3DRPB

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 105
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB04
2VG5A 2F8EX 3KK1A 2YNIA 2WK4A 3IGNA 1S9GB 3OSPA 3GIMA 4FS2A 2BANA 4LSNB 5I42B 3DLGB 3CDEA 1R0AB 1J5OB 4MK8A 3BSAA 3GIJA 5L1JA 3QLHA 5KFLA 1S10A 1HQUA 3KLGA 5J2NA 1S49A 5KT7A 2WCXA 2VG6B 2WOMB 3JSMA 4ECTA 3CWJA 3OL9A 2AGPA 3H5UA 2W8KA 1JLQB 1IKVA 3LALA 3QLHB 5C25B 5KFTA 3H5XA 5EUHA 3HVTA 4MIAA 1LWFB 3V81B 3GQCA 2VA3A 2ZE2B 4PWDB 4KO0A 4WXOA 2I5JA 2BQUA 4RNNA 5KFBA 4DG1A 3VQSA 5EDWA 4JV2A 1RT6B 2YNIB 3DI6A 1TKXB 3LP1B 3BQ0A 3LP0B 5D3GA 4MKAA 1DLOB 2V9WA 2OPQA 1RT4B 2YKMB 2BQRA 4H54A 3DOLB 3DDKA 5F8MA 3M9OB 1RT6A 3DI6B 3IRXA 3DLEA 2HNZA 1T94A 4Q45A 3C6UA 4EBCA 4RW9B 4DL4A 1LW0B 3QZ7A 2R2RA 4PQUB 3DRSB 3KHLA 1LWCA 4KAIA 5DG9A 1REVB 3BREA 1S0MA 2VG7B 3I0RA 4WFYA 4ED6A 3KNAA 5DQIA 2I1RA 1RYRA 4RW9A 4IR1A 2RKIA 4DL7A 2JEIA 3H40A 2FJVA 4RUCA 4Y34A 1RTDA 1JKHB 4KB7A 3V81A 2HNDA 4ECVA 3DLKA 4ZVEA 3LANA 4EYIB 3TVKA 1TL3B 3UR0A 2IM2A 4IG3B 4IOBA 3DLKB 1HARA 2WONA 4PWDA 3GV8B 4ZVGA 3DYAB 2AX1A 1QAIA 4RW6A 4XPEA 3Q8RB 2O5DA 5I42A 3EPGA 4ZP9A 2XCPA 4K50A 1C0UB 1C1CA 3GIIA 2W9BA 1JX4A 4YP3A 4O3SA 3C6UB 4MK7A 1RT7A 5K14A 1S48A 2XI2A 4H4MB 1BQNB 1NHVA 2B6AB 2XCAA 3MR5A 5DLFA 4WZQA 1DTTA 1IKXB 4FBTA 1XR5A 5CYMB 2AGOA 3OL7A 1RT5B 4WYLA 5KT4A 1DTTB 4RUAA 4NLQA 2R2UA 3OLAA 2FLPA 3MR6A 3E51A 3KOAA 5F8LA 2JEJA 5KFHA 4KO0B 4B3OB 2W7OA 4QWEA 3KK2B 3T5KA 4ECZA 1S6QA 4O3NA 1TKZA 3KHHA 1RTJB 4O44A 4ZHRA 1QAJA 1EP4A 1KHWA 2XGQA 3KLFA 2R8HA 1TV6B 5L1IA 3PW2A 5L1LA 2D3ZA 1IKWA 2ZD1A 3NBPB 1JLCB 4NLYA 4GC7A 1ZETA 2BR0A 2JEFA 1HMVB 4IG0B 3N6MA 1YVFA 3G6XA 3IG1A 2YNHA 1RTHB 4Y3CA 4KBIA 1TV6A 2W9BB 4QPXA 3MEDB 3V6JA 4ID5B 2FVQA 4JUZA 1T05A 3TAMA 2ILYA 4EBDA 3NAIA 5F8JA 2BANB 4LSNA 4J9OA 4EO8A 2HAIA 2R8GA 3CJ2A 1FKOA 2RKIB 2ZKUA 2W9CB 3NMAA 3IGVA 2CKWA 2D41A 4NRUA 4TLRA 2HNZB 1JLFB 4R8UB 2AX0A 2FVPA 1D0EA 4TYBA 2OPRB 2C2EA 2IA6A 5HLFA 2B5JA 1LWEB 4B3OA 1S6QB 3E01A 3H5SA 1S6PA 1TQLA 3CDUA 1C0TA 3MEGA 3KJVA 4NLVA 4NZ0A 4K4WA 1S1VB 3HKWA 1HPZA 1T03A 3HVAA 1S9FA 1S9EB 4IFYB 1C1BB 1S1XA 1T05B 4I7FB 4KV8B 4ID5A 2B6AA 1RT4A 3PW0A 2XI3A 2IC3A 5HROB 3BGRB 3H98A 4YMEA 4GC6A 4IRDA 4M95A 4EO6A 3OL8A 4IDKA 3FSIA 1GX6A 2W9CA 1C0UA 1C1CB 5KFXA 1VRTB 3IS9B 4TY8B 2W8LA 1JLAA 3C6TA 3ISNC 4WE1A 2WHOA 3CJ0A 3NKYA 5DG8A 4F4ZA 3MFHA 4ED2A 1NNDA 5KFCA 3M9MB 5KG7A 5EWGA 2HMIA 3M9NB 4TQRA 4TY8A 3RBDA 1QE1B 5C24A 3GV7B 3HHKA 1HYSA 3MEGB 3KJVB 3FQLA 1T3NA 1JKHA 2VG6A 4FS1A 4K4ZA 4ED0A 5J2MB 3I5AA 1TP7A 1S1TB 4RW4A 4FBUA 5F8IA 3QO9A 1IM4A 4JV0A 4MFBB 4KV8A 4RNFA 4F4YA 2UVUA 1S9GA 1FKPB 2OPPA 3CDWA 4EYHB 3V6DA 1FKOB 2C2RA 4QW9A 4WYWA 3PW4A 2FVRA 3KK1B 5KFPA 3QYYA 2VA2A 2EC0A 4F4XA 5KFYA 4IQXA 1JLGA 4KSEB 4KE5A 1TKXA 4ZVFA 3MEDA 4K4TA 1S97A 1BQNA 1DLOA 4H4MA 2QV6A 3RBEA 3LAKA 4LQ3A 4K4SA 4WZMA 2FLLA 1S1UA 3DM2A 5J1EA 5KT6A 2V0NA 2IJFA 4ECSA 1TL1B 3H2LA 4MH8A 5KFFA 2UVRA 1N5YB 2HMIB 4HYKA 2J6SA 4RW7B 3QO9B 4IKAA 4R5PB 2FVSA 4RW8B 1TL1A 1N48A 1S1TA 3T5HA 1WNEA 1LWFA 3KMSA 3IN5A 2IAJA 3M8QA 4NLPA 4IG0A 3Q8SB 3OHBA 1JLCA 2YNHB 4ICLB 4I2PB 5L1KA 4EEYA 2AQ4A 2IC3B 5HROA 2AGQA 1RYSA 4NLWA 3D28A 1RTIB 3BQ2A 2ZD1B 3KMQA 4J9PA 3QIPA 5KFIA 5KG4A 5EWEA 1BQMA 3KHRA 1TKTB 1JLGB 5CYQA 4ED3A 4K4VA 1MMLA 1SV5A 2IJNA 5KFVA 5HP1B 3V6DB 4PUOA 1JIHA 2QE5A 4K4YA 3DMJB 4KFBA 5HBMA 1UWBA 4PQUA 5L9XA 1LWCB 3DLEB 3GYNA 1DTQA 1S1WA 2BRLA 3FDSA 3BGRA 1LW0A 3QGHA 4KHRA 4NLDA 3T5LA 5DQGA 5KFEA 4ECWA 1HNIB 4NCGB 4LSLB 1RA6A 5KG6A 2ASLA 1N56A 4Q8FA 2OPRA 2W9AA 1S1WB 1DTQB 2IM3A 3LP2B 3CJ4A 4TYAA 3KK3A 4WFXA 4YR0A 3ITHA 2FVCA 1S4FA 2OH2A 2HNDB 4H4OA 3G6VA 3ISND 4R5PA 2V4QA 1S6PB 2E9RX 3DYAA 1JLBB 5DLGA 4IR9A 4JV1A 4YQWA 3SFGA 4Y2CA 4O4GA 1RTIA 5D3GB 4DL5A 1TL3A 4F50A 4ECRA 1RDRA 1W25A 3PJWA 1IKYA 1GX5A 3DRRA 2J6TA 4IRCA 1RT7B 4URQU 4NLXA 1IKWB 4ZP7A 1IKYB 2ASDA 1R0AA 1RT1B 2OPQB 3T5JA 5KFDA 3H59A 3LP1A 5KFZA 1J5OA 4ZPDA 4K4XA 3TAMB 2OPSA 1N5YA 3PW5A 3GIKA 1VRTA 3IS9A 1N4LA 4RNHA 4ZPCA 4ZPBA 2YNGB 3DRSA 3DRPA 5C42A 4OL8A 3UQSA 2AWZA 2JLEA 2GIQA 3RB0A 3NL0A 4O3OA 2UVVA 2XWYA 3KK3B 1S1UB 4QWDA 5KFRA 3BSOA 3LP2A 5HLFB 1XR7A 1EP4B 5J2MA 4MK9A 4QWCA 1I6JA 1TKZB 3KLIA 2AU0A 1FK9A 3KK2A 1MU2A 1SUQA 4TN2A 3PZPA 3JYTB 3KLVA 5DG7A 2IMWP 1LW2A 5KG0A 2ATLA 3PVXA 5HP1A 4PUOB 4Q0BB 5F9LA 3H4BA 4RU9A 1CSJA 4MKBA 4DL2A 4TXSA 4LQ9A 3FRZA 1RT1A 3QGIA 5KFJA 3BJYA 2WONB 2JC1A 2RDIA 2RDJA 4J9QA 4NLRA 4R0EA 1HQEB 2GC8A 5KFGA 3CJ3A 3MEEA 2RF2B 2BE2A 4NRTA 5KG2A 5J2PA 1SH0A 3Q8PB 2YNGA 5C42B 2RF2A 3PR5B 2OPSB 2BQ3A 1RT3B 2YNFB 4RW7A 4ED8A 1RTDB 3C6TB 3DLGA 2FLNA 5C5JA 3KHGA 4WE1B 4RNMA 1K1SA 5T14A 5FDLA 3V4IA 1KHVA 5KFNA 1C0TB 3SFUA 1VRUB 1MU2B 1SUQB 1S0NA 3E01B 3MR3A 4XO0A 1LW2B 3KLIB 3DRRB 3DOKA 4HKQA 4YR2A 1EETA 2R2SA 4O4RA 3GV5B 1S0OA 5DGBA 5F8NA 3MF5A 4IRKA 4O44B 4ZHRB 4EBEA 4I7FA 4QW8A 3FQKA 3BQ1A 3V6KA 3T1AA 5KT2A 4ECQA 1UWBB 5KG1A 2I5JB 4DG1B 4IH5A 3DMJA 1SH3A 2UUTA 3UDLA 1FKPA 2OPPB 4I2QB 1JXLA 1SV5B 3EZUA 4O3RA 1KLMA 2IM0A 3FFIB 3T19A 1XR6A 1RT5A 1RT3A 1JLAB 2YNFA 