3DRPB

Hiv reverse transcriptase in complex with inhibitor r8e
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
423
structure length
404
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 105
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drpB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drpB04
4Y2CA 2ATLA 3BSNA 2UUWA 3T5HA 2J6UA 4WZMA 4I2QB 3QO9B 1S1WB 5HROA 2D3UA 2WHOA 4ECTA 5DLGA 4KKOB 3V6JA 2ZD1B 1LW2A 1ZTTA 1NHUA 3CIZA 3H40A 2VA2A 3HVTA 2FVRA 4K4TA 5KT4A 4RNHA 3GILA 2XCAA 4KHMA 4NZ0A 3GV8B 3IS9B 4IRCA 3H5XA 2JC0A 1JLFA 2IA6A 1N5YB 1JLCA 1RT1B 1TKXB 2FVSA 4Q0BB 1IKXA 2WTFA 2YKNA 3JYTB 4ECRA 2ZE2B 3ITHB 5C24A 5K14B 4B3OA 3OL7A 4J9NA 3KLIB 4U7CA 3QIDA 3DM2B 4NLQA 4ECZA 3V81A 3Q8RB 2BANB 3T5JA 3OSPA 3BQ1A 1S1TB 4ZP6A 3M9OB 4IR9A 1HARA 1TL3B 2O5DA 5L1IA 3KHHA 3OL8A 3KK3B 3E51A 2FJVA 4IOBA 4ZVEA 4Q43A 3M9NB 2AWZA 3V6HA 3KLGB 2JEJA 3DLKB 2BRKA 2FVCA 4IH6A 2AX1A 4TY8B 4ZP9A 5KFRA 4O44B 5CYMA 1IKVA 2YNFA 3ISND 4RUCA 3MR5A 1JIHA 4DL7A 1XR5A 1BQMA 1RT4A 1TL1A 3KK2A 1VRTB 5KFNA 5KG3A 2UVVA 3I5CA 5KFAA 3GIMA 3H98A 1TQLA 4TQSA 2I1RA 3BSOA 1LWFA 3DOLA 1HNVB 2R2TA 1J5OA 3IRXB 3D28A 4J9LA 1RT7B 4NLPA 5KFGA 3OHAA 2YKMA 3LP1A 1TKTA 1S1VA 3KJVA 4IG3B 1TVRA 2OPSB 1IM4A 2OPPB 1GX6A 5D3GA 2WK4A 4RUAA 3BGRA 4MK8A 4PQUA 5KFMA 4MKBA 1FKOA 3LALA 3V4IA 5HROB 3PW0A 5EUHA 3KK1A 5KG5A 1S6QA 2XGQA 3RAQA 2C28A 3LP2B 2IC3A 3TAMB 1LW2B 3JSMA 5DQIA 3HVTB 2WRMA 2R2UA 5F8MA 4URGA 3KLEA 2FVPA 1C0UB 1RTDA 1C0TA 3IG1A 3MEGA 1JKHA 5KT7A 3DI6B 4ED7A 5DG7A 2JEFA 4MK9A 1W25A 3CJ4A 3FFIB 4IFVA 5C42A 4K4ZA 2WONA 5KFHA 1S0NA 4ICLA 3M9MB 4XPCA 1S49A 4J9MA 4NLVA 3MFIA 4TLRA 2RDJA 1IKWB 1IKXB 2YKNB 2HNZA 5C24B 3QGIA 4B3OB 3PJXA 5KFKA 4O3PA 3CVKA 3CWJA 1BQNA 1RT3B 1S1XB 1SH0A 2W9CA 4ZPAA 3MEEB 4PWDA 3DMJB 5F8LA 4QWCA 1S0MA 2AX0A 4O4RA 3V81B 4URSA 4K4YA 5KG6A 2FLPA 1K1QA 2R2SA 4EO6A 3UDLA 1S48A 5F8IA 1SH3A 3MR6A 1MMLA 4RNOA 3E01A 1YVFA 3N6NA 4WFYA 3BSAA 4O3QA 1D1UA 3VQSA 3IN5A 4RW4A 1TKZA 4ECWA 2IM1A 3T1AA 1UWBB 1N48A 1C1BA 4RW9A 3C6UA 3V6DA 5CYMB 1IKVB 2YNFB 4I7FA 1N56A 3KHLA 2EC0A 1OS5A 1GX5A 1RT4B 1TL1B 3MFHA 4WE1A 3SI8A 3GV5B 1RTIA 1JX4A 2BQ3A 1RT2A 1LWFB 3M8QA 3DOLB 1J5OB 1RA6A 3H59A 1REVA 2YKMB 3LP1B 1TKTB 2YNGA 3KJVB 1TVRB 4TYAA 2C2RA 1RAJA 3QYYA 5D3GB 4NLOA 3BGRB 2IMWP 4YMEA 3MECA 4PQUB 3PW5A 2BR0A 5F8HA 3V4IB 1HNIA 5KFPA 2UVRA 3D5MA 3KK1B 4Q44A 5F8NA 1JLBA 1HQUA 5L9XA 3MEDB 2IC3B 4KBIA 2R8KA 2OPRA 3JSMB 3G6XA 1IKYA 4RNFA 2IJNA 1XR6A 3KLEB 5L1KA 5KFQA 3IG1B 3MEGB 5EWEA 3M8PA 1KHWA 4IFVB 5C42B 2WONB 2V9WA 3DYAB 5DQHA 2HMIA 1SUQB 4NRTA 4Q45A 2VG7A 4R8UA 1JLQA 3C6TA 4EYHB 4DL4A 2FLNA 1S6PA 2HNZB 3NGDA 3PR4A 5KFXA 4ED3A 5KFUA 1T03A 3LP0A 4TQRA 5DLFA 2VG6B 2ALZA 2B6AA 1TV6B 4PWDB 4ZMMA 2WOMA 4LSLA 3GIKA 5KFEA 3I0SB 5KFOA 3EPGA 4FS1A 1LWEB 1N6QA 1SV5A 4ED2A 3KNAA 5KFBA 5HLFA 2RDIA 5KG7A 4XPEA 3DRPB 4LQ9A 3HKWA 5EWGA 3E01B 5HP1A 4TN2A 1RTHA 1HQEA 2HNDA 4RW4B 1FK9A 1TKZB 5KT6A 3CDEA 3MR2A 1C1BB 4H4MA 5L1LA 4RW9B 4I2PB 3C6UB 3BQ2A 4I7FB 4JUZA 4F4ZA 1RYSA 4X2BA 4ECXA 1QUVA 1S1UA 4WE1B 2HWIA 1DLOB 3KLVA 1KLMA 2OPQA 2V4QA 3Q8QB 1RTIB 2IAJA 3CJ5A 4DG1A 3QIPA 2HNYA 5KG0A 1REVB 5DGBA 2YNGB 1T94A 2HWHA 4QWDA 3ISNC 1TP7A 2JC1A 2BRLA 3H5UA 3RB6A 1VRUA 3H5YA 4ID5A 3N6MA 5J2PB 3MECB 1D0EA 1EP4B 3QGHA 1S4FA 3QZ8A 3I0RA 4J9SA 5KT3A 2AGOA 2D7SA 2R8GA 1HMVA 2ASDA 1JLBB 1HQUB 4QW8A 4TY9A 2OPRB 5KG1A 1IKYB 4KSEB 4MKAA 2RF2A 4O3RA 5J2QA 3V6KA 1U09A 4ZPBA 2GIQA 4ZPCA 2I5JA 3BQ0A 3M8PB 5I42A 4JV2A 3UPFA 4RZRA 3BJYA 5HBMA 4Y34A 4EYIB 2VG7B 1JLQB 3C6TB 3LAMA 5J2NA 4DEZA 1S0OA 4K4UA 1I6JA 2W9BA 2E9RX 3SFGA 2IBKA 2W7OA 1T03B 3LP0B 2UVUA 4PUOA 2C2EA 1JLFB 2D3ZA 4G3IA 3NMAA 1C1CA 1HPZA 2B6AB 1JLCB 2XI3A 2WOMB 4LSLB 4DL3A 2IM0A 4K50A 4R0EA 4MIAA 5KT5A 4NLUA 4Y3CA 3EZUA 4O4GA 4RNMA 4ZHRA 1N6QB 1SV5B 1MU2A 1RT6A 3OLAA 3LANA 5HLFB 2B43A 1RA7A 5DGAA 3FDSA 5HP1B 3CJ2A 2E9TA 3TQ1A 1HYSA 3ICLA 3KHGA 1FK9B 3UR0A 3CDWA 3H4BA 3G86A 4H4MB 4WYLA 4KKOA 2OH2A 4LSNA 2BE2A 5KFIA 4YR3A 3DLGA 4EEYA 3I5AA 2RKIA 4QWEA 2V0NA 1S1UB 2GIRA 3T5LA 4K4WA 1K1SA 4DL2A 3UQSA 3IGNA 5KFWA 2C22A 4ECVA 4IKAA 3MTKA 2FLLA 4EBCA 3QIPB 4J9PA 2HNYB 3PZPA 5DQGA 4KO0A 3GYNA 4YR2A 1BQMB 3KK2B 4Q0BA 2WB4A 4Q8FA 2B5JA 4ECYA 5KFDA 4KFBA 4ID5B 4IG0A 1EETA 5K14A 4MK7A 3KLIA 2XCPA 4ED6A 3GV7B 3LAKA 4ZPDA 4MFBA 1R0AA 3I0RB 5KG4A 3HVWA 1S1VB 1HMVB 2AGPA 2DPJA 2JEGA 4WZQA 1T05A 5C5JA 1S9FA 5KG2A 4NCGA 1JLEA 4KAIA 5J2QB 3EPIA 1FKOB 4R5PA 4IDKA 2I5JB 5EDWA 2GC8A 1S6QB 5I42B 1N4LA 3KLFA 4J9KA 5HBMB 3DOKA 2UVWA 2R2RA 5J2NB 2R8IA 3DRSA 1C0TB 1RTDB 3KLGA 1JKHB 3QLHA 4M95A 2CJQA 5F8GA 1SH2A 4TY8A 5T14A 4J9OA 3OL9A 4O44A 5I3UA 4PUOB 1RT5A 3KOAA 4ICLB 1C1CB 1HPZB 3BREA 2R8HA 1JLAA 4URQU 1RTJA 3KLHA 2F8EX 3H2LA 2JLEA 4JV0A 5C25A 4H4OA 4O4GB 2QV6A 1LWCA 3FQKA 1FKPA 3CJ0A 1HNVA 1XR7A 1MU2B 3KMSA 4ZVFA 4DL5A 1BQNB 1RT6B 2W9CB 2J6SA 4O3OA 4ZVHA 4IG3A 5KFLA 2OPPA 3MF5A 3T5KA 4XO0A 4OL8A 3OL6A 3H5SA 1HYSB 4M94A 2D41A 3T19A 5KFZA 3DLEA 3H4DA 3QGGA 3CJ3A 4ED1A 5F8JA 2FJWA 2FVQA 5J2MA 4LSNB 2BE2B 3LP2A 3TAMA 3DLGB 