3DRPB

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 105
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB04
3DRPA 4H4MA 4ZP9A 3KLIA 4Q45A 3MEEA 1S1UB 2VG7A 5KG1A 4NYZA 2IMWP 1HNVA 1K1QA 2OPQB 4PQUA 5DLGA 1HPZA 1EP4A 3DMJA 5F8MA 1KLMB 1MU2A 2B5JB 3NAHA 4OL8A 1DTQA 3M9NB 4TY8A 4RNNA 2B43A 5DGBA 2W8KA 3PR4A 4R5PB 2OPPB 2R2RA 5J2PB 3MFIA 2AQ4A 1RT1B 4JUZA 4TQRA 1FK9A 3IG1A 2IJNA 4KBIA 2W9BA 5DG7A 1JLQB 3MFHA 4ICLA 4KFBB 2HWIA 1S0OA 5C25B 4LQ3A 5KG4A 1IKWB 3H4DA 2YNIB 3JSMB 4IH5A 4LQ9A 1S1VA 1S6PA 4O44B 5KG3A 2AX1A 1S1WB 4TN2A 2JEIA 4MIAA 2I5JB 2ASLA 4ZP6A 3KOAA 4ID5A 2D3ZA 5KFBA 1RT4A 2EC0A 5EWFA 2C2DA 4QWEA 3DOKB 1JXLA 3OLAA 3KK1A 4JV2A 1JKHA 1LWFA 3FFIB 4PUOA 5I42B 4ED3A 1S9GA 1CSJA 3CJ0A 4ZPAA 5KFJA 3KHLA 4J9SA 5F8IA 3KK3B 2ATLA 4MKAA 3PVXA 2HMIB 4O4GA 1GX6A 2OPRB 1YVFA 4RU9A 1UWBB 2VG6A 3G6XA 5KFNA 1HNIB 3VQSA 4F4YA 1S97A 1FKPA 1JLFA 4O4RA 5J2NB 3LP0B 3CJ3A 1S9EA 3DLKA 4MK8A 2I1RA 4NLDA 3DRRB 5KG7A 3Q8SB 4RNHA 2D41A 3KLEB 3BQ1A 1TVRA 2YKNB 5F8HA 2W7PA 4I2PA 1N5YB 2RKIA 2AWZA 3H5UA 3GIIA 3RBDA 1QE1A 3HVWA 4QW8A 2HNDB 3M8PA 3MEGA 1IKXB 1R0AA 2RDIA 5F9NA 2B6AB 3H40A 3GIJA 5L1JA 3C6UB 2C2EA 4IG0A 4M94A 4DG1B 3EZUA 1DLOA 4NLPA 1RT2B 3MR3A 3RBEA 1D1UA 3BGRB 2E9TA 4IFVA 4WYLA 3BSAA 5C5JA 5DQHA 4DL5A 1TV6B 2VG5A 4H4OA 5HP1A 1J5OB 3FQKA 4RNMA 3IS9B 3BSNA 4KO0A 1EETB 4TQSA 3RB6A 1TL3B 3ICLA 5KFQA 1RA7A 4YP3A 4WYWA 4RW9B 4J9NA 2ZE2A 2BANA 4H54A 4IDKA 2ZKUA 3N6MA 1QUVA 5EUHA 3QZ8A 5KFAA 4ECUA 5J1EA 4NLXA 3QO9A 2YNHB 3I0RB 2XWYA 4ECZA 1C0UB 1LW2B 3RB0A 4RUAA 3KLFB 4IFYB 4RW7B 1RAJA 4NRUA 3Q8PB 3MR2A 2IAJB 5FDLA 3H5XA 1C1CA 3BQ0A 3I5AA 2FLNA 5HBMA 2CJQA 4RW4B 3D28A 4JV1A 1KHVA 4B3OB 2J6SA 3G86A 1KHWA 4IOBA 3M8QB 1RT3B 2YNFB 5J2QB 5J2MA 3T1AA 3FDSA 4DL7A 4K4SA 5KFLA 3TVKA 5HROA 1TQLA 4WXOA 5F8GA 4MFBB 4WXWA 2OPQA 2YKMB 1IM4A 1JLCB 4RUCA 5EWGA 3RB4A 2UVVA 3LP2B 4ZP7A 4NLSA 2UVUA 2UUTA 2B5JA 1S1XB 5KT5A 1REVA 3BSCA 1IKVB 4ECQA 1TKZB 4R0EA 4FS2A 3Q8QB 3LAMA 5KFOA 3GIMA 2R8KA 3RB3A 2J6UA 2OPPA 3T5KA 4IQXA 5J2PA 3T5JA 1RT1A 5F9LA 4K4ZA 4WFXA 3DYAB 5DQGA 1JLQA 4KHRA 2IM0A 4KFBA 1VRTB 4NRTA 3GV5B 3H4BA 4NLYA 3PW0A 1JLGB 1BQMB 1XR6A 3OHAA 1JLBB 1IKWA 3JSMA 1JX4A 4IR1A 5CYQB 1XR5A 4O44A 2JC1A 2JC0A 3GIKA 2OPSB 1S9FA 3MEDB 3OLBA 3I0SB 1S6QB 1T94A 3PHEA 4M95A 4ZHRB 4URQU 3E01B 3DOKA 2GIQA 2ASDA 5KT7A 3CVKA 4G1QB 5JUMA 1ZETA 3V81B 2WONB 4RW6A 4TXSA 1SH3A 2XGQA 5I42A 3QGIA 2UUWA 4ECTA 2DPIA 4ECRA 5D3GB 3KK2A 2IM1A 2WHOA 4ZVFA 4O3QA 3DLGB 5KFDA 4Q43A 1LWEB 3GV8B 3DOLB 3KHRA 4K4WA 2WCXA 2HWHA 4EYIB 2XGPA 4EYHB 3UDLA 1FKOB 1TP7A 1RYRA 1ZTTA 2FVPA 3CJ4A 1UWBA 2FJWA 4EEYA 2JEGA 1HNIA 2VA3A 3KLGB 3IRXA 4R8UA 2JLEA 4YR2A 5KFEA 5J2NA 3LP0A 2BRKA 3QZ7A 4EBEA 4IG3A 1HQEB 2IC3B 3DRRA 2WK4A 4ED1A 1SV5B 2UVWA 2FVCA 3KLEA 4KAIA 5KFXA 4QW9A 3H5YA 4Q44A 4F50A 2YKNA 4J9RA 1HQUB 3LP1B 1N5YA 2IM2A 1NHVA 3QYYA 2WOMB 4RW8B 2V0NA 3G6YA 2HNDA 3C6TB 1IKXA 1LWCA 1T03A 2B6AA 3HHKA 2AGQA 3C6UA 4Y3CA 2RF2A 3CIZA 4DG1A 1C0TB 4MK9A 1RT2A 1RTDB 2D7SA 3PR5B 4KKOB 3CDUA 3BGRA 3QIDA 4H4MB 4ECVA 4ED7A 4EBDA 4HKQA 1BQNB 3UR0A 3PW4A 1TV6A 1S0NA 1J5OA 4NLQA 2FVSA 4PQUB 5KFUA 2BQUA 2BQ3A 4TLRA 1EETA 1EP4B 2V4RA 1MU2B 5KFFA 1JLEB 1DTQB 4TY8B 1RTIB 5T14A 3NBPB 2F8EX 1S49A 2BRLA 3MR5A 3KLVA 4LSLB 2IJFA 3T5HA 3I0RA 1C0UA 1LW2A 1ZTWA 3QGHA 3QLHB 3IG1B 5DGAA 2W9BB 4DL4A 3KLFA 4URGA 4IFYA 3QIPB 5KFIA 2IAJA 3CJ2A 1SUQB 2ILZA 3DI6B 4Q8EA 4RW4A 3TAMA 4F4XA 4IRKA 5DG8A 4O3PA 2R8HA 2BR0A 4B3OA 5CYMB 2R2TA 3HVTB 2QE5A 4ED6A 2XCAA 2E9RX 4XPEA 3PW5A 4O3SA 1RA6A 3DDKA 5KFVA 1RT4B 1RT6B 1TL1B 3M8QA 1QAJA 1SH0A 2YNFA 5J2QA 3FSIA 2WRMA 4DEZA 4HYKA 1LWFB 1NNDA 4MFBA 5KFTA 4J9PA 2YKMA 4J9LA 1JLCA 2HNZB 3DLEA 2DPJA 4ZPBA 1IKYB 1IKVA 2UVRA 4K4UA 1TKZA 4LSNB 4J9KA 4Y2CA 3PZPA 5HLFB 3DRSB 3OSNA 3ITHB 4ZVHA 3V4IA 4EO8A 5KFKA 4IR9A 4I7FB 3KLHA 4DL6A 3ISNC 4ZPDA 3DYAA 3KNAA 3V6JA 4O3NA 1I6JA 3IGVA 3V6HA 1VRTA 1GX5A 4F4WA 4I2QB 1C2PA 1JLGA 1JLBA 1TVRB 4K4TA 1S1UA 2RKIB 1HMVB 5CYQA 3N6NA 5I3UB 5KFWA 4RZRA 3KMSA 4FS1A 4ZPCA 2V9WA 2OH2A 3PW2A 1HARA 3I0SA 4J9QA 1S6QA 4XPCA 1KLMA 1XR7A 2ASJA 2W9CB 4ZHRA 2R8GA 3E01A 4IG0B 2AX0A 4G1QA 2V4QA 4IH7A 3V81A 2WONA 2ALZA 4R5PA 5C42B 3RAXA 2FJXA 5D3GA 3BSOA 3DLGA 1LW0B 5L1LA 1LWEA 2VG5B 1WNEA 1NHUA 2AU0A 1TKTB 4NCGB 5C24B 3PW7A 3H98A 1FKOA 3DM2B 4NLOA 5L9XA 5L1IA 5C25A 3UQSA 2XI3A 3CDEA 1TKXB 4WZMA 3SFGA 4IDKB 1JLAB 1T05B 2CKWA 2YNIA 4FBTA 1RTHB 4URSA 1DTTB 3LALA 1HQEA 2IC3A 5K14B 1W25A 3CO9A 3H59A 5KG6A 1SV5A 4KB7A 1S1WA 2FLLA 3OSPA 5DLFA 2I5JA 2BE2B 2QV6A 1VRUB 2ZD1B 3KJVB 1S1TB 3LP1A 3N6LA 4IRDA 4QWDA 4ZP8A 2R8IA 5KT4A 4IRCA 2WOMA 1RTJB 3FFIA 3JYTB 3C6TA 4NLRA 3MECB 4Q8FA 1RT7B 4KV8B 3KK3A 1HYSB 3FQLA 1C0TA 5KFYA 2JEJA 4NLGA 4G3IA 1RT5B 1RTDA 3MR6A 4K4VA 2HMIA 3ISND 2XCPA 2OPRA 3M9OB 2AGPA 4WZQA 2W8LA 2RDJA 1BQNA 5J2MB 2HNYB 2HAIA 4WFZA 1N4LA 5KFZA 5HROB 5KFGA 2R2UA 3OHBA 5KT6A 1N6QB 1C1BB 4PWDB 1REVB 4J9OA 1JLEA 3NKYA 4NLWA 5KG0A 1RTIA 2YNGB 3NBPA 3BJYA 3BQ2A 2JEFA 4Q0BB 4LSLA 2FVRA 4KHMA 3V6KA 4K4XA 4WE1B 1MMLA 