YRUA 4HTUA 4ZIVA 3NRBA 1M1KT 1QTNB 3CI5A 5DMRA 4I0WA 3SCXA 2E88A 2V69A 2QMXA 2YCHA 3VV2B 4DR5J 3MPWA 1D8YA 3BN7A 3PCOB 3D7SB 4JI6J 5AQRA 2Q79A 5K14A 4O8UA 1U25A 5F3ZA 1ITPA 1U0SA 2DHSA 2J4RA 4OO1J 5GVQA 4OX9J 1T11A 3FK4A 4P6QA 2F63A 2CWKA 4OLAA 1H6KX 2YX6A 1F2HA 4JI4J 2D7SA 3VVUA 3OTOK 3QFWA 3CC4S 2SXLA 3CG7A 3G87A 4N8OA 4RBTA 1NJXA 3DOKA 2C1EB 1FDNA 2Z2MA 4LVNP 1YZ7A 1BWVA 5KOXA 2IVFB 3CJRA 1PJ5A 5AQTA 1DEJA 5L46A 2A5XA 3OVBA 3WNEA 3QWPA 3DMJA 3VQ7A 1H98A 4FWSA 4Y2KA 2BXJA 2HS0A 2EG1A 3HK2A 2MLXA 1WHWA 2QEXN 1VQLN 5F2RA 2AGOA 4LMZA 3MGJA 3T9NA 4QWAA 4ATNA 2HIYA 1NM2A 3P38A 4HHJA 4OJ1A 4XPCA 5DQGA 1SQFA 4NYNA 2W9CA 3W3SA 2GGPA 2L08A 2RHQB 3TP2A 4QU7A 1F5CA 3SIPB 1HBNA 4FPAA 1YJUA 1Q86O 5GMDA 3QJPA 3X1LB 4DL5A 2VYPA 3MPYA 5LXYA 3IDHA 2KT3A 3W2VA 4X4QA 3CTRA 1RT3A 3BH6B 1YLXA 4BG8A 5EU7A 4F25A 4ZK7M 5A8WA 1RWVB 4O4RA 3E8OA 3M6VA 3KLIB 2RF2B 4WTOB 2QFJA 3VEZA 1C0FA 4KHUA 4ZN1A 2QA4G 2KO1A 5AQOA 4NLWA 1X9WA 3GP9A 5D4LA 1D9DA 3EEQA 2FSKA 4PY5A 4CO1A 3CDBA 5HATA 4CLYA 1S6QA 2GO8A 4NLTA 1HW8A 1X8DA 2WAQD 1U1OA 2HQDA 4PABA 3DXMA 3SXLA 4YR0A 2FB0A 1WG5A 5LOQA 1HI1A 4DU7A 4DV6J 5IM0A 3NS5A 4M5IA 2QWMA 5JJBA 3L6QA 5CZXA 5ITHA 2QEXS 1VQLS 3AFGA 2LQJA 3O9QA 2Q2RA 4IO9L 4DL2A 1FJ7A 1UETA 4WK1A 1JNZB 4X64K 3QEXA 4DV3F 3QINA 4WIIA 3G8QA 2CQ2A 5M1KA 2QLJB 3CM6A 4CGJA 3B8AX 4NYFA 1U26A 5G4DA 3OR1A 2CJYB 2ZUGA 4WFBL 4Z7YA 3U6FA 1CC8A 1G6BA 3AY9A 2XMTA 3CJ5A 1GMUA 4GVMA 2BKOA 1HBOA 1E6YB 1ZM4A 2HHHF 4H5VA 2HNYA 2V8DA 4LFAK 4NXMJ 2DGTA 4NOHA 2F3JA 2B4OA 2WB4A 4PG5A 2RD5C 3I4HX 1N32J 4C4WA 4FSVA 2OPSB 3I55N 5AQUA 1RTDB 1PJ7A 2EFQA 4OJ3A 1XC3A 2MPUA 4DX8H 3OLBA 3KK1B 5JXSA 5JLFA 4CZMA 3MR7A 1X31C 4LF5F 1S97A 4ZP6A 5ETMA 5ETTA 4PKDB 5FROA 1XMOK 5FRNA 5U47A 3LP0A 4A8FA 2XSFA 5KT4A 3KG4A 1IKVB 2W8KA 3CJ9A 5M1QA 1CS4A 4K0KK 1NK0A 2V68A 4RNNA 2HYIB 2ZVSA 3H5YA 2A18A 2GZOA 2R7OA 1ZC6A 4H5RA 4M5GA 2K3KA 5AZJA 1S6PB 1UA0A 5FJ4A 3MHYA 3W9IA 3AQOA 4NCGB 2HLTA 2IIRA 3LOUA 3T1YJ 4H0VB 2KXHA 4PA1A 4EO6A 2Z8QA 3C6UB 3V9SA 4BWMA 5L9NA 4CHQA 4X4SA 4L8RB 4ED4A 2BANA 2IAJB 4AF1A 1Y5NB 2XY5A 1YSJA 4X4NA 2VQEK 1AROP 1XMQF 1QVGR 1OKJA 1C0TA 4E1JA 4I2QB 3QZ8A 3HT0A 2FVCA 4IEIA 3T69A 4LSNB 2ZM6K 1FFGB 4ZHRB 5A2QY 2IHR1 5AQLA 2NXUA 1ZETA 1KSPA 1M90T 3TA1A 3J80Y 4WP3A 2UXCF 5HVHA 3NBPB 3I55S 2KG1A 2N82B 4CZKA 2OFHX 1NMNA 4DUYJ 3SNNA 2Z2LA 4YHHJ 4J91A 3A4TA 5JS1A 3ATUA 1UW9A 2QYCA 4HDHA 5KFVA 2W7AA 3E1YA 1EKEA 5M1NA 4YR2A 1OH7A 2GFFA 1N8RO 5BR8F 2BJ9A 3CD6N 1EHWA 1OQ3A 3QT5A 1MMNA 3OSPA 4QR1A 4MIWA 4JYAJ 2AYEA 1M5SA 4NLSA 4DPOA 4Y0WA 1J5OB 2E4LA 4JKDA 3JSMB 4FJNA 1KBRA 4N47A 2HFVA 2WRMA 4CK2A 1YBAA 1GLJO 2J0WA 2Q36A 2EK6A 4FK4A 4JI2F 1NGAA 3RR8A 2UXBJ 1B0TA 1Q8KA 3AXKA 4ZIWA 1WEXA 3JTNA 2OD6A 2D74B 1VSIA 1KAXA 3OUYA 3KKFA 3GYGA 3I8DA 