3DS8A

The crysatl structure of the gene lin2722 products from listeria innocua
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
253
structure length
253
Chain Sequence
DQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLDPNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crysatl structure of the gene lin2722 products from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin2722 protein
total genus 87
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ds8A00
3AZOA 4MJ3A 3PUHA 1R50A 2DHDA 1B6GA 3H2JA 5HFNA 5HQ3B 3G02A 1H2WA 5AK4A 4J0JA 5AI6A 3QPDA 4GBGA 4BC0A 3FSGD 1EHYA 1XZAA 2Z3WA 4Y9SA 3UMJA 3IVMA 2QRUA 1FFEA 2WFLA 1DQZA 2B4KA 4GI1A 5FV4A 2ZYRA 3I6YA 1XROA 2QJWA 1A88A 1DWPA 4HAIA 2FX5A 2WG0A 1MNAA 2XQFA 2PSHA 2IX9A 1AUOA 3CXUA 3AZPA 3OURA 1XLWA 3RM3A 3V1LA 1CUIA 2C5GA 2FJPA 4DNOA 5ALDA 2ZYHA 1Q84A 4DMFA 3O4HA 5EIEA 2X8BA 2XUPA 4X92A 1MO2A 4GDMA 1VLQA 4KE7A 5FPQA 4DIUA 2DQZA 1VXOA 1R1DA 3C70A 5CURA 3VVLA 4C4YA 3G9ZA 1VKHA 4L72A 2I3DA 4BVKA 3HZOA 1FFBA 1S8OA 3G0BA 1USWA 5LP1A 3A2MA 1N1MA 3IB3A 4RGYA 3ESAA 2PU7A 1QTRA 1JT2A 4H7FA 4G9GA 4FBMA 1LPAB 4AZ0A 1BN7A 4Y7DA 5ALSA 5K3CA 1DINA 1XQVA 5A7GA 4JUIA 5EI5A 4U2BA 2JGMA 4GXNA 5AKIA 3F98A 1NX9A 3G7NA 3QMWA 2WJ4A 3BL8A 5JASA 4ZWNA 4BAZA 4LYEA 2JGKA 1LBSA 3O9MA 5HK9A 4G4IA 2XE4A 4G4GA 1CQZA 4J3JA 3V1KA 2CJPA 1Q83A 1LPOA 3MUOA 4B81A 3WMRA 3IUQA 3W9UA 2BUCA 3ESDA 4U2DA 4TPKA 1XKTA 4J03A 4WFKA 1U65A 2XUFA 4X71A 4PV7A 1WPXA 4WY8A 2PBLA 1QE3A 4ARBA 2WLSA 3NGMA 3CCCA 1WB6A 4DTCA 1E8MA 1MU0A 2Z3ZA 3W2TA 1TK3A 2QKYA 3FLEA 4CFSA 5EFZA 3U1TA 2DQYA 2PVSA 3PFCA 5JIBA 1Y37A 2GBFA 4EBBA 5CH5A 5FOQA 4UHCA 2BFNA 4FOLA 1ZIXA 5IVDA 4OUKX 3X3HA 3RKSA 3QBJA 3D3NA 2VF2A 3DDUA 2OAGA 3HABA 1ZICA 5DYYA 2G4LA 3A70A 4UFPA 1ORVA 3C45A 4AXBA 1OCEA 5AKLA 3BE8A 3CN9A 4QDOA 2WM2A 1JJBA 5BOVA 2CZQA 4NS4A 3DS8A 3OTQA 1G4HA 4BE9A 5EHXA 2E3JA 2QM0A 4DGQA 1DWOA 2Y2UA 4FDMA 2I78A 2ACEA 4KRXA 4X6YA 5A71A 1P0QA 4FNGA 5C8VA 2C7BA 2WHPB 5CT9A 3C6BA 4HRXA 3RK4A 2FUKA 5SYMA 1H2YA 5CT4A 3N2ZB 1XKLA 1VXRA 5E4JA 5K3DA 5AM5A 4A5SA 2Y6VA 5FXMA 3O9VA 2VTVA 2HA5A 1GXSA 1ZOIA 4BYMA 4OU4A 5AM1A 1BN6A 2VAVA 3PFBA 3UUFA 2ZYSA 3WIBA 3ICWA 3WLAA 4H7JA 3C87A 3R0VA 4KJXA 3WK6A 5I8PA 1W76A 3ILSA 1QTIA 1N5RA 1E8DA 5LKRA 2XLCA 3FCYA 3H18A 3GBSA 3TRDA 3DEAA 1BRTA 4OPMA 1H2ZA 5JADA 3O4GA 4I3FA 5SYNA 2YYSA 1ORWA 1B41A 3KDAA 3PF9A 4AN0A 1QLWA 2WUEA 4L3WA 5JZ9A 2WQZA 3HEAA 2Z8XA 5C7YA 3FYTA 5CBKA 4H35A 5AM0A 4A16A 4UHEA 4P93A 2OCGA 2QUBA 2WUGA 1YB6A 4IH4A 2X76A 2XB6A 2C0PA 1ZI6A 1TQHA 1XQWA 3BF8A 2JIDA 5IH7A 4XVCA 3D4LA 2OCIA 5CT6A 2V9ZA 3P2MA 3VVMA 4MYDA 1LPSA 1EVEA 5AICA 1XFDA 5AK3A 3RARA 5A2GA 3NWOA 4MEBA 4UHBA 1IVYA 1F6WA 1GZ7A 1MN6A 4C4ZA 5LKAA 5LYYA 4FFVA 1IUNA 3HJUA 3IBTA 4AB1A 1XZFA 2QVBA 4UBKA 5ALJA 1GKKA 1ODCA 1EDBA 2J4CA 3O0DA 3WWCA 3FCXA 3N0TA 1UK8A 4JH0A 2EDCA 5ALOA 5K5EA 1BROA 1IZ7A 4Y2SA 3BDIA 2Y6UA 4KAFA 3WK7A 3WK5A 4QDXA 2RGUA 5EHNA 1MAAA 5AI5A 5LZ8A 4B83A 5LIPA 3HXKA 3EQ8A 5CH8A 1Z68A 1EI9A 4I4CA 4ZI5A 1YS1X 3QPCA 4BVJA 4EHBA 3ZLUA 5ESRA 2XQIA 1H22A 3F97A 2PUHA 2BKLA 4AN1A 3KXPA 2WUDA 1QO7A 2P8SA 5ALWA 3WL5A 1JMYA 3STYA 3EQ7A 1LPPA 4IH1A 3O95A 1F8UA 2R11A 1QIIA 4MEAA 1O6FA 2HHAA 1H2XA 3AUKA 3ESBA 4W63A 3WWOA 3HRHA 1SCIA 1TCAA 5KWIA 4KR0A 1CUCA 2B9VA 3HYSA 2O2IA 2W6CX 4RE5A 4OB8A 4X6XA 3K6KA 5D3KA 1XZBA 4XX1A 5IKXA 4W1RA 3O4IA 4X94A 2ORYA 5E4YA 1VZ3A 5HF5A 3BXPA 2CMFA 4AMYA 1LPNA 3T52A 4WY5A 4H7KA 4DNFA 1UZAA 2OQIA 3WQHA 5AKZA 4ITVA 3PUIA 1VE7A 4PSCA 1FSSA 2Z8ZA 5J3JA 1LZLA 3KSRA 4S0XA 1C4XA 4BDTA 5AKHA 2LIPA 4KACA 2GBIA 3FWHA 5AOAA 3ED1A 4EY7A 1J06A 4FWBA 1DTEA 4OSEA 3IULA 4X85A 4J0IA 4DM7A 3WA7A 2WG1A 1R9NA 4DYHA 1TAHA 3E1GA 3STVA 4UHFA 2JF0A 2PKYX 4W9RA 5ALZA 4N8SA 3H1AA 4CCYB 3AINA 5HZGA 2WU4A 4FHZA 4E11A 5AHXA 3V9AA 1Y7IA 5I9IA 1U2EA 4B9EA 2HA7A 1ODSA 4K2AA 1YS2X 3CCBA 1DQYA 5CT8A 3DL7A 4KE8A 1U8EA 4Y2QA 3ZLVA 1UKCA 3OM8A 1CUZA 5D6OA 3RLIA 5ALTA 2AJLI 6YASA 1MTZA 3D2BA 3STTA 5K3EA 3VKFA 1EINA 2AJCA 2OG1A 2PPLA 2WKWA 4DLNA 1XRLA 2WTNA 3H0CA 4HXGA 3B5EA 3I2GA 2AJ8A 4O08A 2Y1KA 1BU8A 5ALQA 2XQGA 2WU3A 4U2CA 3WKCA 1QIDA 2HFKA 2O2GA 2ACKA 4FNMA 4LXIA 4QZVA 1EXWA 4BVLA 4PF1A 5E2IA 2AXEA 1XZMA 4C87A 3TJMA 4KEAA 5DTIA 4F21A 4BCDA 2HM7A 2XDWA 2OGTA 4GWLA 5IVIA 3Q8WA 3I2IA 2G63A 5CXXA 2XMRA 3BIXA 4INZA 5DYTA 1XZEA 4E14A 4B6GA 1JMKC 5DNUA 5K3FA 4Y2PA 1XRMA 1K63A 5T4EA 5D3ZA 2JGIA 3WKEA 5JAPA 5JD6A 4G5XA 3T4UA 5LZ7A 1JI3A 1HKHA 1QIMA 2C5FA 5ALPA 1NU6A 1KU0A 4BAUA 4BBZA 2RIPA 2JGLA 4W1PA 2XUOA 5AIAA 3DNMA 2WIKA 1CUJA 1MAHA 5HFAA 3NOXA 2I03A 1YASA 5AKJA 1P0PA 1JJFA 4M0MA 4UFOA 4OU5A 2QOEA 1CRLA 2J4FA 4U2EA 5FLKA 2I3ZA 5HK8A 2H1IA 4FMPA 1XZCA 3VJKA 4G8BA 1XLVA 3I1IA 3STXA 5AJHA 3I6ZA 3C5VA 4CI9A 2PM8A 2VA9A 2WIJA 4G9EA 1XZKA 4CCYA 4AO8A 5T4FA 4B0PA 3LIPA 1QIEA 1D07A 4ZREA 3S2ZA 3TEJA 2CBGA 3L1JA 1UWCA 3QZUA 2HADA 3BJRA 4L0CA 4RPCA 4F0JA 2QT9A 3I2FA 2QXTA 4DSZA 4J0KA 2GYWA 2Z5GA 4J0DA 4QDUA 2OCKA 4F5ZA 4B7ZA 5CRIA 1ZD2P 3C6ZA 3H2KA 1TCCA 4GW3A 5JYCA 3DD5A 3I2HA 3KOOA 4Y2VA 1CUDA 2OQVA 2WILA 3K9BA 2H7YA 5YASA 1G66A 5JAOA 2NW6A 