3DS1A

Hiv-1 capsid c-terminal domain mutant (e187a) in complex with an inhibitor of particle assembly (cai)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTATLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
total genus 29
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds1A00
2JYLA 2JO0A 2BUOA 5DCKA 3P05A 1AUMA 2EIAA 2XXMA 3DS2A 4PH1A 4XFYA 5I4TG 3H4EA 2XV6A 3G1GA 3G0VA 2JYGA 3DPHA 3G21A 3H47A 4U0BA 4U0CA 4XRQA 3DS0A 5HGLA 1EOQA 2XT1A 3LRYA 4XROA 4U0DA 2L6EA 2LF4A 3VRLC 1A8OA 1EIAA 3G1IA 5HGMA 4COCA 4U0EA 4XFXA 1BAJA 4U0FA 2KODA 1D1DA 5JPAA 3DS3A 3NTEA 4WYMA 2M8LA 4PH0A 4M0IA 3DTJA 2M8NA 4QNBA 4COPA 3G26A 2M8PA 2ONTA 4IPYA 3DS1A 3G29A 1A43A 5HGNA 5HGOA 4XFZA 3G28A 4U0AA 3DS5A 3MGEA 1QRJA 1E6JP 3DS4A
chains in the Genus database with same CATH superfamily
5BS2A 1K9MQ 2EFJA 3G0VA 4XRQA 1OR5A 1Z6MA 2N6ZA 2PNGA 3LRYA 3CC2P 2BHVA 1Q7YQ 4U0EA 2PEOA 3CCMP 1ZMBA 2EHTA 2PEKA 1K73Q 4IZ6A 3DTJA 1VQKP 1YJ9P 1A43A 2PEMA 3GKLC 2XZ0D 3OW2O 1UNKA 2VLNA 2K93A 4H2XC 2FQ1A 4PH0A 3CCVP 2JBGA 1IMPA 1Q81Q 3DS4A 2E1MA 2L22A 2Z46A 5I4TG 2FAEA 4H2WC 3EJEA 3G21A 4GR6A 2Z45A 3GZLA 2X2BA 2K5XA 2LIWA 4QKOA 2DGYA 1KQSO 1M74A 5F2KA 4COPA 2KOPA 5F2OA 2N6YA 4F37A 1VQ6P 2K0DX 4GR2A 3LMOA 2JYLA 1YIJP 1VKUA 1EOQA 2VLPA 2EHSA 3CMEP 2JB0A 5EJDA 3CCRP 4WYMA 2EG5A 2GZJA 1M6EX 4DG9A 3EJBA 4BPGA 4BPHA 2KWLA 1VQPP 1VQMP 2JGPA 3DPHA 5HGLA 1FR2A 2XT1A 1MZ8A 4BPFA 2L4BA 2KW2A 3NTEA 3HZQA 1VQNP 1L0HA 1W2BO 2PEQA 3CC4P 2JAZA 3G71P 2VLOA 2K0YA 2CG5B 1AYIA 5KP8B 1S72P 1NJIQ 2DNWA 2M5RA 2PEJA 2N5HA 1NQ4A 1BAJA 2L0QA 1IUQA 2QEXP 2MVVA 2LKIA 4IPYA 2KORA 5EW5E 2PY8A 2K2QA 4UHPB 3P05A 2EIAA 2PENA 2N5IA 3H0DA 1KD1Q 1YITP 1ACPA 4U0BA 5BS1A 4HKGA 3CCEP 1DNYA 4XROA 2JQ4A 2KGCA 1Q82Q 4PXHB 2AFDA 1Q86Q 2KGAA 2M8LA 1VQLP 3G6EP 2BUOA 2CNRA 5DCKA 5HVCA 2FVFA 3M1MA 3CCJP 3CC7P 1YJWP 1BXIA 2JYGA 2MY5A 3DS0A 1KC8Q 2GZEA 1KLPA 1M90Q 2LMLA 1VQOP 1YJNP 2KG6A 2ONTA 4U0AA 2JO0A 3EJDA 1IMQA 1UJZA 2LPKA 3NY7B 3G4SP 3H4EA 1X3OA 1HQBA 1JJ2O 1A8OA 5HGMA 4U0FA 3CXCO 