1IKWA 5AXMA 3F9MA 5D0GA 2GJIA 4HEA9 4X2BA 2LA4A 5KG4A 3G82A 4X66K 1UOCA 4B9NA 1HJOA 3C95A 4YDDB 4DR7K 2E1AA 2FVRA 3MR5A 4K8ZA 2HQIA 3BSNA 1M5VC 5EX5A 3MM8B 5C5JA 4CCHA 2E2NA 3EDRB 3IA0A 1S9FA 1NGEA 4BC5A 2AEMA 2CPIA 5IT0A 4RW8B 1D0EA 2ZJPL 4ELTA 3CXCM 3OFHA 4IH7A 1NJIO 1XNRK 3HFKA 4GVEA 4N8NA 3L3VA 3S3NA 5D3GA 1EAYC 3BSCA 2ATLA 3GG0A 1U1RA 4WE1A 2NXEA 3CCUN 3W8GA 5GAGP 3O80A 2UUBJ 3CD6S 2I7PA 3PXGa 1MW7A 1VQMN 1FI4A 3DOLB 1M0SA 1NCLA 2Y0SD 1S0OA 2B6AB 5A8KB 3WT0A 4EAHD 3MCPA 2F4VJ 4DPWA 2OZSA 2B9XA 1KHVA 1TKZB 5FPDA 4OX7A 3P6YC 4AUKA 1TVRA 5KFUA 3HM8A 2MLZA 4KH0B 5IT9O 2YHYA 5KGXA 4ICLB 5LXRA 4ECWA 4RJVA 2D5RA 3IFRA 3EE8A 1QLNA 3G6EN 1HKCA 2BE9B 2LQ9A 5HK4A 4PZVA 1J53A 2FC9A 3PY8A 5E3QA 2BJ3A 2RS8A 3K2PA 2MHEA 4LFCF 1N4LA 2P9PB 3IKMA 1X4CA 3JYTA 3MM9A 3OTCA 3S3MA 2VFRA 4UUXA 4DN9A 1KRPA 1FRHA 2AIRB 5HO4A 1VQ8N 5D4PA 3CO9A 2C22A 2E5LK 1BDGA 1BLUA 4DTNA 1S79A 5ETNA 3W65A 1RBVA 1EIYB 1WWHA 3MXJA 5GAHP 3M2UA 5KPRA 2J6SA 1NK7A 1YUWA 4C8LA 1O51A 3CCUS 3OTOJ 2VONA 4OZ0A 5C24A 1HHSA 3BO3A 4EGLA 5HRRA 1RU1A 3HFZB 3E51A 1TZ0A 5L1LA 4CLWA 4A62A 1ZBIA 1VQMS 4FM0A 4CO5A 1H7XA 2I8EA 4O55A 1Q53A 5DZ7A 1SCJB 4LBIA 1F9FA 2BX6A 4I6YA 1NM1A 4ZLNA 1XC9A 1QTMA 2DNYA 2RU3A 4NI2B 1RNHA 3SQ2A 2ILYA 3ENHA 4UY8T 4XTTA 1QAIA 1NMEB 2V34A 2E20A 3SFUA 3NEKA 2YKMA 2I38A 4CT8A 2GA7A 4LY7A 4LF4K 4B9MA 3PSFA 2VBXA 4OYBA 4KH6A 1S1WA 3UCZP 1LW0B 1DGKN 1R43A 3TAFA 1RT2B 1W97L 2HSTA 4EU0A 3FKBA 2KXFA 5H9EK 3THYA 4C11B 2MQPA 3EDQB 4FBTA 2JX2A 2VPYB 1ZAXA 3G0ZA 1SPBP 2RILA 1LCUA 1VK8A 3S1TA 4X65F 4FM1A 1VQ8S 3JAMU 2C2EA 3G71S 4BRDA 1YWXA 2D4WA 2EPIA 3I5CA 1JCEA 1ZM3A 2JVOA 5HSPA 1OO0B 2GVDA 4ZN3A 4FF3A 2P9UB 3NDKA 3VQPA 1NGHA 3CMAN 4DZDA 4WK3A 1H3DA 4PL7A 2R7WA 5B0CA 3VAHA 4NB4A 3I33A 1WC5A 3FMBA 1JLGB 3FSIA 1FXLA 5EN1A 1VBZA 4E7KA 1CJTA 2RE1A 3DGPA 3SAHA 2WVEA 4RTFD 1S48A 2CJXB 3DHXA 4LREA 3TYTA 3OS1A 4Z0UA 3M2VB 4O3RA 2K2PA 5C42B 3S01A 4X64J 2HNZB 2VQFK 3M9MB 1VQNS 3LQVA 4DU8A 4O5FA 3IG1A 3H8YA 3TZZA 1NGGA 1AB8A 3BZKA 2D69A 5J2PB 4OPHA 1B99A 2ZWHA 1VDHA 4LFAJ 5KFZA 3V4IB 3CCEN 3J7ZO 4J2EA 2C2MB 2CPDA 1CJUB 2IJRA 3D1QA 4FKYA 3MECA 4WWSA 2HAFA 2PFUA 4FVUA 4DX5A 3SYZA 3MX2A 3L3CA 3V81B 4GKKF 3M1VA 5K8OA 4M3ZA 3WXMB 4ZPWR 3R3LA 4PYDA 3ZNUA 2MKYA 1GLEG 2RS2A 2JVRA 3ILIA 4PPZA 2UUAK 1M1GA 3F5TA 3EZOA 3PYGA 5F9NA 3CD0A 1MNEA 3ENVA 4CO3A 4OZ3A 1JXLA 2NS1B 1JL2A 5J1PA 2LXFA 5IQ6A 3POTA 1XMOJ 4IG3A 1DTQB 3ZETB 3TA2A 5DDRC 3CM5A 4NLOA 4IEEA 3NWRA 3DU6A 2G9OA 4K0KJ 1RTJB 2DK2A 1NLKL 5KFJA 1RCOB 1B9FA 3QWUA 5CHIA 3CJQA 1R7IA 3H59A 5TKYA 2C3UA 5AQHA 3T1AA 2J7KA 2YX7A 1Z2LA 3D3CJ 2W2MP 1AA1B 2OMLA 5L1IA 1YX2A 2NPFA 2ZEJA 4CGIA 2R8HA 4IOAL 2VG6A 1RT5B 2KJVA 1NG9A 4E3SA 3ZT1A 2W7OA 2A1BA 2Q0RA 2ALZA 2YWFA 2O1PA 1NPPA 1HWJA 2VQEJ 4OJRA 1WORA 