5AM2A 1K5PA 1XZLA 4ZRDA 1ACJA 1JKMA 5LZ9A 5JARA 4GEGA 5HCUA 4UHDA 1OILA 3OOSA 4K6HA 4Y2XA 3PICA 2XUDA 3AIMA 2BUBA 3IUMA 2GYVA 1MX5A 4N5HX 3WKAA 2ZSIA 3IUJA 1IUPA 2Q0XA 1IUOA 1HQDA 3WA6A 3WYNA 3ICVA 2GBCA 1DU4A 2GZSA 3W06A 5E4TA 5K3BA 1Y7HA 1YAJA 4HXFB 2WJ3A 4OYLA 1EDDA 3JWEA 3G0GA 1ZI8A 5DNVA 2OPHA 4X97A 3C43A 1WB4A 4OB7A 1YB7A 3M81A 5I7UA 1XZJA 2WIFA 4JEIA 3AZQA 2IIVA 2R8BA 3G9XA 1WM1A 3GZJA 4BP8A 2XQKA 1X2BA 3HC7A 4LYDA 1YA8A 2B61A 3QVMA 1QIHA 2HA4A 3ZV7A 5A62A 4HXEB 3F9CA 3FSGA 5JAUA 4OB6A 1TRHA 3SWWA 4CIAA 2WHPA 5EIAA 1AX9A 1BCSA 4Q3LA 2HA3A 4EY6A 2OCLA 3E3AA 1GPNA 3EQ9A 3PI6A 3C6YA 3FYUC 3R3WA 1DX6A 2XMZA 4OYYA 4BCCA 2XMQA 4X93A 1QIFA 2VAXA 2HRQA 4H7HA 5LZ2A 1O6GA 3B12A 1W52X 4C4XA 4EZIA 4BP9A 1E89A 1XZHA 3FVRA 1BS9A 1CQWA 3B3QA 3STUA 4X95A 5FRDA 3V48A 4K5QA 4X7BA 1TCBA 2WHRA 2XUGA 1ZGCA 1CLEA 2WHQA 3FAKA 2C58A 5AKYA 1YCDA 2QMQA 4DMKA 5EHZA 4X3CA 4BC1A 1W6RA 1QONA 3ZLTA 2ONCA 4LIPD 5AM4A 1SOMA 1QFSA 1WHSA 4J0CA 1AGYA 1L7AA 1W1IA 1CUEA 4KE9A 3TGLA 2WFMA 5FDFA 1VZ2A 2OGZA 4LKOA 2CEKA 1WCYA 1AKNA 3QH4A 1RYYA 4BRZA 3QITA 1QZ3A 4BCBA 4IH9A 5DYWA 2YXPX 1M33A 5CT5A 4EY5A 3I6MA 2HFJA 4ZV9A 2XUJA 1DWQA 5ALYA 5AI9A 4H7DA 2V97A 3JW8A 4CIBA 2JEYA 1QIJA 4D9JA 5HF6A 1MX1A 1ZJ4A 3IUNA 3FOBA 2VSQA 4QLOA 1XZGA 1XRQA 4XIIA 4FLFA 1SCQA 1AC5A 3G0CA 3OPMA 1EVQA 4WDRA 4NMWA 3WKBA 1MJ5A 1MT3A 1FFAA 4HZGA 4FTWA 2HIHA 4WCVA 1QIGA 5LZ5A 1ZI9A 2VT7A 3I2JA 1UOQA 3M83A 4OD0A 3WJ2A 1Q0RA 4F60A 1ZGBA 2B20A 3IURA 4TVKA 1CVLA 4QWWA 3OG9A 1ZIYA 3DOHA 3H2GA 5ALIA 4ETWA 1EX9A 2C0QA 4AX4A 1UFOA 2ZVDA 2HA2A 1TKRA 3KWJA 4QDZA 2XUKA 2QR5A 4X00A 3C8HA 4DMCA 4Q3OA 1LNSA 3IIIA 5AP9A 2QUAA 1R88A 2JEZA 2PSDA 3W04A 4GECA 2FJ0A 5KWJA 3C6XA 3C8DA 5AIBA 1WPRA 4LHEA 1X2EA 4N8EA 1LBTA 3R3UA 1R3DA 4HRYA 2G5TA 1EB9A 2OXEA 3QMVA 3S8YA 2ZSHA 2XUQA 3D5EA 1UT6A 3O4JA 1U4NA 4C6HA 1CV2A 4P92A 3U0VA 4PO3X 4U2GA 4PW0A 1UKBA 1XRPA 2JGFA 4HVTA 2ECFA 1QFMA 3M3DA 4B80A 4J7AA 1EK2A 2ZJFA 3W9BA 3R3YA 2C4HA 4K6KA 2BAGA 5LZ4A 1ODTC 3WK4A 2BGRA 4EY8A 4PSDA 1A8QA 2PSJA 1A8UA 1EK1A 3DQZA 5FUMA 4BZZA 4IO0A 4C88A 4EUSA 4WJLA 4KAAA 4EA6A 1EB8A 4U2FA 1HLGA 4YPVA 1LGYA 2D0DA 4X6UA 1CUFA 3VXKA 1HDEA 4FFWA 5F4ZA 2AJBA 1AQLA 4DSAA 1EA5A 3WJ1A 3LS2A 3V1MA 2WJ6A 5KREA 4G1FA 3VJMA 3PF8A 3DKRA 4C89A 3H19A 1F0NA 2HU5A 4WFIA 1F0PA 4UBMA 1CUXA 3BF7A 3C5WP 5AH0A 1T4MA 4FLEA 1LLFA 1Q0ZA 1SC9A 3EIOA 4IHAA 1UK7A 2V98A 4H18A 3A6ZA 2O7VA 1DT5A 5ISMA 1QOZA 3ANSA 5CXUA 1N5MA 4QEKA 2ZYIA 4W1QA 5T4BA 2WFLB 2EEPA 4UBOA 3D0KA 2HA0A 5K3AA 1IZ8A 1PFQA 2PSFA 3GUUA 1XRRA 1NU8A 2QS9A 5AKEA 3V1NA 4PNZA 4LXHA 4UFNA 3IDAA 2WIDA 2W22A 5JZBA 2YH2A 4WDQA 2O7RA 4UBNA 4MWTA 5ALRA 3KD2A 4G4JA 4YK7A 3H04A 1L7QA 3DYVA 5AKKA 1XRNA 5AKXA 1WB5A 4UBIA 1VA5A 1CEXA 3QM1A 1HBJA 3H2IA 3LIIA 1UOPA 3FBWA 3G8YA 3R40A 1PV1A 3HLKA 4CG3A 3AIOA 1HPLA 2XUIA 1G42A 4ROTA 1JU4A 5ALVA 1YR2A 4KYVA 5FPPA 2HDWA 4UPDA 4Q05A 1ISPA 1HL7A 3R3VA 1SCKA 2H7CA 4H7EA 1CUHA 1TIBA 5ALKA 2PSEA 5CMLA 4C01A 5AI0A 3SK0A 4ZXFA 1W4LA 4GHWA 4DMHA 2BJHA 2BGNA 2YASA 1UK9A 3ZPXA 2UZ0A 5JD5A 3ZI7A 3W05A 4M0FA 3CN7A 4BZWA 3Q0TA 5DNWA 2G5PA 1LPMA 5HF9A 4B0OA 2VJAA 1GQRA 2OGSA 3I1YA 2DHEA 4JYPA 2WIGA 3A2LA 3AFIA 1E5TA 1EH5A 3STWA 3G9UA 4Y2TA 1G5FA 1CUBA 5A7HA 4X91A 3F8SA 3G9TA 4H0CA 4ZV7A 1E66A 2HL6A 2K2QB 4QNNA 3VDXA 3DKKA 2O2HA 4DNQA 1UXOA 3M82A 5JZSA 1A7UA 1CUAA 1JU3A 4YX9A 4NZZA 2VJCA 4QDTA 1L7RA 4RE6A 4ARAA 2BUAA 1KU6A 4HS9A 1MX9A 3QPAA 4H7IA 1XZIA 3WWEA 3DJYA 3GROA 5ALFA 1K8QA 4I19A 3EBLA 3WL6A 2PUJA 4Y2YA 2VATA 4G8CA 5ALLA 4Q82A 1CUWA 3WWDA 2XMGA 5ALXA 5FP0A 4B9AA 2J3QA 1GKLA 5AI8A 4PQEA 2OAEA 4UBLA 2H7XA 5JD4A 1EDEA 2PL5A 1JFRA 3DLTA 1XZDA 4AZ3A 2PU5A 3WZLA 2V96A 4E46A 5AK5A 3DCNA 5EHQA 3GA7A 4CG1A 3VISA 5ALHA 3MUNA 3WZMA 5HKBA 3DYIA 3HI4A 4P08A 2AJDA 1CUSA 5DWDA 1KEZA 3GELA 4TGLA 2WUFA 3LP5A 3K2IA 4Y2UA 3FNBA 3G0IA 4MYSA 5AOBA 2GYUA 4BAGA 2VEOA 4XWGA 1BE0A 1R9MA 5IVKA 1P0MA 3ANTA 4KE6A 3FLBA 1VOTA 5BV7A 2QTBA 1MPXA 3VJLA 3R41A 2VJDA 1P0IA 2X5XA 5AK6A 1QIKA 5ALEA 4XJVA 5D7BA 5KBYA 3A2NA 3ZWQA 1XLUA 4KRYA 2GZRA 1XQXA 2H9YA 2XQJA 5HF8A 2JGJA 3H17A 1UOOA 4L9AA 1GGVA 2D5LA 5IVHA 1ACLA 1IMJA 2Y2VA 5CW2A 1QGED 3KWFA 4JYMA 1BCRA 5AM3A 4FKBA 4PSUA 4E15A 4IQ4A 4RNCA 5A6VA 1ZJ5A 4AO6A 3H2HA 2ZJ6A 3FVTA 2XT0A 5AOCA 1T2NA 5AKGA 3PE6A 3WK9A 4N8DA 4BDSA 2XMSA 2XI4A 2WFZA 5C8XA 1WOMA 3IA2A 4QA9A 1E8NA 1W75A 5DTJA 1RP1A 4HTAA 2QJRA 1MNQA 4Q34A 1VE6A 2VJBA 7YASA 2HU8A 1CUYA 5HKAA 5ALUA 1ZD3A 3R3ZA 5CH3A 2HA6A 1VA4A 5JATA 1LZKA 2GBGA 1YA4A 4LXGA 3BDVA 4KAJA 4AO7A 2VQ6A 3WK8A 3H1BA 4Y2RA 1PJAA 3HACA 1THGA 4J0HA 1J2EA 3BJMA 1YSCA 1SFRA 3E4DA 5C81A 4JNCA 3WWPA 3WIOA 4Q1VA 2CKMA 1FFCA 2QXUA 5ALMA 3MVEA 4CG2A 5AI4A 1H23A 3WYDA 3R3XA 2HU7A 2QZPA 5FKJA 5HQ3A 2IITA 1AURA 2ES4A 3OC0A 3D59A 1VJ5A 4AMZA 4UUQA 4FLMA 1N8SA 1UK6A 5AO9A 1JJIA 1RWQA 3HSSA 1FFDA 4BRSA 4NVRA 3SC2A 1UKAA 1GT6A 2WG2A 3JYHA 2VT6A 4N5IX 4BATA 3DOIA 3L1IA 1I6WA 1C7JA 1J1IA 2WTMA 1CUUA 4H77A 4MQMA 4EY4A 4Q3KA 4J0GA 3QMMA 4BTLA 2XLBA 5H3HA 2XMDA 1GQSA 5K3FB 4DNPA 1E3QA 4M0EA 2RI6A 4BE4A 1CFJA 1CUVA 4W1SA 3FYUB 3D2AA 3ESCA 4FBLA 1AMNA 