3QGGA 4J9MA 3QLHA 4ZVEA 3V6DB 5F8JA 3GILA 3QIPA 2XI2A 2E9ZA 3T5LA 3I5BA 2W9AA 4F4ZA 1D0EA 1SUQA 4DL3A 3DI6A 3NAIA 5KT2A 2J6TA 3DRPB 4ECWA 1S0MA 3KLIB 3MEEB 1U09A 2VG7B 1QAIA 3HKWA 4YMEA 4U6PA 4FBUA 1HNVB 5CYMA 3CDWA 3HVTA 3IS9A 4EBCA 1HPZB 3FRZA 3DMJB 4KSEB 1TL3A 4YR0A 1TL1A 1RT6A 4RW9A 3OL9A 3SFUA 3UPFA 4X2BA 4MKBA 4RW6B 2IA6A 2HNZA 2W7OA 2YNHA 3KK2B 1IKYA 1FK9B 4K4YA 3EPIA 2IBKA 1T3NA 4LSNA 4RW7A 4DL2A 5HLFA 4NLUA 3DRSA 4ICLB 4MIBA 4U7CA 3NGDA 4QPXA 3ITHA 1N48A 3I5CA 3D5MA 4I7FA 5KG2A 4MK7A 4IH6A 4Y2AA 3IRXB 4R8UB 3MF5A 2IM3A 3TQ1A 1S1VB 1S6PB 3GYNA 3MTKA 4IG3B 3CWJA 4I2QA 4KE5A 4ID5B 4TYAA 3SI8A 1RT3A 2WTFA 3LANA 3OL7A 1HMVA 3KK1B 5I3UA 5L1KA 1JKHB 4IKAA 4RNFA 4PUOB 4EO6A 1S9GB 1LWCB 1RYSA 3LP2A 1T03B 1JIHA 4ED0A 1S48A 3G6VA 5KFRA 2W9CA 1S1XA 3E51A 4ECYA 2GIRA 4NLVA 5F8LA 2RF2B 1SH2A 3KHHA 4GC6A 5KFCA 4YR3A 4ED8A 4O4GB 5C42A 3KMQA 2VG6B 2FJVA 1LW0A 2C28A 3GQCA 1FKPB 1JLFB 1RDRA 1Z4UA 1TKTA 4ECSA 1S9EB 3DLKB 4NCGA 5C24A 3DM2A 2D3UA 4JV0A 5DQIA 1TKXA 1BQMA 1JLAA 1T05A 3H2LA 4I2PB 4GC7A 1N56A 1RTHA 5KFPA 1DTTA 2O5DA 5K14A 1QE1B 2OPSA 3MEDA 3M8PB 3MEGB 1R0AB 4TY9A 2AGOA 4O3OA 2BE2A 4YQWA 1S4FA 2FVQA 5KFHA 5EWEA 1VRUA 2ZD1A 3KJVA 2GC8A 4RNOA 1S1TA 5KFMA 5EDWA 4MH8A 3Q8RB 3GV7B 1DLOB 2C2RA 3PJXA 2BQRA 1RTJA 3JYTA 2WB4A 4WFYA 3OL8A 3TAMB 2C22A 4ECXA 3MECA 4IFVB 1RT7A 2R8JA 5KFSA 3T19A 3H5SA 3DOLA 4H4OB 4KV8A 5HP1B 1HYSA 5F8NA 3M9MB 1RT5A 4KO0B 3IGNA 4Y34A 4ZVGA 2HNYA 4QWAA 2ZE2B 2BANB 4QWBA 3KLGA 3IN5A 1S10A 3NL0A 2FLPA 2VA2A 2ILYA 5KT3A 4ED2A 5J1EB 3DLEB 3QO9B 1N6QA 1C1BA 4PWDA 3BREA 3NMAA 4QWCA 2XC9A 3KHGA 1K1SA 2YNGA 1HQUA 5FDLB 1OS5A 3CJ5A 4Q0BA 3BR9A 3HVAA 4NLTA 3V4IB 1C1CB 4RW8A 3LAKA 4WE1A 4XO0A 5DG9A 5HBMB 3KLHB 3OL6A 3RAQA 3V6DA 2R2SA 4TYBA 4NZ0A 3EPGA 3PJWA 5KG5A 4O3RA 4K50A 5JXSA 4ZMMA 4KKOA
chains in the Genus database with same CATH superfamily
2VG7A 1N8RT 1TKDA 2W01A 3CUNA 5HMXA 1K1QA 4PQUA 2J8AA 4DS5A 1J2VA 2B51A 4R25A 2UUBF 4YHHF 4JI2J 1FK9A 2HRYA 4I69A 1PO6A 4ICLA 2ABYA 2YWFA 1IKWB 1FTRA 2CQCA 5T41A 2AYBA 5HMYA 1RU1A 1IWGA 4PUOA 4ZPAA 2UZAA 1CULA 1FD8A 2NXJA 4RU9A 1UWBB 4F4KA 2MKJA 3ZXWA 2DNLA 2HYIB 3TVYA 3PDNA 2NPIA 2V4JA 1E6YB 3DN9A 1TFWA 2KYZA 3J81j 2R7QA 2LMIA 1WJ9A 2VFTA 2M0GB 2J8SA 5EUHA 5HMWA 3LOUA 1YITS 2XZTB 5FDLA 3UCUP 5H9FJ 1G1XA 1C1CA 3FCWA 1KHWA 3M8QB 1RT3B 3C3LA 1JMTA 4JI8F 3T1AA 2LA6A 5EWGA 4ZP7A 1YLXA 1UVJA 1U6FA 3LWMA 3T5KA 2PMZD 1NEEA 3DYAB 3U02A 3KUEA 2F65A 1BQMB 2DXFA 1HD1A 1Y5NB 4JOUA 5AJ3F 2MGZA 5M2RA 2ADCA 3J80Y 4ECQA 2V8GA 2AYMA 1A9NB 2HWHA 1FFWB 2X51A 3ZTOA 2CNNB 1RLCL 1RHRB 5LSLA 1PJ7A 2VDIA 3KG4A 4QW9A 2YXLA 3G6YA 2KZMA 2ZHOA 4FDFA 1R27B 4CTAA 2BJ3A 3W9JA 1RTDB 2EFPA 3QIDA 3L3CA 3CJQA 1KTQA 3FVYA 4NLQA 4PQUB 3TARA 3NNHA 2KM8B 4X64F 3MCOA 1RTIB 2JLFA 4PQAA 2WVFA 1GMVA 3HHNB 5KFIA 1AUDA 2NUHA 4EUVA 2DGWA 2BR0A 2YBVA 2QYGA 2DR7A 3PW5A 4O3SA 2HNZB 2GX8A 1IKVA 3K2YA 1IQTA 4BC9A 4ZVHA 3KLHA 2VPYB 4DL6A 2VOPA 3GG1A 1I6JA 3I56S 2KRBA 3CCJS 3IMQJ 3J7AN 2MJUA 3I0SA 2MQPA 3A8EA 2BE7D 3CIMA 3SXLA 2WBMA 2ZDOA 1M5VC 5C42B 4P74A 3MMAA 2K3KA 2AU0A 3U1LA 1WTBA 3CDEA 1Y9OA 5FLXY 3FBCA 4XAKA 2UU9F 3H59A 2OUGA 2XWXA 4A8OA 2D74B 3KDNA 1RT7B 2HS0A 1H0HB 4PRFA 5AE3A 2W2PP 3AH6A 1IBMF 1LXNA 2OPRA 2RDJA 3GSIA 1VQ7S 1J5EF 3FCHA 3QWPA 1KQFB 2WSEC 1MMLA 1Q8LA 2XI2A 4DR5J 4RKUC 3DI6A 2AZ1A 4X84A 3G4SS 2J0SD 2DEJA 1TL1A 2MQ8A 2CJBA 2MGZB 1NKCA 2HHTA 4C8NA 3CD7A 2MHEA 1YHQS 4Y2AA 3GYNA 4J9VA 3D0IE 4ZN1A 2F5GA 1TL7B 3W65A 3OVBA 5SUHA 3CCES 3TZZA 3H25A 4ED0A 4C11B 1ZZNA 2VPXB 5HQMA 2VD3A 5D0HA 2N4DA 5C24A 4JV0A 2OFHX 3GCXP 1T05A 3BYPA 3GWCA 3MEGB 3JTOA 1UJ5A 1VRUA 1IXKA 3Q8RB 5G0RA 2C2RA 3M9MB 2M8HA 1RT5A 1BQXA 2R3VA 5K8NA 1YJ7A 4UY85 3LTOA 3PO4A 3KLHB 2FJDB 2HGNA 1CPZA 3LQVA 1LKZA 3IO1A 2P6SA 3MEEA 2KHCA 3BBFA 2OPQB 4OL8A 1S0VA 3MDFA 4RNNA 1UVMA 2BA9A 2XY7A 3MMAB 2L9DA 3Q2SC 4MYUA 4LF2A 3MOZA 1RWUA 3C2PA 1S5ZA 2N7CA 1JJCB 3KOAA 2NPFA 2IA0A 1NLKL 2O01C 1CSJA 3CCSS 2GVZB 2AEMA 2OPRB 3T1YF 1VBYA 4RBVA 4F4YA 4NLDA 1CC8A 4RNHA 3UNGC 4MIWA 4C8ZA 1TVRA 1RBLA 5F8HA 2QLWA 4USKA 1HKAA 2RDIA 4TKTA 3CTRA 5G4DA 1XEZA 5HP1A 3AA9A 4XDDA 3RB6A 2XULA 3ICLA 4YP3A 1G4CA 4J9NA 3P8BB 2E5HA 1U6ZA 1S57A 4RPFA 2BJ8A 5CAAA 2ZH3A 3MM5A 2ZH2A 3B8HA 4DV5F 2J6SA 5HJXA 1RLDA 2EVZA 5HROA 4OI3A 1R8AA 1TAQA 3A8IA 5KT5A 5D4PA 3CCVS 4KH1B 3PY8A 2J6UA 5J2PA 2G9OA 3CCQS 4C3KA 3GV5B 3UDEA 1VIOA 1NZ8A 2IRUA 2YPYA 3AB2B 1JX4A 4CLKA 1HR0J 4X62F 2AMCB 1QD1A 3M6WA 5FIIA 4DQIA 4C8LA 1NK9A 1WEYA 3S7RA 3B82A 1AZSA 1X5OA 1CQMA 4ZS6A 4OV6A 2HVHA 5J2NA 3LP0A 2GAHC 4IG3A 4AUKA 4JI6J 2XMTA 2CJAA 2RNEA 1U24A 2EFOA 2ZJRQ 5DDQC 1YG0A 5KTQA 1C0TB 2MKHA 3N0VA 1RT2A 5I3PA 5IM0B 1G6BA 3BGRA 2C42A 1R8PA 4WP3A 1N36J 1UVLA 2GAGC 1U8SA 4QU7A 4Q2LA 1EETA 2PFFB 5CYJA 2P2CB 3I0RA 1C0UA 1ZTWA 3CW2C 4WU2A 3BBBA 3QIPB 1HBUB 3MMBA 2E7WA 1VQNS 1RXOB 4LVNP 5CYMB 4KQZA 4PPZA 1WC0A 3I6PA 2QA4G 2XLKA 2XS2A 2FGCA 4LSNB 1OQ3A 4F2RA 2MHNA 3M30B 3ISNC 2HZVA 1HWUA 2Y1JA 1TVRB 2CG4A 1NDPA 4CLYA 1HHTP 2W9CB 3WBZA 1DHMA 4DR4F 3KG0A 1I94F 