1UAXA 3ISZA 3CCES 3AXMA 1GT8A 3CJ7A 3TUZC 3KKSA 3LPUA 3R6LB 4DR6K 2VGNA 2W1BA 5LSRA 1Q81T 5B7WA 3CCTA 3P8BB 5ETLA 1X9JA 1M5KC 3DXKB 2JWKA 4FZZA 3GWCA 3ADAC 4YR3A 4CGGA 3IMQJ 2HQ3A 4NO7A 1U2VA 3R1HA 2DO4A 4PEOA 4GMJB 3WQUA 3W63A 2AJ2A 2W40A 2FJEB 3IS9B 4OZ1A 3KXDA 2MY7A 3R5GA 2PFDA 1SC4B 5IWAF 1H0HB 1KD1T 1MWQA 2HBQB 2NUBA 1C0MA 2DR5A 1HUXA 5GADP 1N6QB 2IJFA 3LAKA 1DZ5A 4Y28C 4FWNA 4JK7A 3H5XA 4JRPA 4LF1A 5KQ8A 2G1HA 3L2RA 2B43A 3VF4A 1NZ8A 3AD9C 2XCPA 5HBMA 4WZQA 1TR0A 1SH2A 1U0HA 4QWDA 2I5JB 3I9V9 2F7VA 3KZBA 2RJZA 3L4QA 4PCQA 4BWJA 2ZH1A 1S4FA 3VQTA 4X66J 2RVJA 4FPIA 4DU3A 4A47A 1JKHA 4OL8A 1GX5A 3ULEB 4DR7J 2VWJA 5K8NA 1U7LA 3RBXA 1JLCB 5SWMA 4ANDA 3MMCB 4B9LA 3WUHA 2EEYA 1H1VA 1R6VA 3CQ8A 1WOSA 3ZFVA 1Y3KA 3TZWA 3PW4A 2Q6BA 2VZ9A 3DLLQ 1HPZB 2MKCA 4ED7A 1XNRJ 3GL1A 3LDOA 5GAEP 3H0PA 5AQSA 2EC0A 1QE1B 5D0RA 2D0CA 3MFHA 4FJ5A 5AZIB 3MDFA 2V4JB 3PRBA 2M70A 2OAUA 2PE8A 2ZZMA 2M7SA 4HACA 2M52A 3C15A 3IWXA 3AVFA 5AQFA 3TA0A 4E7LA 3PR5B 1U6FA 3AV9A 2K06A 4BGAA 1RWPB 2XMUA 3A2FA 4LRFA 1WN7A 1UVMA 3TU5A 1KQKA 3B8HA 3T1HK 5C12A 1MN7A 3K7RA 3BN4A 2Z57B 3QSIA 1Q7YO 3SSQA 4M1KA 1CEZA 1BQNA 4CECA 4PWUA 3AVNA 2W24A 1V3RA 2OEJA 4NWBA 2EKYA 4N76A 4R25A 4I7FA 5J2MB 3VWSA 1LWCA 4AHRA 1RK8A 4ZS6A 2O8CA 2FGOA 1VLYA 3BGUA 4MDAA 1N56A 3DN9A 5AT1B 4L3QA 4B3OB 3TVZA 5DG7A 1VBKA 1GOCA 4M94A 1Z25A 1JCGA 1QHAA 5AFUA 3HL8A 2F8HA 1VGYA 2ZZNA 3VMFB 2QL7B 1RHRB 2E5LJ 4MQ3A 2PGCA 2IGIA 5IV3A 2V9KA 2FJDB 2IY5B 5LMNK 2CA9A 3P3DA 2HBRB 2O8FB 1NK4A 2D0BA 1TUVA 3THXA 5AE3A 1RWOB 4TU7A 3QJJA 2DHXA 4AE5A 1IBLF 2ZZTA 2P1JA 3MUTP 4A8OA 2NR0A 5GIOA 3DCAA 5BXIA 4RWTA 2R2UA 3UN2A 1UEKA 4EFHA 4R8UB 1NK9A 3VCDA 2W4DA 5AE2A 2AGPA 4M7YA 2GHWA 5ETKA 4PG7A 1E6VB 1C4CA 4UZBA 3J81Y 3ETMA 8AT1B 1DJ0A 3C14B 5CYQB 5KFNA 2XMMA 1AZSB 2MEWA 3V6KA 4NZ0A 3I0SA 3FC9A 4BRQA 1TL4A 5KRSA 4F50A 1A9NB 2E1MC 4LF4J 2EHGA 3PIOL 1TKXB 3NCRA 4KHPF 2Q3PA 3EVMA 4KPCA 3Q8RB 1WC1A 4U7CA 3KJVB 4F04B 3VAIA 1I3OB 4G1IA 5H9EJ 4RUAA 4QS9A 4BRNA 2HVHA 4C3MA 3ZTRA 4NRUA 1GXTA 1U2RA 4CLUA 4HUGA 3KK3B 1P27B 1YVUA 2WVDA 3HJVA 1VSKA 1GLBG 1UCNA 4QBUA 2ZHOA 4G9ZA 1RTHB 3R9PA 4NCBA 2F8MA 2Y3YA 2W9AA 1TGOA 4OKKA 4KBOA 1WHXA 3MMAB 1CJVB 3M8RA 2GBZA 3Q8UA 4B3SF 1B7FA 9RUBA 4P2FA 3K17A 4KYZA 4WP8A 3BV8A 1XIQA 2WOMA 2C2DA 4PXDA 1RKIA 3OW2R 4CBXA 1K8KA 1ZAVA 3KLEB 1Q0NA 2ZGYA 4DV5F 2OTLN 1ZM9A 3I96A 2IJNA 5DM6Q 2FC8A 1B0VA 2CXEA 3BSOA 2ZBQA 2BBEA 3PW7A 1WF0A 3D2FB 1NJWA 2VQFJ 3SUOA 3TX0A 2WONB 3MMBA 1NSKL 3MAHA 5AQZA 2Y1RI 4DR4J 1WC0A 4KFBB 3H98A 3ONQA 3PR4A 1X9MA 1APSA 1NGCA 1WSEA 2G2OA 4W92B 2NUHA 4CZFA 2QI2A 1OVYA 1H73A 3OYMA 3FGVA 2RRBA 3FZ2A 1EETB 4FYDA 1CJKB 5ETVA 3VQ5A 1S1VA 4CI0B 4Q8FA 2EW9A 3LANA 3T41A 2UZAA 2WW8A 1DTTA 4AFFA 5FRMA 4ZP8A 3DRYA 3M6XA 3OBWA 4QW8A 1UVJA 