4CCWA 4MQLA 4OCZA 2RAUA 2ROQA 2XUAA 4GLBA 1AZWA 2XMCA 3GFFA 3WL8A 3MGAA 5C8ZA 4EB0A 4MWSA 5BWBA 2XMBA 4YASA 3SX4A 1CPYA 4Y2JA 4QE3A 4BTVA 5ALNA 2RHTA 1ZD4A 5LLSA 2DCMA 4UBJA 3EF3A 4ZGBA 5JANA 4K6GA 3AIKA 2BCEA 3FYUA 5EGNA 5JAHA 3BIWA 2RHWA 3NUZA 3WKDA 5T4HA 2JBWA 1DT3A 3BWXA 5CTAA 3G0DA 3WI7A 3LCRA 2JGEA 1DX4A 2CB9A 4G8DA 3D7RA 2J3DA 3F67A 3UUEA 1J07A 1K4YA 5A7FA 1ZD5A 1ETHA 1C7IA 5BWCA 2WSLA 1YAHA 4UHHA 2DHCA 2DSNA 3PDCA 3F96A 3L1HA 3DL4A 4WFJA 3AJAA 1OXMA 3WL7A 3I2KA 2CUTA 1FJ2A 1A8SA 1CUGA 2RONA 2XUHA 3LLCA 3FLAA 3QYJA 5DJ5A 4A23A 5DLPA 4B82A 4P9NA 1GPLA 1XQYA 4B84A 1X70A 2OLEA 1WHTA 1CR6A 4AQDA 2HRRA 3AILA 1BEZA 2DR0A 3E0XA 4Z49A 2PX6A 5JALA 1THTA 3I28A 4V2IA 4B85A 2EDAA 4QWMA 4MXDA 4X90A 1GPKA 3D2CA 1LPBB 2DFPA 1CIJA 5ALGA 1QO9A 4QLAA 1K6EA 1BEEA 5EIHA 2ZJ7A 1R4ZA 3YASA 1QJ4A 4BB0A
chains in the Genus database with same CATH superfamily
2CY0A 5EZQA 1XLTC 4WL0A 3PUHA 3IALA 4FHCA 3R7DA 4DLAA 2Q21A 1AKYA 5IDQA 5C18A 2QUZA 2LVBA 5EJ4A 2NV0A 1ZONA 5DASA 4PTYA 3VNUA 1SKYE 1ZSNA 2YX1A 2VAWA 2Y27A 2ZOSA 1GGMA 4ND6A 5G0WA 4W8OA 4QOFA 4EGJA 4C3UA 5FWDA 1K89A 5AK4A 4NAVA 1AHNA 2OOKA 3ZVLA 3PEYA 1RJFA 4IDHA 4MYCA 3RG8A 1EXMA 1NMEA 3GMTA 3FSGD 1P2TA 3LW8A 4N7BA 3TM5A 1EHYA 2RKOA 3LP6A 4R8RA 4TYMA 5DF1A 1SKYB 2J32A 3DNFA 3QV1A 4CMEA 1JDUA 5FUWA 1U1IA 2AWOA 1FFEA 2QRUA 1FU7A 2WFLA 2WU1A 4G5RA 1DQZA 4HB4A 4M7RA 4OBBA 4RS4A 3IQFA 1VJDA 4AW9A 1G16A 5CHYA 4YJGB 4ZANA 3R09A 3GGOA 2VHYA 3OCZA 3I6YA 4WY5A 3ZS8A 1B0PA 3ND8A 3RRXA 3DT8A 5ER9A 1U2GC 1PLLA 1OOEA 3WVNA 4BQRA 3EGXA 4MWEA 3IODA 5ANRB 1UM8A 2B7CA 2HUPA 4H3HB 2H2FA 1J8YF 3DTVB 4JP1A 2PSHA 4FYPA 4K05A 2ONJA 5K3SA 4MRSA 5HUHA 1ISGA 3CXUA 4ZTZB 2ZIZA 3MT8A 3ORRA 3RM3A 3H8SA 3V1LA 3A4TA 3RYIB 3ZVKA 2XNKA 3G89A 2FJPA 1Y1SA 5DXAA 3V8VA 2VIIA 3RTCA 1NNI1 3CX8A 4KMSA 2Q50A 5ALDA 2IS4A 3VNAA 4U7JA 4CT0A 1Q84A 2DJIA 5EZ6B 1DI0A 4FYVA 4B4DA 3F5QA 5EIEA 3EZYA 3RYCA 2X8BA 4XGIA 4A36A 1RLIA 4ZHQB 1ARZA 2ATVA 2GB4A 3CE9A 4X92A 1SB8A 5TF4A 3SYNA 3AU9A 4EO9A 3EOAI 4X54A 5MDHA 2AFRA 4BHTA 4D96A 1V8ZA 4GDMA 2BFPA 3VA7A 4RVSA 2G72A 2XZLA 4ZCLA 3T1NA 1N2ZA 2Y99A 3FB1A 4EZBA 1ZO8A 3HA3A 3UJ8A 1O8CA 2JNWA 1TE2A 1I4DD 1XCGB 3Q5GA 1FYXA 1ZD1A 3C70A 2UVPA 3RUPA 3WIEA 4GQAA 3INGA 3AEXA 3TZCA 3JQFC 4B31A 1A7KA 1S6YA 3DT6A 1G3MA 4ZHQF 2DETA 4ALKA 4U6SA 4IW3B 3S40A 4YAOA 3RRZA 4UM9B 2CXUA 2Q4TA 5IHXA 4LF8B 2ZBVA 3KTOA 4RA6A 4F8EA 1Z2PX 2XGMA 3HR4A 3INYA 3O1HB 4L6CA 3AVTA 4D9FA 5D3MA 4DY4A 1GFSA 4EGAA 5LP1A 2L18A 3GN1A 3IB3A 3AF1A 2FUG6 2JATA 3RTDA 1JT2A 5HBGA 3STWA 1N34B 2D7DA 1Z0SA 3OIVA 1LPAB 2OQ2A 4O2BA 3ERCA 4D0NA 4K28A 4QGSA 2ZSFA 4L51A 3PLRA 4IXNA 5K3CA 2QQFA 5CA1F 1JBKA 4IIHA 4RDHA 1DINA 4NBSA 3ZHUA 3FRJA 1D2MA 1FTGA 4JUIA 5EI5A 2PMWB 4B4KA 4BWFB 2JGMA 2WQ7A 2I1QA 4ZOEA 5BORA 5KNBA 1MCZA 4Y18A 4GM0A 1TAQA 4YJ3B 5AKIA 1NPTO 2PLAA 1GZUA 4UCWA 2J3KA 5BV1A 3LXMA 1H1LA 1B15A 3H9JA 1CU1A 3WYGA 2WRZA 3HPQA 3PL1A 3QMWA 2QB5A 4V38A 4GOMD 3BL8A 1SR8A 4B4VA 3IHKA 4ZWNA 4RMIA 3DOCA 4BAZA 1LBSA 1QHNA 2E4AA 1A71A 1UBKS 3AEKB 1XTQA 1RP7A 3O9MA 2JRLA 2XE4A 2A9QA 1C1XA 5JV5A 1DIRA 5K0CA 4J3JA 1RADA 3A9VA 1QRDA 3PGKA 5GM1A 1KSHA 4HEA6 2PKCA 4HQNA 1GADO 2IEBA 1E3IA 1VJRA 5EIFA 3MUOA 3W2EA 1Z34A 3O8BA 3RQSA 4DT1A 3CO0S 2R0QC 2OR3A 2R7NA 4NBLA 2JCSA 4UQOA 4LF7B 1B76A 5AKJA 2HCRA 1C0PA 4V0MA 4Y1FA 5EESA 2ZSKA 2R7AA 2NPOA 3KC2A 4HEJA 4U2DA 2HWUA 3D6TB 2BCJQ 2PD6A 1XKTA 3A7EA 3CUYA 4JUDX 4Q21A 1GNSA 2P9YA 3RU2A 3K70D 1ZNXA 1U65A 2VPZA 4EHKA 1EVKA 3OX4A 4G0OA 2IEZA 3MLEA 4X71A 5HHTA 4BKMA 1GUZA 3H65A 2GHTA 3TE7A 2FR8C 3ZU5A 4QUIA 2CHEA 2PBLA 4WKBA 3I34X 3A7DA 2H2HA 5FI5A 3TAXA 4K6OA 2WLSA 4GZ5A 3CCCA 5C7LO 1JEOA 3QPBA 4ZZ1A 1E8MA 4DCTA 4RIFA 4DUZB 4Q02A 4YMWA 2AW5A 4Q4JA 3CVVA 1L4BA 3I04A 4FOTA 2KW5A 1KIFA 1XE3A 2QKYA 4CFSA 2Y1FA 3LH5A 3UCFA 2X3UA 4D5GA 1AF7A 4ZHQA 2I55A 1HNNA 2IXBA 3PXXA 3U1TA 2Q5FA 4RXTA 5LQDA 1Y37A 1P4GA 3PC7A 3PFKA 4EBBA 5FOQA 3B6KA 2IW3A 1ZAYA 3PGMA 5ICEA 2PKQO 3UWSA 4UHCA 2BFNA 4FOLA 1ZIXA 2HV8A 3VTZA 3LT0A 3WBJA 3L4JA 3ZQJA 1TFRA 1ISJA 2PLRA 3WYEA 2O8CB 4C7JA 3QKSB 5EOVA 4ZV4A 1Y5NA 3D3NA 5HBRA 4JP2A 3DDUA 3TRFA 1U3GA 4MYUA 2Q46A 1PFKA 5HZHA 5GONB 1E3WB 2MSEB 4DPLA 1ZESA 4LFAB 5FTWA 3EVEA 4NMXB 2HK7A 3OCUA 3DLPX 4GOKA 1CS0B 1B0ZA 5AOVA 1WXEA 1T1JA 1CR4A 2G4LA 3H7AA 4LECA 4UFPA 5CVUA 1ORVA 3VSCA 3IOBA 1R4NB 2FFHA 4FZRA 4DILA 2JLBA 2WT9A 3JSAA 1QVAA 3OOEA 1OCEA 5K8VA 3JQPA 1TADA 5AKLA 5K0JA 3FLMA 2H1FA 2B2CA 1DDIA 2BEUB 3BE8A 3L07A 3UMYA 4POAA 3BGWA 1KO5A 1X8JA 3CN9A 1WNFA 3NOQA 3MPOA 4F3TA 3P52A 1GPWB 3P2YA 3VZBA 2QAGB 1T43A 2EWMA 3JD4A 1Q92A 3I53A 4HDQB 2BM0A 2QN7A 1G6KA 3FMIA 1O5OA 4RACA 3OEWA 3TI7A 1YDGA 3M5WA 2FDRA 2YZGA 1PHPA 5CBPB 1W47A 3GH3A 2E3JA 3FUWA 2QM0A 2B78A 3HCOA 5DGCA 1JR3E 5B3JA 3FTDA 2J59A 1HT3A 3EARA 4Q6BA 1GRCA 2C7GA 3LC2O 4FDMA 5E8RA 1M8JA 3WRYC 2HO5A 2A6PA 1GA6A 5B30A 2I3BA 4WOPA 5A71A 4DLBA 1NBIA 1EQUA 1P0QA 5C8VA 2LWIA 1USGA 1RXEA 4KH0A 5HZKA 3G2JA 4TYPA 3S6JA 1XRSB 4DBVO 3I8SA 1U8XX 3WO1A 1E4VA 3DXXA 3IQXA 4IIBA 4PBRA 1XEXB 5F77A 5SY9A 2YJGA 1IG0A 4MQFA 3IHWA 3RK4A 1IYZA 1P19A 3MB5A 3NHLA 