2KGEA 2QA4P 1K30A 7CEIA 2OTJP 5HGNA 3DS5A 1M1KQ 1CEIA 3CE7A 2AF8A 2N98A 2KG9A 2K0XA 2GZIA 2KOSA 2FACA 1YI2P 3I55P 2LTEA 4XFXA 2P9XA 1GXGA 2KODA 2K94A 1HY8A 2GDXA 2N50A 3MGEA 3HYBA 4NEOA 2XXMA 2AVAA 4XFYA 5CZDB 2OARA 3CMAP 2FADA 1EIAA 2ERHA 3GJNA 2FQ0A 2LIUA 1N8RQ 3DS3A 3U43A 1VQ4P 4H2YC 2KOOA 2GZGA 4XFZA 1QRJA 1VQ5P 1AUMA 2MR8A 2CQ8A 2XV6A 3G1GA 4U0CA 3VRLC 2L6EA 1GXHA 2MF4A 3CCSP 5KP6B 1ZNVA 2ROQA 2GZFA 3G26A 1YHQP 3RG2A 2FQ2A 5HGOA 2GDYA 2LOLA 2FHSC 5F2NA 4PH1A 2NO8A 3WBHA 3G1IA 3B4QA 1QVGO 2CWOA 1VQ9P 2M8PA 3G29A 1EMVA 4MRTC 2GDWA 3G28A 2QNWA 1E6JP 1T8KA 2CGQA 3DS2A 5KP7B 3CPWO 3RG6C 1E0HA 3H47A 2XZ1C 2KR5A 3Q20A 1VQ8P 2KGDA 2KOQA 3CCUP 2GYKA 2OTLP 4M0IA 2FVAA 3CCLP 2VSQA 3B5IA 2VLQA 1RO0A 2MD9A 2LL8A 2AFEA 2Z44A 1VHNA 1M6NA 2KG8A 3CD6P 3I56P 2FVEA 1AF8A 2K92A 2MVUA 4QNBA 2M8NA 5HV8A 4R0MA 1VQ7P 1RO2A 1GPJA 2PEIA 4U0DA 2LF4A 4COCA 1DV5A 2L9FA 4CA3A 2MR7A 2WPTA 1D1DA 5JPAA 3E2DA 2JU1A 2JU2A 1QVFO 1RNIA 3DS1A 1L0IA 3GZMA 1K8AQ 1F80D 4PWVB 3CCQP
chains in the Genus database with same CATH topology
2JO0A 5BS2A 5F2NA 1K9MQ 2EFJA 4PH1A 3G4SP 3H4EA 3G0VA 3DPHA 5HGLA 4XRQA 3WBHA 2XT1A 3LRYA 1JJ2O 3CC2P 2BHVA 1A8OA 5HGMA 3G1IA 1Q7YQ 4U0EA 2PEOA 3CCMP 1ZMBA 4U0FA 3CXCO 2PEKA 3NTEA 1K73Q 1QVGO 2QA4P 1K30A 2CWOA 3HZQA 1VQNP 2OTJP 1VQ9P 3DTJA 1W2BO 1VQKP 2PEQA 2M8PA 1YJ9P 3G29A 1A43A 2PEMA 5HGNA 3CC4P 3G28A 3DS5A 3G71P 1M1KQ 1E6JP 3DS2A 3OW2O 3CPWO 3RG6C 3H47A 1S72P 1NJIQ 3Q20A 1YI2P 1VQ8P 3I55P 2PEJA 3CCUP 4XFXA 2P9XA 1BAJA 2KODA 4PH0A 1IUQA 2OTLP 2QEXP 4M0IA 3CCVP 4IPYA 1Q81Q 3CCLP 3MGEA 2PY8A 3DS4A 3HYBA 2E1MA 3P05A 2EIAA 2PENA 2XXMA 2Z46A 4XFYA 5I4TG 3B5IA 3H0DA 1KD1Q 1YITP 3G21A 1RO0A 4U0BA 5BS1A 3CCEP 2OARA 4GR6A 2Z44A 2Z45A 4XROA 3CMAP 1EIAA 1M6NA 1Q82Q 1N8RQ 3CD6P 3I56P 3DS3A 2DGYA 1KQSO 1Q86Q 2M8LA 1M74A 1VQ4P 5F2KA 4QNBA 2M8NA 4COPA 5F2OA 1VQ6P 1VQLP 4XFZA 3G6EP 4GR2A 1QRJA 1VQ5P 2JYLA 2BUOA 1YIJP 5DCKA 3M1MA 1AUMA 3CCJP 1VQ7P 3CC7P 1RO2A 2XV6A 3G1GA 1YJWP 2JYGA 4U0CA 3DS0A 1KC8Q 1EOQA 3VRLC 2PEIA 2L6EA 2LF4A 