2RKIB 3HVAA 1C0UA 1Z4UA 4GC7A 3G6YA 3DI6A 3PVXA 4FBTA 1WNEA 2CKWA 3V6DB 3FFIA 4J9QA 3RAXA 4KV8A 4RW8A 4WFXA 4J9RA 4KO0B 4HYKA 1T3NA 3DRRA 4NLRA 4IFYA 5J1EA 1JLGA 1S9EA 1S10A 1IKWA 1QE1A 2B5JB 5KFYA 4YP3A 2W8LA 4KFBB 3G6VA 3FSIA 5KT2A 4IG0B 1EETB 3RB4A 4HKQA 1RT2B 2YNHA 3M8QB 4MFBB 1R0AB 1RT3A 1S1XA 3MR3A 3MEEA 4EBDA 3DMJA 2IM3A 4ECQA 1S9GA 4KB7A 1T05B 3NKYA 5KFFA 1C2PA 2BQUA 3HHKA 4NCGB 4NLXA 4NLGA 4NYZA 1JLEB 4RW7A 4ECUA 1HNIB 3NBPA 4R5PB 4IDKB 4RNNA 2ILYA 5JXSA 1DTTA 4RU9A 2VG5A 3KLFB 2YNIA 4DL6A 4IR1A 3DOKB 3PHEA 3QZ7A 4F50A 4G1QA 4TXSA 1UWBA 1QAJA 4ZVGA 3DRSB 4WXWA 3NAIA 4WYWA 5DG9A 3QLHB 3KMQA 1DTQA 2J6TA 3NAHA 2WCXA 5I3UB 4QWBA 3OLBA 3PW2A 1RT5B 5F9LA 4IRKA 2XWYA 4WXOA 4O3NA 1JLAB 2HMIB 1RTJB 4MH8A 3KLHB 1NHVA 5KFTA 4R8UB 3BSCA 5FDLA 5DG8A 1LW0A 2XC9A 4LQ3A 1S6PB 2QE5A 3I5BA 5C25B 4H4OB 3PR5B 3OSNA 3GIJA 4F4YA 2UUTA 1ZETA 1LWCB 1FKPB 2HAIA 3PW4A 4ZP8A 5KFVA 4NLWA 5KFCA 2XI2A 4RW6A 5L1JA 5CYQA 3RBDA 2DPIA 2IJFA 1S97A 4ZP7A 3GIIA 3RB0A 3DLEB 2V4RA 4U6PA 3N6LA 5J2MB 3MEDA 4TYBA 3PW7A 1RTHB 1HQEB 4Y2AA 2HNDB 4I2QA 4K4VA 4IQXA 4H54A 4K4SA 3QO9A 1S1WA 1ZTWA 4FBUA 4NLYA 2ZD1A 2AGQA 3FQLA 5KFSA 3KHRA 4KV8B 4RW8B 3CDUA 3IGVA 4F4WA 3DYAA 3DRRB 1SUQA 2W7PA 4IFYB 5J1EB 1JLGB 1S9EB 4ED0A 4JV1A 1QE1B 4QW9A 1KLMB 2OPQB 4Q8EA 4MIBA 3SFUA 4K4XA 2IAJB 2YNHB 3IS9A 1CSJA 4IH5A 4DG1B 2AU0A 2BQRA 2VG6A 2ZKUA 2W8KA 4EBEA 1NNDA 1TV6A 1N5YA 3PJWA 3Q8SB 2ASLA 1RT1A 2FJXA 1TKXA 1S9GB 4WFZA 4EO8A 5F9NA 3JYTA 3I0SA 1VRUB 3BR9A 2ZE2A 3ITHA 4NRUA 4F4XA 4IRDA 3NL0A 2E9ZA 1LWEA 4RW7B 3RBEA 3NBPB 3OHBA 1RYRA 2AQ4A 4GC6A 2VA3A 1DTTB 3DRPA 3DM2A 2VG5B 4YQWA 2YNIB 4NLTA 2BANA 2RF2B 2W9AA 5KFJA 3Q8PB 2C2DA 4G1QB 2JEIA 1S1TA 5EWFA 1TL3A 1KHVA 1DTQB 4I2PA 4FS2A 3KK3A 4ED8A 4KHRA 4NLSA 1JXLA 4QWAA 1DLOA 5FDLB 1LW0B 1QAIA 3FRZA 4NLDA 5JUMA 3DLKA 4YR0A 2XGPA 2W9BB 3GQCA 4O3SA 4ECSA 1RDRA 2ILZA 3DDKA 4IH7A 2R8JA 1VRTA 3TVKA 4QPXA 2IM2A 4RW6B 5CYQB 3RB3A 5J2PA 2ASJA 4ZHRB 4KE5A 1EP4A 3IRXA 1RT7A 3CO9A 2OPSA
chains in the Genus database with same CATH superfamily
5L8RC 3BSNA 3KNGA 2V8DA 3R5CA 3UCGA 2BJDA 4MYTA 2PO4A 1CULA 1WJ9A 2F63A 4KQZA 2Z2LA 2J9DE 4DR6J 3D54A 4CLYA 4ELTA 4ZJLA 4ZP9A 4TY8B 2CDQA 1VRTB 3E8OA 5IT9U 2PE8A 3R7BB 5ETVA 2CJYB 4J9QA 4W90B 4KC5A 4MKBA 3G71S 5CAAA 1EKRA 4J9MA 4CI0B 3MCNA 3PJXA 2LQ8A 3CVKA 5M2UA 2JSXA 3IA0A 1X4BA 1DFDA 3TARA 2VUGA 3HKZD 4WFYA 3TVZA 3RB4A 5K8NA 3IM9A 5LXRA 3BF4A 2Z4PA 1LWFB 3HPOA 3RZAA 1S57A 2YKMB 4P71A 4RUHA 3OXLA 2XZWA 4NXMJ 3OUYB 3MPUB 3PO5A 4PQUB 2HWTA 2OP5A 2I0XA 1WTBA 3T1HJ 2ZWPA 5EWEA 4KTQA 2HQDA 2CXEA 2FLNA 5AXNA 5A8RB 1X4CA 3B82A 3KG4A 3AODA 2CQIA 4WIQA 4ITSA 1QM9A 2DISA 3TO8A 3R7SB 1LEOA 1F2GA 1WHYA 5B0DA 2LP4A 4LFCJ 4LFAF 3VAFA 2OTJS 3C66A 3ULHA 7FD1A 2ZM6F 3QGHA 4LBPA 4JI5F 1KWMA 2DNNA 4O3RA 2B0GA 5I42A 3UPFA 3L4BC 1ZM9A 1CJUA 4X64F 2E9RX 4FVMA 3GFYA 3PYEA 2WOMB 1PILA 3PKMA 3CEDA 3QAUA 3RBXA 2DO0A 2GCFA 3VAGA 1R43A 2HGLA 2HBRB 1WELA 1X4AA 4C4WA 3QIPB 3IAS9 3P5BP 1R31A 3HD2A 4Q0BA 5KFDA 1BD6A 4HI2A 4OMFG 4MFBA 2IVFB 2AGPA 3CC7S 3BGOP 3NOCA 1KNZA 1KTQA 3EUNA 3OFHA 5KG2A 1L3KA 4KAIA 3EPIA 3PACA 5EDWA 4DFJA 1T02A 5HO4A 1RTDB 4LF5F 3EXYA 1RT5A 3MMCB 1HD1A 3W5XA 4Q8EA 3K0JA 3EGVA 5KFLA 2VJVA 4UY85 2MDAA 3BYPA 1JNZB 1S6OA 3L09A 1SXLA 3DU5A 1HLWA 3G6YA 3PVXA 3OVSA 4DF8A 4FBTA 1U45A 1KSPA 2EFVA 1M5KC 4ILLA 1Y3KA 4OHYA 5AXKA 3MR3A 2AMCB 1FRKA 1QJHA 3I4HX 3BGLA 2MLZA 1S4EA 2JH3A 3KLFB 2X51A 5DG9A 3QSYB 4PQAA 4IO1A 2VL1A 4DV7F 4N8NA 2DGVA 2V8GA 2UXDF 1SKSA 1SKRA 4LF9J 4ZVPB 4RW6A 5L1JA 4YB6A 3CCJS 3C16A 2L3MA 3MEDA 4CO1A 2QFJA 2PMHA 1HQEB 4X62F 1Z2ZA 1ZTWA 4X4QA 2R7SA 1WG4A 2AGQA 5B09A 4RW8B 3DRRB 3QRPA 1VQNS 2E5JA 3M2UB 1CSJA 4DZDA 5CCLA 4EBEA 2ASLA 4NRUA 1CEZA 4FS2A 4KHRA 3DN9A 1U8WA 4J9UE 1WG1A 3AQOA 4DSEA 4ETXA 3H2UB 2G1HA 4ES2A 5LSLA 2J9EA 4C7QA 4KE5A 1FX2A 4PEOA 2IYIA 3TZYA 1NH8A 2DY1A 3AT1B 4MKYA 4PPDA 4FF3A 3MM9A 1SIWB 3ET6B 2F9DA 3PV8A 2X7IA 1UJ6A 3N79A 1NJYA 3DM2B 2HRUA 3CNQP 1XNRF 1BGXT 3BQ1A 3J81U 2OD4A 2GIFA 4RWXA 3KDOA 4UOCA 5KFRA 2AX1A 1WHVA 3M05A 4CM2A 3TJ9A 5KFNA 3CCMS 1RP5A 3R27A 1SBRA 4U8VA 4BC7A 3OPKA 3D28A 1HNVB 1YWXA 2KO1A 2N82B 1S1VA 1KVKA 1TFWA 2J0XA 5KFMA 3V4IA 3ILIA 5EUHA 1Y3JA 3WQPA 1JKHA 2GHPA 1FA0A 3M9MB 2RDJA 4K2XA 5KFKA 2B4OA 3NEKA 3TZXA 2VOPA 5F8LA 4URSA 1YJTA 2F5GA 1S48A 2Z57B 4E2FB 4PXDA 2D9OA 4DV1F 4L74A 4DCOB 1VJQA 4USIA 4HTJA 1IKVB 2YNFB 1N56A 2Z0GA 4DU8A 2HHUA 3M8WA 1RAJA 2VQEJ 2Q3PA 5F8HA 1HNIA 4GMKA 3MM8A 2CQ1A 4UF4A 2PC6A 4M5JA 2CPIA 4DR4F 4M5GA 5AE2A 4L72B 3HZEA 2HMIA 1UW9A 4O23A 5E0OA 1T03A 4B9LA 3SCIE 5E3QA 4LF2A 2RNEA 1VLYA 2QRRA 4F4AA 3T3FA 1OMSA 2HZAA 1JXVA 2HRTA 4QYZJ 2ZBIA 4FXDA 2ZZMA 1F5AA 3J80U 4JI2J 4B3MF 1MLAA 4DG1A 2LQJA 5KG0A 2KM8B 1XIQA 5J2PB 1X60A 4LF4F 2D7SA 4U7UK 2H5EA 3IO1A 3EICA 5BR8F 3DCAA 1Y5LB 3HFVA 3W61A 2QJ3A 1W2BR 3SV3A 1RXOB 1QDUB 4OZLA 3NS7B 4QPTA 2HHSA 1TL5A 5KT5A 2BW7A 5IT4A 2DCUB 2F9JA 4FXVA 1FRJA 2GGPA 1RBAA 4QWEA 4QR1A 2GIRA 3SXLA 4USWA 1PO6A 1PC4A 2AF6A 2KXFA 3LAKA 3HSGA 4ZPDA 1RAIB 2FD2A 1HMVB 1T05A 4BWJA 3KYLA 1DAXA 