3DS4A

Hiv-1 capsid c-terminal domain mutant (l211s) in complex with an inhibitor of particle assembly (cai)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
76
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 29
structure length 76
sequence length 77
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds4A00
5JPAA 4U0DA 2XXMA 4U0FA 2M8PA 2KODA 3G29A 3VRLC 3MGEA 3G1IA 4U0CA 4U0BA 2M8NA 4XFZA 2JO0A 1A43A 4U0AA 3H4EA 2L6EA 3LRYA 3NTEA 4WYMA 4XFYA 5DCKA 4U0EA 1BAJA 1E6JP 1AUMA 3DS0A 3G21A 2LF4A 2XV6A 4XROA 2M8LA 4PH0A 4XFXA 3DTJA 2EIAA 3DS4A 3DS1A 4IPYA 4PH1A 5HGMA 5HGNA 3DS5A 5I4TG 2ONTA 4XRQA 2XT1A 1EIAA 3G0VA 4COCA 4M0IA 3DS3A 1D1DA 5HGLA 3G1GA 5HGOA 4QNBA 4COPA 1EOQA 3H47A 1QRJA 2BUOA 3G28A 3G26A 3DS2A 3P05A 2JYGA 1A8OA 2JYLA 3DPHA
chains in the Genus database with same CATH superfamily
1RNIA 4H2YC 3CC4P 4BPFA 5HGOA 2M5RA 2FQ2A 2N6ZA 4XFYA 4MRTC 5HVCA 2VLNA 2N98A 3HZQA 4XFXA 5HGNA 1ZMBA 2GDYA 2KOQA 5HGLA 2XZ1C 2CG5B 2JYGA 1FR2A 2CNRA 3G29A 2JB0A 2Z45A 3CCSP 1RO0A 5CZDB 2LF4A 3CMEP 3B4QA 1CEIA 3DTJA 5BS1A 1Q82Q 2GZJA 4XRQA 2VSQA 3CCUP 2LPKA 1VQ9P 5F2KA 2OARA 3P05A 1YI2P 3CCEP 1K8AQ 2JGPA 4BPHA 3RG6C 2KG8A 2KGEA 2M8NA 1KQSO 2Z46A 1GXGA 2LIWA 2VLOA 3WBHA 4COCA 4UHPB 2JYLA 3CE7A 2MD9A 2FVEA 2L0QA 4IZ6A 2L22A 2EHTA 1M6EX 2FQ0A 2L4BA 4U0EA 2MVUA 3G21A 1VQOP 3CCQP 1YJNP 2CQ8A 1HY8A 2ONTA 1D1DA 2GZFA 2EG5A 1OR5A 1KD1Q 4COPA 2QNWA 2EHSA 1EMVA 1Q86Q 4DG9A 4H2XC 2KODA 2L9FA 4WYMA 3LRYA 5EW5E 3M1MA 3CCVP 1L0HA 1ACPA 4PXHB 5I4TG 4HKGA 1YHQP 1VQ6P 3G26A 3G28A 3DPHA 3CCJP 2VLQA 2FVAA 4U0FA 2AFEA 1IMPA 2JQ4A 4H2WC 4U0AA 2P9XA 2MR7A 1M74A 3CD6P 2K93A 7CEIA 1K30A 1YIJP 2MVVA 5BS2A 1M1KQ 2BUOA 2GDXA 2FQ1A 5JPAA 3GZLA 3VRLC 2WPTA 3OW2O 1A43A 5KP7B 2K0YA 1UJZA 4PH0A 2EIAA 1DV5A 3DS1A 5EJDA 1VQ4P 4M0IA 4QNBA 2OTJP 1Z6MA 3CCLP 1RO2A 1VQPP 2GZEA 2KGAA 3G6EP 2KR5A 2DGYA 4BPGA 2AVAA 3G1IA 5DCKA 2KW2A 2K5XA 5F2OA 1T8KA 4GR6A 2PEJA 1MZ8A 2KGCA 2K2QA 2LIUA 2FAEA 1DNYA 1VQMP 3MGEA 1BXIA 2LKIA 1Q7YQ 4U0CA 2KOOA 1M6NA 2M8LA 1F80D 