3DLGA 4P73A 2Q1LA 3VF0B 4DOZA 3M1VA 4HACA 2MDAA 2C3OA 4USWA 1H2UX 2AHOB 2FLLA 1S1WA 1ZH5A 2V69A 3P5TL 4QWDA 1EX8A 3PRDA 2IYIA 1VQ6S 2RRBA 1B4SA 1YRTA 5HROB 2ZZMA 4CQ1A 4PWDB 1RAGB 1WOPA 4UUWA 3TA2A 1SKSA 1EZZB 4D3HA 1N32J 1BXNA 1CJTB 5A0YA 2J6TA 2CNLB 3IWLA 3T3FA 3PACA 3FRZA 4AL5A 3MD3A 1UZDA 1HNXF 3N01A 3QJPA 1IM6A 1FEEA 1HBNB 1ZAWA 3HHLA 1IKYA 1RHUB 4K4YA 3EPIA 2RILA 3DLLQ 4DL2A 5HLFA 3CD5A 3DRSA 1PC4A 4I7FA 4IG3B 4BCAA 3OXLA 3M8YA 5D77A 1F5AA 2GIFA 1ULRA 2VKZG 3LP2A 3E51A 2FZKB 2XHCA 3RR8A 4N47A 1Z4UA 4X65J 4I4BA 4UQTA 2PEBA 1WHYA 3SV3A 2CNKB 2AGOA 1S4FA 1FDDA 2QFJA 4MH8A 1U7LA 6FDRA 2HK2A 3OPKA 2P8IA 1OIAA 9RUBA 4OZ3A 3H5SA 4LR8A 3BGUA 3VAJA 4PG5A 2ZE2B 2ZUGA 3IN5A 5EX0A 3NWRA 1FRKA 5B0DA 2B4PA 5HMZA 4WE1A 5HBMB 3QJLA 4B3MJ 2H5EA 4ZP9A 3L7OA 4Q45A 2GGPA 4NOHA 1B7FA 4OQJA 3TP2A 1TMMA 2VQFF 3CT9A 2VBYA 5DG7A 1XC9A 2RAQA 2AF6A 4HACB 5A2QY 2EBGA 3BDEA 1XTZA 3AJ1A 1VOMA 1S1WB 4ZJQA 1RT4A 2C2DA 2EC2A 3NGUA 4JV2A 2NYHA 2CXEA 1G2EA 3ZTSA 2LA4A 2D69A 5KG7A 3VAHA 2F40A 2D41A 1U25A 3W63A 3H5UA 2J76E 1R0AA 2N7YA 3C6UB 3HSJA 4IG0A 5LMUJ 2NXUA 4NLPA 3RBEA 3AOBA 1Z2LA 2N82B 4WYLA 1TV6B 2CZ9A 3ENQA 2E1RA 2KG1A 2DO4A 3EZ5A 2UV8A 1QUVA 4G65A 4JV5J 4CO5A 3HHLB 1RWKB 2Y0SD 1WG1A 4PG4A 5LSOA 3MPDA 1X4AA 2MQQA 2MEWA 4C0BA 2MYFA 1Q95G 3KYLA 2H54B 2JH3A 3O44A 3LP2B 1RADB 2F8HA 2NSCA 2VQEJ 2YVSA 4CT9A 3S1TA 2KB2A 2ZHBA 1DZ5A 1JLQA 4ZCLA 2DK2A 4NRTA 1QTNB 3M7VA 4DU8A 1ZS6A 1JLGB 5IFMA 5CYQB 2OO4A 2HVDA 1S7HA 3HFVA 1YIJS 2ZBIA 2W2QP 2GHVC 3V81B 4NA1A 4DUYF 4Q43A 1LWEB 1FKOB 1RKIA 2EPIA 1X5SA 1HIYA 2B9EA 2XNQA 1FO1A 4M5LA 1D09B 2YY3A 4ZVRB 3C8YA 3CDUA 4ED7A 2ROGA 1J5OA 2OIHA 5K20B 1OMSA 2V4RA 4OX6A 2A0FB 1JLEB 3D3BJ 2HLUA 1HW8A 4LFAJ 3OTOF 3MR5A 3QWUA 2MSSA 1T9UA 2IRXA 2ZBCA 3M8WA 5DGAA 3QLHB 1HW9A 1UPPA 3KLFA 4FF3A 3HPOA 2JLGA 2XQCA 4LF4J 2KXHA 4YB6A 1RT4B 4DEZA 1O51A 1UPMB 2HQFA 4BDPA 3OSNA 1YJRA 2CJYB 4ZPDA 1X4DA 3IGVA 4NEYA 4RL1A 2DNMA 2H48B 4OZJA 3J81Y 3E01A 4IG0B 1YJWS 3IFEA 3UD3P 5DO2A 1QY7A 3BSOA 3O8WA 1QVGR 4YB7A 1WNEA 2ZC4A 8AT1B 5L9XA 1TKXB 4I68A 3QAEA 4AQYJ 4TVAB 3TAQA 1U2FA 2J0WA 2Y8YA 5LXRA 1KDNA 3FFIA 3D0HE 5MLCV 4JI5F 1K73T 4L76A 4OYBA 4NMLA 3TJAA 1JB0C 3J7Z5 2LEBA 1T7PA 2H5IB 1BE4A 5AXLA 1FRJA 2HQGA 2UXDJ 2E1MC 2HAFA 1TL4A 2RUSA 2QMXA 4NE9C 3SYZA 2DNRA 2DRBA 4CLFA 1AT1B 1IBKF 2B9XA 3W8PA 1Q79A 1QAIA 1T95A 4GKJJ 4JI6F 3DMJB 4OJ1A 4P7VA 4O0NA 3TX8A 3EJMA 1BY9A 1SIWB 4LFCJ 4EGLA 1Z1ZA 1KKHA 2FY1A 2DCLA 2WW8A 3OV7A 2V67A 4FYVB 5L39A 2IYGA 2WTFA 5IXUA 1JKHB 4DR3J 2A10A 5F8LA 1SH2A 2NCKL 1F5CA 5GAHU 1HD0A 2KT2A 1EKRA 4YDDB 1JLFB 4HHJA 2FD2A 2DY1A 3PRVA 4KHPF 1YWXA 4NEZA 2WVDA 4WU3A 2NQPA 1SL1A 3GV7B 3JYTA 3OW2R 2R8JA 4OHYA 4H4OB 1PC5A 3JSRA 3K8WA 3Q8YA 3LPEA 3KUHA 2AJFE 4QWBA 2V8VA 1WTFA 3BREA 4QWCA 3TR5A 2M88A 1VGYA 4DPXA 4B9LA 3U1MA 5B0CA 2FHOB 3V6DA 4ZIWA 1IWAA 4B3TF 3H20A 4OYOA 3DRPA 1UL3A 3KLIA 2IMWP 3EGVA 2BW7A 4I0WA 2ATCB 2IPOB 4LRFA 2B43A 4MYTA 2NLWA 2IJNA 2G2YA 2DGSA 2AJ4A 1RSCA 1ZOTA 3HFKA 3JSMB 4IH5A 4J91A 5HN0A 2GO8A 2R7XA 2ZH6A 1VQ5S 2EC0A 2YWWA 2XS7A 1MROB 1LWFA 3FFIB 3CPWR 2U2FA 1C4CA 4J9SA 4F67A 2A6OA 2MQMA 4LF9F 4X66J 2RHQB 3VQSA 2CQ4A 3VQTA 4F02A 2I1RA 3NWGA 1FFSB 2C2MB 3TX0A 1QE1A 5F9NA 5LOQA 1T0TV 4ELTA 3HMJG 3WIUA 3T9ZA 1APSA 4KO0A 1XQIA 2B9YA 1YTYA 1X4CA 4IDKA 1R8CA 3M2VB 3SDEB 2FC9A 4FXDA 3OUYB 2CJQA 2QLXA 3D28A 3ILJA 4K5SA 4UOCA 4AL6A 1WG4A 1LXJA 2BKPA 2UV8G 5U47A 2YNFB 3VR1A 4CLLA 4NI2A 1Y5IB 3HHLD 4MFBB 2QN6B 3RB4A 1JLCB 5E3CA 2J0QD 1WSVA 4ES2A 3AOCA 4FYYB 2DGXA 2MKIA 2D9OA 5HQ8A 3BGFA 2LQJA 1S6QB 2ZM6F 4OZ1A 4RR5A 4ECTA 5I42A 1PGZA 3UDCA 2F4VJ 4DQRA 2JEGA 2KM8C 4C0HA 2VA3A 4HVZA 2E5LF 1SV5B 5CXTA 2Y8WA 2QTWA 3UE2A 1IKXA 2B6AA 1HWKA 4YDXA 3EVMA 1V6HA 4HKQA 1BQNB 2HPUA 4OZLA 4YN3B 3UN5A 1S0NA 2IBOA 4CLTA 5HK4A 3NBPB 1RACB 2F8EX 1FXDA 1FE0A 2UXBF 3HD2A 4LREA 2ZH9A 2QGFB 5GAGI 2K2PA 2QE5A 5GMEA 3WIVA 4DZDA 2VFUA 3O5TB 3FSIA 4OX8A 2BE9B 3C14B 3H8YA 3GPAA 4ETXA 1LWFB 1WHWA 3RRHA 3PIOQ 1NJYA 3SSQA 4ZPBA 1VMBA 5ETRA 2KL8A 4X4TA 2FPHX 2J7WA 4DX8H 6AT1B 2E66A 4FXWA 4HDGA 2DVIA 2PFDA 2LP4A 5KFWA 2HHSA 5KOWA 2ZH4A 5IT0A 2KVIA 4BHQA 4RX6A 3BGOP 4G1QA 3GJSB 2LEAA 2FJXA 4C7QA 3K5LA 2ROEA 1FJCA 1FXRA 4OJGA 5DM6Q 1RP5A 4NLOA 4DPTA 2UUCF 4IDKB 5B0BA 1NBEB 1SQEA 4LF8J 1HQEA 4FF4A 2ZD1B 2HVZA 2V2VA 2DHHA 3GJQB 2Q43A 1TR0A 2LXFA 5JVHQ 4K4VA 3AJDA 3AD8C 1N4LA 4ZLJA 1SI9A 5KFGA 1F3FA 4DCOB 3CC4S 3V5RA 1L3TA 2B8QA 4U96A 3BQ2A 5E3AA 2W9AA 1D0EA 1FA0A 2IRYA 4YMEA 1XN9A 2QSWA 1EKSA 1YGYA 4DQSA 2YNHA 2YKPA 1H2TZ 3NGTA 3GTYX 1P27B 2Z30B 1N48A 1WF0A 3I31A 1T9XA 1V9OA 4A8FA 1RABB 2K3IA 4NASA 2NXNA 2XBPA 5AXKA 2E1AA 2CQIA 1S7IA 4C9DA 3SV4A 3L7UA 3TRGA 2AV5A 2VFRA 2SXLA 2D3UA 1IR0A 3IR5B 5K14A 2QLBB 5IQ6A 4YQWA 1HBMB 4V19J 5EWEA 2PA8D 4WFYA 3R27A 4QYZJ 2GMHA 2V94A 1NDKA 4M5HA 4N5SA 4ED4A 4YB1P 3R5AA 4Q0BA 4A4JA 4XO0A 4G1PA 3QATA 3SIPB 4RWXA 2NREA 3GB0A 4KKOA 1HPZA 4ZN3A 1UEVA 4DF4A 2LECA 4KGKA 4KFBB 2CPJA 4AL7A 4UZCA 2FC8A 4TN2A 4MIAA 2ASLA 2RH3A 4KYZA 1JXLA 1KR4A 1M5OC 3PEHA 3D1QA 2LU2A 