4DLEA 3HCXA 3KOAA 2GMJA 1NJXA 1BQNB 3RAMA 3MF5A 2DHAA 2DXFA 1GTEA 3OR1A 3LP2A 3CSKA 3Q89A 2J7WA 4HHJA 4FF1A 4GC7A 2WAQD 2DVIA 4JI4F 4JI8F 1UVLA 2EG1A 3CUNA 1E6VB 3A8KA 4IG0B 2MKCA 2BVZA 3AJ1A 3MEEA 3DMJA 1S9GA 2QTWA 5THWA 4Q2MA 2P2CB 4B3SJ 1AT1B 5JXSA 1U2FA 2J8AA 4C3MA 2D1CA 5U47A 3QZ7A 1QAJA 3QPIA 5BYQA 1M1KT 1FTCA 2XC9A 4DSFA 4F4YA 3GIJA 2Y1RI 3PW4A 4ZP8A 2Y3YA 4Y2MA 4ZN1A 1VQ6S 4HHHA 4HDGA 1SJ4P 2KG1A 2LEAA 1YRUA 5EGYA 1O0PA 3TI0A 1C4AA 5JVGQ 3NWGA 3IGVA 5J1EB 1QE1B 2OPQB 3D66A 4DPXA 4FYYB 2RHSB 3GMGA 3Q8SB 2VQFJ 4EO8A 3RBEA 2KXHA 3M2RB 1RYRA 3DRPA 3FMWA 2RF2B 3I9ZA 4LVNP 4KH1B 2PMWA 1TL3A 1HBNB 1S72S 4QWAA 1R8BA 3F41A 4P52A 1OO0B 5GADU 3W2WA 4DFKA 4YB5A 3EZOA 3ZZ0A 3QT6A 3PIOQ 1QAXA 5GAGU 1HA1A 1H73A 2QLFB 3QO9B 2WHOA 4KKOB 4FYVB 1FJGF 1Z2LA 3HVTA 2XO7A 2XCAA 2VKRA 3SQGA 3ITHB 1T9TA 1K73T 5B0EA 1H0HB 2NSBA 2ZC4A 4DUZJ 4IR9A 3FEYB 3DRXA 1VIOA 3IC1A 2PI5A 1OYDA 1M5HA 1VOMA 4DL7A 1X5OA 1XR5A 5FLXU 1W7WA 1TQLA 2QLJB 1VQ7S 2I1RA 4QCLA 3H0PA 3BGRA 2KHDA 1VQOS 1KP6A 2KL8A 3JSMA 2CUYA 2LU1A 3PNIA 2YQ0A 4TKTA 1MW7A 2N4DA 1DRZA 1HKAA 1IKXB 1VS3A 3R3TA 3N28A 3NCPA 5DRKA 2BYCA 3D4JA 1SH0A 5CHCB 4XTTA 3V81B 3LPEA 4RR5A 2UUAJ 1KBRA 2R3VA 4P10A 2XLKA 1N32F 5K8PA 2KH9A 2BABA 1S99A 1RJJA 4I7FA 5IXUA 3M2VA 3BB5A 3MPDA 2C2RA 2BZ2A 4NLOA 1GXTA 1RAOA 2BR0A 2BUNA 5D8HB 5F8NA 3QT7A 1IKYA 2KVIA 3SDEA 5L38A 1KQFB 2VICA 3HULA 1T9WA 3DYAB 3GLJA 1JLQA 2MLYA 4ED3A 2VG6B 3DLJA 2B7BB 5KFEA 4F26A 4P2XA 2JFDA 3MM5B 5HP1A 1K9MT 1H6KX 4LRFA 5KT6A 2W25A 2E1CA 1CLFA 1GFWB 1NKBA 1DLOB 2CQ3A 1ZAVA 5GADI 1HNXJ 1N34F 2DR8A 1U02A 2GW8A 5GAGI 1PKUA 2F65A 1XMOF 4ANDA 2CJAA 3PJ9A 4Q5VA 4JV2A 3D1OA 4CO4A 1C4CA 5BXIA 4K4UA 1OY9A 4G3IA 3HMJG 3GG0A 2XG8A 3EZUA 1UVKA 2DIVA 3UDEA 1HI0P 4DCJB 3TQ1A 2V4JA 4DQIA 1VQ8S 2XHWA 4JI3F 1ZM4A 3G86A 4JI7J 1T9XA 1NPRA 2RU9A 1U0HB 4USHA 2AJ0A 4KO0A 3KK2B 1KRPA 2B9XA 3GV7B 3JTNA 5DDOC 3BO2A 1M90T 2PFFB 1AW0A 1WC5A 3DOKA 4UW2A 2NXJA 2CJQA 1SH2A 4TY8A 3ADAC 1OWXA 1C1CB 1DARA 1JJHA 5CZVA 1LQ9A 5C25A 1Y4ZB 3AOCA 2SXLA 3IR7B 3ZO7A 3GCXP 3T5KA 2J0SD 1HYSB 2OIHA 1T11A 3H4DA 1RSCA 3CJ3A 1UAWA 3L9ZA 4UOGA 2RKIB 1F60B 4N5SA 1WNEA 3RAXA 2DR5A 2WVCA 2VJUA 1S9EA 2B5JB 4G6VB 2OD6A 2FYXA 3UNYA 1BC6A 5A0YB 2O66A 3MTJA 3ZFVA 2IHR1 4RU9A 4NCAA 3C3LA 3M32B 2E29A 3M6XA 3EDRB 4DXLA 3MMBA 2JZ5A 4OJGA 4O3NA 5KFTA 1R6YA 3SSSA 5ITHA 3LF0A 3I5BA 4I4BA 3FC9A 1LWCB 1IQTA 3I6PA 4I0WA 3UFCX 2J9CA 2Z2MA 1J27A 4TYBA 2VB6A 4L3KA 4C8OA 4DCPB 1S1WA 3D3BJ 2QSFA 3FQLA 3KHRA 4KV8B 2HBQB 2W7PA 5T41A 1M5OC 2YNHB 3K5OA 4DSLA 3D1QA 1ZZNA 2KZZA 3OHBA 1X0PA 2VA3A 3QJJA 2OMOA 2XMJA 2YNIB 1VQ4S 4DPTA 3OXFA 1W2IA 2NPFA 2Y9HA 1LW0B 1FF2A 4CT8A 3R9LA 3AJ2A 3H42A 4QPXA 2IM2A 4DOZA 3TOQA 1YBUA 1FFSB 1PYSB 3PFOA 2WW4A 4ZVSB 4M8LA 2M52A 1RHUB 1AUSL 1QVGR 4A8XA 1LW2A 4K4TA 4IRCA 3IS9B 4DR5F 1N5YB 2LYVA 1IXKA 3KUHA 3JYTB 4J9NA 2E1AA 1VQ9S 2QX0A 1AUDA 2ZZTA 2ZH7A 5RUBA 3OSPA 2EK1A 4I69A 1X5PA 3ONQA 2YH1A 1FEEA 2NXNA 3VGVA 2EFPA 1TL1A 2H9ZA 2DBBA 1LK7A 3GIMA 3CCLS 2FC9A 2BDPA 5A8KA 1YJRA 1AYEA 2HFUA 2WVEA 2ZUGA 2YX4A 4LF7F 3KK1A 3N5FA 1RTDA 2JNJA 4K4ZA 3QJLA 4E0DA 1R8AA 2MZQA 2ZVIA 1WKLA 2J5AA 1EQ0A 3FEXB 2KT2A 5DDQC 4FDFA 3IR6B 3AY0A 4IO9Q 4RNOA 3TP2A 4WFNQ 2A10A 3D6FB 5F3ZA 4QBUA 3GFZA 2V2KA 1Q8BA 1Q0NA 2PEBA 1ZM2A 4LFAJ 5M2PA 1TKTB 1VC0A 3QYYA 4LREA 2R8KA 2F8MA 4RNFA 2ZM6J 2B9YA 3IG1B 3UN2A 1X5SA 1GT8A 2V9WA 1WKKA 3LH2S 2VOOA 2B6AA 2XMTA 5CQGA 4X64J 1HHTP 1N6QA 2A3JA 1REGX 2Z30B 1GMWA 1HQEA 1YZ6A 1TKZB 3U27A 2KVQE 3ZTSA 4WE1B 2PGCA 2BJ3A 1NDLA 1D3WA 1NKEA 2KI2A 3ISNC 2BRLA 4ID5A 2XNRA 1T9VA 2Y1JA 1WKJA 4JI1F 1YBAA 2CVEA 2IDEA 4JP8A 4Y34A 2UUCF 5ETOA 2UVUA 2W7OA 3LP0B 1HPZA 4DJBA 1GEHA 4BWMA 4DX6A 1Q8LA 1NDCA 3HT0A 3UR0A 4CDIA 2PT0A 2AD9A 2J7KA 1T9YA 3IGNA 5KFWA 4ECVA 2FLLA 5T7LA 5IT9Y 3UD4P 3GYNA 2D69A 3JQKA 1R8CA 3TZWA 2M0GB 2XCPA 1PC5A 2HFNA 2ADBA 1SC6A 5J2QB 4IDKA 1Q5VA 3MUVP 3QMQA 1WACA 1JJCB 2OKQA 2W1BA 1GMVA 2F8EX 4JV0A 4O4GB 1ZM3A 5LMNJ 1HNVA 4DV7J 4EZ6A 5GAEI 2VONA 2UXDJ 3MCMA 4ED1A 2FVQA 2FHOB 4AYBD 2NPIA 1HBOB 1Z4UA 3A8JA 5A8WA 4AD6A 4WFXA 1T3NA 1GH8A 1HHQA 4K0KF 1ULRA 2ZJPQ 4KB7A 3GJRB 1FNXH 1JLEB 2JVOA 1ZH5A 3S6EA 1KD1T 4IRKA 4ZOSA 3PW2A 5E3PA 3W65A 1F5BA 3JS9A 4C3KA 1S6PB 2CQCA 2QE5A 2XHCA 1NJIT 4OHXA 1TK0A 4YB7A 2CPXA 3ZXWA 3BO4A 2LVWA 2G0CA 4CYUB 1I51B 2HS4A 2YWGA 2HK2A 1X8DA 2DRDA 3ZNJ1 2XZTB 2E5GA 2CYYA 2ZKUA 2JWNA 1NNDA 3AAWB 1U24A 2RIJA 2ZVSA 4OLPA 3BEGB 1DTTB 3FBFA 4A4JA 5CCMA 5LM7E 4DR7F 2JEIA 3Q8PB 2XBPA 4G1QB 3VZIA 4DQRA 2RSQA 1XNRJ 3A3OB 5IC6B 1QAIA 2H54B 3GQCA 1W26A 2YPYA 2DRAA 2W4PA 1YLXA 5J2PA 4ZPVR 3IRXA 3MI7X 3TQEA 3P4UB 2W4CA 1Y7PA 4GVLA 4TVAB 5HROA 2UXBJ 4MT1A 3IBCB 2AYGA 3FNNA 1IM6A 3G87A 2LA6A 2LA4A 3I96A 4ZA1A 3VCDA 2QSWA 3OL7A 1NB2A 4A8MP 2OSRA 5B0BA 3QWPA 2QL9B 3CMAS 4RX6A 4DX7A 3R5AA 1U1KA 1T9UA 5L1IA 4C8MA 4IOBA 4ZVEA 2CZVC 2HYIB 2RUSA 4K59A 2BRKA 3GSDA 4NXMF 3T9NA 2MQ8A 3VZHA 3T1HF 1N33J 3LP1A 4RUAA 1U0SA 1Q7YT 4J37A 1VMBA 2XGQA 4UY8T 2IC3A 2FVPA 2VFVA 3EWGA 4HLBA 1NK9A 4MK9A 4XPCA 2M2BA 4DR4J 4OYOA 4B9SA 4M1KA 1D9DA 