3H3XA 3V4SA 4EMUA 1ZR2A 4BXOA 1UKYA 5CT4A 1YDWA 1B6TA 4I1OA 1ECBA 3O7MA 3VNBA 4M36A 4C4PA 1NJFA 2UDPA 4KO8A 5CLQA 5TMDA 3QPUA 1DHRA 2BSXA 3RVJA 1OV4A 1Y63A 1X7XA 1CT9A 2VXCA 2JFOA 5K3DA 2XIQA 3R6GA 2OB2A 3GCGA 1CJKC 3RKUA 1T36A 3IPXA 5K20A 4NCIA 3NHZA 2W6QA 3FI9A 4JI3B 2UZ1B 1U7XA 3FDFA 4NFYA 4JLBA 4Q66C 5HA5A 2XDYA 3SR0A 2VTVA 3WNVA 3ZCQA 1ZOIA 4BYMA 4Z53A 3OJEA 3WTCA 1I8TA 1OYYA 4R6XA 5K4AA 1BN6A 3EUEA 1M0SA 3TE6A 4AAYA 2ICAA 3WQSB 3RS9A 4Z3KA 3PFBA 4O2AA 1FL9A 3KSAC 4FVTA 4BB6A 4XLLA 3ZU3A 1KDTA 2C84A 2IE8A 5DW0A 1MQAA 3A1VA 1LC3A 2E87A 2P9QA 2OHIA 4B47A 5AVRA 3A6DA 5IT4A 3UWMA 3WLAA 3ZDFA 1X80A 2YZ2A 3CBGA 4O63O 4P22A 4QTUB 2H1OA 2BP7A 2XTNA 3A2KA 5TARA 1ZH0A 4P3PA 5JH7B 3G2PA 3NPAA 4MRVA 4W7SA 1BYIA 2DKFA 4HUQA 4EGSA 3RYFA 4ZZ0A 4LE2A 1DKNA 4RHFA 3WAJA 9LDTA 5JEDA 3SQLA 4AYWA 3FOCA 4I1RA 1SZDA 1NKTA 1E9DA 3DDHA 4HNHA 2I9KA 3BN3A 3EXHB 1ZLYA 3H18A 3LQFA 1N0HA 3OLXA 1RJ9B 2AT1A 2W8BA 1BRTA 1CSEE 2CSUA 3GUCA 3LC0A 3UMCA 3V8EA 2JLWA 3K0SA 4RJIA 2I6QA 5EWMA 1JEAA 2EF1A 3CLTC 4JJ4A 5ELLA 2JD2A 5DBOA 2ZPTX 1M0TA 1ZW1A 5BSVA 1P1HA 3HBNA 2ZIGA 3L5OA 2V3WA 2IIQA 4PLYA 3FDZB 2OD9A 3AR5A 3PF9A 4RA9A 1NVEA 2C42A 1SELA 4YB8A 2GEBA 1EWTA 2IX3A 4UEQA 4FGSA 3HEAA 1ML4A 4YUWA 1E3MA 2PS9A 4ND1A 5EJGA 4TKUA 4MJXA 4JQCA 4ER5A 1RRFA 4QJBA 4ZYWA 4IDNA 2GPJA 3LDGA 3GLGE 3WOHA 3LFUA 1N2SA 1QDEA 4P93A 2OCGA 3P5BA 3SSMA 1KMIY 2RHMA 1CVRA 2WUGA 4B7XA 4HX9A 3REFA 1QU3A 1RM3A 1JLHA 2QRGA 3LAWA 4BX2A 2WC1A 2C4MA 4Q1AA 2GAJA 4DBLE 1X14A 4IILA 2ENUA 3PRJA 4BEBA 5DI3A 3OPYI 1D7OA 1U7HA 3B6MA 2D8AA 1Y33E 3UGKA 4ZGGA 4D6YA 3PA6A 3I8OA 5TJ9A 1TQHA 4URZR 3B9BA 3M6UA 3SDBA 1OAKA 4O2BB 2IP1A 1ZN8A 4F04A 5EXSA 3ICPA 3QFHA 1YZFA 2CDRA 2V7QD 2HRDA 3R7AA 5JNVA 1O0BA 5EIBD 4IL5A 5HTOA 4RK0A 1ZK0A 1O9BA 2VUSA 4XSHA 3ONFA 1D1QA 2RGCA 3FYDA 4JWKA 1LPSA 2I2DA 5INTA 4F9FA 5AICA 1WXFA 5KOHB 4MI3A 1GKYA 1MABB 4AWAA 5KU1A 1OWNA 1VJCA 4WJZA 5A2GA 4MEBA 3IEPA 4UHBA 4COOA 4Q47A 1ENPA 4I3GA 1EFAA 2FN4A 2NXNA 3IAM6 4G0UA 2ZT6A 1SUFA 2CL0X 4JLKA 1CHDA 4FXPA 4MRRA 4RADA 3UHAA 2QN1A 3DGFC 3HDTA 8LDHA 3RROA 2AI3A 1MN6A 2AC4A 3AJRA 1EBBA 5LKAA 3RC7A 4FFVA 3V4PB 3L92A 4YAEA 5CVCA 2GCEA 2J87A 3G68A 5C3MA 4FI3F 4IXDA 1XLTA 4BZPA 4P38A 2H5IA 4S1WA 3WGLA 4BX9A 1KC1A 4K03A 2QN6A 5T8KC 3L0CA 4S3MA 3VDRA 3O0DA 1EDBA 1GPYA 3TLBA 3IP7A 1IOWA 1A3CA 2A8YA 4BFTA 1HF3A 2L69A 2PO7A 2XHZA 3FWZA 3NIGB 3C3KA 4MA0A 5EKUA 3R9KA 4D02A 4B73A 2EDCA 5G4KB 5MN4A 3UN1A 4P7JA 3TD6A 4CKCB 4PG4A 1SWVA 4G8JA 1W34A 4QU5A 1BROA 1IZ7A 3RHTA 1WD5A 3BD8A 4PGAA 3ZNOA 5L3QB 1WDKA 4R7TA 2DBYA 4DJAA 4KAFA 2IT1A 4ENPA 4QARA 3CLVA 3IAUA 4CMJA 1KO4A 3KPVA 3WK7A 4NS1A 3K1AA 4HWTA 1ZDMA 4TXMA 1PS9A 3SHVA 2VK2A 1DKUA 1HTBA 3NV9A 2BL4A 1YZNA 4V0ME 5EHNA 3RKRA 3TBKA 4JSRA 2X41A 3AVPA 4YI5A 1OI7A 3TW4A 1TUBB 1Z47A 4YBZA 1UQUA 4I9NA 5HE8A 5CH8A 3U3RA 1Z68A 4C4TA 1PV4A 3WYCA 5H83A 1TEVA 4RSRA 2JLSA 3RT9A 1ZXLA 3HH8A 1WMFA 1KVTA 4LNUA 1N1EA 1YS1X 1OHHA 2ZI6A 3PKJA 4R68A 4KHPB 1SHUX 4YJGA 3OA0A 3BYZA 2APJA 4XCQA 3OCWA 2P2ZA 4WK4B 3BMOB 4M38A 2B8TA 4N3CA 1X7ZA 1NVMB 2FAXA 3WLOA 5KTRA 5TEVA 1SG6A 1X1QA 2EZTA 4IEFB 4IQ0A 3QF4B 4KUHA 2BYTA 1EGMB 3K9GA 3RVPA 3BICA 4KL8S 5B2EA 4BUCA 2O2JA 1EBFA 1OXVA 1CRPA 3T7AA 1YB5A 3QUTA 5ALWA 2XRZA 1NM5A 2A3NA 2JAOA 3STYA 1A5TA 1ZGJA 2AYZA 3EQ7A 3T7DA 2YWDA 1N2HA 3QX7A 3FCEA 2WVGA 1CZHA 1T3SA 4Q7JB 3ZJTA 2ZS8A 1W59A 4GKKB 4KYUA 2PBRA 2P9JA 4I08A 2ZU6A 1QIIA 1O5TA 1O6FA 2HHAA 4QIHA 4R9VA 3RRBA 4K9QA 4LI0A 1F4PA 4W63A 1W1WA 1ZM2A 2EWWA 3GG9A 3L7BA 3WNQA 3ZIAA 5JQGA 1OIXA 3HRHA 4X9XA 2B36A 2X9LA 2DMRA 2VOJA 2YV3A 4PNEA 1NOIA 4R9SA 3ZOKA 5BV2P 5TMPA 3CCFA 3G13A 2OHFA 4PG6A 1TCAA 2QT1A 4N6GA 5ICMA 4EEKA 2ZAOA 3Q2OA 1HUQA 3QNMA 5M04A 2O2IA 1WMAA 2FV8A 2W6CX 3FDXA 3HVIA 4OB8A 4X6XA 5MN6A 2HOQA 2BCGY 1JA0A 2G80A 4M60A 3RSZA 3U7QA 3DCJA 4WZ6A 4EUKA 1XZBA 1BXZA 1FUYB 3G8CA 3VU0A 1P72A 5IKXA 3MAJA 4LC1A 3M6AA 2B83A 2ORYA 1VZ3A 3LQQA 3WB1A 2ILVA 1FX0B 4YRAA 4IQGA 1M2GA 3BXPA 3CWCA 3LMKA 3H9BA 3QJ5A 1H8HA 1K97A 3AEZA 1Z3IX 4NABA 3T52A 4L5IA 4H7KA 3ED5A 4DNFA 3E6AA 2P27A 3FHTA 4MGZR 4RK7A 3HG7A 4H0FA 2HSWA 1C1YA 2I7VA 3AUFA 1KRHA 2P67A 1TU4A 1VE7A 3HV0A 4PSCA 1FSSA 2NV2B 1DBRA 4LPKA 3WBFA 2FMHA 4DMMA 2GBPA 5ARBA 1D03A 1LZLA 2PX8A 4Y6LA 3AR7A 4S0XA 2YWXA 1C4XA 2XTMA 4UU0A 1U04A 1IN4A 1Z63A 3ZDEA 1H2RS 2YJ3A 4BPRA 4HJXA 3DMFA 1B7GO 3KQPA 4ENSA 3OFND 1RS0A 1TL7C 4JBIA 2ZYUX 5AUNB 2R8OA 3DB1A 3ZGVA 5AOAA 4RMGA 4C7VA 3J80A 2PE5A 3ED1A 3SJBA 3RABA 1J7JA 1V16B 2A9OA 2VA8A 1J06A 2YTZA 5KC9A 1V25A 2MSNA 1DTEA 4BNLA 3QU9A 4RQAA 3N8DA 1YKSA 1GSIA 4YMIA 3SVZA 1CF4A 3IIEA 3LVBA 5KMGB 4LJ4A 3KOZA 3CF6R 5A3JA 2D2IA 3LT4A 4QELA 1N3IA 3N0RA 1D9XA 1CJBA 5CB4B 4WLUA 4XDGA 3FJOA 5A05A 3WHPA 5A9SB 3WA7A 4P34A 1V35A 4M1SA 1BWSA 4UTRA 4NXNB 4TSFD 3B70A 3E1GA 1UADA 2J6IA 2RG1A 4CQLB 1IN6A 3EZ7A 2QVYX 3SGLA 4UHFA 2DG2A 2WZBA 4S2EA 3ZTYA 4W5JA 3BXHA 3W5UA 2Y1GA 2DVMA 3JZAA 4WGGA 1X0XA 2REXB 1PL0A 2GHQA 1XXLA 3QYFA 5DBGA 3C1TA 4BNXA 1R0CA 3AINA 2JCBA 3MTAA 3GWGA 3OFNA 3ZU2A 1HDGO 4XZ3A 2NX2A 4RPIA 4PNHA 1JJAA 1U2EA 1T9CA 4LVNA 4ESOA 1ODSA 4XAQA 