3H4DA 4NLGA 3QGGA 5KG3A 5DGAA 5DQHA 2IBKA 5J2PB 4RNOA 2BRKA 4K4UA 2D3UA 5KFQA 5C24B 1TVRA 3CJ5A 1VRUA 4NLOA 1RT2A 2B43A 4QWAA 4G3IA 2HNYB 2GIRA 1QE1A 3H5YA 3OHAA 4URGA 4Q8EA 4O4GB 4Q44A 2HNYA 4H4OB 2WB4A 3BSNA 2C2DA 4IG3A 1JLEB 4Y2AA 1HMVA 3IG1B 1FK9B 3RB3A 4IH6A 3MFIA 2YKNB 2XC9A 3IRXB 1S1XB 5KG5A 4ZMMA 3DOLA 2WRMA 3KLEA 3KLHA 4O3PA 2D7SA 1ZTTA 4I2QA 4DEZA 5I3UA 4U6PA 3MECB 2R8KA 4O3QA 3DRPB 4J9RA 5KT5A 4KFBB 5HBMB 5F8GA 4RZRA 4KHMA 5J1EB 2R8IA 4J9SA 5I3UB 3PJXA 5JUMA 3SI8A 5CYMA 2C22A 2B5JB 4U7CA 3OLBA 1IKXA 2J6UA 4XPCA 4NLTA 5KFAA 5C25A 1HNIA 4NCGA 1RT2B 4WFZA 4URSA 3HVTB 2WOMA 1IKVB 1JLEA 2IAJB 3M8QB 3JSMB 3OSNA 3V6HA 1HYSB 5FDLB 2R8JA 4DL3A 1C1BA 1JLBA 3D5MA 5CYQB 4RW6B 3ICLA 4MFBA 3NAHA 3CO9A 1BQMB 2FJXA 4ED7A 4Q0BA 3CVKA 1HNVB 2DPJA 2HWIA 4ZVHA 3I0SA 4KKOA 4NLSA 2E9ZA 4G1QA 4QWBA 4X2BA 4IDKB 1QUVA 2ASJA 3BR9A 3RB6A 1HQEA 1D1UA 1SH2A 5KFSA 4YR3A 2YKMA 2ILZA 5J2NB 5F8HA 5KFWA 1ZTWA 3LAMA 1RA7A 2E9TA 1KLMB 2CJQA 4MIBA 1JLFA 4R8UA 5KFMA 4NYZA 4ZP6A 2W7PA 3M8PB 4IFVB 3V4IB 3N6NA 3BSCA 1REVA 3CIZA 3ITHB 1K1QA 5F9NA 2HWHA 5J2QA 3M8PA 4IFVA 4WXWA 1LWEA 4RW4B 1EETB 3I5BA 5KT3A 2C28A 3HVWA 1JLQA 3OL6A 2YKNA 1RTHA 1NHUA 2R2TA 1S9EA 4IFYA 3Q8QB 4J9NA 3G6YA 4ZPAA 3I0SB 4KKOB 3MTKA 3N6LA 4I2PA 4ICLA 1HNVA 4G1QB 1S1VA 1Z4UA 4J9LA 3TQ1A 2DPIA 4ZP8A 2WTFA 3MECA 4F4WA 3PHEA 1N6QB 4IH7A 4TY9A 4J9KA 5KFOA 1RAJA 3FFIA 2UUWA 3GILA 2VG7A 3G86A 4TQSA 1N6QA 5KFUA 2XGPA 3DM2B 1TVRB 3MEEB 2BE2B 1HQUB 3KLGB 3MR2A 4J9MA 1OS5A 4ECXA 4ECYA 3QZ8A 3RB4A 2UVWA 2FJWA 3I5CA 3PR4A 4LSLA 4RW8A 3UPFA 2IM1A 3RAQA 5KFKA 3I0RB 2JEGA 4Q43A 1HPZB 5J2QB 1U09A 1T03B 4M94A 3NGDA 2ZE2A 3JYTA 5JXSA 3NBPA 2VG5B 1TKTA 3PW7A 3QIDA 3QIPB 3KLFB 3RAXA 4ED1A 4DL6A 1C2PA 4NLUA 3KLEB 1RTJA 3DOKB 3KLHB 2JC0A 2V4RA 3EPIA 4ECUA 2ALZA 5EWFA 5K14B 3LP0A
chains in the Genus database with same CATH superfamily
1ZAVA 2F8EX 2QL7B 1KN6A 1SJ3P 4LFCF 4KT0C 1RAAB 5LXRA 3J7A1 5K5MA 2OD6A 2HKEA 2ZZNA 3QRQA 4FS2A 3FVYA 4LSNB 4W90B 1G2EA 2DGOA 1NJZA 3DLJA 2H5JB 2FY8A 1J5OB 1N0VC 3GIJA 4A8YA 4ZJOA 2MQMA 4TU8A 4NEZA 1YITS 3C14B 1S10A 1HQUA 1S59A 4L72B 4B9UA 3CNQP 2LEAA 2VG6B 2WOMB 1G4CA 3CWJA 1N54B 1EKSA 5GMEA 2DHGA 2HFNA 4L6V3 3M8RA 2W8KA 1R7IA 3CCRS 1N8RT 2HYIB 5C25B 2DXEA 2GA7A 2EKYA 2PN6A 2YY3A 4RLEA 1LWFB 2FHJA 4YB5A 3SQGA 3V81B 1E6VB 4LJMA 1YJNS 1PJ5A 3JS9A 1B0PA 1S7HA 2EFOA 2Z30B 1UAWA 5D0HA 3ZZYA 1GNKA 2X7IA 1FESA 3IR5B 1H73A 2ZFHA 1ZM4A 1MW7A 5CAAA 2HZCA 3QFHA 1NHKL 2CQGA 3ZZUA 1K0VA 2BQUA 4NXMF 5KFBA 5LMUJ 1SQGA 3JSYA 2Y1LB 2ZWPA 5L46A 3DI6A 1UW4A 1TKXB 1GQEA 2EI5A 3LP1B 3CJ8A 1J2VA 5HI7A 3OXGA 5ETKA 4ZCLA 3QPIA 1UKUA 3OR2B 2EFQA 4CQ1A 4H54A 2MLZA 4ZLNA 5F8MA 3M9OB 1RT6A 3DLEA 2HNZA 1IJEB 1T94A 3GJSB 4I6YA 5ETPA 3WX8A 3PY8A 2R2RA 4PQUB 4UOCA 5D4LA 1GAOA 3KHLA 1LWCA 3JXOA 1JNRB 1HL6A 1S0MA 3GIRA 1NDKA 2MEWA 5DQIA 4C11B 4RW9A 2CA9A 4IR1A 1WKJA 3CCVS 2JEIA 3Q24A 2FJVA 2HFZA 2BJ8A 2F1FA 2IRUA 2FB0A 1RTDA 1JKHB 1VJQA 4KB7A 2HNDA 3GMGA 3CJKB 5GAHU 4ECVA 5CD4A 3RRGA 2IY5B 1RE1B 5F0UA 1RAEB 3RTVA 2KL8A 1VCTA 2A6MA 1IN0A 1DAXA 2QL9B 2FYXA 3W2VA 2LDYA 2IM2A 1UW9A 3GV8B 3JQMA 1VISA 1QVFR 3UNGC 2FPHX 1ZZFA 4U96A 4ZVUB 1BUXA 4WK3A 2O5DA 3D6FB 4C8KA 1M5HA 1J27A 4K50A 5G0RB 4CNZA 2KG0A 1YHQS 3C19A 2DRBA 3NRBA 1LXNA 3C6UB 1DQ9A 1NM2A 1HHQA 1Z2ZA 2XI2A 3CGIA 5DLFA 3MR5A 2B6AB 2MKSA 3PO5A 4WZQA 1CEZA 1DTTA 1KC8T 4RBTA 4DX7A 3TA0A 1NK4A 3PYFA 3OL7A 4EZ6A 3ZZTA 1YZ6A 2OSQA 4PR6A 2RQCA 2VH7A 4RUAA 4C8MA 5KT4A 2XMAA 1FDNA 2HURA 2V2KA 3TJ9A 4DV5J 1FTCA 1EB0A 2FLPA 2F65A 1RAFB 5F8LA 4KO0B 5B0BA 3TAQA 1X9WA 3KK2B 2GVZA 3ETOA 1S6QA 3ZTOA 1V9OA 1TKZA 3KHHA 1MG7A 4ZHRA 1QAJA 1NLKL 2WVEA 2ZDOA 3U1NA 3M8ZA 5L1IA 2AD9A 4NLYA 1ZETA 1F2GA 2QMXA 3N6MA 4DUZF 1YVFA 2J76E 3J7Z5 3EYZA 3PACA 3IG1A 2YNHA 1RTHB 1SQEA 3M2VA 1KFSA 1TV6A 5E3QA 3MEDB 1F5BA 1WHWA 2R7RA 3LPEA 3V6JA 4HDHA 4JUZA 4EBDA 1YIJS 4EO8A 2R8GA 1FKOA 2RKIB 1WACA 1WSRA 3KUHA 3UCGA 3WC2A 3IGVA 2MKHA 1FTRA 2Z2LA 2HNZB 1VK3A 1D0EA 2HQFA 3GB0A 4PG4A 1UTAA 2IA6A 5HLFA 2B5JA 1WC6A 4RJVA 4DS4A 3EMTA 1FDAA 2BMBA 1S57A 4QIWD 2MY7A 3WX4A 5CA5A 2DKOB 1TQLA 1OQ6A 4PAAA 1BMQB 3EGZA 4NLVA 2W4DA 4NZ0A 2MZJA 2NZCA 5I3PA 1YK9A 4TVAB 3W62A 3Q23A 1FA0A 2N4DA 2DVIA 3I4PA 2K1RA 4N8OA 2JFDA 4WP3A 1S1XA 2ZWOA 1YJWS 2A6OA 2AYBA 4GKKF 1RT4A 1BLUA 2XI3A 1M0SA 1RAIB 2ROEA 4NI2A 5IC4B 5IM0B 1YZ7A 4CTAB 1U2RA 4DLEA 3C46A 2CNOB 4FPIA 2UXBF 2LDIA 3FSIA 1GX6A 4AXJA 2KFZA 3M2RA 3SZ2A 2W9CA 4P75A 2V94A 1C0UA 1C1CB 2MQNA 3IS9B 1RI7A 2CQ4A 2P2CB 4DR6J 1JLAA 4OJGA 4WE1A 4WWSA 5DRKA 3QWPA 4CO0A 3W1YC 3MFHA 2HZVA 3MGJA 1T7PA 1NNDA 4P10A 4EK2A 1WC4A 2VQFJ 5KG7A 3RBDA 2DNLA 1QE1B 1WHVA 3D1QA 4FP9A 4XTTA 3L4BC 1HYSA 4F7VA 2V8GA 1M90T 2CVEA 2LECA 4M5NA 1T3NA 3P6YC 4EZ9A 2MQ8A 5E2QA 4ED0A 4B9NA 4X65F 3KJNB 2DITA 1TP7A 1S5ZA 1VDHA 3WIUA 3QO9A 2CIMA 2HRUA 2K1RB 4CH0S 4LF6F 4AYBD 3CT9A 5E33A 3TZWA 2R7VA 4ZCKA 1X5OA 3ENWA 3PXGa 2OD4A 3AODA 2QLWA 1FNOA 1RHUB 1NB7A 3T3FA 3HJFA 3VGTA 5A8RA 2MZ1A 1YI2S 2CQIA 4QW9A 2VPZB 3PW4A 3KK1B 2HHHJ 3O44A 1U2FA 1A6LA 