4O3PA 1UPPA 1BQNA 2EKYA 5D15A 4ZCMA 2DCLA 1D8ZA 2I6WA 1PBAA 5HMWA 4WWSA 1OPIA 3CCSS 3LA0A 3SSQA 3C6UA 2RH3A 1R7IA 1GX5A 1WF0A 3GV5B 2Z2ZA 2VASA 2VZ9A 1KEKA 4B3MJ 2G0JA 1FRMA 2OFHX 2YWEA 2RS8A 1PJ6A 1DQAA 3M8PA 5BR8J 1ZPWX 2MJNA 4WK3A 4C8KA 2C2NA 5HMXA 5DM6Q 3IFEA 5LL6d 2C2OB 1MN9A 2XS2A 4FS1A 3CJQA 4L75A 3TR5A 4XPEA 4F3MA 2MQPA 1D09B 3H25A 4H4MA 2QIFA 4YEAA 4I2PB 3UD3P 4ECXA 1NPKA 2QMXA 4Z7CA 4N7TA 2OPQA 4PYDA 4DV6J 1RHMB 3ILJA 5DGBA 4PZVA 1NZAA 2KDOA 1UEKA 1IBMF 1NUEA 3I0RA 2R8GA 4QW8A 2PMZD 2RF2A 2AP6A 3T6JA 1NRKA 2CJKA 2DGUA 4LF1A 4WP9A 3BZQA 1JWWA 2CJ9A 3ENQA 5DGAA 4K7QA 4KKOA 3HO1A 4LSNA 4YR3A 4DL0C 4HR2A 3BKTA 3MTKA 4U7UD 4J9PA 3PZPA 3I82A 2LEPA 3OXGA 2WB4A 4JI8J 2XS5A 1R0AA 4X4OA 3FUYA 5C5JA 2IRUA 1FKOB 3PXGa 1EHWA 5I42B 4KGVB 2RAQA 1CJUB 3GIKA 3QLHA 3I9V9 1SQEA 2MKYA 3M8YA 2R7VA 3H5SA 3LO3A 4X4VA 1Q1KA 5J2MA 4A47A 4QQBA 4CLLA 4OZNA 3JAMY 1RWMB 4J9RA 5MAOA 3X1LB 7AT1B 1JLGA 3N9UC 3G6VA 4P7VA 1FT8A 4MFBB 3HXMA 3CXCR 1J2VA 4EBDA 2KJWA 2IM3A 1WUUA 4NLXA 2APOA 5K8MA 4IQMA 1YJVA 2BE7D 1FERA 4TXSA 1DTQA 1YG0A 1RT5B 2AZ3A 1U1PA 1NSAA 4HT5A 5H9FK 4CLFA 3SBMA 4GVBA 3MM6A 1T0TV 5KFCA 3ZZRA 2ATCB 5CYQA 3CD5A 2N3LA 1SJQA 2H4WB 4U6PA 5GMEA 4QIFA 1WF1A 2VKZG 3THVA 2YH0A 2DH7A 4ZVTB 1K0VA 4M5NA 4BS2A 3FCHA 1X9SA 3DYAA 1JB0C 4F2RA 2XZDB 4ED0A 3UCUP 2Z58B 2VG6A 1RT1A 2FJXA 3TRGA 4CQ1A 3MURP 5EHHA 1HWJA 2V8HA 2W2OP 3UW1A 3HSDA 4B9NA 3KFWX 1DLOA 3NGSA 2GO9A 3JB9k 3VR1A 4OIXA 1UJ5A 4IH7A 4RW6B 1KOHA 4WBFA 4CLKA 2W2QP 2LXIA 2E1RA 5LSRA 4X4NA 2V5HG 1H3DA 2AEJA 4WP8A 1R8HA 4WIIA 3CO0P 1XMQF 4NZ0A 3VV2B 1XK8A 3JXOA 3P96A 2X1BA 4OZJA 1HR0F 2K1RA 2GVDB 2YKNA 3U7JA 2NREA 1TMJA 3PYFA 2IRXA 3TJ8A 4AXJA 5EX0A 4CO3A 1U0HA 1N32J 1RCOB 1VLOA 4DF4A 3MR5A 1RT4A 3KK2A 1U2RA 4QYRA 1NM2A 5KFAA 1VI7A 4RBVA 3DDNA 4LJMA 4NE9C 2OPPB 1K44A 1H98A 2XNQA 2X1GA 2HHWA 3POTA 3F73A 1WSRA 2U1AA 4C98A 4LIWA 4C8ZA 1SJFA 3FFIB 3LOUA 3MM9B 4UUWA 1CJVA 2HURA 1UFLA 2LQ5A 1QTMA 1IUJA 4XIUA 3AQPA 3AD8C 3CW2C 4DS5A 2C1EB 1SH3A 4PWUA 4CLUA 2IM1A 2AJ4A 2WBMA 3MMJA 1IBLF 3QATA 4WTYA 4DX8H 1NHKL 1JX4A 2GVZA 2NR0A 4W4MA 3K89A 1N0VC 3V4IB 5CZXA 1N34J 2WW8A 1XMOJ 4ZCLA 4ETZA 1BQXA 2PI4A 1UVNA 2XYHB 2GHVC 4QU6A 4Q45A 2VG7A 2E7XA 3CCQS 4Y6IA 3EE3A 4LSLA 2H3EB 2VFRA 5KFOA 4ED2A 1FI4A 6FD1A 1TL4A 4WKYA 1B70B 4JI3J 2UU9F 4ES1A 3Q8QB 2W7AA 3RR8A 5FJ4A 4UT4A 2DHSA 1J5EJ 3H5YA 2HG4A 3J7ZT 1KDNA 3FBBA 3MM8B 2ASDA 3F56A 3W66A 3RUBL 3MAAA 3P49B 5M2RA 3TANA 1X9MA 1T03B 2F40A 4PUOA 1JLFB 2YY3A 1U2CA 4ERDA 1T3OA 4RNMA 2OEMA 1FDNA 1HHSA 4DR3F 2M7SA 2E9TA 5J1PA 3ICLA 1SQGA 3FSXA 1A0OB 4WPAA 3IMQJ 3NMRA 1DQ8A 2ZHOA 4B3SF 4OV6A 1JNRB 4JV5F 5D78A 4LRDA 1B3TA 4MK7A 2A2DA 4ED6A 1CS4A 2L08A 2VFUA 4OQJA 3SYZA 3W2VA 3MOJB 4ZPWR 2AYEA 1FWKA 2VPYB 4DV5F 5IQQA 2HLUA 4GKKJ 4AQYF 2DD8S 2CQ2A 4FXWA 2R2RA 2R8IA 4NA2A 3A3PB 1CJKB 3DGVA 4DS4A 4CH7A 4O3OA 1RISA 3EZ5A 1G3OA 4QIEA 1X5TA 2NUUG 2D41A 3DLEA 3W8GA 4CO0A 3HHLD 2F4FA 3H7HB 2FDNA 2WZ1A 4GKJF 2OMLA 4I6YA 4LFBJ 1TL7A 2HKEA 2XTJP 4NXNJ 4L73A 1T05B 3Q8VA 1NEEA 4NYZA 4RW7A 4ECUA 4RNNA 3A1YG 5K5MA 2VG5A 4I67A 4USUA 3NAIA 4QWBA 5F9LA 1TKDA 3MGJA 2HBZB 4X4RA 4USMA 4DHVA 1NDPA 1EX8A 2MQOA 1RLDA 5ETSA 3VAJA 3GONA 2FTRA 1Q53A 4I2QA 4NLYA 2AYMA 3HI9A 4RO0A 4CH1A 2FHKA 2QG9B 2HVHA 1WOSA 3CD7A 5ETQA 4DUZF 2CVIA 1S9GB 1HNZF 3ELHA 4DUTA 4DR5J 2LEBA 4OI3A 2CJXB 4YQWA 2W9AA 1KKHA 1SB6A 1L5UA 3ILLA 2DXDA 2KJVA 1NXIA 3OVBA 1R3NA 1IVZA 4ANEA 4NLDA 2XGPA 2W9BB 2RUGA 1TK5A 2MPUA 2J0WA 4DUYF 3DOMA 4QOTA 1H38A 3NRBA 1ZTTA 1WOPA 1BMQB 1B4SA 2F4VF 3HHLA 2JC0A 2UUAF 1O51A 3VGTA 2XM3A 3KLIB 3IXQA 1YJ7A 2RRBA 2V69A 3CC2S 3NWRA 2EVZA 3M9OB 1TL3B 2M8HA 1VK3A 3KLGB 4A8FA 2ACMA 3D68A 3W2WB 1S7HA 4B9TA 5MLCV 3OHAA 2G4BA 4YY3J 1IM4A 1O6XA 1RK8A 2EWHA 4CLWA 4OYZA 1UPMB 5DQIA 2HHTA 4CIOA 3HVTB 2FY1A 2B7CB 3CPWR 3KLEA 2MZTA 2FY8A 5DG7A 2MMYA 2ZH9A 3RJMB 3MFIA 3SQGB 5A2QY 1RT3B 3A13A 3KJFB 1S0MA 4FNIA 2L48A 5IC4B 2DHHA 2MGZA 2HW3A 1FVSA 3N6NA 2DNOA 4RW4A 2EC0A 2M8DB 2ZNYA 3FVYA 4OJHA 1UFWA 2RQKA 2VHGA 3BGRB 4B17A 4YMEA 5KFPA 2UVRA 2XMWA 1NK0A 3AHPA 4JI0F 4KBIA 4X4SA 3JSMB 2CPZA 2IRYA 2VIHA 4NX9A 1E6YA 5HQLA 4JI1J 3TNVA 4C9DA 1S6PA 2ZEJA 3MMAA 4EGLA 5KFUA 4O0NA 4LSZB 1QSYA 2B4PA 1FD8A 2ROPA 5KFBA 1U47A 3NGTA 2MB0B 2CNKB 5EWGA 1WORA 4CYUA 2KZMA 2C3PA 3H2VE 1FK9A 3CDEA 2XLJA 4I7FB 1S1UA 1VBZA 3DDIA 3PCOB 3NP5A 4X84A 2EW9A 1D0EA 1EP4B 2JJ4D 5KG1A 1IKYB 3SDEB 3V6KA 1FWPA 3EGZA 3BJYA 1OPZA 2K06A 4CLTA 1JLQB 2ZH1A 5A6WA 3SFGA 1DZ5A 1JLCB 1BWEA 2IM0A 2EFGA 3EGWB 4K5SA 4Y2KA 2B43A 2J7UA 3VAIA 1KN6A 5HP1B 3CJ2A 2NXCA 4BCAA 2BE2A 1CBKA 4F04B 1A9NB 1K1SA 4IKAA 1P1LA 3OBIA 1F9HA 3C46A 2CQ4A 4KFBA 4UZCA 2CPDA 1YX2A 3NS6A 2UV8G 1N4LA 3K2YA 4OHWA 4G1IA 3BREA 2HHPA 4DBQA 4DL5A 4O0IA 4X65J 1NSKL 8RUCA 2ZKTA 3HP6A 4LUBA 3ENVA 2V4JB 2AIRB 3G2XA 3T19A 1VC5A 2KFZA 3HSZA 3CDAA 4UQTA 4KO0B 4NLRA 1FD2A 4J5OA 2RQCA 1YRXA 4NA1A 3UI3A 2NCKL 2CZ4A 4OJ3A 3HHKA 1ZBTA 3DOKB 3PHEA 4G65A 4F4KA 5CA5A 4ZVGA 4WYWA 1F6TA 2QA1A 4DR7J 4MKVA 4WXOA 3D6HB 3EX7B 5DG8A 5C25B 3OSNA 4LF8J 2DNQA 1FWLA 3SMZA 1NH7A 