2W1BA 2G2OA 3MHYA 2FJEB 2UP1A 3G6XA 1T9WA 1E6VB 4DPOA 2F3JA 4RUCA 3CJ3A 3DLKA 2XMAA 1FVSA 2F9DA 4ZVSB 3MMCA 3NLCA 3GIIA 3I96A 2HNDB 5HVGA 4LFCF 3T9NA 2EBEA 1RAIB 3ENWA 4LBHA 4DL5A 4CLPA 3N6MA 5J1EA 4DF8A 2YNHB 2R7OA 3RB0A 4OV1A 2KO1A 1AROP 1F2GA 3RJMB 2Z2LA 3X3UA 2LXUA 2XMWA 2LYVA 5A8KB 3RZAA 2ZEJA 2J0XA 4OYMA 4BWJA 2UUAJ 5J2QB 5B08A 2VFVA 5KFLA 4JBCA 1ZYQA 1VQ9S 2LQ8A 3FZBA 2B56A 4KPYA 5KFOA 1PJ6A 2G13A 4IQMA 1OSCA 1M0SA 3G8TA 4KHRA 3PKMA 3KDOA 5D0GA 1VR6A 1NK7A 4IR1A 2C3MA 3OJUA 3CCMS 3KG1A 4ZHRB 4URQU 3MM6A 4TXSA 3DLJA 4DLEA 2BEFA 1WF2A 1V5VA 1JJHA 5D78A 2IC3B 3DRRA 4Y00A 3RUBL 4IO9Q 4L3NA 2YKNA 1PJ5A 2IM2A 1NK6A 1SPBP 3C6TB 1T03A 4WP8A 3CIZA 4KKOB 5IWAF 1ACMB 2CPHA 3THPA 1GMUA 3GIRA 1YJVA 4URGA 3BPSP 3D54A 3UI3A 2ILZA 4X66F 5L9NA 1ITPA 4DV2J 5DDOC 2XCAA 4I56A 4TU9A 4ZVTB 1VJWA 4OI6A 4QYRA 4JB8B 2EK1A 2QSFA 3M8SA 4GVBA 3PTWA 4YY3J 2HSEB 3N79A 4FS1A 2RT3A 3QBCA 2CNOB 3F56A 5A76A 1CC7A 1NHUA 2YQ3A 3T41A 4FF1A 1R8BA 3DDIA 1SC4B 2QV6A 4NA2A 3SZ2A 4IRDA 2R8IA 2WOMA 1RTJB 3D1OA 4DR2J 1FRMA 4OI1A 3J7YI 1HYSB 4P2SA 3K5PA 4ES1A 1SKWA 7AT1B 1B7YB 2AGPA 2HNYB 1GH8A 2GCFA 1C1BB 4ZLPA 3D6FB 4GVLA 4UF4A 3CDAA 1R0BG 3W66A 3SEOA 2NS1B 3I5BA 3LH2S 2ALYB 3ENVA 4KTQA 4FKXA 3QNWB 3CDWA 1RT6A 2CQ2A 3IBCB 5A8RB 4DZ6A 1WORA 2VIHA 3N5FA 4PWWA 4JYAF 5D15A 4JI0J 5D4NA 4GO7X 4L74A 1UA0A 1VBKA 2FY8A 1B0TA 5F3TA 4RNFA 6FD1A 1T03B 4FYXB 4DBQA 4GC6A 1YBUA 4X4PA 4O4GB 4ED8A 1R6VA 1LW0A 1KTVA 4ECSA 1XNRF 4CLZA 1BMQB 4OX9J 2BBEA 2AJ2A 4I2PB 3IR6B 4MT1A 4WWSA 3W5ZA 3SQGB 3JSYA 3CD6S 2KG0A 3OL8A 2XO7A 4DV6J 1FDNA 1KC8T 1MN7A 4Y34A 1P1TA 4DX6A 4YFUA 2BW2A 2BANB 2VA2A 2HFUA 4DFMA 1K47A 2AYEA 2JVRA 3AOAA 3LAKA 2W24A 2L41A 4DFKA 1OY8A 1NO8A 1X5PA 2N3LA 1HNVA 5ITHA 1RE1B 4CH7A 5F8MA 2HQDA 2EFNA 4C3MA 5EGYA 2PA3A 4M5DA 2EFGA 4UUXA 3ZC4A 4DR1F 1RGVA 4CRJA 5HI7A 1GTEA 5CA5A 2CJXB 2U1AA 2NZ4A 1FJGJ 3Q24A 4CLUA 5F8IA 3PVXA 3HSZA 2R7TA 1S97A 1S9EA 2MB0B 1RWPB 3D1HA 4F04B 5ETNA 3I9V9 3HX9A 4B9VA 4WK1A 2CPZA 1FJ7A 1R31A 3GIJA 2DH9A 2N3OA 1DLOA 2O66A 3GJTB 5C5JA 1CS4A 3Q0AA 2MPUA 2MKCA 1B0PA 3AY0A 5KFQA 4EZ6A 1VI7A 2I38A 5KFAA 4GKKF 2HBQB 4IFYB 4ZVUB 3QAUA 1RAAB 2Y1LB 2GQQA 2FLNA 3QT5A 4LF5F 3U27A 4K4SA 5F8GA 4WXOA 2B5JA 3A3OB 1REVA 1FRHA 4AE5A 2OPPA 4I6AA 1Q53A 4P71A 2HBRB 3POTA 5H1SV 2KXNB 3OHAA 5BYRA 3C15A 4O44A 3HO1A 2V2KA 3DOKA 2GIQA 2GHPA 2UUBJ 4YHHJ 1SH3A 4O3QA 2K1RA 3JS9A 4QIGA 4DJBA 1HNIA 3M2UA 2JLEA 2WK4A 2WAQD 2ZH1A 4KAIA 5KFXA 4Q44A 2ZZTA 4J9RA 4P6QA 2DRDA 2XTJP 3IRWP 2OJ3A 3PR5B 1YDLA 2CQ3A 3PYFA 2V8DA 3GYXB 3GFHA 4K7QA 1LW2A 2CDRB 1NAQA 1XMBA 3MM9B 4B3OA 4WCEQ 1HNWF 4ILLA 4C8YA 2BJEA 3M6VA 3R97A 3CB4A 1LEOA 1TKZA 4GRSA 1BWEA 3ITHB 3V4IA 1S99A 4M1KA 3IC1A 4DV3F 3DGPA 5CCMA 2X1AA 4UOGA 4JI8J 2BACA 1WEZA 3ZZRA 3CCRS 3MPVA 3SCKE 1M5PC 5JVGQ 4ALZA 2VBWA 4Q2MA 3VVTA 4NXMJ 1X7VA 4YS2A 3RAXA 4WTOB 3NOGA 4NCGB 3R6GB 1YJTA 3CULA 1DQ9A 3BEGB 3NP5A 2B0GA 5AJ3J 3FC9A 1R3NA 3LP1A 1M90T 2MKSA 4ZP8A 3MECB 1RK8A 5KFYA 2HVEA 3M9OB 2HAIA 3BKTA 4ZCKA 2CDQA 3G9CA 1REVB 2M52A 5A6WA 4J9OA 2CQHA 5IQQA 3PIPQ 2FIUA 4QIFA 5F8JA 2OHDA 4A8WA 5EHHA 3NG8A 5KT2A 2EG2A 2PMWA 3IAM9 3HVTA 3MM7B 4WFBQ 3W2VA 4X64J 3SFUA 3UPFA 1G7CB 3FKBA 4F3QA 3O2IA 3WC2A 2KT5A 1CBKA 4GMKA 3M2UB 3TQ1A 4ID5B 1H7XA 2YQ0A 3OL7A 1T11A 1S48A 4A8QA 1S1XA 3R2CJ 2Z4PA 3K5NA 3FUYA 1X4BA 5B0EA 1TKTA 1KSPA 2Y3YA 3M32B 4CP5A 4P9SA 2DR6A 4M5MA 2BE2A 2BYCA 3JTNA 1CG2A 1I51B 4IFVB 4M5IA 3CMAS 3DOLA 4RUHA 5JJBA 4ELVA 1F9HA 3G8SA 4NXNF 1FKAF 2VPZB 2UU9J 2Z2MA 1V5IB 2XC9A 3UD4P 5ETVA 4B3SF 1HQUA 1S6OA 4K2XA 3V4IB 1N54B 3R8YA 1IBMJ 4ZMMA 3CC2S 1BUXA 4OHVA 3TJ8A 1RBOB 1J5EJ 5IOLA 4PYAA 4R0JA 1KEKA 2CPIA 4PYDA 3MFIA 3R1HA 2AQ4A 1LK7A 3BZQA 2W9BA 4F8RA 2HZCA 5D8HB 1S0OA 5KAKA 4GO5X 4F26A 4ZVQB 3Q2TC 4LR9A 5GAEI 3MAQA 3E8OA 3CC7S 4EI2A 5GADU 4ED3A 3ET6A 4F25A 2IDLA 3BR8A 3H2UB 1GEHA 3K59A 4ETZA 3TVZA 3ZTPA 2DNYA 4LRDA 2WVEA 2NXCA 2W7PA 1AYEA 5L1JA 2MMYA 4DG1B 2DNPA 5GVQA 3OTBA 3BSAA 1AFIA 1HHSA 3AD9C 3OHBA 4H54A 1MWZA 1SJ4P 3QO9A 2XWYA 3A8JA 3HKZD 1NJWA 2OELA 3FJ2A 4HEA9 2LQ9A 4WPAA 4OX9F 3ILOA 5A6PA 1JK9B 3OR1B 3TQEA 4NLSA 1S1XB 2POKA 3RU0A 2QLJB 3BO3A 3LAMA 4IQXA 3FBFA 1DRZA 3JAMU 3H4BA 4NLYA 3PW0A 1IKWA 1MNEA 1S9FA 2J9DA 4W4MA 4WFAQ 4DR7F 3G6ES 2WONB 4RW6A 3QGIA 3D0GE 1V3ZA 3DOLB 3HZGA 2W4CA 3L09A 1JNZB 5SZTA 1UWBA 3FSXA 3RR7A 4L75A 2CJKA 2XY6A 2XZDB 4FKYA 2EFVA 2FVCA 4USHA 1HQUB 3QYYA 2RMLA 5IV4A 5B7WA 1E6YA 3CF5Q 2UXCF 2D7SA 3F41A 3T1YJ 1T9YA 1SIZA 5KFUA 3QGPA 3S8SA 3NMRA 5JMNA 2OMOA 2HEKA 3CJRA 2PN6A 2CPDA 1FX2A 2W9BB 5F3ZA 4DL4A 4CDIA 2CQ1A 3FMWA 4TLQA 1SUQB 4F4XA 2Y1IA 2NXEA 2BJ1A 1X9MA 4ED6A 1K8AT 2E9RX 4F3MA 4FBUA 3BKUA 3M8QA 3D3CJ 2H5JB 3DLEA 2ZKTA 3RBZA 2UVRA 4DPUA 4EO8A 3V4MA 3DYAA 1GMWD 3PEJA 4O3NA 2FJBB 2E1CA 4X4VA 1C2PA 1NPPA 1S1UA 4A47A 4RZRA 1HARA 4J9QA 2ASJA 2Y1RI 2PE8A 4MKVA 1M1HA 5K8PA 3CCWA 5L1IA 3UQSA 2YX4A 4DPYA 2V50A 1FXLA 3MUTP 4X62J 4KGMA 4A8SA 2WBRA 4B17A 5DLFA 5M2PA 3N6LA 5LL6d 2M2BA 2PI4A 2HQIA 3JSBA 2XMVA 4Q8FA 2L48A 4KV8B 1IR1A 3FEZA 1RTDA 2CPEA 