7FDRA 1HIYA 4IRDA 3GMGA 1IBKK 1RBSA 3CWJA 4OI3A 2UUAJ 4JKHA 2FGCA 3S3OA 1QD1A 4K4ZA 2FHKA 1X3MA 1UW4A 3L2UA 5T7LB 2MKSA 2CNLB 3NH2A 3MM7A 3VGVA 4J9NA 3O9SA 3QPIA 3M8SA 2O8DA 1NB7A 4O44A 4DV3K 4UUWA 5KFIA 3QESA 2QXFA 3M8WA 3U7JA 5GINA 3GSDA 2GX8A 4WQ4A 1RYSA 3K9JA 3H2VE 1RI7A 5B0FA 1RDDA 2FQQB 1S1TB 1H72C 2RUSA 3T19A 2AX0A 2QZ8A 4QQBA 2ZH4A 4BC7A 3EVOA 1RAHB 4B3RK 4M5HA 1RLDA 3NGUA 1XTZA 2E7XA 3FEYB 1S57A 4XEIA 1HNWF 1U02A 4Q2LA 3HKZD 2YHAA 1VHIA 3ZSQA 2IS3A 3FR0A 2VC0A 1S5ZA 1SH0A 4DR3F 1Q1KA 3OL6A 4DR6J 1MA9B 3H4BA 4G1QA 4C3KA 3EPIA 2ZH6A 3IBCB 1YQHA 3VEVA 1NSQA 3TAMA 4P52A 2NXNA 1DQ9A 3HVRA 1ELOA 2ZOGA 4HH0A 4N56A 1J5EK 4CO4A 1CG2A 2V2VA 4X84A 3SLCA 3DGVA 3NE6A 2NZ4A 3H7HB 4ES2A 1X5OA 4ES1A 4DCPB 2XY6A 3MN6A 2QKKA 2VU5A 1YHQS 5BRHA 1HQUB 2HFSA 4PQUA 2KKHA 2VBYA 4AQYF 1K1QA 3TEGA 1UEUA 3AA4A 3FQKA 1C0GA 2P5VA 4JI7F 3PIPL 4ECQA 3M7VA 1SBRA 2KHOA 5F8NA 4ID8A 3C0BA 2PAVA 5EXWA 2GX9A 4RU2A 5AQMA 2IM2A 4J2BA 1XMQK 2MB0B 3LGHA 2C3PA 2YKPA 1S1XB 4TVAB 2AYBA 4EEYA 3RBEA 3SMSA 2QFIA 2DNLA 1O5JA 3FCHA 1RT4B 1C1AA 1TMJA 1PC5A 3UW1A 4K2JA 5GMEA 3FZMA 1P1LA 1HYSA 1C1BA 2ZC3A 2PA3A 3QAEA 3FSXA 4FLUA 3WEEB 3DLKB 2JC1A 4FWMA 1IR1A 3AVCA 2VHGA 4CTAA 4PWDB 4ZVSB 2YHWA 3OV7A 4FWLA 5BR8K 2Z1GA 3N6NA 2BR0A 3BEGB 3B6BA 4JK8A 1VQKN 3GU0A 3SCKE 2DO0A 1VRQC 4USTA 3BGLA 6AT1B 1NGIA 1V4SA 3VHQA 5LM7E 1JJ2R 4FJGA 2CNNB 2IOCA 2KRBA 1PIEA 1NLVA 4DQIA 3Q8VA 5LJ5Y 1X4FA 5FLXY 3KUHA 2B0GA 2ROEA 3BKUA 1UFWA 1UA1A 2D1KA 3GYXB 3HX9A 2NCKL 1QQNA 3D0IE 3VAGA 4IFEA 2CH5A 4QIVA 3LP2B 4ZA1A 2FZGB 3MEEA 2ZWPA 4DF8A 3NF6A 4EHUA 1N33F 2B56A 5G0RA 1HL6A 4M5DB 2EWSA 2BQUA 4H0TB 3T1HJ 2BE2B 2VKRA 3DM2B 5KFOA 1J2VA 5IT4A 3TUIC 2U1AA 4FJXA 1X4DA 2MGZA 3R5JB 3UO0A 1VQ4N 4EBCA 4RUBA 3KG1A 3NMUA 3KK2B 3MZIA 4FJLA 4BRCA 2WBMA 1EQ0A 3MEKA 3IP0A 3A0IX 2N3OA 4CYUB 4GVBA 4JHDB 3FZLA 2G2ZA 3AD7C 3CCLN 3JQMA 4DV1F 1WSHA 3CJKB 4HCCA 2GMHA 4WKRA 3AO3A 2YX1A 5KPZA 1JK9B 3GIMA 3CFPA 3D0GE 1VQKS 3MAAB 4CNYA 3UWTA 5DETA 4H0YB 5LMNJ 4DL7A 2V2KA 2YKNA 5EWGA 1VQ5N 4JB8B 2VCPA 2B9EA 4LF8F 1IN0A 2B9YA 2I0XA 4FPRA 2AJQA 1RBLA 2UVWA 3SMPA 3M32A 2O4GA 2XWXA 1JJ4A 1SUQB 3PLAA 5GMKa 1UVKA 4M63A 3MOJB 1BISA 1HD0A 2Y0BB 4I2PA 1EZZB 4IFVA 5AQXA 4EWTA 2HBYB 4FZXC 3T6BA 1S7HA 3V6JA 5CXTA 2NSCA 1HNXF 3R5BA 4ANCA 4KB7A 4CO0A 4YY3K 2BYCA 3SDEB 3WX8A 4B9VA 2DPNA 4JI8K 3EO3A 2OP5A 3CC7S 4HHUA 1Q78A 2YQ1A 3B6PA 4JI5K 1DHMA 4P73A 4DF4A 4CJFA 2GMJA 4H4MB 5I42A 1FCAA 4TY8B 3MR6A 1SJQA 4IKFA 2G4BA 2QW9A 2JJ4D 1TKTB 3LPYA 5F8IA 4K4YA 3E3XA 4KV8A 2LQBA 2DRDA 5F8LA 1U09A 5CCLA 3AH6A 1RGVA 3DRXA 2C2RA 3K57A 4KAZA 4OHYA 3CCJN 4DI6A 4UOHA 3U9ZA 1HKGA 1RTIB 1M1KO 3R7SB 4O3SA 4E89A 4A8QA 4MLEA 1Y5LB 2WW4A 5JVHL 1N0UA 1LXNA 1JLFB 5DGBA 3ZX3A 2RT3A 1UZDA 1XUPO 1JLEA 4OZ5A 5C2GA 2OFGX 