1AGNA 2FI1A 3TQOA 3TBHA 4A6EA 1SOAA 4WNAA 4Q3BA 4ER0A 3GJQA 3IJRA 2HBRA 2QRHA 3G6KA 4WEQA 3NVKI 1Z4MA 2BFBB 3HO6A 3OM8A 1OFTA 1QHGA 1W5TA 4IIVA 4YGYA 3LX8A 3Q9NA 4GFDA 1CUZA 5EHIA 2J8ZA 1P7WA 1T24A 2J5RA 4L75A 3GEPA 3JTMA 4BLVA 1U7TA 3C4JA 3W9SA 3KB8A 4ZVPA 1P45A 1X1TA 3JVDA 3IAM1 3VPCA 2PJUA 3H4MA 4CM4A 3TN7A 3V55A 3CPEA 3H5VA 4DV0B 3GPLA 2OHXA 3CGGA 4HL6A 2NSJA 2PGLA 1K6MA 4LCJA 2B4YA 4AN4A 4DR7B 4CNQA 1IBCA 4PLTA 3L46A 5IG2A 5JBNA 1DC5A 3ONWA 1M7HA 1R0SA 5ADVA 4R2LA 2EERA 1P2UA 4OH1A 4PSVA 5G1PA 4EPWA 4CRWB 2XHEA 2ZUWA 2A1TR 4L7VA 3QJGA 4HXGA 2AE2A 4MDYA 3WLHA 1QM5A 4M86A 4KRGA 1WXQA 2JANA 1N6IA 1BJRE 4O08A 5J5AA 2HF2A 4B6RA 5KDOA 1BFKA 1YOBA 3BTUA 2JDIA 4L4ZA 4YI3A 5DT9A 4C0JA 2G28A 4LVCA 2KHZA 7REQA 5JPDA 1FNNA 1BU8A 3EXIB 3TPFA 4LDZA 2W2KB 3BB3A 3NHKA 1IHOA 4I5GA 2XWPA 2I0FA 3ZV4A 3Q6IA 3QW4B 3NUQA 1L8OA 3HFJA 2BKAA 1C29B 2DTEA 2QRVA 2WU3A 4Z4CA 4UVDA 4G01B 4CU2A 1DAFA 1PFGA 1U1EA 4D0LB 4OKNA 5JJIA 5H3LA 4CI0B 2PT6A 4BWVA 4YWHA 3IVGA 1H2BA 2N3ZA 3LCJA 3OQ1A 4DS3A 1JA1A 1EXWA 2H4JA 4EL0A 4X1KB 3TR5A 2FFBA 5E2IA 1V1JA 3AC0A 4KI0A 4NOKA 1OY1A 2H1WA 4OSOA 1L5FA 3B48A 4C87A 2J6BA 1U3VA 3S70A 2BMFA 4BCDA 3Q3HA 2HM7A 2XDWA 4RWZA 3DM9B 3TPCA 4KR3A 5IVIA 3MINA 1TGYA 4ZQBA 3I2IA 1F2UA 2G63A 5CXXA 1IEQA 1W96A 3BIXA 2ZS9A 2ZGVA 3PPXA 4HMPA 4FCTA 5A9RA 1PU2A 5EY5B 4IVQA 3QIVA 4CMKA 1EEXB 1NQXA 4Z9YA 2R5FA 3VZQA 3C1AA 4B6GA 3NU1A 3WGQA 1TNDA 1EM8A 4RNDB 6ABPA 3N2GB 1QMPA 1GGEA 3QVJA 2FXVA 2QBYA 3C3MA 3NM4A 3KHKA 2AGVA 1KI7A 5D86A 2EHDA 3FF1A 4R2WA 5LBIA 1XEWX 2H1LA 1K63A 1MVLA 4K3UA 4A03A 2WI8A 2HTFA 2BR3A 2R84A 2G04A 2JHAA 1HYEA 1MGOA 1YU6A 2OECA 1VBKA 3KQVA 3WKEA 3JYPA 4NSNA 3ZK9A 4M9ZA 4DEXA 5JD6A 5K8UA 1E3EA 1P17A 3UFXB 3MAAC 4B2YA 1RI1A 1U99A 3D7MA 4US1R 3JV7A 2IOHA 3DAPA 3L1KA 3TD2A 5K0NA 1NI5A 4HPXB 3EG5A 1HKHA 1G2IA 1DC7A 4URYR 2C5FA 5ALPA 2M98A 4Z4GA 2CF6A 2IV3A 2FMXA 2QD1A 2JVJA 5F33A 4U5QA 1I3NA 5KCZA 1J6UA 4IS3A 4R1TA 2FHSA 4EGFA 3H3FA 2E4YA 3ETDA 3AUJB 3TRIA 1IZ9A 2V8OA 2O2ZA 1WNTA 1V8FA 1E32A 2PXAA 2Q8PA 4OJKA 2IYEA 1MAHA 2GAAA 4OMFG 3JALB 1IOLA 3W90A 4D25A 1BQ3A 2I03A 1YASA 1ZM9A 2J5QA 3T34A 3I52A 2Z56A 5DN6D 3PUKA 2XNCA 3MLAA 4KLAA 4ND8A 4AJNA 1M83A 4RHYA 1NBAA 2HC9A 3OJFA 5I7AA 5TR9A 1AK9A 3D0QA 2GVZC 1G3IA 3PNYA 1XMXA 2Z2IA 1Z9BA 2QRZA 3F3YA 3OZWA 4OU5A 1GGNA 1JU9A 1T5LA 4NP6A 4ZQCB 1TF7A 1R6TA 3CZ5A 1WDLA 2DPLA 3EOBI 5DWQA 3RSSA 3PNBA 5CLJA 1J8VA 2H17A 2I3ZA 3DMYA 3IB6A 2H1IA 5CA1A 1ISMA 1GL9B 4QXAA 3TSZA 1ZWKA 1K8ZB 4R2JA 3FNIA 3VJKA 4B71A 2GFIA 1D8AA 1LLCA 4E5MA 1JG2A 5JLAA 5FI1B 3W8DA 3D6MA 3I6ZA 3IFSA 3DE7X 4NF2A 4Q3EA 2H57A 4CI9A 4MA5A 1FRNA 2IGTA 4QG3A 2VA9A 1NW4A 1H42A 5A4JA 3LYHA 1WLYA 1R5JA 1XZKA 2HMAA 2VH1A 4CCYA 3L1UA 1YJ8A 3K8OE 3OFKA 3UT6A 4XWAA 3FUXA 5PGMA 3TAHA 5L7WA 1VFNA 4B2IA 1GDTA 1U3DA 2MTBA 3NCTA 4B0PA 4TS1A 3VU3A 1ZU4A 4Z7QB 5A0TA 3D8BA 1D07A 3RNLA 3JTEA 4M0DA 3S2ZA 4PM4A 3TEJA 4DKJA 3FUCA 1PQPA 2M6KA 2CBGA 5C52B 2RI1A 2NUAB 1SXJB 3M0EA 3MRSA 3R5HA 1WKBA 4ND2A 5J5VA 2DPMA 2HDOA 3BJRA 4NOLA 4RPCA 4QM6A 4IM7A 4L74A 4NJEB 5IP5A 5HIKA 5JJLA 2Y1OA 4RCYA 4MVJI 1Y9AA 2JFUA 3ZK8A 5JTUA 4F46A 4DLLA 4BGDA 3I6BA 3H86A 4DKXA 2RGBA 2ZDGA 2V74B 4JLSA 1C4WA 2OCKA 4QRHA 1G5IA 1YA6A 4XUDA 1ZD2P 3T9CA 2V6MA 3C6ZA 3K2QA 3GRPA 4WBNF 1Z7GA 5EE1A 4FMCF 3TZEA 2GERA 2I5PO 2QTCA 1FP7A 1PQUA 2RCNA 4HXYA 3OLVA 2J0UA 3I2HA 4FINA 2LE0A 4K6MA 4P3YA 5EJAA 1CUDA 3ZHTA 5EJ6A 3EZ2A 1Z0KA 5DK4A 3VOTA 5BRAA 3OSUA 1Z8HA 4G25A 4C08A 4KQFA 3TZ6A 3NBFA 1FTNA 5EUCA 1J5PA 4QJ3A 2VDJA 3UEOA 5AM2A 3A6JA 1L8QA 2M1XA 4XJXA 1NVAA 4F2PA 4PC2A 1HXHA 2DY1A 4L0QA 3MSXA 4ITUA 1SQGA 3KVNA 1KQGA 2WLTA 1KQ3A 4QFMA 4AZ0B 5LVAA 2ZIFA 4YJHB 3FMOB 1HWYA 5I51A 2XECA 3AIMA 2ZXUA 2ZRMA 3IQIX 4RK1A 1U6KA 3CLHA 3EZ9A 3Q11A 3IUJA 1RQPA 3AUYA 1PW7A 3B1XA 1M1XB 4JU8A 2VDKB 3COYA 1OSNA 3IO5A 2ANCA 2ATXA 5GZ1A 4DR3B 1T3GA 3TQSA 4LBYA 2A14A 1D4FA 4W82A 1QKJA 3O8LA 1V3TA 2GZSA 4UMFA 3TKLA 3L8FA 4MQFB 4FGZA 1NC1A 4OV6B 4MQEA 1K2VN 3NVAA 3AEQB 2WDPA 4TRMA 2ODBA 1AM4D 1ZI8A 4PYKA 3G2QA 5KSZA 3WGKA 1CR2A 2CUZA 9MHTA 2I3GA 1GQ2A 3ABIA 1ZKDA 5AHWA 3V5NA 3PLNA 1MO5A 1WB4A 3VKUA 3G17A 1D2HA 3PKZA 4B1FA 1YB7A 3M81A 4LJ5A 5EWLA 2ZFUA 2FPGB 5I7UA 4X1KA 1TGVA 3OI7A 3FTFA 2IIPA 1O0CA 3AVWA 3BZWA 3R0IA 2ZVQX 5JZVA 1XZ8A 1USUA 2WWTA 1LSOA 3GZJA 4INOA 4IDCA 4CR6A 4RHTA 1QGUB 4MMYB 3ROGA 1KO8A 1L3IA 1VECA 3HZHA 4P54A 1X2BA 3ZGNA 3DBOB 4FOOA 2Q99A 2QENA 2UYOA 4MYHA 2B61A 2D5BA 4NARA 1XYGA 2HWWA 4C7XA 5JYEA 4ZDWA 4OI4A 3KQYA 1H66A 2GUGA 2FEOA 1WUYA 4HXEB 4JSYA 5A62A 4GKJB 1MIOB 3TMYA 5J4HA 1LKZA 2VP6A 3LWDA 4OB6A 4WEOA 5C4GB 2K5UA 1XVTA 3SSOA 1E59A 1U4SA 2W6JA 3BBLA 1ZEMA 4Q4AA 4J4TA 3ZDAA 2OWDA 1FSPA 4R98A 1AX9A 3RS8A 2NQTA 1XDGA 4MEJA 1FVHA 5K01A 4JB8A 5K09A 1TM2A 2QX6A 5DBHX 2OCLA 3RIYA 3JYLA 1E9AA 3E3AA 4MK4A 3UYLA 2HT6A 3GJYA 1OV6A 4Z9AA 3ITKA 3V80A 1JTVA 3PI6A 3C6YA 1E2LA 4G67A 4AP5A 1AJEA 4DMUB 1IJKA 1OWOA 2CDNA 3ITDA 5K1ZA 3LD9A 3COJA 1AT1A 1VI6A 1NQTA 1Z08A 2XMZA 4QYXA 1ULUA 2UYQA 4C1NA 1J0BA 2G7MC 4PTZA 3T15A 4DQLA 2VAXA 3L6RA 1YVPA 2IOQA 3TMKA 3P9XA 1LQTA 4H7HA 5LZ2A 1L4EA 