3CGIA 2HIYA 3P4UB 1VIXA 1RTIA 2YNGB 3BJYA 3CD0A 2FVRA 3KUGA 2E9ZA 3VCDA 4C0OC 2D1CA 2M7SA 3HKWA 3DC2A 4DUZF 4RW6B 3F44A 2DR9A 2HNZA 2W7OA 2V5HG 4U95A 2K7JA 4QPXA 1IJFB 1TUWA 1RHJB 4IH6A 4NWBA 1M1GA 4A8MP 2AEJA 2V34A 3SI8A 1BWVA 4DPWA 2O3DA 5E3QA 2J5AA 4DV7F 2ZVSA 3FMBA 1PYOB 4OI2A 4DUTA 5C42A 1WC6A 1FERA 4LBIA 2Y0BB 2OMLA 1DBDA 1VCTA 2HHVA 4ZITA 3ZZOA 3M8PB 3PM9A 2PI5A 3L95X 4X4OA 1UTAA 2DNQA 4DR4J 1I94J 2W25A 4ECXA 1RT7A 3LW5C 4KY3A 5KFSA 1RJJA 1WELA 3HHEA 2EW9A 1X4FA 2VOOA 1U0SA 5KT3A 3DLEB 4QQBA 4CIOA 3CJ5A 1Q7LB 4NXMF 5B0AA 5EX3A 4B3RF 4P75A 2AJQA 4LF6F 1S1UB 2J7UA 2DYAA 3VGSA 2XLIA 3TA1A 5A8WB 4J90A 2RS2A 4Y28C 4FZVA 1RT1B 3C66A 2YKOA 1Q8BA 2R42A 3H4DA 1KNZA 4WIIA 1Y4ZB 3P6YC 1UVKA 1TL7A 5HO4A 3MEKA 1HNXJ 2IVMA 5D6GA 3P96A 4C11A 2GZOA 4MTPA 2OAUA 4CI0B 3NCRA 2FUG9 3CCUS 3J7A1 2ZHAA 3KLEB 3W60A 1ZZFA 2BM1A 1WHVA 4QW8A 2IVYA 3MEGA 3HJVA 2WB1D 4X4RA 1DAXA 4CCHA 1D1UA 2QZ8A 2VONA 2QG9B 4B9MA 1U1KA 3VV2B 5AE2A 2IAJB 2XLJA 1D3WA 1EARA 1P6TA 4F36A 4KGZB 1H74A 3NGKA 1U1OA 4N56A 1GAOA 4TU7A 2OPQA 2YKMB 4LJMA 2B4OA 2RVJA 4DSIA 2ZITA 4R0EA 3EDRB 2BUNA 2LLZA 5F9LA 4WFXA 1FCAA 1QSLA 1URRA 1JLBB 1NDCA 3RRGA 3OFHA 1T94A 2P9CA 2Q3PA 1RWMB 4TU8A 2VQFJ 2GMLA 4K4WA 3L4BC 2B7CB 2GVZA 4EYIB 2JL9A 1RYRA 1YQHA 2FJWA 5C7PA 3IRXA 2KJVA 4YR2A 4LMZA 2YPZA 4DN0A 2VDHA 2AGQA 1R0CB 3EGZA 3WZ0A 1XJWB 4ZLLA 1SC1B 1XMQF 5KFFA 5D4OA 2KFZA 4DQPA 2QL9B 3AD7C 3E3XA 3C46A 1S77D 3I82A 1ZA1B 3QFWA 3QGHA 3JQMA 1CJVB 3PX6A 1CJKB 4USMA 5J1NA 4W90B 5KFVA 1GXTA 2BZ2A 2M8DB 2QA2A 1Y3KA 3TZWA 1WC1A 4U9RA 4Y2CA 1ZM9A 4HI2A 4F4WA 3K58A 2QT7A 2X1BA 4K4TA 4J5OA 5I3UB 2Z2ZA 2H3EB 1FESA 1WOSA 2AX0A 1MWQA 2RIJA 2BM0A 4FYWB 2MZRA 5ETQA 2MZJA 4F2SA 1JLAB 1DTTB 4KB7A 3OSPA 3KJVB 4HHHA 2OSRA 4DUYJ 2GVDB 3C16B 3DHXA 1C0TA 5ADZA 3HF5A 4P72A 5M2UA 5IM0A 3S01A 2XCPA 2E5JA 2MLZA 2LVWA 3MGJA 4IYQA 4DCPB 1WEXA 1N6QB 1TU0B 1RWXB 5KG0A 4ZCMA 1IJEB 2YWKA 4ZCIA 2QEXS 1B64A 3QIPA 3LF0A 2F4FA 3NS5A 4DL3A 1D8ZA 1L3VA 2RQCA 3K0JA 1HBUA 1VQLS 1EIYB 1RAEB 2LDYA 3PRBA 1HA1A 5CYMA 4OMFG 2JFKA 3P5BP 2ZJQQ 3OL9A 3O6QA 1HWJA 1X5TA 1ZA2B 2IA6A 3OTOJ 1I5OB 3C19A 3TI0A 4I6YA 2IBKA 4LSNA 3NGDA 3M30A 3PHTA 4ZKAA 2JNJA 1Q5VA 2ZH8A 5T7LB 3IRXB 3MF5A 1KD1T 1S1VB 1S6PB 3NNCA 3THTA 3ETMA 1IBLF 3EVOA 3LANA 3KK1B 5L1KA 3RTVA 1S9GB 3RYLA 2W9CA 3D68A 4WJBA 3MAHA 1FKPB 4AT1B 2FDNA 4FF2A 1EQMA 2OPSA 4K0KF 1URNA 5KFHA 4WTYA 5I4MA 1RAHB 1T9TA 2DXDA 1X8DA 3T6JA 4C3LA 4USTA 1S10A 3M6UA 4PWDA 2QL7B 2H65B 2XY5A 4XDCA 3UW1A 4HTJA 4OJHA 4JI5J 3RAQA 3BDPA 1VLYA 3DRYA 4JI3F 3EPGA 3PJWA 1OPZA 1CJTA 1SC3B 3D67A 2BJ9A 4KGVB 4WKYA 5KG1A 5DLGA 5THWA 1DTQA 1WWHA 1N0VC 2ADBA 1HBNA 1IBKJ 2RDDA 4U8YA 2MY7A 4LQ3A 5D0EA 1YZ6A 1PSDA 3BH7B 2Y9HA 2PMHA 2D3ZA 2KXFA 4CNYA 2DGTA 4IUFA 2H51B 2ATLA 3DKDA 4RJVA 2RB7A 3NNAA 3IAS9 4ED1A 3MMJA 3O3LA 1U0HA 1N5YB 1HBOB 1NK5A 3CJKB 2E5IA 3D6MB 4M94A 1T02A 2FZGB 2FTRA 3BV8A 4F4AA 4ID8A 3AQOA 1FWPA 3G96A 4RU2A 4KHPJ 2ZE2A 2ZKUA 1TL5A 3OFGA 4NLXA 4UOFA 2L08A 3EXCX 4RBUA 3MR2A 1HL6A 3GLJA 3BQ0A 3OTEA 5HBMA 1U1PA 4RW4B 1RZMA 3W3SA 2DHXA 3W8GA 3G86A 4LBPA 3UVJB 2IDEA 2C1EB 4YOEA 4QIEA 2V9WA 1WHXA 3SSSA 1SL2A 5DETA 4FS2A 3BO4A 3K8VA 2HGMA 1UFWA 4B3TJ 5BR8F 4JI1F 2JC0A 2OPSB 3VAGA 4DSLA 1FNXH 2XGQA 1HLWA 3GV8B 1IN0A 3GFYA 3WDOA 3A3PB 1ZTTA 4PR6A 1U02A 4R8UA 2ZH5A 4G1IA 4NYPA 2V0NA 1YJ9S 2MZQA 3C6UA 1D9FA 4LF9J 2BKOA 4ATNA 1VHIA 1TV6A 3EICA 2H1YA 1NB2A 1HI8A 1DTQB 1S49A 3VTIA 3R5DA 4LSLB 2KTQA 2I2YA 1DQ8A 1RAOA 1VC0A 4P52A 5HVHA 2PT0A 2R4FA 1X4GA 2R8HA 3BO2A 1Q1KA 3HULA 1SJQA 2WRMA 3QRPA 4B08A 3B54A 2R7WA 3OR2B 4WKRA 1PCAA 1YJNS 2CQGA 4B9NA 5MAOA 4QCLA 4CO4A 3HM9A 3AA8A 3NRBA 4I2QB 1JLGA 2XMKA 1U0HB 1HMVB 5CYQA 2G0JA 3PW2A 3QPIA 3KJFB 4IH7A 3V81A 3ADAC 1LWEA 1LFPA 3H98A 1FKOA 3DM2B 2GNKA 3EVWA 2XI3A 3GE9A 1HNZF 4M63A 4URSA 4K59A 2ZM6J 1S1TB 3UDVA 4DL0C 1U4BA 2E1PA 3MR6A 5DS7A 2P9EA 2E5LJ 1XMOF 1JLEA 2PC6A 4N7TA 5L38A 4ZA1A 3V6KA 2DNGA 3QLHA 3GCWP 1NB7A 2QIFA 4DQQA 2XNRA 3PKYA 3G8QA 3IBFB 2MKYA 4DSKA 4DU7A 4RW9A 2R7VA 2R7RA 1KRPA 1F0XA 2UXBJ 1PAEX 4DV1F 2RU9A 5IT9U 3HDSA 4A8KA 4R8UB 3ZFVA 1Y0HA 1VS3A 1FDAA 3G6VA 4ECYA 5CZXA 2GIRA 2ZNZA 2VG6B 3AB4B 3MI7X 1LK5A 1TKXA 1QSYA 4PG8A 4CZCA 2QA1A 5KFPA 3OQ2A 2CYYA 3HZEA 4RNOA 4AYBD 5KFMA 5CD4H 4RLEA 1F1BB 1B99A 3WX4A 4Z7CA 2UUCJ 3GZ7A 1KBRA 2FLPA 4KIAA 3NMAA 4DCJB 1VQ4S 3PFOA 3FZ2A 3VWSA 3S6EA 3ZTRA 1YK9A 4TYBA 4NA3A 2RRNA 4KRWA 4UY8T 3R6LB 4N8OA 1TK5A 2XMUA 1KONA 3UWTA 3MM8B 3DMJA 1MU2A 2CPXA 2XYHB 2DISA 2VJUA 2CPFA 2MQNA 2M9KA 2R7SA 2JX2A 1YSJA 2DH8A 4LRBA 2HFZA 1FNOA 2CQBA 3K57A 3EWGA 4BC7A 1Z2ZA 1SXLA 4WFNQ 4ZP6A 3OBIA 5KFBA 1JKHA 4LT6A 3CMQA 3U7JA 1OSDA 3P45B 7FD1A 2RQ4A 3OFFA 2VJVA 1JLFA 4O4RA 1Q86T 1DY3A 4PZVA 3Q8SB 5B0GA 4TNOA 3H2VE 2RKIA 1WG5A 1WC3A 2GQCA 2OEJA 3EE3A 2QC3A 2AEFA 3IA0A 4H4OA 4XK8C 3BSNA 1X4EA 1N33F 4CYUB 4RW9B 2C3UA 3DOMB 2M70A 4NRUA 2A6MA 2VBZA 1UVNA 3BBCA 4JV1A 2AJ1A 3NS6A 3W2WB 1QAYA 4IOBA 3A12A 4LFBF 1QSSA 1IR2A 1ZPVA 2DNOA 1TQLA 1U48A 1NSKL 3R3TA 4M5JA 3SCJE 3Q8QB 1QAXA 3T5JA 2CZVC 3BGLA 