3HHLA 2FC8A 4JYAJ 3DN9A 2AKWB 2HSEB 2R3VA 3HHNB 2GVDB 1S97A 1X4FA 1BQNA 1RP5A 3RBEA 4FNIA 4QU7A 3FBEA 4JI4J 4FNHA 4CT9A 1S1UA 1EX8A 4G1IA 3AA9A 5HJYA 2LA6A 3J7YI 5HMWA 1KLNA 2VZ9A 2IJFA 5LSLA 2OEMA 5DM6Q 3H2LA 3M32A 4DPUA 4MH8A 3CMAS 2UVRA 2CQCA 8RUCA 3NNHA 4PPDA 4RW7B 3ZZ0A 5BXIA 3MCOA 1D8ZA 1DBDA 4ZK7M 1TL1A 1N48A 1S1TA 2V6AA 3V2UC 2OGUA 2A0FB 3T5HA 1DRZA 4JI3J 2IAJA 3OR1A 3HHLC 2XYGB 2CQPA 3M6VA 2YNHB 3M2VB 4NA1A 1BXNA 2AF6A 3BN7A 5HROA 1KQSR 1KVJA 2HHUA 2AGQA 2OO4A 4PZVA 4F04B 3D28A 4ZIWA 5B7WA 1SIZA 3KMQA 2B9XA 2F3JA 1TKTB 4Z7YA 2DY9A 2AJ1A 1NH7A 2X3DA 3DOMB 1JIHA 3V6DB 1FXRA 2J8AA 3PHTA 5KFVA 1NBEB 3DMJB 4NYOA 4KFBA 4CCHA 2DNZA 3W9JA 2B0GA 1LKZA 4RUHA 2CJBA 4WIQA 3GYNA 2BXJA 3BGRA 2QLFB 2VPYB 4NLDA 1WG4A 3GG0A 2OELA 2OUGA 4FYVB 4LSLB 1RA6A 4Q8FA 4ETZA 2POKA 3T6JA 3BF4A 4DN9A 1DTQB 1PYTA 1WF0A 2IM3A 2L3MA 4PABA 2ZNZA 3IXQA 5D15A 2KO1A 3CJ4A 2RQKA 3D9BA 4IO1A 3CD5A 3Q89A 4AXIA 1UJ5A 1X4EA 3LW5C 1ZAWA 2FVCA 3PJ9A 2C2ZB 3ZZOA 1KVKA 2BM1A 1NK5A 3G6VA 2VJUA 4XIUA 4FXDA 4R5PA 3W9HA 1YRTA 3CB4A 1S6PB 2DIUA 2ZHBA 1JLBB 4IR9A 2VBZA 4I56A 4X4UA 3DC2A 3SFGA 1T02A 4Y2CA 4U95A 5ETLA 3BO3A 3Q86A 2BJEA 4F50A 2NLWA 2W25A 1F60B 3PIOQ 1MROB 2DO4A 2GV1A 1RT7B 2BV3A 3TJ8A 1IKWB 4ZA1A 2ASYA 4HI2A 2YPYA 3DGPA 2EFGA 3MUMP 3AOAA 1IKYB 3RRKA 3HFKA 4BC7A 3J7AN 1RT1B 4OYWA 4YUDA 3T5JA 2HK2A 3H59A 3EGWB 1B70B 1D9AA 2BW2A 3R5GA 4DHVA 5KFDA 4K4XA 3TAMB 2DD8S 2B51A 2M2BA 3GIKA 1VRTA 1N4LA 1PYSB 3KJQB 4ED7A 3AXKA 2YNGB 5C42A 3UQSA 1X9SA 2AWZA 3NGKA 4C0HA 5LMUF 4FZVA 2UVVA 3KK3B 1S1UB 4O3SA 1LK5A 2E29A 1OY6A 5GAEI 4EI2A 3MUTP 3UVJB 3IBFB 1EP4B 1RBLA 5J2MA 2AU0A 3MPUB 3F41A 4KJIA 1NPPA 3B54A 4TN2A 1SKWA 3JYTB 4HT7A 4JI1J 1LW2A 3I32A 2FC9A 1LWXA 2CRLA 4BWMA 3ZZRA 4R25A 2E5HA 3K5LA 1PBUA 1NKEA 1P9YA 5B09A 4GMKA 4DSFA 1BWEA 3PX0A 4MKBA 2GW8A 3QGIA 4LT6A 2JC1A 1IQZA 2ZITA 2GO9A 2ZDPA 2ZBQA 4R0EA 1CULA 2YWKA 3IFEA 1HR0F 1D8YA 1XNRF 2RF2B 4KGKA 4ZCIA 4C48A 1NCLA 2EWHA 3PIPQ 2HRTA 1MMNA 3HFVA 5K9FA 3L3CA 4QYZJ 2O01C 1UCNA 5J2PA 3EVMA 4YFUA 4JI1F 3Q8PB 2YNGA 5C42B 2J0QD 2UP1A 2G1DA 4N41A 2ZZMA 2OP5A 3EM1A 4DN0A 2W4PA 3S01A 3C6TB 3C8YA 3PDNA 3T1YF 1QY7A 1R3NA 1CG2A 4CO2A 4XDCA 3CC7S 4WE1B 1TL5A 2U2FA 2PMHA 4ILRA 2FHJD 3VAFA 5T14A 4JI0J 2UXBJ 4XDDA 4OZLA 1X5SA 2OFHX 4NXMJ 2DHAA 1FRIA 3K89A 4HKQA 3DOKA 2RT3A 3R6LB 1EETA 3RJMB 4C3MA 3GV5B 1S0OA 3PCOB 4ELUA 2NXJA 2M4MA 4EBEA 1KKHA 3GZ7A 1D9DA 4DV4F 2NSCA 2E1CA 4DR4F 1UWBB 5KG1A 4DV0F 4DG1B 3I87A 1SH3A 4LVNP 3UDLA 3TZYA 2OPPB 2MB0B 2RNEA 3H90A 2MHEA 1JWWA 5E3RA 3LTOA 1M1KT 1KLMA 4F36A 1CLFA 3FCVA 1RWWB 2XSJB 1XR6A 3OTBA 1RT5A 3HCXA 1JLAB 1NU4A 3VHQA 3HMJG 3QJLA 2WSFC 4JI2F 2XYHB 3MPDA 4C8ZA 4JV5J 2AEMA 1OY9A 2BRKA 4P72A 2VIHA 2BABA 3HULA 2DNHA 2D3UA 2M70A 5ETMA 5KFQA 1U48A 3MM7A 2YKQA 4LFCJ 1VRUA 2XNQA 1RT2A 4G3IA 1NSAA 2GIRA 2K8GA 2KYXA 3CJTA 1B0TA 4OJ3A 2L41A 3H5YA 4Q8EA 2CPIA 2LLZA 1B4SA 2C3MA 4DFMA 4W92B 3I55S 3MM8A 1VQMS 1VQSA 4NMXA 3BH7B 2BW7A 2DGQA 2HQ3A 3QSYB 2C2DA 3Q2SC 2DNPA 4PPZA 4Y2AA 4BLGA 4BDPA 1R0CB 3R2CJ 1WI8A 3IG1B 3RRHA 2L9WA 2M88A 2C2MB 3OR1B 1YQHA 2HIQA 4IH6A 5JMNA 4OX6A 3QRPA 3C2PA 4GO5X 1HWJA 3D3CJ 4QR0A 5KG5A 1QD1A 4ZMMA 1X4GA 1RKIA 3QT6A 1XQIA 3KLEA 2DH9A 3B8HA 2BX6A 3K5PA 3BR8A 2CZ4A 1AFJA 5B0EA 3KUEA 4I2QA 1REGX 4DEZA 1SPBP 4DX6A 2HQGA 1EQMA 2XMKA 4J9RA 5KT5A 4KFBB 3CCJS 4X4VA 3CCMS 1SC4B 4KHMA 3E3XA 3S7RA 1UWAA 2X1GA 4U7CA 2J6UA 3HHEA 4PWUA 3OLBA 4XPCA 3I6PA 5D8HB 1VI7A 3VGUA 3QJPA 4WFZA 5D4NA 1HBUB 3JAMU 4OYAA 5AXLA 3JSMB 1BQXA 1XN9A 2IAJB 3OSNA 1VQKS 1KVIA 5HQ8A 2EBEA 2YKAA 2RS8A 3Q0AA 1WKLA 4KGXB 4F2SA 1SJQA 1FNMA 2R8JA 3R5BA 5ETOA 1LV5A 4ZPVR 2XULA 3D5MA 5CYQB 2ZUAA 1S6UA 1BQMB 2DNOA 2QJ3A 3CO9A 2W7AA 4Q0BA 2E1PA 3I31A 2QG9B 4M5LA 4USKA 4Z37A 2AV5A 1B3TA 3I0SA 4OI4A 3SSSA 2OEKA 5DS7A 2V5HG 3M2UA 2HHSA 1TU0B 2V68A 3M6WA 4DUYF 4ELTA 4C8LA 3Q8UA 1YWXA 4WIIA 2ILZA 2KJVA 5J2NB 2ZOMA 4USVA 3DU6A 1F9EB 3VGVA 4CWBA 2RIJA 3ENVA 2QA2A 5HVGA 2W2QP 5F8HA 3TYTA 1RA7A 5KFWA 1SKUB 1KLMB 3ZZZA 1L3SA 1GXUA 2GAGC 4I6WA 4RX6A 4ZP6A 2DY1A 2AMCB 5E3PA 2DEJA 2GO8A 1U25A 2EFPA 4UF4A 1FVSA 5CCMA 5I3QA 3HXMA 3CIZA 4MTPA 4I4BA 2BJ7A 2D9PA 2VFVA 3CF5Q 2HVIA 3J81Y 3EDRB 2R7TA 1XBWA 1WG1A 1D3WA 1TZ0A 3W8PA 3RR7A 2KTQA 1EETB 1OSDA 2E7WA 2HGNA 2IVFB 1IBLF 4Z7CA 3VTIA 2Q1LA 4L74A 4NXNJ 2YKNA 1ROFA 5DJBA 3Q8QB 4ILMA 1K0TA 2MSTA 3N6LA 5ETTA 1Z4UA 4G1QB 1X4CA 1ZAXA 2GQQA 3TQ1A 2AYGA 1F0XA 4QCLA 5DZ6A 2WTFA 1U1RA 2XNRA 1EQ0A 4PG6A 4ZJQA 2YWGA 1FXLA 5A0YA 4HACB 5KFOA 5GADU 2UUWA 2W2NP 1WJ9A 2YX1A 2DXDA 1RHMB 2HGMA 2EW9A 2ZJRQ 1XC9A 2K7KA 2HS4A 1FDBA 1LEOA 2JLFA 2Z0GA 5D0GA 5D4PA 3DM2B 4DV7F 4A8QA 3UD4P 3EGVA 1V5IB 1PKUA 4YY3J 1RWNB 4J9MA 3MR2A 4ILLA 2UVWA 2XM3A 3GCXP 3RB4A 4F0KA 3I5CA 3CCLS 3C14A 3HJVA 5FJ4A 1UFKA 1TAUA 1KQKA 4CLYA 3RAQA 3BGFA 2UV8A 2DNRA 3RBZA 4Q43A 3K57A 1PGZA 2JEGA 2DRAA 2U1AA 1N34F 1U09A 1T03B 4JP8A 1H2TZ 3M8WA 4LF8J 2X1AA 2BKNA 3IAM9 3N28A 3MTJA 1Q81T 4DR4J 3JYTA 4YDDB 3K0JA 2PMZD 1SC1B 3X3UA 2E5LF 1NEEA 1SJRA 4DL6A 4DFPA 3KLHB 2HIYA 5HL7Q 5D3GB 