3MC1A 2WJIA 1S8FA 3F74A 1O6GA 3GLGA 4CL2A 4Y6SA 1DELA 2HBQA 3FN4A 1KJJA 1U5BA 2ONYA 1DCTA 1UANA 1FBTA 1OPRA 1QE0A 3AR6A 5FBHA 4BP9A 5JNSA 1J2JA 5IU6A 3M4NA 1ZX1A 2F1HA 2C78A 3BFPA 3NGXA 2OUIA 2QLBA 2ZXEA 3V48A 3UJ3X 2NU7B 5GGXA 1X7WB 1QAQA 2XUGA 1L1RA 3EJWA 4BQQA 1YDMA 3L6EA 3R4CA 2WHQA 2QSYA 2BFDB 2BKVA 5DW3A 4Z2AA 1E1QD 4GIBA 2G70A 5IK2D 3BCRA 3B5JA 4UTOA 4ZCQA 4MYRA 3DMNA 2O2SA 1FX0A 2QZJA 4PLVA 2BONA 3FW1A 3FOWA 3CRW1 3A3YA 4DMKA 5HKOA 4FYJA 5EHZA 3AM3A 1Z22A 4IGAA 1WCIB 1R9JA 1O6CA 3HSKA 2X5OA 3GPBA 1OB2A 4ZQFA 4LW8A 4KR7A 3Q0IA 2HRCA 5H80A 2HSEA 4N76A 1GA4A 3KVRA 3TSWA 4DCCA 3E22B 1P91A 4KQKA 4PLPA 1QFSA 4BMOB 2HPZA 3SBEA 2G6BA 3CTPA 1F20A 4F91B 2YICA 1AGYA 1RE0A 4ND3A 4FGKA 3R6TA 4DIEA 1YJ5A 2CLEB 3GRKA 4MW9A 1H05A 3VDQA 1ULZA 1C3OB 1F8FA 1LA2A 3J7TA 8OHMA 4TWJA 1Z0IA 4MCJA 1EG2A 2GA8A 5DLQC 5LCXA 1E0SA 3HL4A 4IG9A 3ILHA 4XUGB 1DRUA 1JLSA 4F06A 2HNAA 3SG0A 1GSOA 1YS9A 1AGRA 2FPIA 3HJGA 2QV0A 1QMGA 2DLDA 3OX2A 2CEKA 3JQCA 1WCYA 1I30A 2QEQA 3KPJA 3WL3A 4CBVA 1AN9A 2I62A 3SS8A 4DDWA 4JKYA 2VDVE 1OIWA 3NIFB 2YXPX 5LMNB 5IPFA 1W93A 2QYSA 2AWNA 3A6EA 3GL9A 2MJLA 2MMGA 1GAWA 4QXMA 4ZRNA 3ZGLA 4UNRA 4IDOA 1QVVA 2FSVC 2VP9A 3UJHA 4IJUA 3TNYA 4ENQA 1WHSB 2ZIXB 1ZD9A 4EGCB 3DZBA 4H1WA 2JIRA 5EXEA 1Z4KA 1PE0A 4FXOA 4NU0A 2VDWB 1Y1RA 4YT8A 2FXIA 2HGZA 3U09A 1KNXA 3D4BA 3OQHA 1QIJA 4RK6A 2CNKA 3K4PA 4DDMA 1J1ZA 3ELYA 3KZMA 1YHYA 2HBYA 3S4YA 4E07A 1H8ED 1W5EA 1MX1A 2I71A 4GP6A 2H16A 1AZLA 2EX4A 5DRTA 2YCLA 3FKJA 4KQ9A 1XL0A 4NG4A 1O8BA 1P39A 1UMBB 4PZ9A 2EBWA 3O75A 4GYWA 1ZSYA 1TFUA 1NPDA 1LU9A 2ZBQA 2VPYA 2ZBFA 1DMSA 3LQ1A 1DXYA 1E2NA 1RXUA 2ZI4A 3OZAA 4M8IA 4TMVA 1SCQA 1YC5A 2EJVA 4TRJA 5EPEA 1AC5A 2VOEA 2X8LA 1K5GA 1Y8CA 4AP9A 1H2FA 2Y9MB 4MV6A 2WHEA 1OVGA 1GQYA 3C7TA 3QF7A 4F97A 4NMWA 3WKBA 3HU3A 2RGRA 1RLOA 3QEKA 2B0CA 1FFAA 2X5NA 4FTWA 3V2UA 1PZHA 3BIOA 4C7KA 4G0WA 4MP6A 3QXXA 3SYMA 5J4KA 1JA9A 2VT7A 3SJAA 3I2JA 1P62B 1UOQA 1M2VB 4GD3Q 3NW9A 4BEVA 4LY3A 5BWMA 4YRKA 4RLHA 2XWQA 5EHGA 3RSFA 5HR5A 2RH8A 3SS7X 4TXHA 1GZ5A 1PFWA 5TMBA 4CV2A 3WB0A 3WGOA 4Q9IA 3KZCA 3N5KA 5ENVA 5ARDA 4H6WA 5K51A 2WABA 2Z2XA 3DMTC 4PHHA 5DX0A 1IPEA 2V7BA 5J3JA 1X6VA 1Y5RA 2X40A 4DREA 2QT0A 4JI0B 4L28A 1JQAA 4A8PA 2E21A 4DFDA 3D2LA 1JDSA 1HC7A 5E95A 5GV8A 4AX4A 3BH6A 4DLPA 3MMXA 2ZVDA 2H63A 4I46A 5HW0A 2PMEA 3E4CA 1E20A 1GGHA 1NRJB 1C0IA 1TKRA 2FMIA 2ZRBA 2ZYTX 3KWJA 4JASB 3ROTA 3DUFB 4CKXA 4FD3A 4DRXA 3I12A 3U2QA 3BXXA 3OM9A 2Q29A 3A4MA 3SP1A 2ASVA 2YYAA 3KTAA 3KQKA 2FH5B 3BH7A 2HJSA 1STOA 3AKCA 4X00A 1BYUA 3NKLA 4P4NA 5IFLA 2GJ4A 2XVZA 5LQMA 2BMVA 3K9NA 2G9ZA 4AMGA 3AIIA 2NXCA 4ER6A 3GOQA 1K3UB 5TY0A 2FK8A 1EE9A 1T3LA 1TJ3A 3JQGA 1N0WA 1FQKA 1Y1PA 2OKGA 3ONNA 4IOLA 4MIOA 4N0DA 2XIJA 1NMZA 1Q11A 2V4UA 1IVNA 1U7WA 1X7YA 1T1RA 1ZM3A 3KV3O 3QEJA 4IIJB 5IZCA 4KOAA 2PSDA 1E7WA 4C6TA 1EQAA 4MCHA 4UNSA 1QHXA 1VPTA 4LJLA 2BKEA 2COKA 2XF8A 2YVQA 3P4XA 4BRUA 3KQNA 2B4QA 4I81A 4ESHA 4JOBA 4I1PA 2IDJA 3C85A 2X22A 1LSUA 2YJNA 1QV6A 4KZPA 5KWJA 1O4WA 1R0LA 4V2UA 1QB8A 3I09A 5GWXA 1YFZA 3P45A 3MJRA 4WXEA 1X1AA 3TSOA 2DHQA 3AR8A 1EB9A 4F96A 1QH8A 1YI8A 3O26A 3W1VA 1GZVA 2YIMA 3QMVA 3IVXA 1C0KA 4R41A 1KAOA 2X2PA 4WZBE 2KB0A 4MV8A 1MZPA 1HFWA 3W5BA 3G1WA 1F4VA 1VTKA 4N0EA 1T5SA 2HHCA 3N53A 4KYTA 1JQ5A 3Q7QA 2NUPB 4E51A 2HMWA 4FK8A 3SR4A 2QTNA 5AJZA 3QSYA 2CYCA 2W6MA 4IFEA 3WLKX 1EM6A 4M87A 3BQMB 3EMKA 4U2GA 4YH1A 3WAKA 1UKBA 2MSDB 1FP1D 1W6UA 3LRXA 5AUOB 1UWVA 4HVTA 5JNWA 1QP4A 3E48A 1S2NA 3RVLA 4RM3A 3R2JA 2C4KA 3V7FA 2R8PA 1TJ4A 1QFMA 1C0LA 5D8DA 1GLNA 3QLUC 3M3DA 3VTFA 2C77A 1QZXA 1JDPA 5LYJF 3R9XB 2B3DA 1H65A 4JXZA 1QFXA 4ND8B 2O57A 1R0RE 4MUNA 3W9BA 1XPRA 5B3JC 4IXTA 5BSUA 1DARA 2C4HA 4E4YA 1ILEA 2XA1A 3KKZA 5F7JA 2OFOA 3H9UA 1UJNA 2Q4EA 1P1CA 5KINB 2O23A 4CM4B 1N2EA 1SD5A 3DBRA 2VKQA 3IQGX 4QEZA 1N3BA 3ZI4A 3KHSA 1TAGA 1V41E 5JNTA 3H5OA 3P27A 2P5YA 1A8UA 4IV0A 4OMCA 5IWCA 1FLVA 3M1LA 4BO6A 2Y76A 5FUMA 3G0HA 2QU7A 3BILA 3TZHA 4BZZA 2V7EA 4KHZA 4IO0A 4K9OA 4FNOA 4LHSA 4Z9FA 3REGA 3UMBA 4EG7A 4EUSA 4HDCA 3QLVA 1Z5ZA 1Y8ZA 3DMRA 3R5KA 3BRWA 4MQEB 1KERA 4HNUA 2PGXA 2R4UA 3CF2A 4P86A 5CB0A 4YT4A 3MD9A 3PWZA 1Y98A 3IXQA 4U2FA 3V8PA 2F9FA 1I7DA 5JDIA 4V0KA 1QK3A 4NNOA 1I1NA 3RJZA 3WC4A 1LGYA 1RWXA 3MPUA 2R2AA 3HWSA 3AL2A 4X6UA 5K0FA 3I9V1 1HQKA 1D2RA 3E5NA 4UU1A 3WQBA 5DULA 3VXKA 2WD9A 4M9QA 3ZWYA 1OC4A 4FFWA 1JR4A 1OFUX 3QA9A 3DZFA 5EC8A 4C0XA 5A1JA 2AJBA 1UWKA 3CLSC 1SA0A 4WLNA 5KQMA 1KFJB 5F52A 3NB0A 1BHJA 3EXHC 3ILYA 2WJ6A 4MW5A 1BO6A 2LZ0A 4ZARA 3EGVA 4YDQA 5KREA 4LWQA 4XCVA 2DBRA 1KYVA 1WXDA 1E98A 3OPYB 2ZRPA 3A31A 3DKRA 4GI3A 5F5LA 3QEOA 1WF3A 4TL8A 1ADYA 1WY5A 4MR7B 1N2CB 3C24A 2JLXA 1Q15A 4O8ZA 1JSCA 3BRCA 5LD2B 1U9IC 1M6EX 4HEQA 4MV9A 1F7VA 2CK3A 4C6RA 4ZEMA 1ORHA 2HY7A 1O97D 1CUXA 3LGXA 2YMLA 2I2WA 3Q98A 5TV2A 2J0UB 1VGQA 1YHNA 4UCQA 2OCYC 1EE1A 3DUWA 1LLFA 1Q0ZA 3F90A 3IKLA 1Z2AA 3A3OA 1SXGA 2R8RA 1O96B 5CIQA 3EVZA 2OSBA 1BMQA 4A6DA 1B93A 5ES4B 1K92A 2B92A 3H11B 2PUVA 3AUXA 3I0NA 3OUUA 2VTBB 3A6ZA 4PBSA 1M34B 1NRWA 4M49A 5EAIA 4AS2A 4MJLA 4B3DA 2ZJYA 3ANSA 1JQJC 