3CO0P 2IM0A 1VRTB 2VZ9A 3FCVA 1XR6A 3JSMA 1FF2A 4LVOP 4LSZB 2WSCC 3UR3C 4M95A 1MROA 3CVKA 4LRCA 4USIA 1YI2S 3MAAB 1UETA 5D3GB 3KHRA 3UDLA 3CCLS 2FVPA 5LXYA 2KFNA 1KS2A 1U2CA 4EBEA 5ETPA 4PG7A 4N77A 4F50A 2AKWB 1SC6A 2MTLA 2XMJA 2O1PA 2J9DE 4ILRA 2L9WA 4OZNA 3M2RB 3JXOA 4EBDA 3UR0A 3PW4A 4DSFA 2BQUA 1MU2B 3R1LA 1W7WA 1KFSA 3M2VA 1NSAA 3MPWA 3SDEA 2W2NP 3OUYA 4DV4F 2F7VA 3NGSA 5ETKA 1A6LA 2YNFA 2APOA 4MFBA 1JLCA 4AD6A 5LM7E 4ENOA 3A4TA 2E5GA 5KFKA 2LEPA 1WDTA 2GS8A 4XIUA 1UWAA 1JNRB 3GG0A 2V8PA 4Y0FA 2RKIB 4FPIA 3VGVA 1S6QA 4XPCA 3I4HX 1XR7A 3LWLA 3KJNB 3IP0A 1UMJA 3N5BA 3Q8VA 4WZMA 1RTHB 1SV5A 8RUCA 1R6YA 1VRQC 2H4WB 1JXEA 3AJ2A 1OYEA 1BQNA 4WFZA 1KP6A 1PKUA 4F0MA 4C48A 2R2UA 1FWLA 4QBUA 3K7RA 2JDJA 1CJUB 2LCWA 2V2ZA 3NBPA 4J9MA 4HLBA 1R89A 1QUPA 3NY0A 3W61A 2VG7B 4PG6A 1DJ0A 5IWAJ 2BABA 1JJ4A 3C14A 4IOCQ 2ZOFA 1FK9B 3DFEA 4ICLB 5KG2A 2CAJA 2H4YB 3MTKA 5RUBA 3CWJA 4QR0A 2KRRA 2Q66A 1FI4A 4PUOB 2DR5A 2M5YA 4FYDA 1CULB 2HS3A 4YR3A 4Z7YA 3CJ8A 3IWXA 3MPUB 4MMOA 5DQIA 2COLA 1GT8A 2YQ1A 4P2XA 2V4JB 2DTJA 2DD8S 2ZD1A 3PNIA 3PX0A 2G1HA 5LMNF 4BBYA 4NMXA 2PSZA 3CCZA 3KLGA 4HL9A 3UN3A 1NSQA 2AW0A 1TZ0A 3US5A 2Z57B 5FDLB 3MPYA 1C1CB 2J7KA 2YH0A 2GO9A 5ETOA 4DMZA 1UJ6A 2X1GA 5JXSA 1HHQA 4USUA 4F0HA 3HSDA 3NXZA 2NSBA 1NK4A 2CWKA 4C98A 4X4NA 2CPYA 4QIWD 5DGBA 4FPRA 3TW0A 4CT8A 2DGVA 2NUUG 2GJ2A 2VKRA 4JI4F 3P49B 3PCOB 1D9AA 3M4XA 4P2FA 4Y2IA 2NR0A 1GNKA 4F3OA 1OY6A 4QWEA 2NZCA 2X3GA 1BHNA 3CJ0A 1WC5A 2XS5A 1N0UA 4NZ7A 2MZSA 4JYAJ 1YVFA 4U7UK 1R8HA 1MG7A 4MK8A 4BWMA 5DRKA 3VAIA 1B3TA 4WP9A 1HBMA 4CTAB 4LF1A 3M05A 2I0XA 3EZUA 4OZ5A 3MR3A 3BB5A 1RAFB 1K0TA 2Z2YB 2A1BA 1KVJA 5L46A 3FQKA 1U26A 1XNRJ 1RA7A 1SB6A 1S72S 2JSXA 4OLOA 1SKRA 4ECUA 3GYGA 5AE1A 1RHKB 4ECZA 4RUAA 1UJ4A 4RWWA 1FDBA 5ETSA 1SVDA 1ZM4A 3DDNA 5K9FA 3KWMA 3W5XA 3T1HF 2AZ3A 3EGWB 1IVZA 2R9LA 4UQGA 3FDSA 2ASYA 1WF1A 2UVVA 4WXWA 2OKQA 2UVUA 1RCXB 1YBTA 1IKVB 3FRYA 2C2KB 2KVQE 3FGVA 4KFBA 2DNNA 1MW7A 1QDUB 3I0SB 4BS2A 3RRKA 5HATA 3R7NB 1L3KA 1YRUA 1PAUB 5JUMA 4C8KA 4G6VB 3ISZA 1ICEB 2RD5C 1NK0A 4NL5A 5K8MA 1UFLA 4DR1J 3D66A 4M5NA 1GXUA 1E6VA 2B9WA 3KLGB 1I3OB 4WK3A 2BRKA 1IUJA 3JAMY 3KNGA 4ZJOA 4UOHA 4FN5A 1A7GE 2HNDA 3TWZA 2RF2A 1WOOA 4ECVA 4JI7F 1BC6A 4DR6F 2W2OP 1VQPS 3VGTA 3TO8A 1T9VA 5BYSA 1RCOB 4EZ9A 2IJFA 3W5YA 3CJ2A 3EZOA 3DI6B 3HFZB 5A8KA 2R2TA 1TL1B 3MOJB 4MKYA 5J2QA 1BGXT 4GKKJ 3I32A 1UCNA 4C2MA 3W9IA 1N34F 2L9NA 2GW8A 4LF5J 3HSGA 5BYQA 1B0VA 2CQDA 2DH7A 1R7IA 1KLMA 4ZHRA 2OSQA 1SBRA 4R5PA 2F1FA 5C24B 1EHWA 2HFVA 5C25A 3HT0A 1PILA 3SFGA 1T05B 2IC3A 5KG6A 2I5JA 2HHHF 1VRUB 2RU3A 3CNQP 5G0RB 4UT4A 3MCNA 3C6TA 3HHDA 3FQLA 3EX7B 1RT5B 3MCSA 4WZQA 1NMEB 3CCTA 3NKYA 2W7AA 2ACYA 4Z37A 3J7ZT 4JI2F 3QGGA 2DHSA 3NCPA 1KN6A 1WD6A 4F4ZA 2HHQA 3OFEA 2XM3A 3MEEB 1U1NA 2BKNA 3R5CA 2RE1A 4N8NA 4KSEB 3VZHA 4CH1A 1O6XA 2QMWA 2BOPA 2MXYA 2DNHA 4KGXB 1T3NA 4RW7A 1RWOB 4NLUA 4LF7J 4ZVOB 2V8HA 2IM3A 1TELA 1HNWJ 2EKNA 2P5VA 2Z58B 3B4DA 4IKAA 3DU5A 1JJ2R 2A3JA 5KFRA 3W9HA 4NLVA 2RF2B 1LV5A 2QJ3A 3TNVA 4CH0S 2MLXA 3R2DJ 3GSDA 4DV3J 1M1KT 1WI8A 1KVIA 1X0PA 2FVQA 5CHCB 2FZCB 2DO0A 1RTJA 1KLNA 5E0OA 4HR2A 1F9FA 1HYSA 5HP1B 2HNYA 3DLHA 1LWXA 1DQAA 1C1BA 2MSTA 1SJ3P 4USJC 2B8PA 4NLTA 2JWNA 3AHPA 2FHKA 3MM5B 4JP8A 4FNHA 4O3RA 1KQKA 1FRXA 4FVCA 2DB1A 2GA7A 3W64A 1L3SA 1KLMB 2EKYA 2C2ZB 4TY8A 5A8RA 3PR4A 3W1YC 3ILLA 4R5PB 5J2PB 2KHDA 3IG1A 2HWIA 3TA0A 5C25B 3HD1A 1IBCB 4DHVA 2DITA 3K17A 1FT8A 2I5JB 3WX8A 1OPIA 1FVQA 2EEYA 1X9WA 1S4EA 5B0FA 1DFDA 5GAHI 1V3SA 1AZSB 4O4GA 1GX6A 1UP1A 2A2DA 2F63A 5KFNA 5J2NB 3LP0B 4OHWA 2W2MP 3BQ1A 4I2PA 2MKKA 3RAMA 3RBDA 2CA9A 3HVWA 3SQGA 5DM7Q 2DEIA 1NDLA 1RT2B 3UCZP 3BGRB 1PYTA 4E2FB 1ZAVA 4RNMA 3QT6A 1EETB 3BPDA 4FP9A 2IHR1 2BANA 1SQGA 3I0RB 1RWVB 1C0UB 2ZH7A 3X1LB 4RW7B 1RAJA 1ZM3A 2RHSB 3K89A 2KDOA 2ERRA 3MMBB 4DX7A 5H9EJ 2XYPB 1AUSL 2HWTA 2VB6A 5GAGU 4NXNJ 3DNCA 3TVKA 1NXIA 2BV3A 1MMNA 1RQ0A 2OLWA 3THVA 4B3SJ 2OTJS 2XEXA 1YZ7A 4USVA 4OJ3A 4K4ZA 1D8YA 3EDQB 2KN4A 3ZNJ1 2IFXA 2JC1A 4I64A 3OLBA 2P6TA 3QJJA 4K5RA 2HHUA 2ASDA 3QSYB 3OTDA 3KK2A 2IM1A 2V9KA 2WHOA 3DLGB 5KFDA 3HP6A 1JXVA 2PIIA 3NOCA 3M1VB 3TYTA 2EK6A 1TAUA 3VGUA 3QZ7A 2O67A 3BM7A 2BXJA 4HTIA 2FHMA 4CO3A 3W7BA 2EWHA 3B6BA 3GONA 3VAMA 2JOQA 1MLAA 4Y3CA 4DR5F 5E7OB 2G0CA 2HVIA 2BQ3A 4CM2A 1M5SA 4TY8B 5T14A 2BRLA 3T5HA 1Q78A 3IG1B 4IFYA 2KJWA 2D9PA 5A0YB 3TAMA 1AFJA 2HFNA 3SSRA 2HS4A 1SH0A 1FRIA 1VQSA 1RU2A 2LU1A 2HHPA 1IKYB 3TAPA 4K4UA 1G3OA 4YEAA 4Y2KA 5HLFB 3DRSB 1P8GA 5GMKa 4IR9A 4I7FB 1DARA 4ANDA 4HDHA 3ZZYA 4ZLNA 4X4SA 3LGNA 3BN7A 4Z2XA 3N6NA 2AT1B 4ZPCA 1XWLA 3KFWX 4U67Q 1X9SA 2ALZA 5H9FK 3PXGa 1SL0A 2Q6BA 2X1FA 4HHUA 5L1LA 2PDAA 3N4WA 4BLGA 4DR7J 2HBYB 3H42A 4ZVPB 1RTZA 4LUBA 2DY9A 4G3IA 1NCLA 4FVMA 3MURP 1NU4A 4ZPVR 4HI1A 1LFWA 3F0NA 2QO3A 2ZNYA 4PPDA 4NLWA 2GV1A 1OY9A 4KHMA 3UNYA 4WE1B 5ETTA 4OYWA 1U2RA 3TZYA 1PIEA 2FGOA 2UXCJ 1SJ1A 5FJ4A 3NAIA 1PBAA 2GGPB 3MM9A 2HIQA 3IS9A 4EBCA 1GMWA 1Q5YA 4PCQA 5D4LA 4ER8A 2C2OB 3KK2B 5IS2A 3G71S 4MIBA 3ZZTA 