4C23A 2XI2A 2VOPA 3A13A 1KHWA 1BD6A 1LKZA 2VG7B 4NLPA 4A8KA 1N34F 4GMKA 3BKFA 4K7QA 1D4XA 4D3GA 4OLBA 4FWQA 2DEJA 2H51B 3DFEA 1PYTA 1T9WA 5RUBA 3ITHA 3FFKB 2JEJA 3M2RA 2CQCA 1RHMB 4KHSA 2Q1NA 3UD4P 3BYRA 4OHVA 4Y2AA 4QIEA 3HD1A 1HKBA 1L3VA 3DHWC 3R6GB 1VOMA 4X65K 3MWTA 2HBJA 1W9HA 2DNKA 3EJMA 2VKZG 4K4XA 1FT8A 2IBOA 2Y1JA 4Q45A 1HR0F 1RT7A 4DL0C 1BI4B 4XAKA 5C2CA 3R9LA 1RDWX 4CLKA 2HBLA 4WF9Q 3F9KA 4H4OA 4CIEA 2ROPA 4FZYA 1U49A 4WFAQ 2CIMA 2MKKA 4X62K 4DR1F 1XN9A 2RE2A 3CCJS 1RU2A 4FJJA 4C8OA 1RBTA 4KH5A 1IBKJ 4LF6F 3J7YP 3BGFA 5I3UB 3ZZ0A 1SKRA 2G8IA 3VQDA 2E66A 1AT1B 3U3GA 5DLGA 4H0XB 2HVZA 5K14B 3TUJC 4DEZA 4LSLA 3OJSA 1FRXA 1DY3A 2PI4A 2W6LA 2ZJQQ 4CIFA 3O3FA 4DV3J 5KFEA 3OXGA 3G4SN 2R2RA 1WB9A 3P4IA 4JI0F 3ATVA 4V19S 2J76E 1ATNA 2R9LA 3HO1A 1UPMB 4JP8A 4J8FA 2W01A 2E9RX 2HHSA 3MOZA 4B3RJ 2CJAA 1OSDA 1JLBA 5ETPA 1O13A 1DT9A 2ZH2A 4UW2A 2W2PP 2HSEB 2ZBIA 4WXOA 3CQXA 2BKNA 4WKYA 2E5JA 4BQZA 5DDOC 1DRZA 1LEOA 3H90A 4CNZA 4OKJA 1UFLA 3HFVA 4U7BA 4CEAA 3OLAA 3PO4A 4ZVQB 5HP1A 2W9CB 3C3LA 1YJ7A 4IG0B 5B8HA 1EKRA 1LWFB 4LF5J 3OVNA 4B3MF 3IXQA 1LWXA 1S3XA 4CP5A 4QW9A 1J5EJ 3RWUA 1K73T 3NG8A 3RB0A 4CF9A 3CE8A 2DFFA 2AP6A 1OYEA 4GC6A 2L9NA 4LIWA 3I0RB 4Y0FA 4FJ8A 1RT3B 2FBYA 3G9CA 4ZP7A 2W9BA 4MYTA 4YS2A 1SI9A 3NMRA 4C0BA 2J9CA 2OYQA 2AF6A 5D77A 1VBYA 3UKUB 4MFBB 1Z6RA 1ZA2B 3GB0A 2ZC4A 3KHGA 3CPWM 1C4AA 5B0EA 3G4SS 2F8SA 5MLCV 2H48B 2BEFA 2UUWA 1S6QB 3NNAA 3P5BP 1VBXA 3IO1A 4F26A 4MKAA 2LSNA 3CC2N 1XMQJ 3MM6B 2OSQA 3O9UA 5A8RA 3EGNA 2WC9A 3NCIA 3VR1A 4ZLLA 2XS7A 3EY1A 2G8KA 2OLWA 5IM0B 3R3TA 3DDIA 4CJWA 4DV7K 4EK2A 3CETA 3JS9A 5IV4A 3V1RA 3FDSA 5B0DA 1U45A 3N5BA 3CMQA 4FF4A 5HOOA 2NQPA 3EKUA 1Q5YA 1MMLA 3R1XA 4LFBF 1KCFA 5BPNA 2RHKA 3SMZA 3OR1B 3R27A 4DS5A 2IA6A 3VZHA 1W0HA 5BR8J 2NYHA 1WSVA 1HBOB 4IOCQ 5J2QA 2HNYB 1YVFA 1FKOA 2R8JA 4O3OA 1TK8A 4WQ5A 3HOTA 3CUNA 4WFNL 4OHWA 5DDPC 4LF7F 2N7YA 4A2BA 3HPOA 2CQBA 3M30A 3MM5B 1WSGA 4WTYA 2Z1HA 4LRBA 1RLCL 2RMLA 2G1DA 1M90O 4EIAA 2FBVA 3O44A 2R7TA 4LF2A 3W5ZA 3UNGC 4Y3CA 2JH3A 1F9HA 2OI2A 3BPSP 3DRSA 4OZLA 3DC2A 3NGKA 3VQ4A 3ZXWA 4CJVA 2J9DA 3LO3A 1UP1A 3HM9A 1SAZA 3MF5A 3LP0B 4Q5VA 1LFPA 2NNWA 2KYZA 1RJJA 5KT3A 4I1TA 3U27A 3HVTA 4FO0A 4J9RA 3NGYA 5CQGA 3CJTA 1IH7A 4J2DA 3IUCA 2CZ4A 5LJ3Y 4RWWA 5AZJB 3WDOA 3TAPA 2XNRA 4BR2A 5BPLA 4HH1A 2KZMA 4RO0A 2CPFA 4RW9B 1X3NA 1YGYA 3Q89A 5KFRA 3AB2B 2KB2A 4WYLA 1I6JA 4BLGA 3P49B 2UV8A 3TOQA 4Z4EA 3FUYA 4FVCA 1EKSA 3PEJA 3IM8A 2ADBA 4M3UA 2X6NA 5I3PA 5E7OB 3MXMA 2UYTA 5F8JA 3Q7BA 2R7YA 1C0TB 1B70B 5AJ3K 1OPZA 3RTVA 2X51A 2KYXA 1FNMA 3U1LA 4WU2A 4C0OC 3ZT4A 2RIJA 3GE9A 1Y10A 3KUGA 2AT1B 2VIHA 3GV7B 4X4OA 4LR9A 3M6UA 2R8KA 5M1PA 3DDKA 2YWEA 3TABA 3OFFA 3CIPA 1KVCA 4YY3J 4OZJA 3US5A 3NGSA 4C8MA 2GWJA 4B3TK 3M8PA 