3DS3A 1IUQA 2LMLA 3LMOA 2FACA 1X3OA 3CCRP 1QVFO 1K9MQ 1UNKA 4U0BA 2JU1A 3GKLC 3H4EA 1YITP 2PY8A 2DNWA 1IMQA 5KP8B 1S72P 2N6YA 4IPYA 2MR8A 2X2BA 2GZIA 1NJIQ 1L0IA 1AF8A 2GDWA 2VLPA 2K94A 2JU2A 2FHSC 3H0DA 4CA3A 5HGMA 3CMAP 1VHNA 1QVGO 1EOQA 3H47A 3CCMP 3I55P 1VQ5P 3EJEA 1W2BO 2KG9A 2CWOA 1YJWP 3U43A 1E0HA 3NTEA 2MF4A 2KGDA 3E2DA 4PH1A 2LTEA 3I56P 1HQBA 1K73Q 2PEQA 4R0MA 2AF8A 2ERHA 3DS2A 1JJ2O 2KORA 4XFZA 2KOSA 5KP6B 3B5IA 3DS0A 1VQLP 1VQ8P 1KLPA 3HYBA 2FADA 3G1GA 1VQ7P 1VKUA 5HV8A 3EJDA 2GZGA 3EJBA 2PENA 4U0DA 1Q81Q 2FVFA 3G71P 2PEKA 1KC8Q 1N8RQ 4NEOA 2NO8A 1BAJA 1AUMA 2N50A 2KWLA 3DS5A 3Q20A 1GXHA 3GZMA 2XT1A 3CPWO 1QRJA 1YJ9P 2OTLP 2AFDA 1A8OA 2QA4P 4PWVB 1VQKP 2KG6A 1AYIA 2JAZA 2N5HA 1NQ4A 3CXCO 2K0XA 2PEIA 2XZ0D 2Z44A 1VQNP 3GJNA 1ZNVA 2XV6A 2LOLA 1EIAA 3G0VA 5F2NA 4F37A 2PNGA 2K0DX 2E1MA 2KOPA 2QEXP 2EFJA 2XXMA 4QKOA 2M8PA 2ROQA 3RG2A 1GPJA 2BHVA 1M90Q 2JO0A 2L6EA 2LL8A 2MY5A 2K92A 1E6JP 2PEOA 4XROA 3DS4A 2GYKA 2PEMA 4GR2A 3CC7P 3NY7B 3CC2P 2CGQA 2JBGA 3G4SP 2N5IA
chains in the Genus database with same CATH topology
1RNIA 2KODA 1VQMP 3MGEA 1Q7YQ 4U0CA 3CC4P 4XFZA 5HGOA 4WYMA 1M6NA 3LRYA 4XFYA 3M1MA 3CCVP 2M8LA 3B5IA 3DS0A 3HZQA 1VQLP 4XFXA 1VQ8P 5HGNA 1ZMBA 5I4TG 1YHQP 3HYBA 3DS3A 5HGLA 3G1GA 1VQ7P 1IUQA 1VQ6P 3CCRP 3G26A 3G28A 2JYGA 1QVFO 3DPHA 3CCJP 1K9MQ 1Q81Q 2PENA 4U0DA 3G71P 4U0FA 3G29A 2PEKA 4U0BA 2Z45A 3CCSP 1KC8Q 4U0AA 1N8RQ 2P9XA 3H4EA 1YITP 2PY8A 1RO0A 1BAJA 1AUMA 1S72P 2LF4A 3CMEP 5BS1A 3DTJA 4IPYA 1M74A 3DS5A 3Q20A 3CD6P 1Q82Q 4XRQA 2XT1A 1NJIQ 3CCUP 1K30A 1YIJP 3CPWO 1QRJA 1VQ9P 1YJ9P 5BS2A 1M1KQ 2BUOA 5F2KA 2OARA 3P05A 1YI2P 2OTLP 1A8OA 2QA4P 3CCEP 1VQKP 5JPAA 1K8AQ 3RG6C 3VRLC 2M8NA 3OW2O 1A43A 3CXCO 1KQSO 2Z46A 2PEIA 2Z44A 3H0DA 1VQNP 4PH0A 2XV6A 5HGMA 2EIAA 3DS1A 3WBHA 1VQ4P 3CMAP 1EIAA 3G0VA 4COCA 4M0IA 5F2NA 4QNBA 1QVGO 1EOQA 3H47A 2OTJP 3CCMP 2E1MA 3I55P 3CCLP 1RO2A 1VQPP 1VQ5P 2QEXP 2JYLA 3G6EP 2EFJA 1W2BO 2DGYA 2CWOA 2XXMA 1YJWP 2M8PA 3G1IA 2BHVA 1M90Q 2JO0A 3NTEA 2L6EA 5DCKA 1M6EX 4U0EA 