3DS1A

Hiv-1 capsid c-terminal domain mutant (e187a) in complex with an inhibitor of particle assembly (cai)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
molecule keywords HIV-1 CAPSID PROTEIN
molecule tags Viral protein
source organism Human immunodeficiency virus 1
total genus 29
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds1A00
3G21A 4U0BA 4U0FA 5JPAA 2BUOA 4M0IA 2XV6A 2L6EA 4IPYA 3G1GA 4PH0A 4U0DA 3DS1A 3H47A 3MGEA 5HGOA 2EIAA 4U0CA 4XFZA 3NTEA 1EIAA 3DS2A 3G26A 2XXMA 3DS3A 4WYMA 5HGLA 3VRLC 2KODA 1BAJA 1AUMA 3P05A 5DCKA 2M8LA 4COCA 1A43A 1A8OA 2JO0A 3DS5A 4XRQA 5I4TG 4XFXA 4XROA 5HGNA 2LF4A 2M8NA 2M8PA 3H4EA 4XFYA 3DTJA 2XT1A 2JYLA 3G1IA 4COPA 1QRJA 1D1DA 4QNBA 3DPHA 3DS0A 3G0VA 1EOQA 2ONTA 3DS4A 4U0EA 4U0AA 3LRYA 3G28A 5HGMA 1E6JP 3G29A 4PH1A 2JYGA
chains in the Genus database with same CATH superfamily
2P9XA 2N6ZA 3G1GA 1K30A 1Z6MA 3MGEA 2AFEA 2M5RA 2KODA 1BAJA 3CPWO 4XRQA 2N5HA 2GZFA 3G4SP 1ZNVA 1VHNA 3CCQP 4PH1A 2MR7A 4NEOA 4PXHB 1M74A 1Q82Q 3CCVP 2NO8A 5F2NA 1QVFO 3GKLC 2GDWA 3CC4P 2MVUA 2AFDA 1AF8A 2PEKA 1DNYA 2PY8A 1YI2P 1NJIQ 2ERHA 4MRTC 2KR5A 3CC7P 3P05A 3G21A 3CMEP 1EMVA 4H2XC 4GR6A 1KLPA 2DNWA 5HGOA 2FQ1A 5I4TG 3B4QA 3H4EA 1VQ5P 1KD1Q 1N8RQ 1FR2A 4DG9A 2MR8A 1E6JP 2LTEA 1YITP 1Q7YQ 3GJNA 2XZ1C 2GZIA 1KC8Q 2PNGA 3E2DA 3CCLP 3CD6P 2AVAA 1VQ9P 1EOQA 4U0EA 1UNKA 1ZMBA 3G29A 3HYBA 1OR5A 3CCSP 2PEMA 1X3OA 1GPJA 5F2OA 2CNRA 2K92A 2MVVA 1VQMP 2LIWA 1JJ2O 2EHTA 3DS3A 3CCJP 2M8LA 2FHSC 1A43A 2JO0A 2GYKA 3I55P 2L9FA 3G6EP 2M8NA 2KOOA 1M1KQ 4H2YC 4U0AA 3CC2P 2K5XA 1Q86Q 1YJWP 4U0BA 4U0FA 1VQ6P 1YJ9P 4PH0A 3DS1A 2CGQA 2CG5B 1Q81Q 2LMLA 3Q20A 1M90Q 2FQ2A 4XROA 5HVCA 2N5IA 4QNBA 3CCRP 2GDXA 3CCUP 2OARA 5JPAA 2BUOA 1HQBA 2K94A 2CQ8A 2EG5A 1AYIA 1HY8A 2ROQA 1A8OA 2JU1A 1QRJA 1E0HA 4UHPB 3NY7B 3G28A 1GXHA 2KOSA 2L6EA 2K0DX 2LPKA 2LL8A 2FVAA 5EJDA 4XFZA 2KG6A 4F37A 1AUMA 3B5IA 3DS5A 2PEJA 5HGNA 2PEOA 3CXCO 4COPA 1RNIA 2MY5A 7CEIA 2KOQA 5KP6B 3LRYA 3EJBA 2CWOA 2Z45A 4M0IA 2JQ4A 1K73Q 2GZEA 1K8AQ 2QEXP 2Z44A 