2CNOB 1RWXB 4ZLPA 2ZD1A 5ETLA 1Y11A 1Y9OA 1S9EB 4QW9A 4MIBA 1R89A 3PJWA 2E66A 1RLCL 3RW7A 5SZTA 2WVDA 3DLHA 4I2PA 3MMBB 4ED8A 2M70A 3IWXA 4NZ6A 5IOLA 3B4MA 1LNQA 2E1PA 4QU7A 3P45B 4M5IA 3TUIC 3ZZYA 4OZ0A 4ZHRB 2OPSA 2Y8WA 4YOEA 1N5TA 3A4TA 1S1WB 5H9FJ 1YHQS 1NHUA 3HX9A 4CH0S 1R6VA 5H9EK 3GTYX 4JOUA 2FGCA 2XULA 3GV8B 3RBZA 4B3OA 5K14B 2I8EA 3QQCD 3DKDA 3KDNA 4ER8A 3RRKA 3KHHA 1CQMA 2IVMA 2DT9A 2YQ3A 3AD7C 3Q24A 1HI1A 1FFWB 2DJWA 1RWUA 3DGPA 2OEJA 1J5OA 5KFGA 3PYDA 2JFKA 5D3GA 4AE5A 3PTWA 1FKOA 1V3SA 1HQ2A 1ZPVA 1NLKL 1SJ3P 1LW2B 3THPA 4URGA 5CD4A 5KT7A 2JEFA 2F3JA 1V3RA 1W25A 1XEZA 4IFVA 5C42A 2OI2A 3IRWP 3QGIA 2UZAA 2LQ9A 3U1NA 2YKPA 2L9WA 4ZPAA 3M8SA 2AX0A 2MYFA 2FLPA 1V5VA 4ZS6A 1VC6A 1M1HA 1MMLA 3VQSA 3T1AA 3T1YF 1TL1B 1OJ4A 4X66J 1WC1A 5A8KB 5F0UA 3MECA 4PG4A 1FJ7A 3M7VA 3KK1B 2ZDOA 2J76E 3G6XA 1IBMJ 4ID8A 3R7NB 3HK2A 4CP5A 4NRTA 3C6TA 1AXQA 1BHNA 3TX0A 3PR4A 3HLUA 1G1XA 2R42A 1KQKA 4QR2A 4CNYA 4LQ9A 2GQ2A 3EDQB 4P74A 1VHFA 2CQGA 3KXDA 3BQ2A 1XBWA 1QUVA 3KLVA 1H74A 2N7CA 1PIEA 2XEXA 3BGUA 4MAKA 2XO6A 1WDDA 3QZ8A 1F5CA 4MKAA 2R7WA 4ZPCA 4CWBA 1YZ7A 3D3CJ 5LMNF 2R7OA 5J2NA 4DEZA 5I3PA 3WIUA 2VODA 4HH1A 2B6AB 2ZH5A 4DR2J 1FJEB 1CG2A 1X4GA 1N6QB 4YUDA 1RT6A 1RKJA 4ZLLA 1RA7A 2ACYA 4UUXA 4AL7A 3CDWA 2OHDA 3LUYA 5D0EA 2PA3A 3T5LA 2KN4A 2LU2A 2C22A 1VBXA 2RDDA 5DQGA 3OJSA 4E98A 2HLTA 2FGOA 2L9NA 2GVDA 4ECYA 3B78A 4ID5B 2DHXA 4WZQA 2V2VA 1PYTA 1C0TB 1VQMS 2P9GA 5T14A 4ZCIA 2R8HA 1HPZB 4FF2A 1JLAA 3IM8A 4H4OA 2LDYA 3PEHA 1UVMA 1IJEB 1CVJA 1V5IB 2OPPA 1IR0A 4PXEA 4F0MA 3HHLC 4LBHA 2CKWA 5T7LB 3FFIA 4HYKA 1URNA 3NGUA 4DX5A 2XLIA 1X4FA 1P9YA 3MPVA 1OY8A 1VQPS 3MD3A 4RKUC 4FKXA 4IDKB 4TLQA 2FHJA 1I94J 1FNOA 3UWTA 5ETPA 4FPIA 4A8YA 1K8AT 2E5IA 4R8UB 1I1GA 2UUTA 3CE8A 1PG5B 2UXBF 4NLWA 2H48B 5HJYA 4FYXB 3BDPA 4ZVRB 1RTHB 4FBUA 5A8WB 2UXCJ 2GMHA 3CDUA 4F4WA 2ZH2A 1RWKB 3PY8A 4DV2F 3OFEA 1KLMB 2VV5A 1FEHA 2OELA 4K4XA 3BN7A 4RLEA 1UFKA 3IAM9 3KJNB 1K47A 4WFZA 4C3LA 1XMQJ 1RBOB 1JK9B 4HACA 2ZE2A 2CAJA 2IYGA 4ZLJA 2HGMA 4OZ1A 1VYAA 2AQ4A 1HR0J 4UZBA 5ADZA 2F1FA 1RU1A 1VJWA 2H1YA 4HEA9 2A18A 3VQTA 2WBRA 1N33F 2Y1LB 2E5LF 3V5RA 3CCWA 2P8IA 4O3SA 1RDRA 3O8WA 2ZHBA 2YQ1A 2ZUAA 3H8YA 3TVKA 1QTNB 2KFYA 3W9IA 4EFAC 4KRWA 3NNCA 1MN7A 1AA1B 2J6UA 1U4BA 5DLGA 4LVOP 1AFIA 2HEKA 3PEJA 5IZHA 2FHMA 3I32A 1JLFA 2IA6A 3US5A 3D9BA 4I64A 3CJKA 3BPDA 5G0RB 1D9AA 5LSOA 2M88A 2X3DA 3FZ2A 2NLWA 2O5DA 2GV1A 3IBWA 1BWVA 3Q22A 4RBTA 3ZZZA 2FVCA 3ISND 4C0HA 5IS2A 3KTQA 3KG0A 4H4KA 1F0XA 1IBLJ 3IRXB 4NLPA 3K7RA 3D6TB 2IY5B 4DSJA 2RB7A 4OYAA 5HROB 4C11B 2C28A 2BJ8A 1YITS 2ALYB 5C2CA 2XSJA 1F3VA 1VFJA 1FE0A 3MPYA 4M5HA 4NLVA 1CJKA 1IKWB 1PAEX 2HNZA 1FXRA 3DU6A 3BKUA 4OJ1A 1TFYA 2C3MA 1FXLA 2L41A 3UD5A 5EX3A 1JMTA 2OEKA 1RHKB 4DV6F 1FDDA 4DV4J 1OS5A 1LXNA 4DWIA 3FBCA 2QGFB 1OSDA 1REVA 2UU9J 3LP1B 2YNGA 4TYAA 1QY7A 4KR0B 4Q44A 2XY5A 5L9XA 2IC3B 1MWYA 1EZZB 3FBEA 3FZBA 3RU0A 3K5MA 1FKAF 5DQHA 4EYHB 4L6V3 2BMBA 4CNZA 1SL2A 5K9FA 5KFXA 3G82A 1FTRA 2ALZA 2Q79A 4ZDNA 5DZ6A 3I0SB 2QA4S 3PO4A 3VF0B 1SV5A 2RDIA 1Q86T 3HKWA 2O67A 3TAQA 4DR3J 3WX4A 2DH8A 2MLXA 4J90A 3C6UB 3Q8UA 1AZSA 4NYPA 5B7WA 2H4YB 4S0MA 2HNYA 4WU2A 3QRRA 1TP7A 3H5UA 3AA8A 1NK8A 1D8YA 4EI2A 4JV5J 4TY9A 1HBUA 2FJEB 1U09A 4USVA 3BQ0A 3M8PB 4DV5J 3B54A 3DLLQ 4TU9A 2W9BA 2E7VA 1X31C 1X7VA 4AQYJ 4W92B 5DO2A 2MSTA 4MIAA 2E5HA 1WOOA 2AEFA 3C19A 1MU2A 5E5NA 3M1VB 4M63A 1HW8A 1NPPA 3HJFA 4AFFA 1Q79A 2B4UA 4NASA 4H4MB 1U6BA 2ZOGA 5KFIA 2EFOA 1ICEB 1XJWB 3R1HA 5HATA 1Q7LB 4J9VA 2XSFA 5H1SV 4LRBA 2XY7A 2YPZA 3KLIA 3O3LA 4GKJJ 3I0RB 4TU8A 4NCGA 1GXUA 4CTAA 3Q2SC 2BE9B 3DRSA 3KLGA 3JQJA 3GZ7A 4ICLB 1RTJA 3HHDA 2ZBPA 4ZK7M 1HWKA 4M5DA 3KMSA 3EJMA 2J6SA 4XO0A 3QGGA 3L7OA 4LSNB 5AE1A 2VC0A 5L9NA 2DY9A 3ZZTA 3AOAA 2BW2A 4IFYA 2EKNA 3M8QB 4P72A 1R0AB 1RT3A 5HK4A 1G7CB 2OJ3A 3NKYA 4NLGA 2XYGB 2BOPA 4OYPA 3H90A 1HNZJ 2W2PP 1NMEB 1RKIA 2VPXB 4WXWA 3PDNA 5IFMA 3QLHB 5F0WA 3NAHA 3NG8A 3QFWA 1V3ZA 1OYEA 1TELA 4QIGA 4V19J 1QVFR 1KS2A 2DPIA 1U7LA 3ZZPA 4LR9A 5J2MB 5L46A 3O1LA 3V4MA 4DUYJ 1Q4RA 4IUFA 4OV1A 4OFZA 1JLGB 2IAJB 2AU0A 2BQRA 2G1DA 3MD1A 2F4VJ 4IRDA 2R9LA 2L9DA 2CFXA 3A8IA 3RYLA 2VBXA 3SIPB 5D4OA 1Z1ZA 2BANA 3CF5Q 4WKRA 3FCWA 1DTQB 5IT0A 2HQGA 4KGKA 2V50A 3K57A 4ILRA 2DGQA 5JUMA 3FGVA 3FRZA 4USTA 1KQGB 5HSPA 4GVBB 3MM6B 1RAAB 4WU3A 5CYQB 1EP4A 4Y2CA 2ATLA 5LMUJ 4C0BA 1CPZA 3RRHA 5BJRA 4ECTA 1RGVA 3R2DJ 4N76A 3H40A 3CIZA 2VA2A 2QYGA 2C42A 1U1OA 3SCLE 1JLCA 1RT1B 4ECRA 3TX8A 3A3NB 3UO0A 4LR7A 3G8TA 2O01C 4OLOA 6FDRA 3T5JA 3O6QA 3N4WA 3E2EA 4Q43A 1H2TZ 2CQDA 1Y10A 4ELVA 4RPFA 4O44B 1QUPA 3R5JB 3K5LA 3G8SA 3MUMP 3I5CA 4TQSA 3JTOA 2XY6A 2GMLA 1ZAXA 4N47A 3KKFA 5LJ5Y 2CQ0A 2X1FA 3MEGA 3LWLA 4JI0J 1FO1A 4ZVOB 2MKHA 2K1RB 2YKNB 4C0OC 4A8QA 2ZZNA 2HFOA 3AD9C 2R2SA 4OX7A 5H9EJ 5F8IA 1S77D 3BSAA 4O3QA 2FZKB 1J5EF 1C1BA 4RW9A 2BKNA 1RT4B 3MFHA 2CQPA 1YDLA 1RU2A 3JTPA 2DEJA 2FZGB 3C2PA 1NK4A 3POTB 2DXEA 1HQUA 2HZVA 2OPRA 2CPJA 3BH6B 4CRJA 2HGNA 5IM0A 3K5PA 1CJVB 3NGDA 5HVFA 2LXFA 2DHGA 4EUVA 2D74B 4EZ9A 2OGUA 