3LP0A 1UEKA 1AW0A 2QYGA 1B64A 1ZOTA 4X64J 5LL6d 5E41A 2VQEJ 5CD4H 4DL0C 3K5OA 5BR8F 3OSPA 2DGWA 4DPWA 3DLGB 3CW2C 2OHDA 4LF4J 1FJGJ 4V1Ak 4PG8A 3BSAA 1LOUA 2DR9A 3KLGA 5J2NA 1ACMB 2BKPA 2WCXA 4I67A 4ECTA 2B4OA 1NSKL 3P5BP 7FD1A 3TZXA 1IKVA 3LALA 3QLHB 2AJ2A 4G1PA 3FGVA 3GJTB 4ZJLA 5IWAF 2ERRA 4B3MF 3UVJA 4KQZA 5CYJA 3GSIA 3IC1A 3V4MA 1HNWF 4CP5A 1KOOA 1X7VA 3R7BB 3TW0A 1KSPA 4WXOA 2PI4A 4ZCMA 4RNNA 5E7OB 4A8FA 4ZKAA 2HHVA 1IBMF 4HDGA 2YNIB 4QYRA 2BDPA 4XAKA 5D6GA 1W7WA 3KFWX 3A8KA 3L09A 3KNGA 3D1OA 4DV2F 2AEFA 2DT9A 3UDEA 2Y1RI 2EXUA 9RUBA 2HFSA 4EBCA 2BOPA 3C6UA 4RW9B 1H0HB 4LR8A 3QZ7A 4RWWA 3DRSB 2E66A 3AD7C 1RWXB 2P9EA 2RKIA 4CO5A 4GRSA 1X4DA 3IWXA 2LEPA 1N36F 1YLXA 3NLCA 2K3KA 3W7BA 3QFWA 3DLKA 2DGSA 1RADB 3GYXB 4ZDNA 3H42A 3MPYA 2KYZA 3SSRA 3UFCX 4EYIB 1HWUA 2DYAA 4HEA9 2XLKA 1TL3B 1UPPA 3UI3A 5BR8J 1P1TA 3DLKB 3EVWA 1HARA 2WONA 4ELVA 4UQGA 3DYAB 2HVHA 2AX1A 3E8OA 1RZMA 3HD2A 3Q8RB 1Y0HA 5I42A 4YHHJ 2HHXA 4ZP9A 2MKJA 3VVUA 3GIIA 2W9BA 2W1BA 3T41A 2OI2A 2RDJA 2JNJA 5DZ7A 1BQNB 1Y5IB 4AQYF 4DQIA 2V2QA 4N8NA 1VQPS 1IKXB 4FBTA 4FN5A 1XR5A 5CYMB 1FRMA 3O5TB 4N77A 3CCSS 2ZC4A 3NGSA 4MYUA 1RT5B 2RVJA 4I0WA 1DTTB 1HHSA 4NLQA 2R2UA 3HVRA 1NZ8A 3MMAB 4RBVA 1KP6A 1MLAA 1NSQA 1WORA 4F67A 3MR6A 1U1OA 3O1LA 1X8DA 4DR1J 2HHHF 4LF6J 3M7VA 1IR0A 4QIFA 4O3NA 4JYAF 4B08A 1DHMA 2R8HA 5IT4A 3RAMA 4V19X 3HI9A 1K8AT 1P8GA 3VR1A 1IJFB 1JLCB 2QMWA 4GC7A 1HBNB 2HHPA 2XO6A 1HMVB 1UVLA 5KAKA 3G6XA 2MSSA 3R5JB 1YX2A 4UOHA 5L39A 1D09B 2GVDA 4JI8F 1VMBA 1H2VZ 2FVQA 1CJVA 1T05A 3W5YA 4CI0B 2JRSA 4P52A 3UWTA 3OVBA 4LSNA 1YJ7A 1IXKA 3ZTPA 1VBZA 1M1HA 1GK8A 3TWZA 5AE1A 2ZKUA 3H0PA 2W9CB 2CKWA 1XMBA 2J7KA 5DETA 3IRWP 3TR5A 5LXYA 3EXCX 1GMWD 4DLGA 4JB8B 3A8JA 2OPRB 1XMQF 4DXLA 1NJIT 5JVHQ 4KH1B 3P8BB 1HLWA 2H48B 3CDUA 1U26A 4K4WA 2CPYA 2AHOB 5HQLA 2VBXA 1S1VB 2CQDA 2JFKA 1HPZA 4Y2KA 1B7FA 1M5KC 4OIXA 1T03A 3HZEA 4IFYB 4A47A 3AT1B 1PC5A 2M8DB 1C1BB 2DHXA 1T05B 3HO1A 4I7FB 4KV8B 3FRYA 3HZGA 4QPTA 2BJ9A 2GGPA 3PW0A 2OAUA 3M2RB 2IC3A 3W5ZA 4WCEQ 2NCKL 3H98A 3L95X 4DR7J 4NMLA 2C3YA 3OL8A 4IDKA 2H4YB 2V9KA 1GH8A 2Q79A 2J5AA 4CZCA 3MEKA 5KFXA 4DQQA 1VRTB 2G13A 3ILIA 3MMCA 1U47A 3M6UA 2KM8C 4BWJA 2WHOA 1FHTA 3R27A 3VAIA 4X4PA 2YWHA 2YWFA 4Y65A 3M9MB 2VFRA 5IFMA 5LMNJ 4TQRA 4TY8A 2CDQA 3EGNA 2RB7A 3IBCB 4C97A 2LEBA 2XY6A 2LU2A 4YB7A 4PG5A 1PJ6A 4F4AA 1TFYA 3GJQB 4P2XA 4K4ZA 3D0HE 5J2MB 4DR5F 2NXUA 2QSFA 2OEJA 5IV3A 5F8IA 2ATCB 2BJDA 2Q6BA 1EAYC 2GVZB 2V8PA 4I6AA 3SYZA 2APOA 3A3OB 1UVKA 4PEOA 1SL0A 5ETSA 1S9GA 1VR6A 2JJ4D 1Y11A 1CQMA 1FKOB 3H8YA 4ETXA 2C2RA 4WYWA 3OTOJ 5KFPA 3QYYA 2EC0A 1WD6A 3FEXB 1VHFA 4G65A 5KFYA 3A1YG 2MKIA 1U6FA 4ZVFA 3MEDA 4KHPJ 1IUJA 2Z4PA 5LMNF 2DO0A 2HK3A 4AT1B 3OXLA 3L7OA 1SCJB 4CNYA 2H1YA 2LCWA 3F0NA 3ET6B 3MDFA 4OYXA 3DDIA 5KFFA 2IYGA 4QBUA 1N5YB 2HMIB 4WKYA 4NZ7A 2KHDA 4HYKA 5F3ZA 1GT8A 2PGCA 1RWPB 3CSKA 1Y4ZB 5HMZA 3H20A 5K20B 3OW2R 4R5PB 4C9DA 3TX0A 4PXDA 1QUPA 3LPYA 4DPYA 3KMSA 1ZBTA 3IN5A 1XMOJ 2YVSA 3Q8SB 3OHBA 3MM9A 4Z2XA 2FJAB 1AT1B 3CD7A 3QATA 4YN3B 4ICLB 2WSCC 4EEYA 1WF1A 2AP6A 2AQ4A 4ZVTB 1AYEA 4X65J 4UW2A 1WSVA 1RTIB 3O2IA 4MYTA 3LQVA 4ZVRB 1AUDA 2CQ0A 5KFIA 2BACA 2G2YA 3JTNA 3S8SA 3U27A 2JHEA 2QGFB 3KHRA 2FHMA 1S79A 3I9ZA 1NJYA 2IJNA 1VRQC 4K4VA 3D66A 4C3LA 1UWBA 4PQUA 1CJUA 1DQ8A 2GIFA 1LWCB 3FBBA 3DLEB 1N5SA 3DOMA 2BRLA 1VQ8S 1R6VA 4RKUC 4H4KA 3MD3A 2WZ1A 1HNIB 5KG6A 5KFEA 1S77D 1N32J 1NSPA 2MLYA 3DXSX 2E5LJ 3SXLA 1QLNA 1S1WB 2LVWA 3LA0A 1I5OB 3A13A 4LF7F 3MAAB 1OQ3A 1GMWA 2VU5A 3BKFA 2CYYA 4YR0A 1OPIA 3ITHA 3KYLA 3PYEA 4CH7A 4LRFA 1S4FA 1UVNA 2HNDB 3CJKA 3ISND 2VC1A 1X60A 1AZSA 4DR1F 2E9RX 1YJVA 2ZM6F 3MM8B 3TUPA 1FRKA 2H3EB 3JQJA 2Y1JA 4DL5A 1C4CA 3CC4S 1T8EA 1W2IA 1OYEA 1M5VC 2ACYA 5H1SV 3A3PB 3AD9C 2J6TA 4PQAA 2WBRA 3D67A 4NLXA 1NK8A 2CJYB 1WTFA 3PEJA 1FFSB 4DV7J 2B3TB 2NSBA 3J81j 2L08A 1HWKA 5E5NA 1I1GA 1RHKB 1CJTB 5KFZA 3LP1A 2Y3YA 1J5OA 2FGOA 1HI1A 4O0IA 4HH1A 4OX9F 1PC4A 1ZM3A 3IS9A 2XS7A 2CQBA 3DRPA 4OL8A 3RB0A 2JLEA 3NS5A 3NL0A 3MAAA 3HSDA 3P5TL 1RLDA 2XWYA 1NXIA 1CBKA 2LU1A 3K8WA 3ENQA 4LBPA 1G6BA 1NPKA 3LP2A 2JZ5A 4OHVA 1KDNA 2WB1D 4ZVPB 1U6BA 5A76A 1X0PA 2AEJA 3JSRA 1S6OA 1I6JA 3GP9A 4QWCA 1F3VA 1X4BA 3PRVA 4LRAA 2QLXA 1MSWD 1FK9A 2J0WA 1MU2A 1SUQA 1V3RA 3ISZA 3MHYA 3PZPA 2H5EA 5DG7A 1U49A 3RW6A 4QR2A 3CCES 3BBCA 4WU3A 5KG0A 4DUTA 1VBXA 2D69A 4OI1A 4Q7AA 3PVXA 3FCHA 3DLBA 2CNLB 2HLTA 1XJWB 1YJUA 3N0VA 4HACA 3FRZA 1RT1A 1CJVB 2E5JA 2RDDA 4F4YA 4J9QA 2LKZA 2M0GB 1H7WA 2PA3A 4NLRA 2FUG9 5DDQC 2GC8A 4RBUA 2W9AA 4LRDA 2G4BA 3MEEA 5DDOC 3FSYA 4YEAA 5SZTA 5THWA 2BJ3A 4OZ3A 1FRLA 2VF3A 3UN3A 2W2OP 1YG0A 3RYLA 2RF2A 1H98A 1FJEB 2YNFB 1CS4B 4YOEA 1T9XA 1O8BA 1NMEB 3LO3A 4KGZB 1FKAF 2KFNA 3VAHA 1TMJA 4QR1A 3UDCA 3K5MA 1AZSB 1A9NB 1FRXA 2XMWA 4USJC 1N33F 4LSZB 1LW2B 2A10A 4I64A 4YR2A 2R2SA 4P2SA 4RWXA 4A8SA 5DGBA 1IBMJ 4DSLA 2MZRA 2N7YA 2QL5B 4IRKA 4ZHRB 3A8IA 2VV5A 2QEXS 2B8PA 1BE4A 1QSLA 2P8IA 4X62F 3T1AA 4ECQA 1N0UA 3SCJE 2I5JB 3DMJA 1CJUB 1FCAA 5IWAJ 1FKPA 2WW4A 