1EIAA 1S72P 5HV8A 2KGAA 3VRLC 2N50A 2L4BA 2E1MA 4R0MA 1D1DA 2JBGA 4CA3A 3G0VA 3OW2O 3RG6C 1M6EX 2K0XA 4BPFA 2GZGA 2LOLA 4BPGA 4U0DA 2K0YA 2VLQA 3EJEA 5DCKA 2LF4A 2M8PA 2XT1A 2JYLA 2Z46A 1VQOP 1NQ4A 2KGEA 2MF4A 1RO0A 4BPHA 2VLPA 2JYGA 2KG9A 2VSQA 2JGPA 2WPTA 5BS2A 2DGYA 1YJNP 2X2BA 2EIAA 3G71P 3CCEP 1YIJP 5EW5E 1KQSO 2EHSA 2FVEA 1VQPP 1M6NA 2LIUA 3DS4A 2PEQA 3WBHA 2KGCA 2N98A 2L22A 1IMPA 2XV6A 3M1MA 2MD9A 3H47A 1ACPA 1VQNP 1MZ8A 3CCMP 4XFYA 3G1IA 3DS0A 5F2KA 5KP7B 2XZ0D 4H2WC 2JB0A 2KWLA 1VQLP 2PEIA 2KG8A 3RG2A 1QVGO 1RO2A 2GZJA 1VQ4P 1L0HA 3DS2A 2FACA 3G26A 4QKOA 1DV5A 5HGLA 5BS1A 1CEIA 4COCA 2EFJA 1L0IA 4XFXA 1GXGA 2N6YA 3DTJA 3EJDA 3DPHA 2ONTA 5CZDB 1W2BO 3H0DA 3CE7A 2PENA 2JAZA 1F80D 3GZMA 1K9MQ 5KP8B 4GR2A 2KW2A 2FQ0A 3GZLA 2BHVA 1IMQA 2OTLP 2AF8A 1VQ7P 2VLNA 5HGMA 3U43A 2GDYA 3LMOA 3CMAP 1VKUA 4HKGA 3NTEA 2XXMA 4WYMA 1IUQA 2KGDA 1BXIA 2OTJP 2K2QA 2FAEA 1VQ8P 2FVFA 1VQKP 4IPYA 2QA4P 4U0CA 4IZ6A 2KOPA 2L0QA 1T8KA 2FADA 2QNWA 3I56P 2VLOA 3HZQA 1YHQP 1UJZA 2K93A 2JU2A 4PWVB 2KORA 2LKIA
chains in the Genus database with same CATH topology
2CWOA 2Z45A 4M0IA 2PEMA 3CCSP 2P9XA 3G1GA 1VQLP 1K30A 2PEIA 5F2OA 1K73Q 1QVGO 1RO2A 3MGEA 1K8AQ 2QEXP 1VQMP 2Z44A 1VQ4P 1EIAA 1S72P 1JJ2O 3DS2A 3G26A 3DS3A 5HGLA 3VRLC 2KODA 1BAJA 4COCA 2M8LA 5BS1A 3CPWO 3CCJP 1A43A 2EFJA 2JO0A 4XRQA 3I55P 4XFXA 3G6EP 2M8NA 2E1MA 3DTJA 3G4SP 1D1DA 3DPHA 3G0VA 1M1KQ 3OW2O 2ONTA 4U0AA 3CC2P 3RG6C 1M6EX 1W2BO 3H0DA 4PH1A 3CCQP 1Q86Q 1YJWP 4U0BA 4U0FA 1VQ6P 1YJ9P 2PENA 1M74A 1Q82Q 4PH0A 3CCVP 4U0DA 3DS1A 1K9MQ 4GR2A 5F2NA 1QVFO 1Q81Q 3Q20A 3CC4P 5DCKA 1M90Q 2PEKA 4XROA 2LF4A 2M8PA 2PY8A 2BHVA 2XT1A 2JYLA 2Z46A 1VQOP 4QNBA 3CCRP 1YI2P 1NJIQ 2OTLP 1RO0A 1VQ7P 3CCUP 5HGMA 3CC7P 3P05A 2JYGA 2OARA 3G21A 5JPAA 2BUOA 3CMAP 3CMEP 5BS2A 2DGYA 2EG5A 1YJNP 2EIAA 3NTEA 4GR6A 3G71P 2XXMA 3CCEP 1YIJP 4WYMA 5HGOA 1IUQA 1A8OA 1KQSO 5I4TG 2OTJP 3H4EA 1VQ5P 1KD1Q 1QRJA 1N8RQ 1VQPP 1M6NA 1VQ8P 3DS4A 3G28A 1E6JP 2PEQA 3WBHA 1VQKP 2XV6A 3M1MA 2L6EA 4IPYA 2QA4P 1YITP 1Q7YQ 