1TV6B 1TR0A 4Y28C 1LWEB 1MNEA 3TW0A 3VTIA 2X1AA 3Q86A 3M30B 2NZ4A 3NLCA 1AROP 2GQQA 1N8RT 4JUZA 1RYSA 2V9KA 3IWNC 4KH0B 4UOHA 2GVZB 2D3O1 3HSJA 1TAUA 1T94A 4QWDA 4GKKF 3ENWA 3N6MA 1RBLA 3M6UA 3D2WA 4ZPBA 1YJWS 2I5JA 4NEYA 2DGXA 1HBMB 1FRHA 3Q0AA 2VG7B 1KFSA 3N0VA 1BXNA 4IYQA 4FN5A 3CULA 2Q6CA 4YN3B 3NMAA 2GJIA 1S7IA 4LSLB 4DL3A 2YTCA 2DNGA 4ZHRA 2CA9A 3BGFA 4PG8A 3KJQB 4P73A 1UJ4A 1SL0A 3TYTA 4BC9A 1B0TA 3CB4A 4LFBF 5D0GA 4EEYA 4YB1P 4NXNF 3UQSA 2QLBB 2P9EA 1L3VA 2MEWA 4V19X 5K14A 3HFZB 1T8EA 2XMVA 4LR8A 3OTOJ 1I3OB 2NQPA 1S9FA 4FNHA 5F41A 3ZC4A 1RAHB 4R5PA 3VALA 4NI2A 3MAAB 4UOFA 1HFEL 2I9SA 3PYGA 4A46A 4PUOB 1VQKS 3KLHA 2HVDA 2R7UA 5GMKa 3TZZA 2F8HA 4ZVQB 4OHZA 5KFZA 1N5QA 3CD0A 3LQVA 2V67A 3PFEA 4F3OA 4B3TF 3RR7A 4A8OA 4P7TA 4NYOA 3HHNB 2JLFA 1GMWD 3D7SB 1CS4B 4JI6F 2O1PA 3W2VB 2CWXA 1PGZA 2ILYA 1WSVA 2VD3A 3LGMA 2DNLA 1B7FA 4DL6A 4LIRA 4F50A 3NGRA 2P5VA 3CCUS 2R7TA 4H4KC 3LGHA 3P5TL 1BE4A 1S76D 1UKUA 2MZSA 2C3YA 3RBDA 2W4DA 2IJFA 4ATNA 2ZJRQ 2HQFA 1S97A 3GIIA 3DLEB 1BY9A 2V4RA 2Z2YB 4K4SA 4WK1A 4H54A 3TA1A 1APSA 2LECA 4JV1A 1TL7B 2AT1B 4FKYA 3TA2A 3S01A 4XDCA 3S7RA 3UDVA 3NL0A 4RW7B 5GAEU 2K2PA 2VG5B 1SPBP 2BKPA 1H7WA 3DHXA 2FUG9 4YY3F 4YR0A 1FNMA 1NK7A 2PIIA 1X9WA 2OTLS 1RT7A 3G6ES 2A6OA 2OSQA 2DYAA 3T5HA 4I2QB 4AL6A 4OX9F 3TEHB 2AJQA 4CO5A 1U25A 2JDJA 2KU7A 3NGKA 3GILA 3GCWP 3QRQA 3H5XA 2LDIA 1LK5A 1LXJA 5C24A 2B8QA 1U26A 3BV8A 3QIDA 1ITPA 2FLOA 3CCES 4ALZA 3M9NB 4GRSA 2BBEA 3TWZA 5B0AA 4KHPJ 1B64A 3L7PA 1L3TA 2HVEA 3CT9A 4MMOA 3DOLA 3T1YJ 3KJVA 4P2MA 2EXUA 3EVOA 1EKSA 3DOMB 3BM7A 2V94A 3LALA 5CD4H 2Q43A 1KLNA 2WRMA 3C15A 1RZMA 1UZDA 3CIMA 1C0TA 3DI6B 1WC4A 3GIRA 3HHLB 2CNLB 5JVHQ 4QIVA 1MROA 2K8GA 4O4RA 1K1QA 2R7QA 3E01A 1D1UA 1NJZA 1HL6A 2WSEC 3A12A 1N48A 5FIIA 4X4PA 1RABB 3KHLA 2K7JA 2RMLA 1RTIA 2BQ3A 1Y5NB 2AZ1A 3OR2A 2NYHA 2GFFA 4LF6F 1GMUA 2P9CA 2IMWP 3NOGA 3PW5A 3EGNA 2V8PA 3D5MA 1JLBA 5D0RA 1UVIA 2QYCA 3KLEB 5L1KA 2KB2A 1KHWA 3QSIA 4FP9A 3RRGA 4F0HA 4I68A 4R8UA 1U1LA 4KGXB 1JJ4A 1GXLA 2QFIA 3EYZA 3I55S 4NMXA 5JMNA 1WDTA 2MGZB 5HLFA 5KG7A 5AJ3J 4TN2A 1RTHA 4RW4B 2VBYA 4WFBQ 5HANA 4XK8C 3BR8A 1WI8A 3KG1A 1KLMA 2V4QA 4HDHA 3CJ5A 3FSYA 4WJBA 1BLUA 3JSRA 2HWHA 3R5BA 4YDXA 5C2GA 3I4PA 4KGMA 4NPOA 2AGOA 5FD1A 2CDRB 2K3KA 1Y0HA 1XN9A 1CJTA 1ROFA 4FVCA 1ZA1B 4F8RA 3SCJE 4X65F 5HBMA 1E6YB 2HAFA 2LCWA 3MMAB 2V63A 3GU0A 3HHEA 1PYOB 2CG8A 3SQOP 3G4SS 2HVIA 4DPUA 4J91A 1FK9B 1ZZFA 2HRYA 4TNOA 3DLGA 3I5AA 4X4TA 1S1UB 2C2MB 3JAMU 4YR2A 2B56A 1VQLS 2PD1A 5G0RA 1T7PA 2DNMA 2HQCA 2GX8A 2DPJA 8ATCB 1GNKA 1NSQA 1U6FA 4J9KA 1XERA 1YBTA 2YWKA 5HJXA 1M5VC 4LF8F 2MZRA 9RUBA 2MQQA 5I3UA 1T95A 2MSSA 2MHNA 4DQSA 4C8NA 2DNHA 2AJ2A 3CJ0A 1XR7A 3NCQA 2W9CB 4DV0F 1WG5A 4WP3A 1G2EA 3ZTRA 2JLGA 1Y00A 4C6AA 4C11A 2BE2B 1A7GE 4DR1J 4CCHA 3D0HE 4DSIA 1HD0A 3V6DB 2DGSA 4QIWD 3PX4A 1YJNS 3IP0A 1NSPA 1SC1B 1IKWA 1B7YB 1R27B 4KFBB 4HKQA 1RT2B 3AFGA 4ED5A 4RL1A 4DV2J 4ECQA 1NK6A 2BQUA 1C2PA 1M5PC 4UQGA 4EWTA 3NBPA 4CM0A 2XMAA 2O3DA 1FCAA 2G2YA 3OLBA 2XWYA 4JYAF 4CLPA 3ZTPA 4MH8A 3FK4A 3O5TB 1FRIA 5HN0A 1WWHA 2QA2A 3BN4A 3MAQA 2E5LJ 5CH7B 1U48A 2QLWA 1RAEB 3N6LA 4NOHA 4OZ2A 1H72C 4K4VA 2DEIA 3LPYA 4B02A 3ENAA 4F02A 1P1TA 2BOAA 3SFUA 4IH5A 1TKXA 5F9NA 3I0SA 2E9ZA 4ZCKA 3NNAA 1YSJA 2ZBQA 4HH0A 4NLTA 1K0TA 1S1TA 5D4PA 5CYJA 1KHVA 5D0HA 1FDBA 1DBDA 3KK3A 2QO3A 5A6PA 1TTHB 2HS0A 1JXLA 3GP9A 3DLKA 3DDKA 3K58A 4L3NA 2F7VA 2ASJA 1VR6A 2IMOA 4DSKA 1LWXA 3RG6A 2DKOB 1O8BA 2ZD1B 3T41A 4KPYA 1S79A 4JBCA 2RQMA 3M1VA 4UTGA 3W1YC 1MWZA 3Q8RB 4ZP6A 4X66F 3VAHA 2BXJA 4V1Ak 3HD1A 3VWSA 4EK2A 3CD6S 5ETTA 1TMMA 4L76A 5CYMA 1Q5YA 4RUCA 1JIHA 4CLSA 1Q82T 2ZJQQ 1TVRA 2OPSB 2HVZA 3PRDA 4R25A 3R8YA 3C14A 4DPYA 3RAQA 2OO4A 3TAMB 2ZOFA 1TUGB 3CJ4A 2FJDB 2WONA 1S0NA 4ICLA 1NAQA 4B3OB 4CO2A 1S6UA 1S1XB 4C8YA 4PWDA 1Q16B 2J8SA 3J81Y 1CQNA 3IN5A 1VRQC 2NXUA 4G1PA 4ECWA 1UWBB 3PIPQ 4OYIA 4C97A 3IBFB 1RAGB 3DGPB 2YVSA 3M8QA 1J5OB 3H59A 3J7Z5 5D3GB 2DITA 2J9DA 1RUSA 3QBCA 2ZBRA 5KFQA 4DR2F 3W8PA 4IFVB 5C42B 3A8EA 1SUQB 2MHEA 2DH9A 2I2YA 3GFHA 1FVQA 3MR7A 2B8PA 3K59A 3UVJA 4N8OA 2CIMA 4KGZB 4PPZA 2R7XA 2G0IA 1LKZA 1QSLA 3O44A 4X2BA 2ZITA 2IAJA 1SIZA 3GE9A 3EM1A 3MECB 2GNKA 4YS2A 4A8SA 4KSEB 3W64A 1JQGA 2IJRA 2W01A 3C8YA 1WHWA 4EMDA 4RZRA 4EYIB 3C6TB 2P6TA 4C48A 4WF9Q 2IBKA 2C2EA 2M9KA 1UW4A 3IR5B 5LOQA 2XI3A 4R0EA 3MCSA 2EPIA 2KTQA 1NBEB 2COLA 4BDPA 3BH7B 5CXTA 3W5ZA 2UUBJ 2HHVA 1AFJA 4C2MA 3J80Y 3W3SA 1WTFA 5KOWA 2QZ8A 4OI6A 4PXBA 5E41A 2ZWOA 4EBCA 1BQMB 1I94F 1EETA 1IBKF 2BX6A 5G4DA 2CRLA 4KIAA 2FIUA 3W62A 2JOQA 5GVQA 2DR9A 2DR7A 4ZJOA 5J2NB 3OL9A 4O44A 2D9PA 4YHHF 4F36A 4P6QA 4PR6A 1ZA2B 1FKPA 4ZVFA 4P9SA 1RT6B 2UXCF 2ZHAA 3OL6A 4K5RA 3Q2TC 1FRXA 3L7UA 2LQBA 3FKBA 2QL5B 2GO8A 3FSIA 1YTYA 3UN3A 3QNWB 2XMUA 4A48A 3AB4B 3EVWA 1NZ8A 1S59A 2J6TA 4CLZA 4DN0A 1ACMB 3GJSB 2FPHX 1JLAB 3GPAA 3BSCA 5FDLA 2VBWA 3PR5B 4H4OB 1FJCA 3R2CJ 1UL3A 2MTLA 2YBVA 4OI0A 4B3RJ 1V9OA 2V8VA 3W63A 3BPSP 1HIYA 3HVRA 2BACA 4Y2AA 5D4NA 2MQLA 5KFSA 4WTOB 2W2NP 2WSFC 2BM1A 5AE3A 1TV6A 