3ITHA 4CLWA 2QX0A 1XNQJ 2OP5A 2CQPA 1H3DA 4ES3A 4TYAA 4PXBA 5CH7B 3GP9A 2YWGA 2IVFB 4CNZA 4WBFA 4Y6IA 3RW6A 4IO1A 4KT0C 2BOAA 3KMQA 4OHXA 3UD5A 3GQCA 4C4WA 4NCGA 2HW3A 2A2CA 2B4VA 2DGUA 5IZHA 2B3TB 4DI6A 4D3GA 1R0AB 2CUYA 3NGRA 2GC8A 4YB5A 4AXIA 3TAMB 4Q5VA 3MECA 1LOUA 1CQNA 2GJFA 5E33A 1K1SA 2XMMA 3HVAA 3BF4A 4N41A 1VC5A 4K50A 4EFAC 1HR0F 2QFIA 2MZ1A 4N76A 3MM7A 3P3DA 3NAHA 1O8BA 3M9NB 4ED5A 3KXDA 1RUSA 5F41A 3DRXA 3OJSA 2HZAA 4JUZA 1VQOS 1JLQB 3QT7A 3MFHA 4OZ2A 1XK8A 3UO0A 5KG4A 4LQ9A 5CQGA 5CD4A 4ID5A 4DUZJ 3OLAA 1S59A 5KFJA 3CJSA 3UN2A 2VL1A 2E29A 1N36F 1N5SA 1NPRA 2DKOB 4NX9A 1VK3A 2LDIA 2H9ZA 3N9UC 3M32A 3H40A 4OI0A 4DV7J 2W4DA 4CWBA 4DX5A 4LF7F 3MUMP 4W98A 4IFVA 2PO4A 1J5OB 3PX4A 3IS9B 2IY5B 2YX7A 3VHQA 1YRXA 5HSPA 2JJ4D 3KLFB 4F7VA 3D6HB 1VJQA 4K8RA 5HAOA 4DDFA 3H90A 2ZJPQ 3SCIE 5LSRA 3J80U 1QVFR 1PG5B 2KI2A 4OZ0A 3PV8A 3RB3A 4J7CA 4B3RJ 2CJ9A 2HRTA 4PXDA 4LF6J 2IJRA 3AAWB 4OHZA 3E01B 2WSFC 4ECRA 3G2XA 3SCLE 4A8XA 3CJ4A 4EEYA 3FEYB 5KFEA 1VQKS 3HHKA 1N32F 4DG1A 3J7YU 4O23A 1TUGB 4H4KC 1SJRA 1NZAA 4RBTA 2JHEA 2MQLA 4S0MA 2ZFHA 2CRLA 1Q0NA 1TUVA 1RHMB 4NZ6A 2KFYA 2P9GA 4DN9A 1YX2A 2DNKA 1GFWB 1KQGB 3GU0A 2JVOA 4PXEA 2BJ7A 3TANA 3DDKA 1IQZA 2J9CA 3OR1A 3R5JB 5LT5A 3L9ZA 2DPJA 1V3RA 5FLXU 3CJTA 3BYRA 3CMES 5EN1A 3G87A 3KNAA 1KFDA 4X65F 2Z0GA 1GX5A 1Y00A 4KJIA 1NPKA 2G0IA 1SJFA 2R8GA 3ZZPA 2V4QA 2WONA 4PWUA 2XSJA 5L8RC 1QM9A 5HANA 1J27A 4LR7A 1YKWA 2YNIA 5E2QA 4KR0B 5E3PA 5HQLA 1N52B 5KT4A 3R7SB 3JYTB 2M4MA 2KKHA 3KK3A 2QMUB 4B3MF 3FNNA 2HMIA 3FBBA 2YWEA 1T3OA 1FWKA 2HFSA 3PYGA 1L5UA 1I1GA 3I55S 2JEFA 3VAFA 3A8KA 2DRAA 2MJNA 3FK4A 4ZVEA 3V6DB 1Q81T 1Q7YT 1SUQA 1S76D 1AB8A 4HH0A 2OGUA 3DRPB 4V19X 3KLIB 2DNZA 3M8ZA 2EFQA 1GTHA 2QL5B 3RBXA 4ZJLA 3R7BB 1XMQJ 4RO0A 2WVBA 1FFGB 1CLFA 1NH8A 3MUVP 2DIVA 1FRLA 4U7CA 1VBZA 3D5MA 2JRSA 3B4MA 2RJZA 4KE5A 3TUZC 4M8LA 3H0PA 1FTCA 3QFHA 4OLPA 1RYSA 1S12A 2VU5A 5LMUF 5KFCA 4DWIA 4HH1A 5FD1A 2VICA 2FYXA 2E7XA 2G4BA 1EQ0A 5IT9Y 2EI5A 4JV5F 2XYGB 1QE1B 3MEDA 4TY9A 3NEKA 1Q4RA 5EDWA 3OVAA 2C22A 3RW7A 2VFSA 3FEXB 3T19A 4KV8A 4KO0B 3R5GA 5D0RA 4ZVGA 2CIMA 3NL0A 1X60A 2ZBQA 5CZVA 2ZVIA 4QPTA 1JWWA 2YNGA 3MZIA 2VQEF 3BR9A 4P10A 3OL6A 5DZ7A 2R2SA 3GFXA 4NZ0A 2VF3A 3JB9k 1W26A 4NI2B 2GMJA 4Y2MA 1CVJA 2XHWA 3ZO7A 2DHAA 4EK2A 2W8KA 4W92B 4V1Ak 2XSJB 2ROPA 3Q8UA 4U8VA 1FHTA 2YNIB 2HURA 2AX1A 3TEHB 1AA1B 2HHWA 2CG8A 1R43A 5I42B 3AXKA 3KK3B 2QRRA 4MKAA 2HMIB 3DGVA 1NRKA 1O0PA 1IBLJ 3D6TB 4OYIA 4QZVB 4B9TA 1HI1A 4LFAF 2AWZA 1EAYC 1RWNB 3M8PA 1IKXB 2B6AB 2LKZA 1H6KX 3V2UC 4EMDA 1XNQF 3D7SB 4DV0J 4J9UE 5DQHA 4LF4F 4TQSA 2BVZA 5DDPC 1UVIA 1ZPWX 2XO6A 1H98A 4K0KJ 1D9DA 1UW9A 4RUBA 3ULHA 1Q82T 3H5XA 1VHFA 3I5AA 3I87A 2Q6CA 2B4UA 2FB0A 3TZXA 1IM4A 1H2VZ 2UUTA 2GFFA 3HLUA 2R8KA 1Q8KA 5A8WA 5AXNA 2BDPA 3CDBA 1RWWB 3AT1B 1RT1A 4JI3J 5H9EK 1Y7PA 2GQ2A 2BX6A 4ZK7M 3PFEA 4A48A 1XR5A 4I1TA 3ZZZA 3GIKA 3MEDB 4AQYF 2G1DA 3AODA 3PHEA 1ZM2A 4G1QB 1ZETA 4Y65A 3KTQA 4ZVFA 4J37A 2WVCA 2XGPA 1UW4A 3SBMA 3IXQA 2VBXA 2I9SA 5IV3A 2ZBPA 1HQEB 2UXDF 3KLEA 3DU6A 2NYIA 1PBUA 2A18A 5IT4A 2YWHA 4IOAQ 2OFGX 2FVSA 4TLRA 4GKJF 2YH1A 1TK8A 3TUIC 3Q83A 3SQOP 3KLVA 3HVRA 1NJXA 3L7PA 3KKFA 2HQCA 1KOOA 2IAJA 2DBBA 4Q8EA 1NH7A 1HWIA 3NCQA 3SMZA 3HK2A 1QAJA 2RUGA 4HYKA 1K0VA 2MZTA 2LQBA 1NNDA 4J9LA 4J9PA 2YKMA 4DR3F 5IC6B 4OYXA 4PXCA 3MXHP 2OEKA 2B7BB 3GR0A 2DHGA 3V6JA 3V6HA 1JLBA 2MLYA 1PYSB 2FJAB 2ZDPA 3TUPA 1U8WA 4MAKA 1WACA 1Y3JA 4LIWA 2VC1A 3EM1A 2BJDA 5BXIA 3IWNC 5BR8J 4JI1J 3CO9A 5K14B 1F60B 1VQMS 2LXIA 1TMJA 1TK0A 2FHJA 4OX7A 3Q86A 3VAKA 5KFZA 3EYZA 3AXMA 3UCGA 5IC4B 1OO0B 2YX1A 4ZDNA 3OT9A 5E41A 4Q0BB 1WI6A 4O0IA 1HQ2A 4X4QA 3GILA 1CJVA 1S0MA 2ZUAA 1CJKA 3AQPA 3BN4A 1HPZB 2FLOA 4YR0A 3DXBA 4XTTA 4ANEA 2AD9A 1FJEB 3A3NB 2C2NA 1H73A 2QYCA 1F2HA 2VODA 2Q79A 3GFZA 5DZ6A 3GJRB 2X3DA 1TFYA 1RISA 4ITSA 5GAEU 3U1NA 3JQKA 5I3UA 2HFOA 4K2JA 4ZIVA 2V63A 1QTMA 3QRQA 2CWXA 1F6TA 3JQJA 3KHHA 2FQQB 1UZHA 4QR1A 3KJQB 1RDRA 3DLKB 4FXVA 3ONQA 3MMCB 1JLAA 3DLBA 1N56A 2VV5A 1DTTA 1SKUB 4I6WA 3KJVA 2OI2A 3TJ9A 2GVDA 1W2IA 3C16A 1GK8A 4A46A 3HXMA 3G82A 2OEMA 2KYXA 4M5GA 1HNZJ 2ILYA 4FNIA 5J1EB 1U1QA 1OYDA 1N6QA 1H72C 4X4UA 1BLUA 1AXQA 1UKUA 5A2QU 3EXYA 4RW8A 1U1LA 4L3KA 3DCAA 1UEUA 1UEKA 3LPYA 5KG5A 2LFVA 4NYZA 1XMOJ 2GHWA 1EP4A 2OTLS 4TQRA 4P7TA 4KBIA 3MR7A 2AJ0A 1VC6A 1M5KC 5AXMA 1K44A 4LIRA 2F4VF 1MN9A 5T7LA 1BD6A 1S1VA 1S6PA 2XSFA 2DJWA 4QR2A 1VQ8S 2RRAA 1NKEA 3MM6B 3KK1A 3OVSA 2C3PA 4OI4A 3MD1A 1S9GA 3LGHA 4DV1J 1CEZA 1X4HA 1B70B 1FKPA 2HK3A 5HJYA 3DRRB 3EGNA 3IM8A 2YKNB 5K8OA 1H38A 1KVKA 1U45A 4EWTA 2D3O1 1C4AA 3OXFA 2QA4S 2HLTA 2I6WA 1U47A 3NS7B 4WYWA 1NM2A 1WKJA 3QZ8A 1MWYA 4CLSA 5E5NA 3Q8PB 2M3DA 2K7KA 1KHVA 2XB2D 1FNMA 4B9SA 1NJIT 1VK8A 3GIMA 1REGX 3D2WA 4ELUA 1MMDA 5DQGA 4GVBB 1K9MT 2K8GA 3DXSX 3TUJC 4OYZA 2XZWA 4LF8F 2KT3A 2VPWB 5GADI 4AFFA 2WZ1A 5KT7A 1Q8IA 3AFGA 2DPIA 4E0DA 4DFPA 2WCXA 3N28A 1TP7A 3G82B 2V6AA 3ZZUA 2CFXA 4L72B 4P2MA 7FDRA 2ZWOA 2D3OR 4PABA 4A8YA 3LO3A 2UVWA 1FEHA 2OD6A 