4I2QB 1K47A 1LFWA 3EZUA 2O67A 4CLPA 5HJXA 2IM0A 2EK1A 2ZH8A 4HHJA 3D1HA 4USMA 2OIHA 1HNWJ 1RT3A 3T9NA 2MZSA 5F3TA 1RQ0A 2HAFA 1YJRA 3M30B 5DQHA 2IBKA 1QAYA 1IBCB 4RNOA 1JJHA 4B3RJ 1EHWA 1RHRB 3P4UB 1D9FA 3OPKA 1TVRA 3CJ5A 2ZBCA 4HR2A 2B43A 3FMBA 4NLOA 4WK1A 7FDRA 3OTOF 4W98A 3BH6B 1U4BA 2FZKB 4URGA 2P9CA 3PTWA 2V69A 1N36J 3GYGA 1FJGF 1PIEA 2NXEA 4USWA 3SSQA 3HHDA 4M5MA 2VKRA 2YQ3A 5B0FA 1X5TA 1RWKB 1VBYA 2GQCA 5BJRA 4AFFA 3D4JA 2WAQD 1CJKA 2G0CA 2KT3A 1APSA 1HNZJ 1UETA 4LUBA 4PXEA 5F0WA 1CVJA 4OLPA 2KFYA 5AE2A 4LMZA 1TR0A 2WRMA 3MAHA 1SL2A 2HQIA 2XHCA 3DNCA 4DOZA 3JTPA 2XSJA 3CD6S 1XERA 1U0HB 5I3UA 3O8WA 3MECB 2E44A 3BPSP 4OYZA 4O3QA 5K8PA 3FKBA 2R8KA 5HBMB 3I96A 4LF8F 3GU0A 2XLIA 4J9SA 2DHSA 5M2RA 4N56A 3FCWA 1V6HA 2E1MC 4OQJA 2N7CA 2E5GA 2C22A 2VFUA 7AT1B 1RU1A 4NLTA 2UUBF 2LP4A 3ZC4A 4NCGA 1RT2B 5T7LA 3N5BA 1W26A 5E0OA 4DV1F 1IKVB 1JLEA 4W4MA 1J5EJ 3W5XA 1RU2A 1OO0B 2MQOA 2KZZA 4LRCA 1T0TV 3OJUA 3SBMA 4DFJA 3R97A 4M8LA 2DR8A 1T9VA 2K3IA 3G87A 4BHQA 3CULA 5CABA 2UXCF 3BGLA 5KOWA 1JJCB 4ZVHA 2B7BB 3MCSA 3TX8A 2E9ZA 1HBNA 4WTYA 1PCAA 2YH0A 4QWBA 4IDKB 1NK9A 4KYZA 2ASJA 3BR9A 1CULB 5BYSA 4DI6A 5KFSA 2RRAA 4WF9Q 2E1RA 1HHTP 1ZTWA 3LAMA 3MXHP 3HHLB 2MY8A 1JLFA 1YJTA 2CNNB 4R8UA 2W7PA 2HRYA 3M8PB 3K8VA 3CPWR 4WPAA 3ZNUA 1RXOB 4L75A 1SQFA 2I38A 3SDEA 5GMKa 2KHCA 2PSZA 4DUZJ 1REVA 3ITHB 1K1QA 2W2PP 2HWHA 2LMIA 2R4FA 3BM7A 4NE9C 3M8PA 5J1NA 4CLFA 5EGYA 5T7LB 2MZTA 6AT1B 2H9ZA 1Q1KA 2ZUGA 2RQ4A 3FEZA 3QT7A 5AE3A 3NGTA 2ZH5A 2E5IA 3W60A 2ZVSA 3OL6A 2R9LA 3KDOA 3TVYA 2R2TA 2RMLA 2HBRB 2XZWA 2GJFA 4ZPAA 3TO8A 4C2MA 5KTQA 4I2PA 2RU3A 4J9LA 1NK6A 2X51A 5B0CA 2I2YA 4ZP8A 2PFFB 3MECA 4F4WA 3AOCA 3PHEA 1U1MA 1W2BR 4J9KA 1UL3A 3FFIA 1SC3B 4LR9A 2UUBJ 2A1BA 2CQ2A 2H4WB 3R6GB 1Q53A 3CMES 1DY3A 3G86A 4KR0B 4TU9A 1FX2A 3AJ1A 1T9TA 2XGPA 3GWCA 1Q79A 3MM6A 1QDUB 1VQYA 2BE2B 4MAKA 3C16B 1PAEX 3HT3A 3UN5A 2B4VA 2HZAA 2JDJA 4C8YA 1WG5A 1LXJA 2IM1A 5B0AA 2CWKA 2LYVA 3US5A 4ES2A 4D3HA 5KFKA 4QZVB 4DDFA 1O6XA 2B8QA 1VQ6S 3MMBB 1OIAA 2M9KA 1BHNA 2DISA 1NK0A 2KXFA 4JBCA 3M6XA 3TNVA 2ZE2A 3UW1A 4DCOB 3EICA 4DV3J 2HHWA 2WBMA 5IV4A 4OI6A 5MAOA 3D6TB 3RAXA 4ALZA 2XEXA 4DF8A 3PG9A 1RTJA 2V4RA 1FRJA 1Q5VA 2KXHA 1ZM9A 4FVCA 3VZHA 2RAQA 4U7UD 4OHYA 2VG5A 4OV1A 3D2WA 4NLGA 5CQGA 1RB0A 3RUBL 3K59A 3T6BA 2MLXA 1N5TA 3AB2B 4X4RA 1S9GB 2YX7A 3EVOA 1TK0A 1E6YA 3CDAA 3OTEA 5HVFA 4DFKA 2AIRB 1NJWA 2WVBA 3VVTA 5I42B 4DSIA 5CHCB 5BYRA 4OX7A 1NRKA 3V5RA 3TUJC 2W4CA 3QLHA 1YSJA 3N01A 5KFLA 3LWLA 1S49A 5KT7A 1FNXH 3UD3P 4ANCA 1QTNB 3TANA 1LK7A 3JSMA 1NKBA 2SXLA 2AGPA 3H5UA 2XHWA 4RU2A 4ES3A 1JLQB 4KTQA 3EZOA 4FYYB 3J80U 3H5XA 2JSXA 5EUHA 3LWMA 4MIAA 2OKQA 1YRUA 1KOHA 3B78A 3PX4A 1TUVA 4IO9Q 5AT1B 4CLUA 3GQCA 1YBTA 2C2NA 4HH0A 3EZ5A 2Y0SD 1PSDA 4UQTA 4A8KA 2VA3A 4KO0A 2I5JA 1XIQA 3VALA 4CLWA 4ID8A 2CQHA 1U1NA 2YBVA 3VQSA 5EDWA 2E7XA 1RT6B 2IHR1 1N88A 2CQ1A 4UUWA 3OVSA 4MKAA 4WJBA 4DV4J 2V9WA 4ED5A 4A46A 2ADCA 3CJSA 2Y8YA 3AQPA 5LM7E 2M5YA 3DI6B 4DL4A 4Q45A 3B6BA 3D6MB 1P9QC 4ZPWR 2XB2D 3SMZA 4NASA 3JTOA 3HSJA 2PI5A 4KAIA 4UZCA 3BREA 4LVOP 2VG7B 4ED6A 1G7CB 1HBMB 3PYDA 2CJXB 2I1RA 3MMBA 5D0RA 4GKJF 2IRXA 3C66A 1RISA 1CS4A 1U6ZA 3DHWC 4RUCA 2HPUA 1HI8A 2KXNB 1DURA 2CJ9A 3NGRA 2FJBB 2BKOA 3NOCA 3BPDA 4I1TA 3TVKA 3UR0A 4IOBA 4IG3B 1RWUA 3T9ZA 3VQTA 1X0FA 4PWDA 3T1HF 2ZBPA 1HIYA 4UY8T 1RK8A 4FKXA 1QAIA 4RW6A 4XPEA 1LNQA 4KGMA 4ENOA 1U1KA 4B3TF 2JX2A 1C0UB 1C1CA 4OX9J 2Y1IA 1JX4A 4P73A 3C3LA 2Z2YB 5K14A 2XCAA 4H4MB 3NS6A 1NHVA 4CYUA 3U1LA 1P27B 3BGUA 3DLLQ 2M3DA 4DPOA 2BUNA 3BO2A 2AJ0A 1P1LA 1QM9A 3QAUA 3C16A 4U9RA 3UDVA 4WYLA 2DH7A 3IAS9 1UJ6A 5AXMA 3Q22A 2Q43A 2G9OA 4ZLLA 3OLAA 2F9JA 2PD1A 4YDXA 4K7QA 3E51A 1AFIA 2DXFA 3SDEB 1Q78A 1SIWB 2C3UA 1T9YA 3RG6A 5D4OA 3AXMA 5KFHA 3T5KA 3VAKA 1U1PA 1ULRA 2XTJP 2V34A 3TAPA 3J80Y 1KHWA 1EP4A 3PW2A 3KLFA 4USHA 2FTRA 2D3ZA 4IRCA 2ZD1A 3NBPB 3NCQA 4LFAF 2HBZB 3DCAA 4IG0B 1VS3A 5SUHA 3LOUA 2KKHA 1R0BG 1TMMA 3IA0A 4Y3CA 4NI2B 4X66J 2CZ9A 1VQ4S 2W9BB 4QPXA 2MGZA 2I8EA 1ZM2A 2J9DE 4E8UA 3W9IA 4IUFA 4USTA 3TAMA 2R7OA 3C15A 3CCZA 2CPDA 4FF3A 5F8JA 2BANB 1T3OA 2NS1B 3CTRA 3M8SA 4J9OA 2HAIA 1HBMA 1PILA 4WP8A 2DNQA 3CJ2A 5CH7B 3UR3C 3ILLA 4DUYJ 3NMAA 5HAOA 4TLRA 4YB6A 1TTHB 1X31C 4QQBA 3AA8A 1JLFB 4AE5A 2AX0A 4R8UB 2FJEB 2FVPA 4TYBA 4ZIVA 4OZNA 3DDNA 3RZAA 1HNZF 3F56A 1B0VA 2XMUA 4DSKA 1LWEB 2LFVA 3RR8A 1S6QB 2VQFF 5AJ3J 1V3SA 2OTLS 1S6PA 3GONA 3GG1A 1C0TA 5ITHA 1NK7A 2ZH7A 5EN1A 2F40A 4OI3A 3IR7B 1HBOB 5IOLA 2QMUB 4AL7A 2OSRA 3R7NB 1S9FA 2VODA 1S9EB 3GSDA 4F3MA 1NDCA 2QTWA 3NP5A 1U0SA 5F41A 2B4PA 2M7SA 2OFGX 1S76D 3D7SB 4FYDA 3W64A 2B6AA 1EJ7L 4M63A 2ZBRA 3GFXA 4UZBA 3LUYA 1WOSA 4UOFA 3BGRB 4YMEA 3A12A 4GC6A 4IRDA 2G2OA 4EO6A 4M5KA 5GVQA 5A6PA 3PV8A 1CC8A 3Q83A 2BOAA 3I9V9 4M5DA 2RHQB 2W8LA 1EARA 3TP2A 3H2UB 2BZ2A 3CJ0A 3ISNC 2CPXA 4HI1A 5EX3A 5C2GA 2R7SA 4HHUA 4ERDA 4PYDA 1F9HA 4D3GA 5KFCA 3M9NB 3CCQS 4LFBF 2HMIA 2OTJS 1KTQA 3ET6A 4KPYA 1WELA 3MEGB 3KJVB 4M5HA 3FQLA 4C6AA 1JKHA 1NDPA 4FS1A 4AQYJ 