3H47A 3HYBA 4U0CA 4XFZA 1KC8Q 1AUMA 3B5IA 3E2DA 1VQNP 3DS5A 2PEJA 5HGNA 3I56P 3CCMP 3CCLP 2PEOA 3HZQA 4XFYA 3CXCO 3G1IA 4COPA 1YHQP 3CD6P 1RNIA 3DS0A 1VQ9P 1EOQA 4U0EA 3LRYA 5F2KA 1ZMBA 3G29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G21 A;  4U0B A;  4U0F A;  5JPA A;  2BUO A;  4M0I A;  2XV6 A;  2L6E A;  4IPY A;  3G1G A;  4PH0 A;  4U0D A;  3DS1 A;  3H47 A;  3MGE A;  5HGO A;  2EIA A;  4U0C A;  4XFZ A;  3NTE A;  1EIA A;  3DS2 A;  3G26 A;  2XXM A;  3DS3 A;  4WYM A;  5HGL A;  3VRL C;  2KOD A;  1BAJ A;  1AUM A;  3P05 A;  5DCK A;  2M8L A;  4COC A;  1A43 A;  1A8O A;  2JO0 A;  3DS5 A;  4XRQ A;  5I4T G;  4XFX A;  4XRO A;  5HGN A;  2LF4 A;  2M8N A;  2M8P A;  3H4E A;  4XFY A;  3DTJ A;  2XT1 A;  2JYL A;  3G1I A;  4COP A;  1QRJ A;  1D1D A;  4QNB A;  3DPH A;  3DS0 A;  3G0V A;  1EOQ A;  2ONT A;  3DS4 A;  4U0E A;  4U0A A;  3LRY A;  3G28 A;  5HGM A;  1E6J P;  3G29 A;  4PH1 A;  2JYG A; 
#chains in the Genus database with same CATH topology
 2P9X A;  2N6Z A;  3G1G A;  1K30 A;  1Z6M A;  3MGE A;  2AFE A;  2M5R A;  2KOD A;  1BAJ A;  3CPW O;  4XRQ A;  2N5H A;  2GZF A;  3G4S P;  1ZNV A;  1VHN A;  3CCQ P;  4PH1 A;  2MR7 A;  4NEO A;  4PXH B;  1M74 A;  1Q82 Q;  3CCV P;  2NO8 A;  5F2N A;  1QVF O;  3GKL C;  2GDW A;  3CC4 P;  2MVU A;  2AFD A;  1AF8 A;  2PEK A;  1DNY A;  2PY8 A;  1YI2 P;  1NJI Q;  2ERH A;  4MRT C;  2KR5 A;  3CC7 P;  3P05 A;  3G21 A;  3CME P;  1EMV A;  4H2X C;  4GR6 A;  1KLP A;  2DNW A;  5HGO A;  2FQ1 A;  5I4T G;  3B4Q A;  3H4E A;  1VQ5 P;  1KD1 Q;  1N8R Q;  1FR2 A;  4DG9 A;  2MR8 A;  1E6J P;  2LTE A;  1YIT P;  1Q7Y Q;  3GJN A;  2XZ1 C;  2GZI A;  1KC8 Q;  2PNG A;  3E2D A;  3CCL P;  3CD6 P;  2AVA A;  1VQ9 P;  1EOQ A;  4U0E A;  1UNK A;  1ZMB A;  3G29 A;  3HYB A;  1OR5 A;  3CCS P;  2PEM A;  1X3O A;  1GPJ A;  5F2O A;  2CNR A;  2K92 A;  2MVV A;  1VQM P;  2LIW A;  1JJ2 O;  2EHT A;  3DS3 A;  3CCJ P;  2M8L A;  2FHS C;  1A43 A;  2JO0 A;  2GYK A;  3I55 P;  2L9F A;  3G6E P;  2M8N A;  2KOO A;  1M1K Q;  4H2Y C;  4U0A A;  3CC2 P;  2K5X A;  