4U0DA 4COCA 3CMEP 3CCSP 1D1DA 5JPAA 3CCRP 4WYMA 2EG5A 3E2DA 1M90Q 1M6EX 3G26A 1YHQP 1RNIA 2ONTA 1VQOP 3DS1A 5HGOA 1YJNP 1QVFO 1K8AQ 4U0AA 3CCQP 1VQPP 1VQMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYL A;  2JO0 A;  2BUO A;  5DCK A;  3P05 A;  1AUM A;  2EIA A;  2XXM A;  3DS2 A;  4PH1 A;  4XFY A;  5I4T G;  3H4E A;  2XV6 A;  3G1G A;  3G0V A;  2JYG A;  3DPH A;  3G21 A;  3H47 A;  4U0B A;  4U0C A;  4XRQ A;  3DS0 A;  5HGL A;  1EOQ A;  2XT1 A;  3LRY A;  4XRO A;  4U0D A;  2L6E A;  2LF4 A;  3VRL C;  1A8O A;  1EIA A;  3G1I A;  5HGM A;  4COC A;  4U0E A;  4XFX A;  1BAJ A;  4U0F A;  2KOD A;  1D1D A;  5JPA A;  3DS3 A;  3NTE A;  4WYM A;  2M8L A;  4PH0 A;  4M0I A;  3DTJ A;  2M8N A;  4QNB A;  4COP A;  3G26 A;  2M8P A;  2ONT A;  4IPY A;  3DS1 A;  3G29 A;  1A43 A;  5HGN A;  5HGO A;  4XFZ A;  3G28 A;  4U0A A;  3DS5 A;  3MGE A;  1QRJ A;  1E6J P;  3DS4 A; 
#chains in the Genus database with same CATH topology
 5BS2 A;  1K9M Q;  2EFJ A;  3G0V A;  4XRQ A;  1OR5 A;  1Z6M A;  2N6Z A;  2PNG A;  3LRY A;  3CC2 P;  2BHV A;  1Q7Y Q;  4U0E A;  2PEO A;  3CCM P;  1ZMB A;  2EHT A;  2PEK A;  1K73 Q;  4IZ6 A;  3DTJ A;  1VQK P;  1YJ9 P;  1A43 A;  2PEM A;  3GKL C;  2XZ0 D;  3OW2 O;  1UNK A;  2VLN A;  2K93 A;  4H2X C;  2FQ1 A;  4PH0 A;  3CCV P;  2JBG A;  1IMP A;  1Q81 Q;  3DS4 A;  2E1M A;  2L22 A;  2Z46 A;  5I4T G;  2FAE A;  4H2W C;  3EJE A;  3G21 A;  4GR6 A;  2Z45 A;  3GZL A;  2X2B A;  2K5X A;  2LIW A;  4QKO A;  2DGY A;  1KQS O;  1M74 A;  5F2K A;  4COP A;  2KOP A;  5F2O A;  2N6Y A;  4F37 A;  1VQ6 P;  2K0D X;  4GR2 A;  3LMO A;  2JYL A;  1YIJ P;  1VKU A;  1EOQ A;  2VLP A;  2EHS A;  3CME P;  2JB0 A;  5EJD A;  3CCR P;  4WYM A;  2EG5 A;  2GZJ A;  1M6E X;  4DG9 A;  3EJB A;  4BPG A;  4BPH A;  2KWL A;  1VQP P;  1VQM P;  2JGP A;  3DPH A;  5HGL A;  1FR2 A;  2XT1 A;  1MZ8 A;  4BPF A;  2L4B A;  2KW2 A;  3NTE A;  3HZQ A;  1VQN P;  1L0H A;  1W2B O;  2PEQ A;  3CC4 P;  2JAZ A;  3G71 P;  2VLO A;  2K0Y A;  2CG5 B;  1AYI A;  5KP8 B;  1S72 P;  1NJI Q;  2DNW