5H9EJ 1TFWA 1Q4RA 1S1TB 4RW4A 1GFWB 3ADAC 4WTOB 4FBUA 1IM4A 3M05A 4MFBB 1RLCL 1NUEA 2VOPA 1FD8A 2WVCA 3RU0A 3PRDA 1OPZA 1HBOA 1Q8BA 2HEKA 1WC3A 2ROGA 4MJKA 3KTQA 4JI3F 4JV5F 1RBAA 4DCPB 1JJ2R 3NCRA 2VPXB 3MCMA 1FKPB 4HL9A 3EUNA 1AUSL 1N5VA 2J9CA 3G82A 3V6DA 4ZLJA 2YH1A 2CPJA 1JJ4A 1NH8A 2FVRA 2DIVA 3UCUP 2CAJA 1VFJA 3CEDA 4IQXA 2HFVA 1TKXA 1QAXA 2J9EA 3OR2A 4K4TA 4WZMA 2MZQA 2QV6A 3LAKA 2FLLA 1FE0A 4TLQA 1M5SA 2VUGA 3G6ES 5CZXA 5J1EA 1UVMA 1RSCA 1IBKF 2V0NA 5ETQA 2UZAA 5FLXY 4ECSA 2FZCB 1TL1B 2CUYA 1QSYA 1AXQA 2DGVA 2J6SA 3FZ2A 2CVIA 3EXYA 4L3NA 3SQGB 1OMSA 3OXFA 5MLCV 3QO9B 3HLUA 2A2CA 1Y10A 4K59A 1WNEA 2J0SD 4B02A 1LWFA 4Q5VA 1BY9A 3A4TA 2DNYA 3R8YA 3M8QA 4IG0A 3WQPA 1FFGB 1L3UA 4OYIA 4OHXA 5G4DA 5L1KA 2F7VA 3TUZC 2W2MP 4DV0J 2IC3B 1FWPA 5LSRA 3BGOP 3SCKE 1RYSA 1DFDA 2ZD1B 4P2MA 4LR7A 3LF0A 8ATCB 1VC6A 3SCIE 1URNA 1WOOA 3AQOA 1XEZA 3T1HJ 4NL5A 2EPIA 4YB1P 3L7UA 1MMLA 2QE5A 4K4YA 2J9DA 2RILA 4OYPA 1SI9A 2XMMA 3B4DA 1N33J 2KB2A 3S1TA 4DV6J 1CPZA 3HKZD 1S1WA 3LGHA 4KHRA 3FDSA 4FPRA 1LW0A 5CZVA 2Z2ZA 3OFEA 1NPRA 3NXZA 5DQGA 1YBUA 5EHHA 4NCGB 2HS3A 1ZPWX 2RQMA 2ZKTA 2OPRA 2VDIA 3I82A 4WP9A 1R31A 3GPAA 1HR0J 3QSIA 1RHJB 3LP2B 2NR0A 4TYAA 1ZA1B 4OJHA 2UUAF 5D78A 3ZZPA 2P6SA 4H4OA 4U67Q 1OY8A 3JQKA 4P7VA 3RGIA 1KEKA 4C98A 5IQQA 2V4QA 3PX6A 5DLGA 4JV1A 1LQ9A 2LQ8A 3TVZA 1H2UX 5HMYA 5JVGQ 2NZ4A 3QBCA 2AJQA 1RTIA 1R8BA 2RJZA 2V8HA 3PJWA 2DB1A 4YY3F 3DRRA 4DR3F 1SKSA 1M5OC 3G71S 2CPEA 4URQU 2J8SA 1SVDA 4CTAA 2WW8A 4DCJB 1YJ9S 1DZ5A 3BBBA 4X4OA 1R0AA 2XMTA 1KS2A 1QSSA 1MN9A 3NNAA 2OPQB 3N79A 3NY0A 1VQ7S 4GKKJ 4J91A 3IM8A 3CJQA 4ZPDA 1N34J 2RD5C 3HF5A 2OPSA 3PW5A 2KT2A 3IR6B 4ZPCA 5H9FJ 2ZH3A 1F1BB 2IMOA 1Y9OA 2UUAJ 6FDRA 2PIIA 2GIQA 2XG8A 2CNKB 5HATA 3MMAA 1TAQA 1Y5NB 4QWDA 2V63A 4C0OC 3BSOA 4JI6J 1KQGB 5HLFB 3LH2S 2VHGA 4LRBA 4MK9A 3G8SA 2KDOA 1TKZB 3KLIA 3IM9A 2CQ3A 3KK2A 3O3LA 3KLVA 3R2DJ 1K44A 3G8QA 1Y5LB 1Q8IA 3G82B 2ATLA 3N9UC 4Q0BB 1VBKA 2XSFA 4NPOA 1CSJA 1X4AA 3H4BA 5ADZA 4DL2A 1F2HA 2HS0A 3PRBA 2HVEA 3BJYA 5KFJA 2WONB 2EK6A 2RDIA 3UNYA 1FE4A 1HD0A 5A8WA 2VICA 5KFGA 2LQBA 3QJJA 2Y8WA 1NAQA 2P9GA 4HTJA 4OMFG 3ZTSA 2BA9A 1EZZB 2LQ9A 4UOGA 4NRTA 5KG2A 1HWLA 2XY7A 1MWZA 1SH0A 3TUIC 5A8WB 2QA4S 4CM2A 4P9SA 5B0GA 2OPSB 4DU8A 1RT3B 3P96A 4RW7A 5B0DA 5CCLA 1GXTA 1U8WA 1K73T 2M8HA 3KHGA 1JXEA 1L5UA 4U7UK 3FC9A 4RNMA 5HVHA 4DZDA 4CO4A 1K1SA 4EU0A 1TUWA 3TEGA 2CZVC 3AHPA 1VC0A 3V4IA 1KHVA 2IA0A 2VBWA 3SFUA 1VRUB 1KQFB 4Y00A 3W2VB 4A4JA 3JB9k 1S0NA 3E01B 3MR3A 4XO0A 3HP6A 2DR6A 3KLIB 3DRRB 1GMVA 3NCPA 4O4RA 5F8NA 3D0IE 2VL1A 5IXUA 2F5GA 1ZPVA 4O44B 4OZ2A 3THPA 3FQKA 3BQ1A 3V6KA 4NCAA 1Q86T 3KDNA 2V2ZA 4K2JA 2GX8A 4DU7A 5K8OA 4OYMA 2VQEF 1FXDA 2KU7A 2VOOA 1HD1A 3GFZA 2UUTA 1Q8LA 4HHHA 4J7CA 1JXLA 1ICEB 1FEEA 1SV5B 1FF2A 3AB4B 2FD2A 3MZIA 3VF0B 2Z8QA 3IP0A 4DX5A 5DM7Q 2YNFA 1Z2LA 3UD5A 4CO1A 2HBYB 3L7PA 3H4DA 3T1YJ 4DR5J 5DGAA 2KRBA 4F8RA 4MKYA 2VFTA 3OVAA 3MM6B 4N76A 2VD3A 3OQ2A 3MUVP 3J81U 2ZH9A 1OSCA 3ZO7A 4O23A 3FUYA 9ATCB 2HNYB 4ZVQB 2YKOA 1H3DA 3OHAA 3L9ZA 3AFGA 4CLZA 1V5VA 4OLOA 4O4GB 2ADBA 4HT5A 1RUSA 2W01A 3AD8C 4RPFA 4Q44A 3VAJA 4H4OB 1JMTA 2WB4A 3VWSA 1FO1A 3PYGA 3BSNA 2FY1A 1F9FA 2HW3A 1HMVA 2ZEJA 2MHNA 1VJWA 4H4KC 2G2ZA 1FK9B 2QSWA 2QX0A 4FKYA 3R3TA 5LSOA 2VDHA 1KTVA 3RB3A 4LF9J 4N7TA 2YWEA 1JB0C 2LXIA 4UUXA 2L48A 1S1XB 2XC9A 2D3OR 1S12A 4CO3A 3THTA 1HNXJ 3KLHA 1HW9A 4O3PA 2XO7A 1X9MA 2D7SA 3AOBA 1KWMA 2RUGA 1UJ4A 4U6PA 4LIRA 2B9EA 2GQ2A 5LJ3Y 1HA1A 3DRPB 2KI2A 1XTZA 2D74B 5ETNA 5F8GA 5J1EB 2GZOA 1RACB 2R8IA 4WKRA 4ZN1A 1T95A 2VASA 5K8NA 3MI7X 3PJXA 4DQRA 5HANA 5CYMA 3SI8A 2B5JB 1IKXA 3NG8A 3MMCB 4KY3A 5KFAA 3IO1A 3HPOA 5C25A 4P6QA 1HNIA 3JSBA 3PEHA 3UO0A 4URSA 1JNZB 3FEYB 4JI7F 3M1VB 2WOMA 3M8QB 4EWTA 3V6HA 3FJ2A 1FWKA 1PYOB 1RAOA 1ZYQA 1HYSB 1N52B 3HFZB 3PKMA 2MQPA 5FDLB 1ZH5A 1S7IA 4DL3A 1FT8A 1C1BA 1FFWB 2YQ1A 4FYWB 4RW6B 3NAHA 4MFBA 3LGMA 3KG1A 2FJXA 4KPCA 3MR7A 3CVKA 3NWRA 4EFAC 4FF2A 2DPJA 1AROP 2HWIA 3HSZA 3KG4A 2QLJB 3W3SA 3DGVA 1RWVB 3OFHA 4G1QA 2CG4A 4X2BA 1XMQJ 2RH3A 2Z58B 1HQEA 1D1UA 1SH2A 2GCFA 4DR6F 2CPFA 3AH6A 3D68A 4OZJA 2YKMA 2XMJA 1P6TA 4EMDA 4X4QA 2XQCA 4UT4A 1SJFA 4B9MA 3X1LB 1URRA 2LXFA 1N32F 2DCUB 2NYHA 3K5NA 4MIBA 3TA2A 1GTHA 1AA1B 4ED4A 2VJVA 5KOXA 1U8SA 3ILOA 3BSCA 3NOGA 2ZH4A 4C8OA 5BYQA 2K06A 4B3RF 3ETMA 2IVMA 3AJDA 4GVBB 2PE8A 4WXWA 2VPWB 2UXDF 4RW4B 2QN6B 3FK4A 2R42A 1WTBA 2DK2A 3I5BA 2C28A 4ZVOB 3G96A 6FD1A 4WFAQ 1S9EA 4C8NA 4YS2A 3BV8A 2F9DA 3MM9B 5GADI 3I0SB 1MROA 2YKPA 1ZA2B 4CH1A 2CXEA 2ZNYA 4DV5F 3M2UB 3PKYA 4NWBA 2DPIA 1I51B 1FRHA 2V67A 1IVZA 1N6QB 4IH7A 4K2XA 1RAJA 2HVZA 2V4JA 4DPTA 1XWLA 4B17A 3ZTQA 2HG4A 1WC1A 3GR0A 2PEHA 2VG7A 3E2EA 5HMXA 4TQSA 3LGNA 2UUCF 5KFUA 3EE3A 1Y3KA 1TVRB 2J7WA 2Z57B 1Q16B 3OT9A 3KLGB 3QAEA 4J37A 4ECXA 1FEHA 1OS5A 1RJJA 3QZ8A 1HBUA 3D54A 2UU9J 2FJWA 4PYAA 2EKNA 3PR4A 4LSLA 1TL4A 3EJMA 3CE8A 2RU9A 1IQTA 1NKCA 2EBGA 4NZ6A 2N4CA 2AJ4A 2MKCA 2WVFA 4IQMA 3F73A 1GTEA 1L3TA 5J2QB 1R6YA 1O0PA 4B3SF 3NGDA 2FJDB 4QIVA 