1Q86 Q;  1YJW P;  4U0B A;  4U0F A;  1VQ6 P;  1YJ9 P;  4PH0 A;  3DS1 A;  2CGQ A;  2CG5 B;  1Q81 Q;  2LML A;  3Q20 A;  1M90 Q;  2FQ2 A;  4XRO A;  5HVC A;  2N5I A;  4QNB A;  3CCR P;  2GDX A;  3CCU P;  2OAR A;  5JPA A;  2BUO A;  1HQB A;  2K94 A;  2CQ8 A;  2EG5 A;  1AYI A;  1HY8 A;  2ROQ A;  1A8O A;  2JU1 A;  1QRJ A;  1E0H A;  4UHP B;  3NY7 B;  3G28 A;  1GXH A;  2KOS A;  2L6E A;  2K0D X;  2LPK A;  2LL8 A;  2FVA A;  5EJD A;  4XFZ A;  2KG6 A;  4F37 A;  1AUM A;  3B5I A;  3DS5 A;  2PEJ A;  5HGN A;  2PEO A;  3CXC O;  4COP A;  1RNI A;  2MY5 A;  7CEI A;  2KOQ A;  5KP6 B;  3LRY A;  3EJB A;  2CWO A;  2Z45 A;  4M0I A;  2JQ4 A;  1K73 Q;  2GZE A;  1K8A Q;  2QEX P;  2Z44 A;  1EIA A;  1S72 P;  5HV8 A;  2KGA A;  3VRL C;  2N50 A;  2L4B A;  2E1M A;  4R0M A;  1D1D A;  2JBG A;  4CA3 A;  3G0V A;  3OW2 O;  3RG6 C;  1M6E X;  2K0X A;  4BPF A;  2GZG A;  2LOL A;  4BPG A;  4U0D A;  2K0Y A;  2VLQ A;  3EJE A;  5DCK A;  2LF4 A;  2M8P A;  2XT1 A;  2JYL A;  2Z46 A;  1VQO P;  1NQ4 A;  2KGE A;  2MF4 A;  1RO0 A;  4BPH A;  2VLP A;  2JYG A;  2KG9 A;  2VSQ A;  2JGP A;  2WPT A;  5BS2 A;  2DGY A;  1YJN P;  2X2B A;  2EIA A;  3G71 P;  3CCE P;  1YIJ P;  5EW5 E;  1KQS O;  2EHS A;  2FVE A;  1VQP P;  1M6N A;  2LIU A;  3DS4 A;  2PEQ A;  3WBH A;  2KGC A;  2N98 A;  2L22 A;  1IMP A;  2XV6 A;  3M1M A;  2MD9 A;  3H47 A;  1ACP A;  1VQN P;  1MZ8 A;  3CCM P;  4XFY A;  3G1I A;  3DS0 A;  5F2K A;  5KP7 B;  2XZ0 D;  4H2W C;  2JB0 A;  2KWL A;  1VQL P;  2PEI A;  2KG8 A;  3RG2 A;  1QVG O;  1RO2 A;  2GZJ A;  1VQ4 P;  1L0H A;  3DS2 A;  2FAC A;  3G26 A;  4QKO A;  1DV5 A;  5HGL A;  5BS1 A;  1CEI A;  4COC A;  2EFJ A;  1L0I A;  4XFX A;  1GXG A;  2N6Y A;  3DTJ A;  3EJD A;  3DPH A;  2ONT A;  5CZD B;  1W2B O;  3H0D A;  3CE7 A;  2PEN A;  2JAZ A;  1F80 D;  3GZM A;  1K9M Q;  5KP8 B;  4GR2 A;  2KW2 A;  2FQ0 A;  3GZL A;  2BHV A;  1IMQ A;  2OTL P;  2AF8 A;  1VQ7 P;  2VLN A;  5HGM A;  3U43 A;  2GDY A;  3LMO A;  3CMA P;  1VKU A;  4HKG A;  3NTE A;  2XXM A;  4WYM A;  1IUQ A;  2KGD A;  1BXI A;  2OTJ P;  2K2Q A;  2FAE A;  1VQ8 P;  2FVF A;  1VQK P;  4IPY A;  2QA4 P;  4U0C A;  4IZ6 A;  2KOP A;  2L0Q A;  1T8K A;  2FAD A;  2QNW A;  3I56 P;  2VLO A;  3HZQ A;  1YHQ P;  1UJZ A;  2K93 A;  2JU2 A;  4PWV B;  2KOR A;  2LKI A; 