1E6JP 3G21A 2PEOA 4XROA 1VQOP 3CCQP 1YJNP 5F2OA 3DS4A 3E2DA 4PH1A 2ONTA 3I56P 1K73Q 2PEMA 2PEQA 1D1DA 4GR2A 2EG5A 3CC7P 1KD1Q 4COPA 4GR6A 2PEJA 3CC2P 3G4SP 3DS2A 1JJ2O 1Q86Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  4U0D A;  2XXM A;  4U0F A;  2M8P A;  2KOD A;  3G29 A;  3VRL C;  3MGE A;  3G1I A;  4U0C A;  4U0B A;  2M8N A;  4XFZ A;  2JO0 A;  1A43 A;  4U0A A;  3H4E A;  2L6E A;  3LRY A;  3NTE A;  4WYM A;  4XFY A;  5DCK A;  4U0E A;  1BAJ A;  1E6J P;  1AUM A;  3DS0 A;  3G21 A;  2LF4 A;  2XV6 A;  4XRO A;  2M8L A;  4PH0 A;  4XFX A;  3DTJ A;  2EIA A;  3DS4 A;  3DS1 A;  4IPY A;  4PH1 A;  5HGM A;  5HGN A;  3DS5 A;  5I4T G;  2ONT A;  4XRQ A;  2XT1 A;  1EIA A;  3G0V A;  4COC A;  4M0I A;  3DS3 A;  1D1D A;  5HGL A;  3G1G A;  5HGO A;  4QNB A;  4COP A;  1EOQ A;  3H47 A;  1QRJ A;  2BUO A;  3G28 A;  3G26 A;  3DS2 A;  3P05 A;  2JYG A;  1A8O A;  2JYL A;  3DPH A; 
#chains in the Genus database with same CATH topology
 1RNI A;  4H2Y C;  3CC4 P;  4BPF A;  5HGO A;  2M5R A;  2FQ2 A;  2N6Z A;  4XFY A;  4MRT C;  5HVC A;  2VLN A;  2N98 A;  3HZQ A;  4XFX A;  5HGN A;  1ZMB A;  2GDY A;  2KOQ A;  5HGL A;  2XZ1 C;  2CG5 B;  2JYG A;  1FR2 A;  2CNR A;  3G29 A;  2JB0 A;  2Z45 A;  3CCS P;  1RO0 A;  5CZD B;  2LF4 A;  3CME P;  3B4Q A;  1CEI A;  3DTJ A;  5BS1 A;  1Q82 Q;  2GZJ A;  4XRQ A;  2VSQ A;  3CCU P;  2LPK A;  1VQ9 P;  5F2K A;  2OAR A;  3P05 A;  1YI2 P;  3CCE P;  1K8A Q;  2JGP A;  4BPH A;  3RG6 C;  2KG8 A;  2KGE A;  2M8N A;  1KQS O;  2Z46 A;  1GXG A;  2LIW A;  2VLO A;  3WBH A;  4COC A;  4UHP B;  2JYL A;  3CE7 A;  2MD9 A;  2FVE A;  2L0Q A;  4IZ6 A;  2L22 A;  2EHT A;  1M6E X;  2FQ0 A;  2L4B A;  4U0E A;  2MVU A;  3G21 A;  1VQO P;  3CCQ P;  1YJN P;  2CQ8 A;  1HY8 A;  2ONT A;  1D1D A;  2GZF A;  2EG5 A;  1OR5 A;  1KD1 Q;  4COP A;  2QNW A;  2EHS A;  1EMV A;  1Q86 Q;  4DG9 A;  4H2X C;  2KOD A;  2L9F A;  4WYM A;  3LRY A;  5EW5 E;  3M1M A;  3CCV P;  1L0H A;  1ACP A;  4PXH B;  5I4T G;  4HKG A;  1YHQ P;  1VQ6 P;  3G26 A;  3G28 A;  3DPH A;  3CCJ P;  2VLQ A;  2FVA A;  4U0F A;  2AFE A;  1IMP A;  2JQ4 A;  4H2W C;  4U0A A;  2P9X A;  2MR7 A;  1M74 A;  3CD6 P;  2K93 A;  7CEI A;  1K30 A;  1YIJ P;  2MVV A;  5BS2 A;  1M1K Q;  2BUO A;  2GDX A;  2FQ1 A;  5JPA A;  3GZL A;  3VRL C;  2WPT A;  3OW2 O;  1A43 A;  5KP7 B;  2K0Y A;  1UJZ A;  4PH0 A;  2EIA A;  1DV5 A;  3DS1 A;  5EJD A;  1VQ4 P;  4M0I A;  4QNB A;  2OTJ P;  1Z6M A;  3CCL P;  1RO2 A;  1VQP P;  2GZE A;  2KGA A;  3G6E P;  2KR5 A;  2DGY A;  4BPG A;  2AVA A;  3G1I A;  5DCK A;  2KW2 A;  2K5X A;  5F2O A;  1T8K A;  4GR6 A;  2PEJ A;  1MZ8 A;  2KGC A;  2K2Q A;  2LIU A;  2FAE A;  1DNY A;  1VQM P;  3MGE A;  1BXI A;  2LKI A;  1Q7Y Q;  4U0C A;  2KOO A;  1M6N A;  2M8L A;  1F80 D;  3DS3 A;  1IUQ A;  2LML A;  3LMO A;  2FAC A;  1X3O A;  3CCR P;  1QVF O;  1K9M Q;  1UNK A;  4U0B A;  2JU1 A;  3GKL C;  3H4E A;  1YIT P;  2PY8 A;  2DNW A;  1IMQ A;  5KP8 B;  1S72 P;  2N6Y A;  4IPY A;  2MR8 A;  2X2B A;  2GZI A;  1NJI Q;  1L0I A;  1AF8 A;  2GDW A;  2VLP A;  2K94 A;  2JU2 A;  2FHS C;  3H0D A;  4CA3 A;  5HGM A;  3CMA P;  1VHN A;  1QVG O;  1EOQ A;  3H47 A;  3CCM P;  3I55 P;  1VQ5 P;  3EJE A;  1W2B O;  2KG9 A;  2CWO A;  1YJW P;  3U43 A;  1E0H A;  3NTE A;  2MF4 A;  2KGD A;  3E2D A;  4PH1 A;  2LTE A;  3I56 P;  1HQB A;  1K73 Q;  2PEQ A;  4R0M A;  2AF8 A;  2ERH A;  3DS2 A;  1JJ2 O;  2KOR A;  4XFZ A;  2KOS A;  5KP6 B;  3B5I A;  3DS0 A;  1VQL P;  1VQ8 P;  1KLP A;  3HYB A;  2FAD A;  3G1G A;  1VQ7 P;  1VKU A;  5HV8 A;  3EJD A;  2GZG A;  3EJB A;  2PEN A;  4U0D A;  1Q81 Q;  2FVF A;  3G71 P;  2PEK A;  1KC8 Q;  1N8R Q;  4NEO A;  2NO8 A;  1BAJ A;  1AUM A;  2N50 A;  2KWL A;  3DS5 A;  3Q20 A;  1GXH A;  3GZM A;  2XT1 A;  3CPW O;  1QRJ A;  1YJ9 P;  2OTL P;  2AFD A;  1A8O A;  2QA4 P;  4PWV B;  1VQK P;  2KG6 A;  1AYI A;  2JAZ A;  2N5H A;  1NQ4 A;  3CXC O;  2K0X A;  2PEI A;  2XZ0 D;  2Z44 A;  1VQN P;  3GJN A;  1ZNV A;  2XV6 A;  2LOL A;  1EIA A;  3G0V A;  5F2N A;  4F37 A;  2PNG A;  2K0D X;  2E1M A;  2KOP A;  2QEX P;  2EFJ A;  2XXM A;  4QKO A;  2M8P A;  2ROQ A;  3RG2 A;  1GPJ A;  2BHV A;  1M90 Q;  2JO0 A;  2L6E A;  2LL8 A;  2MY5 A;  2K92 A;  1E6J P;  2PEO A;  4XRO A;  3DS4 A;  2GYK A;  2PEM A;  4GR2 A;  3CC7 P;  3NY7 B;  3CC2 P;  2CGQ A;  2JBG A;  3G4S P;  2N5I A; 