2BGTA 1GUFA 2VS1A 4E88A 5CXUA 1YTLA 4GEKA 5AFSA 3IIMA 2UVQA 4QULA 4X1YB 1MB2A 1ZGAA 5ED4A 2V1UA 3LVQE 4LZLA 2UAGA 1LDBA 5T4BA 4GI2A 1H3EA 2WWYA 4NL4H 3QKUA 4M1ZA 4G24A 3DDOA 2QGZA 2QTVB 2ZJ8A 4LV5B 5K3AA 4FM9A 2W93A 3I3SR 4CU5A 3PCXA 4FB4A 5A9SA 3GLHB 4E33A 4OXQA 1G291 3QLEA 4JA2A 2X5JO 3HXPA 1LX6A 3A0UA 2DU8A 2ZB4A 3UMSA 4F3RA 4YAUA 4G0ZA 2PUDA 1U1FA 4YO7A 5AKEA 2NYVA 1EEHA 4YAIA 5FULA 2V5UA 1BSVA 1LJUA 4YHHB 3IDAA 4GPTA 4J2OA 1GV0A 1QWSA 3A9CA 4LXXA 4OBEA 4NULA 5JZBA 3FOFC 2B1QA 2YH2A 2Z04A 3GFSA 1PKEA 1QS0B 1C9MA 4WDQA 3EA0A 5J9FA 1PDVA 1QVZA 1YACA 2MMCA 2QROA 3LK6A 3VYSB 4TV9A 3C8UA 4YMSA 1CJTC 1G21E 1NMQA 5B1HA 2DGDA 2VJQA 1AKMA 1IC6A 3L4SO 1I0ZA 4ZFNA 3TVYA 4ZGWA 4DCPA 3CX6A 1DX9A 1ZMRA 3EWAA 5JOQA 3U4QA 3Q7SA 5KYUA 1RWVA 4ZKDA 1BCSB 2IYUA 4EAAA 2EFEB 1QYCA 2BJVA 2H08A 2HSDA 3GGPA 4O4LF 4W5HA 4WRRA 3RAPR 2ZI7A 3HLTA 1ACMA 1O0SA 3AB7A 5CGZA 2QQ5A 3JQ8A 2V5AA 3J7AC 1G7RA 1TYDE 3BGOS 4OHCA 3G8DA 4KOEC 4WZAE 1EFVB 3A1CA 2OKCA 2B8WA 4AKTA 1UM9A 1CEEA 4DCNA 2IYZA 1KI6A 3QK7A 2W2TA 3AEUB 5PNTA 4MULA 3AHDA 1A9PA 2PTHA 4MWZA 4E6PA 2R1UA 3VGPA 5C32A 2F8SA 3D3EA 4V0LA 5DMXA 3RF6A 1ZMXA 3R40A 3OJXA 1P9WA 3HLKA 4L08A 4N5DA 4PQRA 4QJ4A 5DRYA 3SLRA 4YS6A 3KQWA 3THOA 2WQ6A 1LQUA 1TTHA 2AXPA 2OZKA 4UTPA 2PUEA 1ID1A 2A1UB 2AKYA 3B2EA 1WA5A 4G1CA 4NYIR 2VUHB 4ROTA 1MMFB 1VKZA 3NXSA 3T35A 2WD8A 4C5BA 5M5BA 4RDXA 3CKMA 1CY1A 2B4RO 3GC6A 4KYVA 4DA6A 3VOBA 3E2PA 4OGLA 4DSOA 3RFXA 1JIVA 3WMWA 1EIZA 5F7ZA 4Q1DA 1BGVA 1JKIA 4L8LA 1Y8QB 1GAJA 4HPJB 5BO5A 2JIQA 2K4MA 1R6UA 3D4NA 2YZ7A 2BMDA 2UV8A 3KFLA 4NYMR 2H7CA 2NT4A 3GNQA 2CJXA 3ESRA 1BHO1 1RHMA 2PK3A 3B38A 4GLFA 1A76A 2XTAA 1U2ZA 4WNYA 4NYIQ 1ST3A 4RBNA 1MC5A 1T2UA 1R8YA 2GT1A 5A4IS 5IZ4A 1AN0A 1WCWA 3GMSA 3I9MA 3ZD8A 3RAFC 3IPAA 1BDHA 1FP4B 4FFMA 4LE0A 1NRXA 2BEVB 4BGVA 3UCXA 4DDUA 2RARA 1TM4E 2Q3CA 3WQQA 1H5UA 1T13A 3A4LA 4GHWA 4CM5A 2NPIA 4JLJA 1G17A 3LOUA 2BGNA 1EU1A 1M75A 3MIZA 1WVGA 5CR9A 3ZPXA 3LZCA 4W7IA 3GDFA 1TJPB 2JKVA 5JMPA 3KOUA 3SOZA 2M32A 4RY2A 1H93A 1QHHA 3OKAA 4JGBA 1X1EA 1QO0A 4KDFA 4UU7A 1N9GA 1QVRA 4L0DA 3CN7A 4BZWA 2PWAA 1BVYF 2IHBA 3PIRA 2F00A 3ND5A 5EINA 5JJ5A 1ZNWA 2JB9A 3GWZA 2W4IA 3IDFA 4FEAA 2IYVA 5TPWA 3S1AB 5JNLA 1QVWA 4B0OA 3MTQA 2WA2A 4Q5IA 5AXDA 2C97A 2DHEA 2QG9A 1XNHA 5FOXA 3KEMA 5DBEX 1Z0FA 2UZ3A 4J1TA 1U2TA 4XQEA 5EMKA 1NR1A 3T1QA 3EPJA 3W3AD 1YXMA 4B74A 4C0QC 2Q6TA 1YR8A 3UATA 5BMVF 4AMUA 4ZZ3A 5BNIA 3ZH2A 3WRVA 3G9UA 2JPDA 3RAGA 1J42A 5AVWA 1ANKA 5BSGA 3K9WA 1L4FA 1U1CA 5EE9A 5A3VA 4WI1A 3BWBA 3F8SA 4EF5A 4XI9A 4Q7MB 4ZV7A 4QQFA 1W8IA 5KYYA 1C7FA 2WZDA 3DKVA 5GOZA 1Y81A 2A1TS 1E5QA 3GJ5A 3F6SA 1A8HA 5SICE 3GUZA 4CLRB 3ZHCA 5JSQA 1DC3A 3GFOA 4YJ2F 1I4WA 2QX7A 4GR5A 4WCFB 4BQNA 1LLUA 1E7RA 1PWHA 3DAHA 4ZCTA 5ELXA 2IEIA 1KR5A 1DFHA 3IEIA 2Z58A 2O8NA 3PNLA 3HE3A 1CXZA 1JU3A 2HK9A 4OOFA 4QBHA 5EP4A 4HGYA 5JHHB 2VJCA 4CQJA 1F17A 3ZCPA 3G9QA 1DC8A 3GJ0A 2PRZA 5CXSA 2H0RA 1PNTA 2DX7A 2HV9A 1QB7A 2ZRCA 3O5AA 1HT1E 4DXAA 2HREA 4RVHA 5EIOA 1Q2UA 4C78A 2AOTB 1KU6A 1FYFA 4B3TB 3KE8A 1ENZA 7MHTA 2GETA 4BKOA 4ZT4A 1EXDA 3GRZA 1XZQA 3PR1A 4H7IA 3N59A 2RH9B 2REQB 4MHSA 1HQCA 3DJYA 4YAFA 1OBCA 3HBAA 4L2IB 3U56A 1RU3A 1UC8A 1S2IA 2EW1A 3H4IA 3V1TC 4BQOA 3R5FA 1JZQA 3ICEA 2HXGA 1TJYA 1BVUA 1CZKA 2AUTA 4B48A 2C4UA 4PC6A 4WKPA 2VYNA 3OE7A 3GVPA 1TW2A 1F2DA 3R8FA 4WA8A 1KP2A 4LS3A 4KQMA 2OTCA 2X7HA 5ALLA 2BHRA 4AQ7A 2XDAA 2QY6A 1I7NA 2J07A 3WWDA 5EWJB 3L04A 3SE0A 4EKEA 4N9QA 5LL6P 4KLCA 1HDRA 2YJTD 4HB3A 1DKRA 3B20A 3NHUA 4JZYA 4U00A 2PZAA 3MXTA 3MOSA 5THXA 3WE7A 1AB5A 1CY6A 4OI1A 3L82B 3TLJA 1W88B 5AI8A 1M2EA 2CLLB 3SY8A 4JENA 4A9AA 1R0YA 2W37A 4TTRA 4R7ZA 1R0ZA 2DECA 1EDEA 2X15A 2PL5A 3ELBA 3LX6A 1JFRA 1NQUA 2YINC 3DLTA 4G2NA 4QQNA 4EKYA 1ZR4A 3EPKA 1GTSA 5FUQA 2ZBDA 4DOMA 2Q1UA 4DLSA 1Q7RA 3R44A 3WZLA 1YQXA 4B87A 4TWRA 3X1ZA 1M8PA 4M9UA 1VSQA 2PT5A 2W6IA 5AK5A 4ZVSA 3U37A 1RWOA 3KTDA 5EHQA 3VR5A 1LDNA 3QVVA 2FG7C 4L9WA 5IMSA 2B69A 1DG1G 2A67A 4LJ7A 4OQEA 5I9TA 4DANA 5ALHA 4DQ0A 4K87A 5JFTA 1WU7A 2ASEA 1V4VA 3FYSA 3CNEA 3ZWKA 4XIYA 4V39A 3K0HA 5BPFA 1Q7TA 1RTKA 1TYCA 1WB9A 4HWOA 2POQX 2QX9A 2YWBA 4V0NA 4EATA 3KLNA 4ZVVA 3RVKA 4P4LA 4PZUA 2N75A 2ZWPA 1SPBS 4YN3A 3PUWA 1KEZA 1BW9A 2Y4OA 3DP9A 4YRIA 2PVCA 2BR4A 1X1SA 2V7WA 5EKDA 4I3HA 1ZOOA 3DKIA 5IJZA 3MTJA 4MVJH 4N7MA 3Q3JB 4TLAA 4F6CA 4CDRA 4V1CB 1FXWF 4DZZA 4C1BA 5KX5F 4E70A 1DGQA 2XODA 2ECOA 3NT5A 1WMBA 2IU6A 3C1UA 3BBPA 2IPXA 3L8DA 2BZ1A 3F6BX 2Y1XA 4NH4A 4TZKA 2C61A 4XWGA 1HKUA 4H6PA 3HM9A 1BE0A 1VMEA 2HRZA 1E2QA 2BFMA 4JB2A 4B33A 2FEKA 1M2WA 4X62B 3PC4A 2ZKIA 5IVKA 3A6PC 2XRYA 3K0CA 4KR6A 2WVHA 2R1VA 1E62A 2IHZA 1J00A 5BV7A 2CV0A 1J1UA 2V6IA 4OGFA 4TMZA 3KJZA 3HZZA 3F1LA 3R41A 2WJJA 5C1OA 2HDNB 2PX0A 3GBPA 1ADGA 1DXQA 2YXLA 4TN1A 3W78A 4E2YA 4CUJA 2GCIA 2REBA 3AGPA 5FFNA 3MCVA 4NWIA 5FYQA 5KBYA 5IUKC 3ZWQA 1V39A 1XLUA 5D85A 5CDFA 2QGFA 1Q1QA 2EFJA 1XF9A 2H92A 3AL3A 3HDVA 2M6RA 4H1VA 3S2IA 2GZRA 4CL3A 3K2BA 4C30A 1GO2A 4URHA 1I5EA 1WHTB 4KXYA 4MP3A 4X1IA 1UJCA 3GJTA 4KR9A 2C4WA 2GH1A 3RUHA 1YS4A 1VDMA 1WPQA 2XCOA 2VDNB 5BN4A 