2EVZA 3NBPA 2VG5B 1TKTA 2ZVIA 5FLXU 3QIDA 1HFEL 2N3LA 5ETVA 1RWOB 3KLFB 3BO4A 4ED1A 1C2PA 4BBYA 3KLEB 4QIEA 3A8EA 1OWXA 1RTZA 3OTCA 3EPIA 3OTDA 1WC0A 4ECUA 1PO6A 1DARA 5EWFA 4JV2A 4DR7F 2HHTA 3KK1A 3OBIA 2LA4A 4K5RA 2YNIA 2RS2A 1C4AA 1RWMB 2C3OA 4ZLPA 1QTMA 1IR2A 1WUUA 2WK4A 3IGNA 3QQCD 8AT1B 3N5FA 3GIMA 3BDPA 4FVMA 2BANA 3QRRA 2RRNA 3CDEA 4G6VB 1KRPA 1SKRA 3C15B 4DQSA 4C4WA 2KZMA 3MOZA 4I69A 1R0AB 3TQEA 4MK8A 3G4SS 5L1JA 4DBQA 2LQ5A 3Q2TC 4NA2A 3DRXA 3D3BJ 4KIAA 4F3QA 1VQNS 2F4FA 4KGVB 3MAQA 2NUUG 3OL9A 5IT9U 4N47A 2FHOB 4DR3J 1VQ9S 2GNKA 1YKWA 4B9VA 1WHYA 1TL7B 2V8DA 3QWUA 4P71A 4TNOA 5KFTA 2ZC3A 2CFXA 1Z1ZA 2K2PA 3HVTA 4CT8A 3BBFA 3MD1A 4CRJA 4RO0A 4BS2A 4JI5F 1ITPA 3R1HA 2DBBA 4RNFA 3IWNC 1VK8A 2LQJA 1SJ1A 3BDEA 2ZE2B 4PWDB 2NXCA 5A8RB 3TJAA 2I0XA 4ER8A 4B3TJ 4IOAQ 4X64F 1MMDA 2K7JA 4P74A 3WIVA 5AXKA 1PBAA 1GXLA 1NJXA 4DSJA 4DG1A 4J90A 4JI0F 4ZVSB 4CLLA 1F5AA 4BC9A 3BQ0A 3LP0B 5D3GA 1PAUB 1DLOB 2NPFA 2OPQA 1RT4B 2IJRA 5IM0A 2YKMB 2C42A 2BQRA 3DOLB 3DDKA 1VQ5S 3MOJB 3IRXA 2JVOA 4B9LA 3G9CA 1LW0B 1MWYA 2M52A 4CDIA 3FNNA 5L9NA 1F3FA 2L9NA 3CUNA 4OHWA 5DG9A 1REVB 1V3ZA 2HBQB 2JWNA 3QT8A 4E98A 3I0RA 4Q2LA 4WFYA 3SV3A 2XY5A 1VC5A 1RYRA 3KNAA 3TEHB 2BBEA 2Y9HA 1VIOA 2H5IB 2EFVA 2GS8A 4F0MA 4DL7A 3H40A 3PNIA 4FXWA 4Y34A 1HQ2A 3BS9A 2MMYA 3V81A 1E6VA 2HGLA 4IYQA 4RUBA 2OLWA 1UVJA 4DV6F 4DWIA 2HVDA 1H38A 1XNRJ 4CM0A 1Q0NA 4TU7A 5IS2A 4F2RA 4ZPTR 2J0XA 2B9WA 4M1KA 3LANA 4ZVEA 5DO2A 1PG5B 4Q2MA 1H7XA 2DR5A 1EIYB 2H65B 1Q7LB 1IR1A 2ROPA 4ZVGA 4RL1A 4B9TA 1JXVA 1MN7A 5ETRA 5A0YB 1FJCA 3KWMA 1TK5A 3EPGA 4C3KA 2XCPA 1O5JA 1T9WA 4YP3A 1X5PA 1T11A 4OZ0A 4U8YA 3TRGA 3Q8VA 1RT7A 1S48A 4MK7A 4QJVA 4U8VA 5U47A 2HQCA 4EUVA 1KD1T 2DTJA 2MKYA 1WC5A 3NEKA 3F44A 2HWTA 2ZM6J 1CQNA 5LOQA 2AGOA 4ANDA 2PMWA 4AUKA 4X4TA 2ZHOA 3U7JA 1KONA 4OV6A 2AZ1A 3GR1A 1BC6A 2O66A 2AYEA 2EFNA 1M1GA 4NCBA 1YGYA 1HWIA 3CCWA 3KOAA 2FGCA 4HTIA 4OHZA 2JEJA 2W7OA 4AL5A 4B3OB 3U1MA 3UE2A 4QWEA 2XS2A 4PG7A 4ECZA 3PFEA 1HNXF 3W66A 2CPZA 5M2PA 3MM5A 4JI4F 1RTJB 4O44A 2XGQA 4DV1J 2UXDJ 1UFWA 1RBOB 1TV6B 5L1LA 1IKWA 2IFXA 2E1AA 2BR0A 2IIHA 3DGPB 2JEFA 4B3SJ 4OX8A 2EEYA 1IBKJ 2FQQB 3B82A 3KUGA 1UA0A 4KBIA 3H7HB 4MT1A 4JI6F 3R1LA 2Z2MA 2MJUA 2QYCA 1G1XA 4ID5B 1R43A 2EG1A 5T41A 3W61A 4DSEA 3HK2A 2ILYA 3IWLA 5A8KA 1M5PC 1IBLJ 2PFDA 3NAIA 1KR4A 2JVRA 4WFNQ 2GHWA 3TI0A 5D0EA 1RKJA 1E6YB 3MM7B 1WKKA 2F8HA 2B9YA 2ALYB 2D41A 4NRUA 4OFZA 2DCLA 4F02A 4M5JA 5HK4A 2AJFE 3HM9A 3OD2A 2DNKA 3PO4A 2C2EA 1IM6A 2J7UA 2QZ8A 4GVLA 4B3OA 3KG0A 3MM5B 1R8HA 2COLA 2GHVC 1NB2A 3E01A 3BEGB 4DZ6A 3H5SA 2MKKA 4MKVA 2I9SA 3MEGA 3KJVA 5K8MA 5HO4A 2KM8B 2DGXA 3HKWA 1WEXA 4ZN3A 1L3KA 1FJ7A 1GEHA 1NZAA 3HVAA 2CWXA 4J9UE 3VAMA 2CJKA 4M5IA 1HW8A 2Z56B 3BYRA 2XWXA 3KKFA 3W65A 4ID5A 2AZ3A 4FDFA 4EGLA 4LF2A 5HROB 4M5GA 4OJ1A 2MXYA 4WBFA 2ZJPQ 1I3OB 4FF1A 3R9LA 4M95A 2Y0BB 2VB6A 2QA4G 3WC0A 3ENAA 2B7CB 3ULHA 1UVIA 1U45A 2N82B 4TY8B 4DJBA 4FF4A 1S99A 3C6TA 4K8RA 2DRDA 2BVZA 2JH3A 3ELHA 2AYMA 3NKYA 5DG8A 5A2QU 3KXDA 4PXCA 4F4ZA 4ED2A 4LF4F 4ZITA 5EWGA 2A3JA 1VYAA 5C24A 3M32B 3HHKA 3M1VA 3GV7B 2B56A 4C7QA 4DR2J 4F4KA 2VG6A 4NA3A 2Q3PA 1O51A 2R7UA 3I5AA 2C3PA 3BKTA 1UPMB 2R7WA 2IPOB 2KJWA 3EWGA 3RW7A 2ZBIA 2FIUA 2AT1B 4JV0A 4KV8A 1RAHB 2WVDA 3G8TA 2BE9B 3DFEA 1ELOA 2UVUA 5A2QY 3A3NB 1TKDA 2ZH6A 1R8AA 1MNEA 2OPPA 4WFBQ 3CDWA 4EYHB 1R27B 1ZZNA 4LF5F 1VLOA 4DQPA 1S0VA 4PKDB 2VC0A 4CLTA 2FZGB 4F4XA 4AL6A 1KBRA 1VOMA 1JLGA 4KSEB 2G1HA 3HSGA 4KE5A 3S6EA 3GLJA 4LBHA 2MGZB 2NQPA 4H4MA 1DLOA 4CYUB 4LQ3A 4K4SA 2DHHA 2WSEC 2XLJA 4NXNF 4WU2A 2ZZTA 3DM2A 2OMLA 2DJWA 3VCDA 2IYIA 5KT6A 2XMVA 5LT5A 3ZNJ1 1UEUA 1RABB 1WWHA 4HVZA 4JI7J 1Y3JA 4PCQA 4V19J 4OZ5A 3J7YU 2W24A 4MIWA 5AXNA 3OV7A 1JK9B 4IKAA 2FVSA 4J9VA 4RW8B 1UMJA 2QIFA 4O0NA 3RBXA 3SIPB 3TARA 4UTGA 4NLPA 2YPZA 3BKUA 3MMJA 1JLCA 4I2PB 3ILJA 2HFOA 4ZOSA 4Y2IA 3WZ0A 1Q5YA 4NLWA 3BQ2A 4OI0A 1TELA 2QO3A 4J9PA 2GMJA 2HQDA 3QIPA 3GCWP 2KN4A 4OI2A 5KG4A 1BQMA 5EWEA 2GJ2A 1JLGB 5CYQA 3VZIA 4ED3A 4GKJJ 1SV5A 5HP1B 4PUOA 3GTYX 1NDLA 2VFSA 4XK8C 1YRXA 3W2WB 4DF4A 5HBMA 2KVQE 2HHQA 2IDLA 2V50A 3KJFB 3P45B 5L9XA 2JOQA 2MDAA 1DTQA 1DQAA 3CCUS 2VA2A 2C2OB 2OMOA 3QGHA 3T5LA 1U02A 2KT5A 3CXCR 4LF9F 2RRBA 1CJTA 4ECWA 1I94J 2ZHAA 1N56A 2ASLA 1Q7YT 4YHHF 3P49B 1YTYA 1UEVA 4OYBA 3VV2B 3NWGA 3KK3A 2IDEA 3R5AA 2KVIA 4WFXA 1K9MT 2MJNA 1LFPA 4K0KJ 4Y28C 2GAHC 3OJSA 2OH2A 2PC6A 1WDDA 4L76A 5DDRC 3DKDA 4LIWA 1A7GE 3HDSA 3DYAA 2F63A 4GO7X 5GAGI 1WOPA 4F25A 4YQWA 2MTLA 1NO8A 2EG2A 4O4GA 1HKAA 2QRRA 4B9SA 1FX4A 1TL3A 4BCAA 4ECRA 1OJ4A 1RDRA 1W25A 2OJ3A 1IKYA 1GX5A 3N4WA 3OUYB 2A18A 4DMZA 3G2XA 2XZDB 4I68A 4ZP7A 2UUCJ 3AY0A 1SBRA 2KG1A 3M30A 2D3O1 5G0RA 2V2VA 3SEOA 3WBZA 2ASDA 3PFOA 4JI2J 2MPUA 3BYPA 3R5CA 2X3GA 5A8KB 2VONA 2F8MA 1N5YA 2FLOA 1KNZA 4RNHA 4CLSA 4ZPBA 1U2CA 3DRSA 4K5SA 3M8YA 4O3OA 1FVQA 4AD6A 4X4NA 3HD1A 2BYCA 2Q6CA 1UA1A 5KFRA 2GHPA 5I4MA 4KRWA 1XR7A 2IBOA 2NPIA 2H51B 2F4VJ 2MQLA 3MWBA 2UV8G 5FIIA 4JOUA 4LFAJ 4P7TA 2IMWP 2YQ0A 3CD0A 2HLUA 