1N5YA 3ENAA 1HBOA 2WOMB 4RW8B 1LWCA 3CJKA 4QU6A 4KPCA 1NHKL 3HI9A 5K5MA 3PJ9A 2JZ5A 4DSJA 1EP4B 3HHLC 4B02A 1SQFA 1HI0P 2VUGA 4MJKA 3WC0A 3MWBA 5ETLA 3J81U 4RW4A 2MY8A 4IRKA 1OJ4A 4NYOA 4O3PA 5DDRC 5F0UA 1YJUA 1N33J 1NJZA 3UVJA 1VDHA 1RA6A 1RT6B 4C8MA 5KFTA 3ZTQA 1T8EA 3PZPA 1YBAA 2PEHA 1GXLA 4DV0F 4DXLA 2Z8QA 1Q16B 4LFBJ 1XERA 1LNQA 2N4CA 1ZBTA 2RQMA 4KH0B 3KMSA 2OH2A 5LJ5Y 1VFJA 1LW0B 2EG1A 3D9BA 3ELHA 3PW7A 4AXJA 4FBTA 3QQCD 3LALA 2C2EA 1W25A 5AT1B 2BMBA 3HJFA 2I8EA 4UTGA 3MCMA 4DS4A 2XG8A 4NLRA 1RBAA 2JEJA 2F9JA 1RI7A 3FSYA 2W8LA 1ELOA 2ZBRA 5KT6A 3Q23A 1P9YA 2DT9A 1VQYA 1UFKA 3TEGA 4LRAA 4LSLA 9ATCB 4K4XA 3LUYA 3T5LA 3D4JA 4C8OA 4OFZA 4ECWA 5C2GA 4U6PA 1HNVB 2YKAA 3PO5A 1TL3A 1KOHA 2YKQA 4QIVA 1U49A 3CXCR 1AW0A 1M5HA 3OR2A 4M5DB 4PKDB 3T6BA 4L73A 1FX4A 4DV4J 4ILMA 4MK7A 3ILIA 2VASA 1VISA 2IMOA 4I2QA 1Y11A 1N5QA 4EU0A 1HMVA 2AIRB 4EO6A 1LWCB 1JIHA 1X31C 4CO2A 1N5TA 5I3QA 2HGLA 1SCJB 2C28A 2RS8A 1S9EB 3DM2A 1ZAXA 3OTCA 4PEOA 4GC7A 2HKEA 4O3OA 3LGMA 3Q22A 3A13A 1S1TA 5LJ3Y 1DLOB 2BQRA 3Q89A 1F3VA 2CADA 1CS4B 5F8NA 5J1PA 3IGNA 2UUAF 4NPOA 3VALA 2QLFB 3RG6A 1WDDA 1OS5A 1TTHB 2RSQA 5DG9A 3BS9A 3ETOA 4H4MA 2CZ4A 2EXUA 5F0WA 1WC4A 1XIQA 2B5JB 3IR7B 1U1MA 4PAAA 2OPPB 2R2RA 2CVIA 1MSWD 3POTB 2IIHA 3C15B 4CO0A 1S6UA 4O44B 5KG3A 3I4PA 2JEIA 5C2CA 3R9LA 5EWFA 2VH7A 3DOKB 1RB0A 2V2QA 5KOXA 1P9QC 3KHLA 1VLOA 4CO1A 2K1RB 2C3YA 2VG6A 1HNIB 5GMDA 4HT7A 3O1LA 1ROFA 2FHJD 3M8RA 3M6XA 1FD2A 1WSRA 1OQ6A 2DIUA 2AYGA 4ZPTR 3IM9A 2E9TA 1NSPA 3GMGA 4DV2F 2VG5A 5DJBA 1NUEA 1TL3B 3K5OA 3RGIA 1UA1A 1RKJA 1LW2B 3OXGA 3GR1A 3UFCX 5LMNJ 1A0OB 2F8MA 3TOQA 4B3OB 3FBEA 4ZOSA 1L3UA 5CABA 4DLGA 4YY3F 5J2MA 4DL7A 1KQSR 4CM0A 3MM8A 4UZBA 1EB0A 3BSCA 1TKZB 4HT5A 5HVFA 2DCUB 1N88A 4QJVA 4QYZK 1S79A 1F9EB 3DGPB 5BJRA 1JQGA 4WF9Q 8ATCB 2WW4A 5HL7Q 3R5BA 2X7IA 2VC0A 3DHWC 2UUWA 1VBXA 4DR2F 1QJHA 3W62A 4JI4J 4EYHB 1HFEL 3H5YA 1W2BR 3LP1B 1NHVA 3EUNA 1WUUA 4B9UA 4ZPWR 1HWLA 4MK9A 2CVEA 4H4MB 2ACMA 4Q7AA 2G2ZA 3OD2A 4CYUA 3CEDA 2DGQA 3F73A 5E3RA 1OWXA 4OIXA 3DOMA 4C6AA 1VYAA 2HG4A 3IBWA 4M5KA 4JI0F 5DG8A 3W2WA 3HVTB 1X0FA 4OYPA 1EJ7L 4XPEA 3JTPA 4OYAA 3ZZ0A 3W2VB 3QT8A 2HBZB 1P1LA 1LQ9A 2PD1A 4J9KA 3WQPA 1Y10A 3CE8A 3T1HJ 1VRTA 3QRRA 2PGCA 1Y5LB 3I9ZA 2OD4A 2J9EA 3VZIA 3MAAA 5D3GA 4DV6F 2VG5B 2KU7A 1TKTB 1U6BA 2Z56B 1RHQB 3LA0A 2AP6A 2CKWA 4QOTA 2L3MA 4E98A 2BE2B 1FE4A 1O5JA 2DXEA 2HHXA 4IRCA 2GJIA 3H7HB 2MQOA 2W4PA 3A1YG 5ETMA 3M2RA 4NLGA 2HRUA 1NK8A 3ISND 3MTJA 1U1RA 1WKKA 5J2MB 3HT3A 2RQKA 3QMQA 4L6V3 3HCXA 2DGOA 1DURA 4WIQA 2ZOMA 4JI7J 4U7UD 1U09A 3WHIA 4DR6J 3BH6B 2DR8A 5CCLA 2E7VA 1KWMA 2R7UA 4NCAA 4H4KA 3CSKA 4X2BA 4MKBA 1FJGF 2CQ0A 2K06A 2YTCA 3VVUA 2JFDA 3I5CA 4UW2A 2E44A 5B09A 1RT3A 3ET6B 3PYEA 1F5BA 4YUDA 1UAWA 1H7WA 1NKBA 1N34J 3K5MA 2FJVA 1GQEA 3B78A 4DV5J 3PYDA 1N5VA 1BQMA 1QLNA 3H2LA 4DFJA 1RTHA 2O5DA 4DSEA 2V68A 3EMTA 2KH9A 3PJXA 2HQ3A 2ZWPA 2WB4A 4E8UA 3PG9A 4I67A 4KC5A 4ANCA 2VHGA 4QWAA 3QSIA 4ERDA 4ED2A 3QO9B 1CJUA 4F0KA 2HHHJ 3KHGA 2ZOGA 1XBWA 2LQ5A 4NCBA 3ZNUA 2ZZNA 2ZC3A 3E2EA 1WKLA 3BKFA 2KZZA 4C97A
chains in the Genus database with same CATH topology
4WKYA 4EFAC 2VG7A 5KG1A 1U1OA 1N8RT 1TKDA 1HR0F 3CUNA 5HMXA 1K1QA 4PQUA 2MZ1A 4N76A 5DLGA 1HPZA 2J8AA 3MM7A 3P3DA 4DS5A 3NAHA 1O8BA 5THWA 1DTQA 1J2VA 1UEVA 2B51A 3M9NB 4DF4A 4R25A 4ED5A 5F41A 1WWHA 2UUBF 4YHHF 1N0VC 3DRXA 3OJSA 2ADBA 1HBNA 4JUZA 1FK9A 2LECA 1VQOS 2HRYA 1JLQB 4I69A 3MFHA 1PO6A 1XK8A 4KGKA 4ICLA 4KFBB 2MY7A 2CPJA 2ABYA 4LQ3A 2YWFA 4AL7A 5KG4A 1IKWB 1FTRA 4LQ9A 2CQCA 5CQGA 1PSDA 5T41A 2FC8A 2PMHA 4MIAA 4TN2A 2ASLA 2AYBA 4ID5A 2RH3A 2D3ZA 5HMYA 1JXLA 3OLAA 1KR4A 2KXFA 4CNYA 1M5OC 4PUOA 3PEHA 3D1QA 5KFJA 4ZPAA 2UZAA 2DGTA 4IUFA 2LU2A 2ATLA 3MHYA 3GB0A 2FJEB 1FD8A 4RU9A 1UWBB 2VL1A 2E29A 2UP1A 3G6XA 4F4KA 1E6VB 1N36F 2MKJA 1N5SA 2F3JA 2RB7A 4DPOA 3NNAA 3IAS9 4RUCA 4ED1A 3CJ3A 3DLKA 3MMJA 3O3LA 4NX9A 1FVSA 2F9DA 2DNLA 2HYIB 1VK3A 2LDIA 3MMCA 2H9ZA 3NLCA 3TVYA 3PDNA 1N5YB 2NPIA 1HBOB 3GIIA 3N9UC 1NK5A 3I96A 3M32A 2HNDB 3CJKB 3H40A 2V4JA 4LFCF 4OI0A 3T9NA 1E6YB 3DN9A 2E5IA 2W4DA 4M94A 1T02A 1TFWA 2KYZA 4LF7F 3MUMP 2EBEA 2FTRA 4IFVA 4ID8A 3ENWA 2R7QA 3AQOA 2LMIA 2PO4A 4DL5A 1J5OB 3G96A 3PX4A 3IS9B 2VFTA 2M0GB 4RU2A 2YX7A 2ZE2A 5EUHA 2ZKUA 3N6MA 1YRXA 1TL5A 3OFGA 5J1EA 4NLXA 5HMWA 4DF8A 2YNHB 2R7OA 3RB0A 2L08A 4OV1A 2KO1A 3EXCX 2JJ4D 4RBUA 3KLFB 3LOUA 1YITS 3MR2A 1HL6A 1AROP 1F2GA 5FDLA 2Z2LA 3UCUP 5H9FJ 1G1XA 1C1CA 3X3UA 3BQ0A 3OTEA 5HBMA 1U1PA 2LXUA 4RW4B 2XMWA 2LYVA 3W3SA 5A8KB 2DHXA 3RZAA 2J0XA 3G86A 1KHWA 4DDFA 4BWJA 2ZJPQ 3SCIE 3M8QB 1RT3B 5LSRA 3C3LA 1JMTA 4JI8F 5J2QB 5B08A 3T1AA 4YOEA 2VFVA 4QIEA 5KFLA 2V9WA 1WHXA 2LA6A 4JBCA 1QVFR 1ZYQA 5EWGA 1VQ9S 4ZP7A 3SSSA 1SL2A 5DETA 3FZBA 1UVJA 2KI2A 4FS2A 3BO4A 2B56A 4KPYA 5KFOA 1U6FA 3K8VA 4OZ0A 3PV8A 3LWMA 3RB3A 2G13A 4IQMA 3T5KA 2PMZD 1OSCA 2HGMA 1NEEA 3DYAB 1M0SA 3G8TA 1UFWA 2CJ9A 3U02A 4KHRA 3PKMA 4PXDA 1BQMB 5BR8F 1HD1A 1NK7A 4JI1F 1Y5NB 4IR1A 2C3MA 3OJUA 2JC0A 2OPSB 3VAGA 4JOUA