A;  2M5R A;  2PEJ A;  2N5H A;  1NQ4 A;  1BAJ A;  2L0Q A;  1IUQ A;  2QEX P;  2MVV A;  2LKI A;  4IPY A;  2KOR A;  5EW5 E;  2PY8 A;  2K2Q A;  4UHP B;  3P05 A;  2EIA A;  2PEN A;  2N5I A;  3H0D A;  1KD1 Q;  1YIT P;  1ACP A;  4U0B A;  5BS1 A;  4HKG A;  3CCE P;  1DNY A;  4XRO A;  2JQ4 A;  2KGC A;  1Q82 Q;  4PXH B;  2AFD A;  1Q86 Q;  2KGA A;  2M8L A;  1VQL P;  3G6E P;  2BUO A;  2CNR A;  5DCK A;  5HVC A;  2FVF A;  3M1M A;  3CCJ P;  3CC7 P;  1YJW P;  1BXI A;  2JYG A;  2MY5 A;  3DS0 A;  1KC8 Q;  2GZE A;  1KLP A;  1M90 Q;  2LML A;  1VQO P;  1YJN P;  2KG6 A;  2ONT A;  4U0A A;  2JO0 A;  3EJD A;  1IMQ A;  1UJZ A;  2LPK A;  3NY7 B;  3G4S P;  3H4E A;  1X3O A;  1HQB A;  1JJ2 O;  1A8O A;  5HGM A;  4U0F A;  3CXC O;  2KGE A;  2QA4 P;  1K30 A;  7CEI A;  2OTJ P;  5HGN A;  3DS5 A;  1M1K Q;  1CEI A;  3CE7 A;  2AF8 A;  2N98 A;  2KG9 A;  2K0X A;  2GZI A;  2KOS A;  2FAC A;  1YI2 P;  3I55 P;  2LTE A;  4XFX A;  2P9X A;  1GXG A;  2KOD A;  2K94 A;  1HY8 A;  2GDX A;  2N50 A;  3MGE A;  3HYB A;  4NEO A;  2XXM A;  2AVA A;  4XFY A;  5CZD B;  2OAR A;  3CMA P;  2FAD A;  1EIA A;  2ERH A;  3GJN A;  2FQ0 A;  2LIU A;  1N8R Q;  3DS3 A;  3U43 A;  1VQ4 P;  4H2Y C;  2KOO A;  2GZG A;  4XFZ A;  1QRJ A;  1VQ5 P;  1AUM A;  2MR8 A;  2CQ8 A;  2XV6 A;  3G1G A;  4U0C A;  3VRL C;  2L6E A;  1GXH A;  2MF4 A;  3CCS P;  5KP6 B;  1ZNV A;  2ROQ A;  2GZF A;  3G26 A;  1YHQ P;  3RG2 A;  2FQ2 A;  5HGO A;  2GDY A;  2LOL A;  2FHS C;  5F2N A;  4PH1 A;  2NO8 A;  3WBH A;  3G1I A;  3B4Q A;  1QVG O;  2CWO A;  1VQ9 P;  2M8P A;  3G29 A;  1EMV A;  4MRT C;  2GDW A;  3G28 A;  2QNW A;  1E6J P;  1T8K A;  2CGQ A;  3DS2 A;  5KP7 B;  3CPW O;  3RG6 C;  1E0H A;  3H47 A;  2XZ1 C;  2KR5 A;  3Q20 A;  1VQ8 P;  2KGD A;  2KOQ A;  3CCU P;  2GYK A;  2OTL P;  4M0I A;  2FVA A;  3CCL P;  2VSQ A;  3B5I A;  2VLQ A;  1RO0 A;  2MD9 A;  2LL8 A;  2AFE A;  2Z44 A;  1VHN A;  1M6N A;  2KG8 A;  3CD6 P;  3I56 P;  2FVE A;  1AF8 A;  2K92 A;  2MVU A;  4QNB A;  2M8N A;  5HV8 A;  4R0M A;  1VQ7 P;  1RO2 A;  1GPJ A;  2PEI A;  4U0D A;  2LF4 A;  4COC A;  1DV5 A;  2L9F A;  4CA3 A;  2MR7 A;  2WPT A;  1D1D A;  5JPA A;  3E2D A;  2JU1 A;  2JU2 A;  1QVF O;  1RNI A;  3DS1 A;  1L0I A;  3GZM A;  1K8A Q;  1F80 D;  4PWV B;  3CCQ P; 