4JI8J 4LFCJ 1FWKA 3DYAB 2GAHC 4NRTA 4JI5J 4DXLA 4ES3A 3MR2A 4RKUC 2B5JB 1R8AA 1BIUA 3HP6A 4F2RA 5KFWA 5KFHA 3SUPA 1DFDA 2AYGA 2WCXA 1XQSC 1JLQA 4IR9A 3DLHA 1P9QC 4LD0A 3IC1A 2YWWA 5EWEA 2M0GB 4NZ7A 3VF2A 3S9HA 2XEXA 2KLAA 3EZ5A 4NLUA 1P6TA 3CJ4A 3G82B 3BBBA 1HNZF 1VCTA 2KM8B 4LSZB 4LBPA 4GRSA 1O6XA 1IKXA 2RF2A 1QUPA 4AD6A 3NMAA 1FRJA 2MKHA 1G2EA 2XMWA 2VPZB 4ERDA 4QU6A 3SSSA 1HQEA 4R0EA 4KQZA 3J7A1 4FS1A 1XHZA 3NAIA 4I6MA 3C8YA 4ZCLA 1CLFA 4FCYA 2YNHB 2IBKA 3GFYA 5D3GB 5LT5A 4O4GA 4WE1B 4MTPA 4ETZA 4KHPK 3BJYA 1WKJA 4I6WA 3KK7A 1YKWA 4Z4IA 2RDJA 4JI6F 4DFMA 1QAJA 2HFNA 4OX9F 2AHOB 3TR8A 4ELVA 3RMBA 1I94F 4A8SA 4X65J 1CC7A 4H54A 1VSJA 4OJGA 4LH5A 5M2UA 4NA2A 2PY5A 4PG8A 1H2VZ 5M2PA 1BA1A 1GOAA 4JI4F 4UY8O 4YN3B 4Y1DA 2E1RA 3ELHA 4DUZK 5DS7A 1BOTO 5MAOA 3KJFB 4BRPA 1F2GA 1T03B 2JSXA 4KR0B 4XDCA 2R7SA 3SQGB 1FDDA 3DLEB 3ZNJ1 4KB0A 4X62J 1U4BA 5E3AA 1F1BB 1RT6B 3MFIA 3IAM9 2Z56B 4B8CA 3VETA 4X4TA 4KB1A 3WQPA 4DV5K 4IDHA 2OPSA 3ASMA 2HOEA 4GKJK 4B17A 1TP7A 4L72B 4H4KA 3FZHA 1VQON 3VA0A 3MM9B 1AYEA 1FRLA 5KAKA 2DD8S 3K5MA 2ZNZA 3KK1A 2CNKB 1FWLA 5I9EB 1U48A 1XK8A 4RNOA 2E9TA 1V6HA 1U1NA 1HYZA 3HSZA 5DGAA 2CGKA 3OYLA 4M45A 2BUPA 3RB3A 3SQ0A 3QGIA 1J27A 4J37A 3VGMA 4DN0A 1N5TA 1U8SA 2RRAA 4OYWA 3AA5X 4Y2IA 4J2AA 2OTJN 2QA4N 5HROA 2VFUA 2YBVA 3DLRA 3R7BB 5T14A 5IT9U 2FLLA 5FPMA 2HHVA 4W98A 4NPOA 1EP4B 1MU2A 4FXWA 4ECRA 3U8XA 3BBCA 3DU5A 4GY2B 1XI1A 2K3IA 4R5PB 1PAUB 1Z05A 2QM1A 2J0QD 1ZBHA 2MSSA 2W4CA 4IO9Q 2YKMB 4Q44A 1I3AA 4BRGA 2DGVA 3EXYA 1SKWA 3SJHA 1FVSA 3VQBA 3NWGA 2E1ZA 4ZHRA 1S1WB 3LL3A 3DLJA 1KAYA 2Q31A 2R42A 4RX6A 4DOZA 3EM1A 3NBPA 1HD1A 3J7AP 3O4NA 2PT0A 1N5QA 1RACB 1IR0A 5KFMA 1RA6A 4ECUA 5ETQA 4W5NA 2MZJA 3R2DJ 1BHNA 4ED8A 3QLHB 5KFXA 4S0MA 5BRFA 3VTHA 1QS4A 4Y65A 3PHTA 3KD1E 4DTMA 4WP9A 4DPTA 3AVLA 3JSMA 2QA2A 2BH1A 2OTJS 5M2RA 1V5VA 4F3OA 3L0QA 5KFQA 4MKYA 1HWKA 4C48A 1SL0A 1FEEA 1CJTB 3DGPB 3D5MA 1YIJS 4JV1A 4Y2CA 3W66A 3G6XA 4DV7J 2CG4A 2YY3A 2LDIA 3GV5B 4J90A 1CSJA 3S41A 2DT9A 3FMWA 3NAHA 3D6HB 3RMDA 3P83D 1S0MA 3UI3A 3IG1B 4H5TA 4LVOP 1FWPA 3TANA 1TU0B 1X7VA 3QNNA 2YJFA 4YOTA 3EE3A 1Q9XA 1V5IB 3MM8A 4Y2MA 3C66A 1MROB 4AQYK 3O3LA 3Q2SC 1QAXA 1FXDA 4ZPBA 1TL1A 1YDLA 3RSEB 4P7TA 1A5VA 3C7NA 1FXRA 4JI7K 1NEEA 3GJTB 1Q81O 3H6EA 1Z2ZA 2IRUA 4F4YA 4CD3A 3MECB 2DISA 4G3IA 4J9PA 4IJNA 2W2NP 1G7CB 3T1YF 2DTUA 3UE5A 1RHJB 1RWKB 4QPTA 1HHTP 1HWIA 2BRKA 2DR7A 2R3VA 1KTVA 2P9EA 4B1ZA 2VWBA 2V50A 4DSJA 5AQQA 1VJQA 4AHCA 5AQIA 2IVNA 1NBEB 2B6AA 3O9TA 1KNZA 1Q8LA 4W90B 1KD1O 1VS3A 2DHGA 4Y00A 3J7YU 3ZZOA 4OYPA 2PZSA 4JD2A 2FPHX 3V6DA 4ICLA 3CCZA 4YHHF 2ZH3A 1HBUA 4NLYA 1VSDA 2BOPA 3KKRA 4J9SA 4PUOA 4CLFA 4BR5A 2K1RA 3LP1B 1A6LA 2WTUA 1SKUB 2H5IB 2VG6B 1RISA 3EICA 1PBAA 5E0OA 5BYRA 1BUXA 3MTJA 