1PBUA 5KTQA 4F4XA 1WD6A 1LWEA 5DDPC 2BV3A 3VAMA 3M30A 2C2DA 5KFJA 3TUJC 1FX4A 4ZVUB 4RU2A 2QMWA 2ROEA 2DK2A 4QJVA 2ASYA 4I6WA 2KYZA 3VVTA 1VRTA 3G8QA 1VQ5S 2A2CA 3DXSX 3CO9A 2YWWA 1WC0A 2BJ9A 3J81j 2XMMA 4DV3F 3U02A 3V6JA 3NS5A 1HBMA 3MHYA 5KT4A 4ZJQA 1WC6A 3DHWC 2KXNB 3AXMA 4OI4A 4HACB 2ZE2B 2AEMA 4U7CA 4AT1B 3W9HA 1Q8KA 3HF5A 5A2QU 4NLQA 4DV4F 2QMUB 1HNWF 1U1RA 2HZCA 2CPHA 1XNQF 5IWAF 1EAYC 3ZNUA 3CCZA 2JX2A 1N5VA 1Q8IA 4HT7A 2UVVA 3R97A 3BSOA 1LWFA 4J9LA 1EIYB 1LFPA 2YKMA 1X4HA 3LTOA 3OUYA 2HFVA 2KFNA 4PQUA 4MTPA 4PABA 2HQIA 3V2UC 3CJRA 3UDCA 5KG5A 5DDRC 2RJZA 1C0UB 4W98A 2XQCA 1B0VA 3CJKB 3T9ZA 5A8RA 1O5JA 3NXZA 4RWWA 5KG6A 3BKFA 2BM0A 1LV5A 5HVHA 2V2ZA 4HVZA 5D77A 1YVFA 4Y00A 5LJ3Y 2KRBA 2G2ZA 2FB0A 5FLXY 4DMZA 3SI8A 5LXYA 1N88A 2FJAB 5C7PA 5AT1B 2AYBA 3WDOA 2RT3A 3P3DA 4NCBA 4KPCA 2ZNZA 4YFUA 1XR6A 2XSJB 1KFDA 2HNZB 3SZ2A 4XDDA 4DI6A 2P6SA 3OTCA 4ZMMA 2WOMA 1NDKA 2N4CA 1N36F 5GAHU 2YX7A 2YKOA 3DC2A 3ILOA 3MR2A 4PWWA 4OI2A 2YKAA 3GB0A 1U1QA 3QIPA 1REVB 2YNGB 3PX6A 3RB6A 1XMBA 4B9UA 2AHOB 1SKWA 2W2MP 1RE1B 1UA1A 1L3SA 4PRFA 1AB8A 4PXCA 1P27B 2MY8A 1I6JA 3G82B 2D3ZA 1U6ZA 3N01A 3I31A 1XWLA 3MMCA 4K50A 1PAUB 1SV5B 1IN0A 4PCQA 4WCEQ 2MZ1A 3H4BA 4ED4A 4MIWA 1UZHA 1AZSB 3P8BB 2V0NA 3WX8A 2VC1A 3FRYA 4K4WA 2DTJA 2NZCA 1NB7A 2HNYB 2AV5A 1D9FA 4B3TJ 1F9EB 2EBGA 2DGWA 4CZCA 3HVWA 1DURA 4IOAQ 1HBUB 4JI6J 1S6QB 5HMYA 2RVJA 3KLFA 4ZN3A 4JI5J 5F8GA 3NCRA 2ZH3A 2JLEA 4B08A 1VIXA 2CWKA 4DU7A 4ZIWA 2QV6A 3NY0A 3ZTOA 1MU2B 2HHHF 4FZVA 2HHQA 4ZVHA 4M94A 2FJWA 3MXHP 4BBYA 3MM7B 3VVUA 1YKWA 2KRRA 3HVAA 2ZDPA 3DI6A 1UEUA 3J7AN 1X4DA 4RW8A 3DRRA 2C3OA 2DNPA 5KFYA 3TA0A 1S10A 2W8LA 1NKCA 3M2UA 1VK8A 1P9QC 5ETNA 2V68A 1YJ9S 5KOXA 4NCGB 2WVBA 4CTAB 3RTVA 2ZOMA 3KMQA 2A6MA 3DRSB 5E3AA 1F2HA 1OIAA 1RTJB 3DRYA 3AXKA 2E1MC 1WEXA 4U8YA 4USKA 2POKA 4M5DB 5LMUF 1YK9A 4ZLNA 2CG4A 5GAHI 1UWAA 2XI2A 4LF5J 2QN6B 3RB0A 3GYXB 1RWNB 2HNDB 3K5NA 3WIVA 5AXLA 3S8SA 4ELUA 4IFYB 2VBZA 3J7YU 3AA9A 4OX9J 1SKUB 4YDDB 3BDEA 4ZPTR 3AOBA 3ET6A 3OQ2A 3UE2A 3QFHA 1VRUB 1WHXA 1IWGA 3SEOA 4DQPA 1GAOA 3DM2A 3CCRS 3LW5C 8AT1B 1EARA 4NLSA 2H5JB 4DZ6A 1KR4A 2CQBA 5HMZA 3CGIA 1FRLA 3RB3A 2EI5A 4U9RA 1RI7A 2JRSA 2PDAA 5JJBA 2N7YA 4ANCA 3Q23A 5ETRA 3M8ZA 2R7RA 2FVRA 3OTEA 1MMDA 3UR3C 4X62J 2LFVA 3LWMA 3UN5A 2IDLA 4MYUA 4OX6A 3M8RA 2BANB 4OYWA 2YWHA 2AJFE 1HARA 3CCTA 4Y2IA 5B0CA 1V6HA 2XWXA 3E51A 2FJVA 3PX0A 3CC4S 2DNRA 1IKVA 2YNFA 1R8PA 1UCNA 1SC3B 2CJBA 2G9OA 4Y65A 1HWUA 2C2ZB 2R2TA 1WF2A 1DQ9A 1GX6A 4IG3B 3GJQB 4MK8A 3W7BA 3D0GE 4LF6J 2M5YA 5DETA 5F8MA 3TJAA 4JB8B 4MJKA 1KONA 1Y5IB 5IV3A 3J7A1 3PKYA 4WFAQ 1WC3A 4DR6F 5K8OA 3CWJA 2W9CA 4LRAA 1UA0A 2YWFA 4QWCA 3P6YC 3OJUA 1YIJS 3OTDA 3B6BA 1KVJA 3MR6A 3E3XA 4R0JA 1DY3A 3V6DA 4K8RA 3N5BA 1SC4B 4CT9A 4OZ3A 1RT2A 2KKHA 2VFTA 1RA6A 3JSBA 1PSDA 2LMIA 1RWOB 2PSZA 2LKZA 4PYAA 2RU3A 2DNYA 2N3OA 2IJNA 1ZOTA 3MEGB 4EU0A 3MUTP 1P8GA 4F7VA 3J7YI 1PJ5A 2ADCA 1ZAWA 2Z56B 4DL4A 4TQRA 4FF4A 2RQ4A 3VHQA 3GR0A 2YKQA 1C1BB 4RW9B 4RBUA 1RWPB 3JSYA 4BLGA 3B8HA 2HWIA 2QT7A 3OTOF 4NA3A 4DV1J 2HFSA 4DFMA 3VGUA 2JC1A 2WB1D 1Q95G 1S4FA 2PFDA 1HMVA 1HQUB 2OPRB 1RACB 2XS7A 1VCTA 3ETMA 4K2JA 5IM0B 1F3FA 4OHVA 1S0OA 3LAMA 4N56A 3VAKA 1CULB 2HQ3A 4Y3CA 3OW2R 1X4EA 3LANA 5E7OB 5D4LA 1VISA 4LFCF 3OD2A 1IBCB 4DV0J 3M6WA 2MKJA 2OH2A 3HZGA 1NO8A 2G2OA 3JQMA 1E6VA 1YJUA 2FZCB 4IG0A 2VDIA 5LT5A 2ZH6A 2EEYA 3FMBA 2JEGA 2GA7A 1WEZA 5CABA 3F44A 4P75A 2I5JB 1RCXB 2GC8A 5EN1A 4B9VA 1VBYA 2B3TB 2UVWA 3T6BA 4LF4J 4M95A 1RWWB 4J9OA 4GO7X 2FQQB 4URQU 1RHJB 1XQIA 1UETA 1SJ1A 3EXCX 3PHTA 3HJVA 4JYAJ 2EG2A 2CZ9A 2VDHA 3DNCA 5F8JA 3TAMA 2QL7B 3SV4A 3OFFA 1EJ7L 2GHWA 1ELOA 2VF3A 5J1EA 1QE1A 2B9WA 5KT2A 4ZIVA 2Y0SD 4F3QA 1S1XA 3W5YA 4ZITA 1GK8A 4NL5A 1M5SA 2I38A 1QSSA 2VH7A 4R5PB 3U1MA 3M2RA 4NI2B 1RWVB 1UWBA 1OY6A 3O2IA 3RGIA 1HBNA 3KLHB 1NHVA 2WSCC 1ZETA 4ENOA 2HAIA 5D6GA 4D3GA 4DFPA 2AKWB 3DXBA 1H2UX 2GZOA 1NJWA 5ETKA 1XC9A 1X0FA 5E3CA 4IQXA 3QO9A 1WI6A 3K17A 3FJ2A 2GJ2A 1SUQA 4OYBA 1URRA 4Z2XA 4HI1A 2JL9A 3GWCA 1XTZA 1H2VZ 4JI4J 3ITHA 1ZS6A 3MOZA 5A76A 4GC6A 1DHMA 1SI9A 4KHPF 1B0PA 3F0NA 4DDFA 2NXEA 1UTAA 4LF9F 4F67A 2OUGA 1WEYA 4HHUA 5KAKA 2ILZA 1Q81T 3R5GA 2DB1A 2EK6A 1HWIA 3Q83A 4Q2LA 3FCVA 2UUWA 4WZMA 5E33A 2RRNA 2M4MA 2MKKA 3K8VA 2RD5C 3OT9A 3TUZC 3OV7A 2Q1LA 5L39A 4KHMA 3OTBA 2RHQB 2OFGX 2MY7A 4Q0BB 2WTFA 1IKXA 4E8UA 4DQQA 5F3TA 4FYDA 1UVJA 1RAFB 4DPOA 4ECZA 3V81A 2K7KA 4J7CA 3X3UA 4NEZA 3R6LB 1U49A 1YI2S 1B99A 2HPUA 6AT1B 2AWZA 3OFGA 1Q78A 2CNNB 3V6HA 1YGYA 1BQMA 5HL7Q 1NCLA 2FHJD 1UP1A 3HDSA 2H51B 1RT7B 2ABYA 2QEXS 3PW0A 1GQEA 2B9EA 4AXIA 2XYPB 2WK4A 1OSCA 3HFKA 2BJ7A 3TEGA 2CPFA 2R2UA 3G96A 4A8WA 3CJTA 1RADB 5KFHA 5B0FA 2V2QA 3CJSA 3THTA 5AJ3F 5C24B 1FJGJ 2NS1B 3UDLA 4LT6A 1KC8T 3CTRA 3MM5A 5DJBA 2LXUA 3CMES 2HS3A 1F1BB 2IPOB 3PG9A 5DS7A 2Y1IA 4N41A 3QJPA 3I56S 3DOLB 2FC8A 3KJVB 2Z8QA 2QC3A 3C16B 3MEDB 3D6MB 3C15B 1MWQA 2PA8D 5HVGA 2IVYA 4LRCA 1UMJA 2V34A 3BS9A 5AXMA 2B4VA 2NSCA 1MROB 1FXDA 5DLFA 2MJUA 4USJC 3SCKE 2XB2D 1SCJB 1JJ2R 3EPGA 3QGPA 