#chains in the Genus database with same CATH homology
 2JO0 A;  5BS2 A;  5F2N A;  1K9M Q;  2EFJ A;  4PH1 A;  3G4S P;  3H4E A;  3G0V A;  3DPH A;  5HGL A;  4XRQ A;  3WBH A;  2XT1 A;  3LRY A;  1JJ2 O;  3CC2 P;  2BHV A;  1A8O A;  5HGM A;  3G1I A;  1Q7Y Q;  4U0E A;  2PEO A;  3CCM P;  1ZMB A;  4U0F A;  3CXC O;  2PEK A;  3NTE A;  1K73 Q;  1QVG O;  2QA4 P;  1K30 A;  2CWO A;  3HZQ A;  1VQN P;  2OTJ P;  1VQ9 P;  3DTJ A;  1W2B O;  1VQK P;  2PEQ A;  2M8P A;  1YJ9 P;  3G29 A;  1A43 A;  2PEM A;  5HGN A;  3CC4 P;  3G28 A;  3DS5 A;  3G71 P;  1M1K Q;  1E6J P;  3DS2 A;  3OW2 O;  3CPW O;  3RG6 C;  3H47 A;  1S72 P;  1NJI Q;  3Q20 A;  1YI2 P;  1VQ8 P;  3I55 P;  2PEJ A;  3CCU P;  4XFX A;  2P9X A;  1BAJ A;  2KOD A;  4PH0 A;  1IUQ A;  2OTL P;  2QEX P;  4M0I A;  3CCV P;  4IPY A;  1Q81 Q;  3CCL P;  3MGE A;  2PY8 A;  3DS4 A;  3HYB A;  2E1M A;  3P05 A;  2EIA A;  2PEN A;  2XXM A;  2Z46 A;  4XFY A;  5I4T G;  3B5I A;  3H0D A;  1KD1 Q;  1YIT P;  3G21 A;  1RO0 A;  4U0B A;  5BS1 A;  3CCE P;  2OAR A;  4GR6 A;  2Z44 A;  2Z45 A;  4XRO A;  3CMA P;  1EIA A;  1M6N A;  1Q82 Q;  1N8R Q;  3CD6 P;  3I56 P;  3DS3 A;  2DGY A;  1KQS O;  1Q86 Q;  2M8L A;  1M74 A;  1VQ4 P;  5F2K A;  4QNB A;  2M8N A;  4COP A;  5F2O A;  1VQ6 P;  1VQL P;  4XFZ A;  3G6E P;  4GR2 A;  1QRJ A;  1VQ5 P;  2JYL A;  2BUO A;  1YIJ P;  5DCK A;  3M1M A;  1AUM A;  3CCJ P;  1VQ7 P;  3CC7 P;  1RO2 A;  2XV6 A;  3G1G A;  1YJW P;  2JYG A;  4U0C A;  3DS0 A;  1KC8 Q;  1EOQ A;  3VRL C;  2PEI A;  2L6E A;  2LF4 A;  4U0D A;  4COC A;  3CME P;  3CCS P;  1D1D A;  5JPA A;  3CCR P;  4WYM A;  2EG5 A;  3E2D A;  1M90 Q;  1M6E X;  3G26 A;  1YHQ P;  1RNI A;  2ONT A;  1VQO P;  3DS1 A;  5HGO A;  1YJN P;  1QVF O;  1K8A Q;  4U0A A;  3CCQ P;  1VQP P;  1VQM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...