5E5NA 1EXQA 5J2NA 4ZDNA 2MQ8A 1FD8A 1KVIA 3DLLL 3CIZA 2J6TA 4LRAA 5AJ3J 5CZ1A 5F8MA 2LEAA 1EARA 1SIZA 5CCMA 3BKTA 1N33K 3AHPA 4G6VB 2O8BA 5CH7B 2OELA 1RSCA 1R8PA 3VVTA 4PKIA 2DBBA 2KU7A 4ED5A 3GFZA 1VSEA 1QSLA 2ZJPQ 1VISA 2OO4A 2UXBK 2YPZA 4UTGA 3VERA 2BE7D 2Y8WA 2C2KB 2JFDA 2Z4PA 3DKDA 3NKYA 3FZKA 1CZAN 2HK3A 2XZWA 1UWBA 5IOLA 3BB5A 1MDUB 4B3TJ 1DQAA 3PW5A 2KT2A 2IC3B 5K9FA 2EFNA 2KN4A 4DV1K 2XI3A 5LSOA 4WCEQ 4CEZA 1CULA 1Q18A 4FWOA 2ZJRQ 1QVGM 4FNIA 1IWGA 3Q2TC 3TZYA 4OI2A 1TMMA 3FRYA 1RGIA 3AO2A 3K5LA 4M41A 3PX4A 2XZDB 3R1LA 4DX7A 2LVWA 1N36K 3NCQA 3CYMA 4EBEA 3HSCA 2OEKA 2UUBF 4LF8K 1U0HB 1FJEB 3PZPA 2HQGA 4TU9A 4CZGA 4C11A 3UKRA 2HFOA 4ZMMA 2G8FA 2G8UA 1WTFA 3CC4N 4LJMA 2M3DA 1KQFB 1JKHB 5ADXH 1B64A 2N7CA 1OH6A 2X78A 3RGIA 4C97A 1BE4A 2J7WA 1HNVB 5D4OA 1ATRA 1HI0P 2QL5B 5HJXA 1T9TA 1NB2A 3PO5A 1V9OA 3BH7B 1PAEX 2V7YA 2BDPA 3LAMA 4OYZA 2ZOFA 2R7QA 3V5RA 4DV2K 1JLGA 4F8RA 4JI1F 2DFEA 4KHPJ 4NEZA 3UFCX 1F0XA 3THVA 2XMJA 4TYBA 4CJQA 4HACB 3C15B 3WC2A 3O08A 1ULRA 4O0JA 4N7TA 4QIGA 1ACMB 2MYFA 5DRKA 3KWMA 4M5NA 4IKAA 3UB5A 3F41A 3CJ8A 5C42A 3AB4B 5EWFA 2KZZA 4Z4GA 3BY5A 3VGSA 2ZE2A 3W8PA 2CJQA 4J9MA 2JWLA 1M5HA 5EHHA 2CYYA 4XDDA 3NL0A 1NDLA 1FX2A 4KHWA 3SI6A 2L48A 4Z4HA 3OTOF 1S9GA 4DSIA 3GIIA 4DUZJ 5FPEA 2DR6A 3V4IA 2I2YA 3DRPA 2VBWA 3QBXA 1BO5O 3TNVA 1CJUA 3D2EB 2QE5A 1WDTA 4DBQA 1ZZFA 4I7FB 3JAMY 2CGJA 4DV5J 2CQGA 1LWCB 1GTEA 2O8CB 4GKJJ 3U9DA 3H4DA 3HT3A 3RRKA 1RBUA 4MK7A 4CVNE 3TX8A 3O5BA 4IH6A 4CJTA 4DLGA 3UD5A 3OBYA 1X5TA 4JOUA 4K5RA 4FZVA 4ED6A 4DG1A 3WNHA 2ZOMA 3I87A 3E66A 4CZCA 2LDYA 2C28A 2OANA 1DTQA 5DM6L 2PYLA 3AO5A 2J8AA 3THXB 1RDRA 2GWKA 1NXIA 1LOUA 1RBAA 3ENWA 1K9MT 1J6ZA 2E2QA 1S49A 3ETOA 4B9SA 2MZRA 3IWNC 2M88A 2PA8D 4OYAA 3T7ZA 2OPRB 1PYOB 2QC3A 4ZCIA 3ZTSA 1RTZA 3FVYA 3OL9A 2O5DA 3SV3A 3V4MA 3W9JA 2X74A 2H65B 3QIPB 1NZAA 4DR1K 1RWUA 3TRGA 2A3JA 4ILGB 4LQ3A 1NDPA 2NRZA 4K43A 4ZP9A 1V3ZA 4CLZA 3D68A 2XTJP 3RB6A 3HI9A 1DLOB 4KI4A 1LOTB 2H4YB 4HHTA 1KFDA 3G2XA 4K8XA 4AL5A 4H5NA 3DXKA 4K4TA 1ZAWA 3M3ZA 3N0VA 5J1NA 1LXJA 3EPGA 3TVYA 5A2QO 4A5AA 3P1GA 4RW7A 5HMWA 3J80O 2OPPB 3QATA 3KLGA 4X64F 2RQKA 1HBMB 4OV1A 1Y3JA 4GW6A 3IS9A 3W7BA 1BC6A 1WUUA 4JLHA 3OS0A 2WHOA 1SKSA 2JC0A 5HI7A 2P9SA 1EWRA 3L4IA 2GIFA 3HMJG 4BQLA 1RBOB 1TV6A 3D45A 2YNGB 2F8TA 4LFAF 4NLQA 1N6QA 3K5OA 1JB0C 2WOMB 3CDAA 2CGLA 3FEXB 2E1CA 1K8KB 3MK6A 2DGQA 2HGMA 5E2QA 1FHTA 3CCVN 2LQ8A 3FFIB 2C2OB 4NZ6A 2EK1A 1LK7A 1WSFA 1SL2A 3N5FA 4ID5A 2ALYB 1BA0A 2J5AA 3L09A 3RW7A 1G4CA 2WBNA 3UDLA 4BC9A 2ERRA 2AEJA 1REGX 3THPA 2VJUA 2G13A 4P7VA 3FE1A 4YNQA 2XY7A 3BO2A 2HEKA 1XMOF 3ULEA 1REVA 3V9WA 2BJDA 5A0YA 2UXDF 1RAEB 2QO3A 1BY9A 4OYXA 4K0KF 2QSFA 3VA3A 4X4VA 2LEBA 4IOBA 3G6VA 4AQYJ 1WLJA 4DX6A 2BGGA 2QMUB 4JI7J 3K0SA 