3KNAA 1KOOA 1BUXA 4DN9A 3E01B 2RRAA 3W60A 1S12A 2EFQA 4F4ZA 1OQ3A 1NU4A 3QWUA 5GMDA 3GG1A 2CPEA 1RTIB 2XMKA 2VQEF 4I1TA 2VFSA 2KHCA 1SQFA 2MKSA 4PG6A 5E2QA 3OR2B 2DGTA 5KT3A 1JLBB 1IBKJ 1GTHA 5E3RA 2IA0A 1RHRB 1IQZA 3M6VA 4X4UA 3MDFA 1C1CA 1PJ7A 1CC8A 4DR1F 2X3GA 4YHHJ 2DO4A 4HL9A 3OLAA 5HLFB 3BYRA 4A8KA 3FDSA 4I56A 1SL1A 3MZIA 1HYSA 3KHGA 4JI2F 2BEFA 3NNHA 4WYLA 1N5SA 4ES3A 3ZZUA 2RKIA 3W9JA 4DL2A 4FPRA 4ZKAA 2B5JA 1UEVA 3D67A 2E7WA 4PG7A 5KG4A 1S1VB 3DFEA 5A0YA 1U8SA 1KQSR 3PRVA 1TUWA 1CJTB 2QLXA 1N0UA 3M32A 2GAGC 5HBMB 3R5DA 4DPWA 4ED7A 1JKHB 4Y0FA 2M3DA 1FE4A 4LMZA 3H2LA 2VPWB 2OLWA 1S0VA 2PEHA 4P2SA 1LWCA 3FQKA 1VDHA 3PM9A 1LFWA 3MCOA 3MPWA 7FDRA 4OL8A 4U96A 3GJTB 3DLGB 1RB0A 3D0IE 4OI1A 2BKOA 5ETMA 1C0UA 2AJ1A 4KV8A 1TK8A 5B0GA 4YP3A 1PCAA 2YNHA 3CDBA 4M5KA 2YX1A 1IJFB 4FYWB 5K20B 3MEKA 1HNIB 3KUEA 2KT3A 3AH6A 2PN6A 1HI8A 1U1MA 2YNIA 4IR1A 2IFXA 3CJ8A 4GO5X 2HFZA 2WCXA 5I3UB 3TVYA 2HMIB 3BBBA 3WC0A 4LQ3A 1LW0A 3KUGA 2ZFHA 1VQYA 4NWBA 1G4CA 1A6LA 4ZP7A 2LLZA 4KJIA 3PW7A 2ZC3A 3SSRA 9ATCB 2HBYB 2HIQA 4DV3J 3IS9A 2ZH8A 4DG1B 2U2FA 2W8KA 1N5YA 4AUKA 5I4MA 3JYTA 3NBPB 1G6BA 3TUPA 2DGOA 1LOUA 3MAHA 3UCZP 4NZ7A 5HAOA 1HNWJ 3RW6A 3UNGC 3OVAA 2KM8C 2UP1A 1XNQJ 2HSEB 1FESA 5IWAJ 4Z7YA 5BYSA 2ZBCA 3ISZA 2J0QD 1YRTA 2DIUA 3HM9A 4C8LA 2MXYA 4ILMA 2H5IB 3AB2B 2KG0A 2HK3A 2GGPB 2D3UA 4RJVA 4RNHA 2VQFF 2OAUA 4M5MA 1QLNA 4XAKA 2FJBB 4KT0C 1TKXB 2FVSA 3MWBA 2BJEA 1S1TB 2EFNA 3GR1A 3OL8A 3KK3B 5HQ8A 1L3UA 1TZ0A 2JEJA 3DLKB 4IH6A 2VU5A 2AW0A 2BJ1A 1YQHA 1JXEA 5KG3A 3K8WA 3H98A 4DLGA 2MZJA 1TKTA 2GAHC 3KWMA 1I5OB 5DZ7A 2G13A 1S6QA 3OR1B 3LP2B 3L95X 3IG1A 4BHQA 2Q66A 3EMTA 5J1NA 1S49A 1S5ZA 4QYZK 1RHQB 4TLRA 2V6AA 1VGYA 2E44A 1VQSA 3MEEB 3DMJB 4K4YA 1N54B 4EO6A 3FEZA 1N36J 3MM7A 4PG5A 3CCVS 3H20A 1TKZA 2KYXA 3R1LA 2UV8A 5CYMB 3BBFA 4WE1A 2Y8YA 3R6GB 4OYXA 1TVRB 4KY3A 2K3IA 2RILA 3C14B 1N52B 2DR6A 4F0KA 4QZVB 1QD1A 2BA9A 4HTIA 2HIYA 2CPYA 4P2FA 2ZH4A 2WONB 2RS2A 1ZYQA 3GFXA 4LF7J 3ZZOA 4U67Q 1VHIA 3LP0A 2UUBF 2A0FB 2C3UA 4PWDB 2GJFA 1RTZA 2Q6BA 1KTVA 4OX8A 3EVMA 3DRPB 3HT3A 2HNDA 4QR0A 1RQ0A 5L1LA 3WBZA 1IR1A 2C2KB 1MG7A 1U1NA 1HWLA 1VRUA 2GS8A 4J9SA 1TU0B 3WZ0A 3QT8A 5J2QA 3LGNA 2GIQA 1FDAA 5B08A 3S1TA 1IR2A 4M5LA 1R0CB 1H7XA 3GSIA 3U1LA 2QA4G 1FFGB 4NLUA 2YXLA 3UVJB 4O4GA 4KYZA 5BYRA 2MQNA 5HI7A 2W24A 2NUHA 2EC2A 2MQMA 3QAEA 2HHHJ 2KT5A 2Y0BB 1HNXF 4F25A 1HBOA 4OYMA 3D1HA 1F9FA 1SJRA 2IBOA 2WVFA 3AJDA 3L3CA 3IWLA 4Q8FA 4TU7A 2VPZB 2GQCA 2R4FA 1JLEA 1HW9A 3TAPA 1EQMA 3PRBA 5I3QA 2DRBA 2CADA 4RUBA 4B3RF 2ERRA 3B4DA 1EB0A 2JVRA 4OZ5A 4IG3A 2UUCJ 3WHIA 4JI7F 3ETOA 2D3OR 4Z37A 2CQHA 3Q8YA 3VGSA 1SVDA 3BO3A 1MSWD 3M2VB 1TUVA 2B51A 4D3HA 1EETB 2EBEA 3G9CA 1P6TA 5KFFA 4AL5A 1VBKA 1DTTA 2HHXA 4B9MA 1DJ0A 2DNZA 1QAYA 3ZTQA 3M4XA 4G1QA 2IIHA 4PAAA 1M1GA 1MMNA 2H65B 1CC7A 1FKPB 4PKDB 2A1BA 5KFVA 3QT5A 5DM7Q 4N77A 4NMLA 4Q7AA 3I87A 4U95A 4IOCQ 1KVIA 2ROGA 1IWAA 3BR9A 2DNKA 1OQ6A 4K0KJ 1TAQA 1R0BG 5IQ6A 5EWFA 3WC2A 1FHTA 3CMQA 3DLBA 1NK5A 5FDLB 4I6AA 2JHEA 2MKIA 3BBCA 1M0SA 4ECSA 5HQMA 5SUHA 2R8JA 2RE1A 4F2SA 2NYIA 4LBIA 5IV4A 3GYGA
chains in the Genus database with same CATH topology
2W4CA 5L8RC 2XMMA 3BSNA 3KNGA 2V8DA 2J6UA 1Y7PA 4DV3F 3R5CA 5HROA 3UCGA 1U4BA 3U02A 5DLGA 3V6JA 2AYGA 3NS5A 4LVOP 1HBMA 1AFIA 3MHYA 2BJDA 3FNNA 5KT4A 3PEJA 5IZHA 4MYTA 2FHMA 3I32A 3DHWC 2PO4A 2LA6A 1JLFA 2LA4A 3I96A 2IA6A 4ZA1A 3VCDA 2KXNB 3US5A 3CJKA 4I64A 4OI4A 2QSWA 2ZE2B 5G0RB 3OL7A 4KQZA 1D9AA 4U7CA 2Z2LA 4A8MP 2OSRA 3HF5A 2J9DE 5LSOA 2M88A 3QWPA 5B0BA 3CMAS 4NLQA 4RX6A 4DV4F 3R5AA 3FZ2A 1HNWF 2NLWA 1U1RA 1U1KA 2O5DA 5L1IA 4C8MA 2HZCA 2CPHA 2GV1A 3D54A 4IOBA 4ZVEA 4ELTA 2CZVC 1XNQF 3IBWA 2HYIB 4K59A 4RBTA 3ZZZA 5IWAF 3Q22A 2BRKA 2FVCA 3GSDA 4ZP9A 4TY8B 4NXMF 3CCZA 2JX2A 1N5VA 3ISND 4C0HA 5IS2A 2CDQA 1Q8IA 1VRTB 3E8OA 4HT7A 3KTQA 2PE8A 3KG0A 3T9NA 2UVVA 4H4KA 1F0XA 3VZHA 3BSOA 1LWFA 3T1HF 4J9LA 3IRXB 4NLPA 1LFPA 2YKMA 3K7RA 3LP1A 4J9QA 4W90B 1X4HA 4DSJA 2RB7A 4KC5A 4RUAA 3OUYA 2KFNA 4PQUA 4MKBA 4MTPA 1Q7YT 2HQIA 5HROB 3V2UC 4J37A 1VMBA 3UDCA 5KG5A 5DDRC 2XGQA 4UY8T 4C11B 2C28A 2IC3A 1YITS 3G71S 2FVPA 2RJZA 1C0UB 2XSJA 2VFVA 1NK9A 4HLBA 4MK9A 1VFJA 1FE0A 4XPCA 3MPYA 4J9MA 4NLVA 2M2BA 1B0VA 1IKWB 3CJKB 4CI0B 4B9SA 2HNZA 1FXRA 4M1KA 3T9ZA 3DU6A 1D9DA 3PJXA 4OJ1A 5A8RA 4O3PA 3CVKA 1O5JA 1BQNA 5M2UA 2EKYA 4RWWA 1TFYA 2C3MA 2JSXA 1FXLA 4ZCMA 5KG6A 3IA0A 2L41A 2BM0A 5EX3A 1X4BA 2DCLA 1JMTA 1LV5A 1D8ZA 1DFDA 3TARA 4HVZA 5D77A 2VUGA 4DV6F 1YVFA 3HKZD 4Y00A 4WFYA 3TVZA 5HMWA 2KRBA 5LJ3Y 3RB4A 5K8NA 1FDDA 1OPIA 2FB0A 3CCSS 3SSQA 5LXRA 3BF4A 3C6UA 5FLXY 2RH3A 1R7IA 4DMZA 1OS5A 2Z4PA 1GX5A 1WF0A 3SI8A 3GV5B 1LXNA 5LXYA 1N88A 4DWIA 2FJAB 2VASA 2VZ9A 1LWFB 3HPOA 1OSDA 3RZAA 1REVA 2YKMB 3LP1B 2YNGA 4TYAA 4RUHA 1KEKA 3OXLA 2AYBA 3WDOA 1QY7A 2XZWA 3OUYB 2RT3A 3P3DA 4KR0B 3PO5A 1S0VA 4NCBA 4PQUB 1FRMA 2HWTA 2OP5A 2ZNZA 4YFUA 2I0XA 4Q44A 2XY5A 1WTBA 5L9XA 2IC3B 1MWYA 2OFHX 2YWEA 2RS8A 1XR6A 3FZBA 3RU0A 2XSJB 5EWEA 1DQAA 3K5MA 1FKAF 3M8PA 4KTQA 5DQHA 4EYHB