#chains in the Genus database with same CATH homology
 2CWO A;  2Z45 A;  4M0I A;  2PEM A;  3CCS P;  2P9X A;  3G1G A;  1VQL P;  1K30 A;  2PEI A;  5F2O A;  1K73 Q;  1QVG O;  1RO2 A;  3MGE A;  1K8A Q;  2QEX P;  1VQM P;  2Z44 A;  1VQ4 P;  1EIA A;  1S72 P;  1JJ2 O;  3DS2 A;  3G26 A;  3DS3 A;  5HGL A;  3VRL C;  2KOD A;  1BAJ A;  4COC A;  2M8L A;  5BS1 A;  3CPW O;  3CCJ P;  1A43 A;  2EFJ A;  2JO0 A;  4XRQ A;  3I55 P;  4XFX A;  3G6E P;  2M8N A;  2E1M A;  3DTJ A;  3G4S P;  1D1D A;  3DPH A;  3G0V A;  1M1K Q;  3OW2 O;  2ONT A;  4U0A A;  3CC2 P;  3RG6 C;  1M6E X;  1W2B O;  3H0D A;  4PH1 A;  3CCQ P;  1Q86 Q;  1YJW P;  4U0B A;  4U0F A;  1VQ6 P;  1YJ9 P;  2PEN A;  1M74 A;  1Q82 Q;  4PH0 A;  3CCV P;  4U0D A;  3DS1 A;  1K9M Q;  4GR2 A;  5F2N A;  1QVF O;  1Q81 Q;  3Q20 A;  3CC4 P;  5DCK A;  1M90 Q;  2PEK A;  4XRO A;  2LF4 A;  2M8P A;  2PY8 A;  2BHV A;  2XT1 A;  2JYL A;  2Z46 A;  1VQO P;  4QNB A;  3CCR P;  1YI2 P;  1NJI Q;  2OTL P;  1RO0 A;  1VQ7 P;  3CCU P;  5HGM A;  3CC7 P;  3P05 A;  2JYG A;  2OAR A;  3G21 A;  5JPA A;  2BUO A;  3CMA P;  3CME P;  5BS2 A;  2DGY A;  2EG5 A;  1YJN P;  2EIA A;  3NTE A;  4GR6 A;  3G71 P;  2XXM A;  3CCE P;  1YIJ P;  4WYM A;  5HGO A;  1IUQ A;  1A8O A;  1KQS O;  5I4T G;  2OTJ P;  3H4E A;  1VQ5 P;  1KD1 Q;  1QRJ A;  1N8R Q;  1VQP P;  1M6N A;  1VQ8 P;  3DS4 A;  3G28 A;  1E6J P;  2PEQ A;  3WBH A;  1VQK P;  2XV6 A;  3M1M A;  2L6E A;  4IPY A;  2QA4 P;  1YIT P;  1Q7Y Q;  3H47 A;  3HYB A;  4U0C A;  4XFZ A;  1KC8 Q;  1AUM A;  3B5I A;  3E2D A;  1VQN P;  3DS5 A;  2PEJ A;  5HGN A;  3I56 P;  3CCM P;  3CCL P;  2PEO A;  3HZQ A;  4XFY A;  3CXC O;  3G1I A;  4COP A;  1YHQ P;  3CD6 P;  1RNI A;  3DS0 A;  1VQ9 P;  1EOQ A;  4U0E A;  3LRY A;  5F2K A;  1ZMB A;  3G29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...