5B0BA 4I67A 4NA1A 4NL5A 1JMTA 3NH1A 2LP4A 4JV5K 1CPZA 4GO5X 1BHLA 5C7PA 4KTWA 3WXLA 2BQRA 2ATCB 2RNEA 2YWHA 3SCJE 3F56A 2B4UA 1FO1A 3HZ6A 2P51A 1X9SA 3BDPA 4IR1A 3CCQN 4A8MP 1V3SA 5ADZA 1RDAA 3BGRA 3MM7B 3O4QA 3B4DA 2ZM6F 4O44B 4LFBK 3CCVS 1WC6A 4WQ4C 1EX4A 4DCJB 2PIIA 4J5OA 2VD3A 1MWKA 4FPBA 4CEOA 3SSRA 3AO4A 3I6PA 4KREA 2FVQA 2W42A 4LT6A 2YTCA 1P9YA 1O1WA 2M2BA 4D3HA 3C16A 3AD8C 2I7NA 1WOPA 3PYDA 1EO1A 2EFOA 4LF7K 2CDRB 2OGUA 2RQ4A 2ACYA 3PNIA 1T05A 2PMZD 4PG6A 3OYEA 3FLCO 3FRZA 3C6TA 4B3OA 2VPXB 3EVWA 2P9LB 2GVZB 3N4WA 4FS2A 1UWAA 2IVYA 2HZAA 3CHWA 1X0PA 1KAZA 1OS5A 4MT1A 2J8SA 3VQEA 3OJUA 3C94A 1WNSA 3ISND 1N33J 3JQKA 4B9QA 3TAMB 2ZITA 3H20A 4WXWA 3BUZB 4CEEA 1NWKA 2ASDA 1ESVA 3D6FB 2JOQA 4OGEA 2HF4A 3N6LA 4UOCA 2YWGA 3JXUA 2P9NA 3WHIA 4OYMA 4X66F 2MKJA 4W5OA 2MHNA 4HTIA 5CABA 4L76A 4ZJOA 1MMDA 3CCQS 4PYAA 1L3TA 2XGQA 5D0HA 1E6VA 2QLBB 2NRVA 3BZCA 3C14A 3KFWX 2HZCA 4F67A 4DV1J 3WNFA 1AFIA 1XEZA 3BF3A 1FXXA 5F0WA 4AHSA 1OJ4A 2VG5A 3QQCD 4IJAA 1N36J 4FLVA 1AW0A 4OPKA 2H1YA 1RA7A 3NP5A 4LF8J 3D28A 4JAXA 3KJVA 2CFXA 2EFVA 2NRXA 4CZLA 2D1CA 1QSSA 4FWKA 1HYSB 1C1BB 2XMAA 2HHUA 1PO6A 4QOZB 2CQIA 2HS4A 1FJGF 4CH7A 2F9DA 3KHYA 1W7WA 2HGLA 2FVSA 4WFYA 3SAGA 1Y7PA 3KWIA 4CTAB 5KFTA 1CJVA 4FF2A 1T95A 1FKPB 3ENQA 4U9RA 3UIQA 5D8HB 4QYRA 4K4UA 1VJWA 2A40A 2DXDA 2H54B 3QT6A 2B9WA 3DOMA 2FJAB 1NU0A 1IVZA 1RILA 4K4WA 2V9WA 5K8MA 3FZFA 4MH8A 5DM7Q 3KLEA 3QJLA 5KFAA 4USVA 2HPUA 4DV2J 5DO2A 3VQ8A 1WC3A 4ZVUB 2E2OA 4YB7A 1V4TA 5IQQA 4F3TA 4EYHB 1D1UA 2E1PA 2J6UA 3TTFA 3DLGA 1NHVA 2P9KA 2E5IA 2JGUA 5BPMA 3ILOA 3UDCA 2E5LF 1RB0A 2B4VA 2QA1A 3RW6A 4EFAC 5G0RB 1ZBSA 3O1BA 3I32A 3OY9A 4GV6A 4KFBA 1GMVA 1HNZK 2FY1A 2UUCK 3G71N 2GNKA 2MGZB 3TEHB 1NK6A 2NLXA 3LDNA 1AXQA 3UDEA 2YH1A 1LFWA 4KC5A 4CDIA 5BYSA 4F02A 1QQMA 3K58A 4PXBA 1YK9A 5DZ6A 2WSFC 1VYAA 3BP8A 4QWEA 2ZKUA 4DUTA 1R6YA 2B3TB 3PIOQ 3ZTQA 3TJ9A 2Y1LB 2CQ3A 1FA0A 3NY0A 2BACA 4USHA 1Y4ZB 3NGRA 3EUNA 4E2FB 5AXNA 5JVGQ 4LF4F 4CIOA 2FXUA 5T7LA 3HSTB 1VQNN 4NYZA 3GZ7A 2WBRA 2CNOB 3MN5A 1I94K 4CZEA 1HW9A 2NLWA 3W0LA 4JI3K 4CJLA 4YP3A 3NAEA 4C1NI 2HMIA 4M63C 1NJYA 3AOAA 2QV6A 4O3QA 1N88A 4PWWA 2P2CB 1RHKB 2XSJA 4I2PB 2DH8A 3OYFA 2ZGZA 2GV9A 4CHOA 2DY1A 3D6MB 1ZZNA 3RB4A 3QGGA 3EGWB 2UU9F 4K25A 5KFGA 4DR1J 5J1EB 4UOFA 2HFUA 4E7IA 2DCLA 3UQSA 4FLZA 3HVAA 4HUFA 1HNIB 4Q0BA 3CPWR 4JKGA 1RXOB 4YMEA 1VQ9N 1GH8A 2LFVA 3PRVA 1VQPN 3UR3C 1QHTA 3VOVA 4WF9L 2NZCA 3Q24A 1IKYB 3VN5A 4XO0A 4YOUA 4ID1A 2D3ZA 3H45C 2QIFA 4CJ7A 1RWNB 3NOGA 2IDOA 1KDNA 3PYEA 3S6EA 1TUYA 3QDKA 2A10A 3OVSA 1DKGD 4E1MA 2VF3A 2Q6CA 2PSZA 2V52B 4KV8B 1TUUA 3T6JA 1B92A 1L5UA 2HVEA 2QN6B 4ZVOB 2RKIB 3O1WA 4M3XA 2XULA 3VTIA 1VRUA 3A8EA 5HVGA 1KLMA 2C3MA 4O3NA 3VGLA 4IXCA 3PFEA 2ZQBA 1HQUA 3SPYA 3TSQA