3KPWA 3OCYA 3PQ3A 4QYMA 3T7TA 4NFLA 3P0HA 1L5SA 1G8FA 3MHTA 4TT3A 2OESA 4L8FA 1GTVA 4Q00A 4F6LA 4HQ6A 1AKTA 2COUA 5BSHA 3EOZA 3VKHA 1UXGA 1S9DA 4DTIA 4BJ5A 2GZDA 5C1IA 2CDCA 4YV2A 3KETA 1DAMA 5CIYA 2WJWA 1EFHA 1L5GB 3CONA 4ETMA 5K03A 4PSUA 3DEJA 1PWZA 3O3OB 4BFWA 1WR8A 3HMQA 3QYPA 4NMMA 1UMBA 3DHNA 4O6VA 2CK3D 1MXFA 5E8JA 3BK1A 4URWR 3WLLA 1NG9A 1PBTA 2DLCX 1DADA 5A6VA 2ZUVA 1IBRA 4XQ0A 4KNVA 3FPKA 5BR4A 2GO1A 1KJ8A 4HF7A 4D7AA 1UCFA 2Z5VA 2QNRA 3B3GA 3CR3C 3KAPA 3G2LA 2ZBEA 2VDMB 2ZRQA 3H2HA 3GJ7A 1GTZA 3B9RA 3W6UA 4MYTA 4EHHA 1KMQA 2YUTA 2Q5EA 3FZEA 5A5GA 4JITA 4WQMA 1G7CA 4M0UA 2CUNA 1R0WA 1UJ4A 4WACA 4J0QA 2C7RA 1KYYA 4UOZA 2ZZNA 3CQ9A 2XI4A 4JAVC 3FZYA 5EL0A 1UP7A 4WKCA 5C35A 3NTUA 5JJCA 4C2TA 2WFZA 3U4DA 3GLUA 2JJYA 4MR8A 3E84A 2ZYWX 3GLRA 3K70C 3N87A 3JQRA 1TYZA 5JBQA 4F1WA 1U6JA 3T54A 2I67A 5ILOA 4G5SA 5KNBD 5ECWA 5CDYA 1R9GA 2ZCVA 4B3FX 5NULA 5AJYA 3I73A 4MWCA 3UBTA 5AWFC 5BUQA 2VVTA 3OQ6A 1SC3A 3RIHA 1R6VA 4GRDA 2CDAA 2ZYAA 5FTNA 4YMVA 4M7WA 5A4FS 5EE3A 1LX7A 4E1VA 2O0LA 5HJEA 2LPMA 2VJBA 1H3FA 1C3EA 2YY6A 1KJNA 1WDMA 1PJTA 2CLOB 2HU8A 1G5TA 1DAGA 1JGTA 1V3VA 3HQ4O 3Q3IA 3OTWA 4ID9A 5AW9A 3RFFA 1Q17A 1OLSA 4W6ZA 3V1UA 3OU7A 2H48A 1P7CA 3IHTA 4OJTA 2OCDA 5TGDA 3ZDXB 1YFLA 4RPGA 1NVXQ 2D00A 4O0MA 1NUTA 4OHYA 1EVJA 1ZD3A 4ZCSA 4QO7A 5T41A 3U7EB 5JATA 1Z5GA 2ZI3A 3RASA 3VR4A 1NW3A 5HXAA 3AY3A 1G6HA 3LUGA 5IBPA 3IV6A 3T1TA 4ZAVA 2VQ6A 5EMLA 5KYVA 3WK8A 4EYGA 1Y9DA 1SBZA 4BFYA 5TXGA 2NM0A 2R7MA 1N7HA 3T3MB 5K7SA 2BY4A 4R9UC 4BGEA 1U1DA 1PZEA 3QE3A 3RYIA 5JCJA 1CP2A 3WYBA 1W30A 3TIXB 1V11A 2P40A 3OZVA 1YSCA 4G3XA 2YDYA 4JP5A 3VNSA 3SLGA 1XWIA 4KGVA 1GN8A 2O8DB 1MJFA 1KSGA 1YNSA 2H51A 1SFRA 3UUWA 2AD5A 3EEFA 5C81A 4AUMA 3EK2A 1R5BA 1ECLA 4JFAA 1IY2A 1W9MA 1K7XB 3ROZA 3P1JA 2VRCA 3QOWA 4X65B 5LIRA 5KJ1A 3OX1A 2ESRA 2WF7A 3BL6A 1WXGA 2Q9UA 2FN3A 2GBLA 3MVEA 4ZCPA 3OMXA 2IUUA 2PJRA 4LJRA 4GBED 4U39A 4XJSA 1NP7A 1C41A 4Q37A 5CEJA 1D1TA 2G5CA 2CYBA 1E9FA 2QZPA 1FQJA 4GPD1 4Q12A 3ZY5A 1PL7A 2IITA 1FY2A 4ZC1A 3KYBA 1AQJA 3ZLJA 3HO8A 1DG9A 4MPTA 5U1PA 1LSSA 3CH5A 2VNSA 4L5AA 4MAAA 1MOQA 4KZKA 5GY7A 2A9FA 1ZH2A 2F67A 4LZAA 3EPLA 1HSZA 1VJ5A 3GJSA 1GCOA 3SHQA 3HYNA 2JAWA 1TF2A 2WFAA 3GYGA 4UUQA 4FC6A 4J07A 4JVSB 4MV0A 4QG7A 1YTUA 2QV7A 4ARZA 2Q9CA 2ZYDA 5AO9A 2XE8A 3HBJA 3AK4A 3V4RA 2VHTA 1MOPA 1NWHA 1VC2A 4NPCA 1G5RA 3HSSA 3HJRA 3LY7A 2VUIB 2WD7A 4R4JA 3WMEA 3DM5A 3IJEB 2JLQA 2QDXA 4NVRA 3BWCA 1L5YA 1XCPA 3NHBA 4QGFA 3RVMA 3PQEA 5IN5A 1C9NA 4B3BA 3SC2A 2P91A 5C2JB 3NFRA 2VUTA 2Y71A 1CS4C 1GT6A 3AI2A 4P32A 3T3EA 2QRPA 1T5DX 1IDN1 3GLVA 4KSBA 3ZZ0A 5LP6A 1ND6A 3N5CA 4JUAA 1EFTA 2HMTA 3QELA 1VYVA 2HNBA 4QBIA 1ZMBA 4ZOAA 5LNK1 2WTAA 1GTRA 2VTKA 5EYPB 4KPYA 5BQFA 4N3AA 2H2GA 2IUSA 4BATA 1I80A 2CC2A 2FVXA 4CLOA 5E2BA 4GSKA 4W8HA 4U3JA 4ZAFA 2P0EA 1WQ1R 3HM2A 3M7IA 1Z0DA 4B3XA 3OTHA 1IWOA 4J1TC 3KJFA 2WTMA 4ZKEA 2CNNA 1H1LB 1UBFA 2VPQA 1IBSA 3PQFA 2EBUA 3F4BA 4MQMA 4OP2A 4EY4A 3QMMA 1Y3CE 2XLBA 1NQ5A 2RH4A 4U7FA 2ZUBA 4R5MA 2IUTA 5HQJA 4ENRA 1JVNA 1JDNA 2BVNA 2OBLA 1W0CA 2QTWB 1M73E 3N28A 4Y0NA 3PX3A 3TR0A 3VR6D 5B6PA 2Z98A 1F38A 5F73A 4G37A 2OFFA 2GN8A 3L18A 3WLRA 4RTSA 3MCWA 3D5QA 3FRIA 1N2CA 3MJCA 4DNPA 2HYIC 3LQKA 1OA1A 4BO2A 3NYRA 5I9LA 1X77A 4BE4A 2AFHE 5KS2A 1VIDA 3H1TA 1BCRB 3P71T 3ZQKA 3ZV3A 2AKEA 2ZJ2A 4EUNA 4WT7A 5TMEA 3EFEA 4EITA 3DF9A 4MZXA 4W1SA 1Z33A 4CLHA 4OX9B 1TU0A 1OT3A 3ESCA 1MOZA 5AD1A 1FMCA 3IC5A 2WV7A 1I9GA 2E4WA 4K7JA 2X6QA 3EVCA 4MQLA 2RAUA 4OCZA 4ZVTA 5HKKA 4YRMA 3WL8A 2RSLA 4CM8B 4OIMA 1FUUA 4LSGA 4LVOA 3NT4A 3WLQA 4PSAA 2VF5X 3E3NA 1QYVA 3W6ZA 5KI6A 1AIPA 2GCOB 2XMBA 3ADOA 3FPGA 4YASA 2OC9A 4JVMA 4L95C 1H1TA 3GCDA 1AHIA 1YRBA 1YZUA 3KUUA 3EIHA 4HNSA 3UAGA 5ALNA 5FADA 4ZI7B 1PGQA 3PK0A 2RHTA 5F3WB 1OBOA 3QFCA 4LZWA 2D6FA 1ISSA 4N47A 4B4WA 3OIDA 1VHLA 1RTTA 3PZRA 4D79A 4WX2B 1ZJZA 2VJNA 2BSAA 4DV2B 3EF3A 4GXQA 4JBNA 4P83A 2AEJA 2ZB2A 3B82A 4H6VA 4EH1A 3NRCA 4ZGBA 3FSEA 2A5DA 2B5OA 2WPDD 2BLNA 2I4OA 3RUAA 3EQ6A 5JFOA 2EF0A 4CG0A 5EJ8A 4X63A 3SJZA 2Q1TA 1ZH4A 5T57A 5LDDC 4PLHA 4K6GA 5L3QA 3FGNA 3N8GA 1RQXA 2XZOA 3BIWA 3CNLA 3TCXB 3QJYA 4QXOA 1IL0A 5BR1A 1RBMA 2Q2NA 1KFEB 2JAHA 3N1UA 4FP9A 4BKRA 5T4HA 1REQA 2XKKA 2L19A 5REQB 1N78A 3NIWA 1D2AA 1NAIA 1PJ4A 3OIGA 4LRSB 1W5SA 4D43A 2IVFA 5K0LA 3JY6A 1W94A 2VZ9A 3PD0A 1I2AA 2UUOA 1RXCA 1OLSB 1VHQA 2J3EA 4OGKA 1SUCA 4L8GA 3FMFA 2CBXA 3VUEA 1L5NA 1EP1B 2J3DA 2X4IA 3KVVA 4MKGA 3ODGA 1JHQA 3PFWO 4R1LA 4HR7A 3BMOA 4ZZIA 1L6IA 1Y7TA 1B2RA 3EZXA 3ISVA 4H1TA 4W6QA 1N2JA 4AJHA 3VSAA 5I45A 5IAAA 1GZSA 1K4YA 2QRQA 3AMVA 1N33B 1ZD5A 2YWEA 1J9GA 5CD9A 2UUAB 1C7IA 1CFZA 1Q1AA 1QQ6A 1TA4A 5E7IA 1LBEA 2XADA 5BWCA 1TTQB 3OZRA 4IR7A 2WSLA 5CPFA 5EJ7A 1U0GA 1GVNB 5IJXA 1YAHA 2AR9A 5EZYA 3QKTA 3PDCA 3TNJA 1SUAA 5F4BA 3VI3B 3FAZA 1NUPA 4NOJA 1JAZA 3R74A 4OQYA 2F2TA 5KSWB 1V5FA 3K0FA 3QKIA 4KODA 2JFNA 2O06A 3DV9A 2QG6A 4TZ0A 1DCFA 3LT5A 1FJ2A 1E2GA 5FFFA 3EZNA 1OMOA 2FZGA 1IJBA 1SKQA 1T91A 2YYYA 4PC3A 4W9NC 4GR9A 4E6EA 1M5RA 1SEVA 1KDOA 4LXQA 4M88A 3RVOA 2BOVA 3T0IA 4D97A 3KUKA 5JDCC 2M6SA 2VYCA