1VIXA 5HP1A 4PUOB 4A8XA 3PM9A 2XS5A 5F9LA 1WEZA 2V4JB 4RU9A 2LXUA 3CO0P 4LF1A 4LQ9A 4TXSA 5IC6B 1FDDA 3WDOA 1WI6A 4DV2J 1XNQF 5D77A 1HQEB 1QVGR 2NREA 1CC7A 2DGTA 3CJ3A 2MQQA 1XK8A 5J1PA 4QU6A 3D0GE 2P5VA 3GJRB 2BE2A 2V8VA 3K2YA 2D1CA 2C2KB 4ITSA 3W8GA 1FD2A 2ZH1A 4K0KF 5EX0A 5M2UA 1IWGA 2O3DA 4CLKA 3PR5B 5IZHA 3P3DA 3TOQA 2BQ3A 2FLNA 2N3OA 4ED8A 1RTDB 3DLGA 4Y2MA 5C5JA 1H6KX 3HX9A 4B3MJ 3HT0A 2CDRB 3UCZP 2FHKA 5DDPC 3IBWA 5CXTA 5FDLA 3FBCA 5KFNA 4DV3F 3FZBA 1C0TB 1VQLS 3EDQB 3K7RA 1MU2B 1SUQB 2CG8A 3K17A 1OYDA 4J5OA 1S4EA 2EC2A 3I56S 4JI5J 3GFYA 1R8CA 1RAGB 3MF5A 2GGPB 1UP1A 3K58A 3CJRA 4A48A 4I7FA 1JQGA 3GE9A 2XZTB 5A6WA 4QW8A 3ZTRA 5JJBA 1U1QA 4P2FA 5KT2A 3WHIA 3I4HX 3B4MA 5HQMA 4IH5A 1VHIA 2E7VA 2RE1A 3HHLD 2X1FA 1R89A 1Q82T 4O3RA 2QLBB 4USUA 3W2WA 3FFIB 3T19A 2GFFA 1B99A 2XBPA 3AJ2A 3QGGA 5KG3A 1B7YB 4L3KA 5J2PB 1U1LA 4ANEA 4K4UA 2PDAA 2DEIA 3IMQJ 2AW0A 3MPWA 5H9EK 3UN2A 5C24B 4DPXA 1YDLA 2P6TA 2YWWA 5IQ6A 1DJ0A 2RHSB 3M4XA 4QWAA 1RGVA 1QE1A 4KC5A 1U7LA 5GMDA 3W63A 3NNCA 1SB6A 1XNQJ 2XYPB 2PEBA 3AAWB 1ZS6A 2HNYA 2YXLA 4E0DA 3BN4A 3DRYA 4L73A 4IG3A 1UZHA 3U02A 1JLEB 1TK8A 2I6WA 3DLHA 1J5EF 3O6QA 1R8PA 1F6TA 4ZS6A 2O1PA 3VAGA 4F3OA 2A2DA 2B4UA 3JAMY 4JI8J 5B08A 3R7SB 4R0JA 3MFIA 1HI0P 3SCLE 1VLYA 2YKNB 4DR2F 3BB5A 3CC2S 3IRXB 4ES1A 1BWVA 1Q95G 3SV4A 3DOLA 1SC6A 3CDBA 4X4SA 3J7ZT 1ZTTA 1XMOF 2UXCJ 2JL9A 1T9UA 4NEYA 1UFLA 2NXNA 1WF2A 2GMHA 2MYFA 5HN0A 2ZH2A 1G3OA 3NGUA 2BEFA 4RZRA 2BJ1A 4HLBA 4IOCQ 1WHXA 4TKTA 3POTB 2QFJA 3SQOP 1BD6A 5I3UB 2R7QA 4Y6IA 2CADA 5JUMA 2PT0A 3GFHA 2KH9A 5LJ5Y 3ZFVA 4LF5J 5FD1A 4KH0B 1RCOB 4RR5A 4NOHA 2GMLA 4LFBJ 3HVTB 1TUGB 4LF7J 2DNNA 4KHPF 1TL7A 5GAGU 2FDNA 3H2VE 3TZZA 2NUHA 3TA1A 1CJKB 1RHQB 1RCXB 2DNGA 1PJ7A 3R5DA 3NS7B 4PWWA 2DR7A 3CCTA 1MWQA 4UY85 1JLBA 2G0JA 1Q8KA 3ICLA 1A0OB 1BGXT 1H72C 3MCNA 1FI4A 1HNVB 5L38A 4N5SA 1VQOS 4KKOA 2G0IA 4NLSA 2JLGA 3QGPA 4FYXB 1Y7PA 2CJAA 1EKRA 1FERA 1QUVA 1U0HA 4PXBA 4X66F 1IWAA 1SXLA 2ACMA 3DXBA 4LREA 3EX7B 3RB6A 2R7XA 2X1BA 5HSPA 4YR3A 3OFFA 2UU9F 2H54B 2ZOFA 3MPVA 2E9TA 2D9OA 2CJQA 2NYIA 2QA1A 4FXVA 5L8RC 5KFMA 4NYZA 4IFVB 3QT5A 5GAHI 4X84A 3V4IB 4A8WA 3N6NA 3OFGA 3FSXA 1UZDA 1Y00A 2QFIA 4ATNA 2BE7D 2RUSA 2DNMA 2CPHA 3FBFA 4F0HA 5F9NA 1KFDA 5J2QA 1U24A 4IFVA 3ZXWA 1GMUA 1LWEA 2GJIA 1FWLA 1WEYA 2IRYA 4NYPA 2HFUA 4S0MA 2Q66A 5KT3A 2PO4A 4MMOA 3VGSA 3HVWA 1JLQA 1RTHA 1NHUA 4IFYA 4OZ1A 3G6YA 4J9NA 4KKOB 3OUYA 3MTKA 4USIA 4ICLA 3DHXA 1HNVA 1N5QA 1S1VA 2ABYA 4NX9A 5GAEU 4A8MP 3NMRA 2VBYA 4QOTA 4F26A 4TY9A 2C1EB 4OYOA 3MURP 1S72S 2VKZG 4X62J 2F4VF 1L3VA 3BZQA 3GILA 4LBIA 1N6QA 3QNWB 5AJ3F 3H25A 2ZOGA 3Q8YA 5C2CA 5H9FK 5IT9Y 4M5DB 4A8OA 2PA8D 2QC3A 5C7PA 3MEEB 4C0BA 1HQUB 4ECYA 4QYZK 4CIOA 2DGUA 4Y0FA 2L9DA 4RW8A 3UPFA 3DU5A 2ZJQQ 4DX8H 2IVYA 2YX4A 3POTA 5E3CA 1F5CA 3I0RB 4GVBA 1HPZB 2DH8A 1WDTA 2KRRA 1H74A 4C11A 5RUBA 3FMWA 5IT0A 4M94A 1QJHA 5E3AA 3CMQA 2RSQA 1SL1A 1VGYA 3ONQA 4QIGA 5JXSA 1X4HA 3PW7A 4PRFA 4E2FB 3QIPB 2YTCA 3QMQA 3D6HB 2QT7A 4NLUA 1YBAA 1SJ4P 2JC0A 3DOKB 2BM0A 1AB8A 4DS5A 3THVA 2ALZA 3CIMA 1I94F 5K14B
chains in the Genus database with same CATH topology
1ZAVA 2F8EX 1KN6A 1SJ3P 4LFCF 4KT0C 5LXRA 3J7A1 5K5MA 2OD6A 2ZZNA 4FS2A 3FVYA 4LSNB 4W90B 1G2EA 2DGOA 1NJZA 3DLJA 1J5OB 1N0VC 3GIJA 4A8YA 3KTQA 2MQMA 4TU8A 1YITS 1S10A 1HQUA 4L72B 4B9UA 2LEAA 2VG6B 2WOMB 3CWJA 1N54B 3M8RA 2DHGA 2HFNA 4L6V3 2W8KA 3CCRS 1R7IA 1N8RT 2HYIB 5C25B 2GA7A 4RLEA 2EKYA 2PN6A 2YY3A 1LWFB 2FHJA 4YB5A 3SQGA 3V81B 1E6VB 4LJMA 1YJNS 1B0PA 1S7HA 2EFOA 3ZZYA 1UAWA 1GNKA 1FESA 3IR5B 2ZFHA 1ZM4A 1MW7A 2HZCA 2CQGA 3ZZUA 1K0VA 2BQUA 4NXMF 5KFBA 3JSYA 3DI6A 1UW4A 1TKXB 1GQEA 2EI5A 3LP1B 1J2VA 5HI7A 3OXGA 4ZCLA 3QPIA 1UKUA 3OR2B 2EFQA 4CQ1A 4H54A 5F8MA 3M9OB 1RT6A 3DLEA 2HNZA 1IJEB 1T94A 4I6YA 3PY8A 2R2RA 4PQUB 4UOCA 5D4LA 1GAOA 3KHLA 1LWCA 1JNRB 1HL6A 1S0MA 5DQIA 4C11B 4RW9A 4IR1A 3CCVS 2JEIA 3Q24A 2FJVA 2HFZA 2F1FA 2IRUA 2FB0A 1RTDA 1JKHB 4KB7A 5GAHU 2HNDA 3GMGA 3CJKB 4ECVA 3RRGA 4B9NA 5F0UA 3RTVA 1IN0A 1DAXA 3W2VA 2LDYA 2IM2A 3GV8B 1QVFR 3UNGC 2FPHX 1ZZFA 4WK3A 2O5DA 4C8KA 1M5HA 4K50A 5G0RB 4CNZA 2KG0A 1YHQS 2DRBA 3NRBA 1LXNA 3C6UB 1DQ9A 2XI2A 1Z2ZA 3CGIA 5DLFA 4O3SA 4WZQA 3MR5A 2B6AB 2MKSA 3PO5A 1CEZA 1DTTA 1KC8T 4RBTA 3TA0A 1NK4A 3OL7A 4EZ6A 3ZZTA 2OSQA 2RQCA 4PR6A 2VH7A 4RUAA 4C8MA 5KT4A 1FDNA 2V2KA 1FTCA 2FLPA 5F8LA 4KO0B 5B0BA 3TAQA 1X9WA 3KK2B 3ETOA 1S6QA 1V9OA 1TKZA 3KHHA 4ZHRA 1QAJA 2ZDOA 3U1NA 2AD9A 5L1IA 4NLYA 1ZETA 1F2GA 2QMXA 3N6MA 4DUZF 1YVFA 2J76E 3J7Z5 3EYZA 3PACA 3IG1A 2YNHA 1RTHB 1SQEA 3M2VA 1KFSA 1TV6A 5E3QA 3MEDB 1F5BA 1WHWA 2R7RA 3V6JA 4HDHA 4JUZA 4EBDA 1YIJS 4EO8A 2R8GA 1FKOA 2RKIB 1WACA 3UCGA 3WC2A 3IGVA 2MKHA 1FTRA 2Z2LA 2HNZB 1VK3A 1D0EA 3GB0A 4PG4A 2IA6A 5HLFA 2B5JA 4DS4A 1FDAA 5CA5A 3WX4A 4QIWD 2MY7A 1TQLA 1OQ6A 3EGZA 4NLVA 2W4DA 4NZ0A 2MZJA 5I3PA 3Q23A 1FA0A 2N4DA 2DVIA 3I4PA 2K1RA 4N8OA 2JFDA 1S1XA 1YJWS 2AYBA 4GKKF 1RT4A 1BLUA 2XI3A 1M0SA 5IM0B 2ROEA 4CTAB 1U2RA 4DLEA 2UXBF 2LDIA 3FSIA 1GX6A 4AXJA 2KFZA