#chains in the Genus database with same CATH homology
 1RNI A;  2KOD A;  1VQM P;  3MGE A;  1Q7Y Q;  4U0C A;  3CC4 P;  4XFZ A;  5HGO A;  4WYM A;  1M6N A;  3LRY A;  4XFY A;  3M1M A;  3CCV P;  2M8L A;  3B5I A;  3DS0 A;  3HZQ A;  1VQL P;  4XFX A;  1VQ8 P;  5HGN A;  1ZMB A;  5I4T G;  1YHQ P;  3HYB A;  3DS3 A;  5HGL A;  3G1G A;  1VQ7 P;  1IUQ A;  1VQ6 P;  3CCR P;  3G26 A;  3G28 A;  2JYG A;  1QVF O;  3DPH A;  3CCJ P;  1K9M Q;  1Q81 Q;  2PEN A;  4U0D A;  3G71 P;  4U0F A;  3G29 A;  2PEK A;  4U0B A;  2Z45 A;  3CCS P;  1KC8 Q;  4U0A A;  1N8R Q;  2P9X A;  3H4E A;  1YIT P;  2PY8 A;  1RO0 A;  1BAJ A;  1AUM A;  1S72 P;  2LF4 A;  3CME P;  5BS1 A;  3DTJ A;  4IPY A;  1M74 A;  3DS5 A;  3Q20 A;  3CD6 P;  1Q82 Q;  4XRQ A;  2XT1 A;  1NJI Q;  3CCU P;  1K30 A;  1YIJ P;  3CPW O;  1QRJ A;  1VQ9 P;  1YJ9 P;  5BS2 A;  1M1K Q;  2BUO A;  5F2K A;  2OAR A;  3P05 A;  1YI2 P;  2OTL P;  1A8O A;  2QA4 P;  3CCE P;  1VQK P;  5JPA A;  1K8A Q;  3RG6 C;  3VRL C;  2M8N A;  3OW2 O;  1A43 A;  3CXC O;  1KQS O;  2Z46 A;  2PEI A;  2Z44 A;  3H0D A;  1VQN P;  4PH0 A;  2XV6 A;  5HGM A;  2EIA A;  3DS1 A;  3WBH A;  1VQ4 P;  3CMA P;  1EIA A;  3G0V A;  4COC A;  4M0I A;  5F2N A;  4QNB A;  1QVG O;  1EOQ A;  3H47 A;  2OTJ P;  3CCM P;  2E1M A;  3I55 P;  3CCL P;  1RO2 A;  1VQP P;  1VQ5 P;  2QEX P;  2JYL A;  3G6E P;  2EFJ A;  1W2B O;  2DGY A;  2CWO A;  2XXM A;  1YJW P;  2M8P A;  3G1I A;  2BHV A;  1M90 Q;  2JO0 A;  3NTE A;  2L6E A;  5DCK A;  1M6E X;  4U0E A;  1E6J P;  3G21 A;  2PEO A;  4XRO A;  1VQO P;  3CCQ P;  1YJN P;  5F2O A;  3DS4 A;  3E2D A;  4PH1 A;  2ONT A;  3I56 P;  1K73 Q;  2PEM A;  2PEQ A;  1D1D A;  4GR2 A;  2EG5 A;  3CC7 P;  1KD1 Q;  4COP A;  4GR6 A;  2PEJ A;  3CC2 P;  3G4S P;  3DS2 A;  1JJ2 O;  1Q86 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...