3DS8A

The crysatl structure of the gene lin2722 products from listeria innocua
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
253
structure length
253
Chain Sequence
DQIPIILIHGSGGNASSLDKMADQLMNEYRSSNEALTMTVNSEGKIKFEGKLTKDAKRPIIKFGFEQNQATPDDWSKWLKIAMEDLKSRYGFTQMDGVGHSNGGLALTYYAEDYAGDKTVPTLRKLVAIGSPFNDLDPNDNGMDLSFKKLPNSTPQMDYFIKNQTEVSPDLEVLAIAGELSEDNPTDGIVPTISSLATRLFMPGSAKAYIEDIQVGEDAVHQTLHETPKSIEKTYWFLEKFKTDETVIQLDYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crysatl structure of the gene lin2722 products from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin2722 protein
total genus 87
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ds8A00
1TQHA 3FYUC 4C01A 2YXPX 4J3JA 2QXTA 3I2HA 3M83A 4ARBA 4QWMA 3IBTA 1ZD3A 3R41A 4QDTA 1QO7A 4BCDA 2Y1KA 1EVQA 1FJ2A 4BC1A 4DMKA 4UBKA 5ALVA 2WKWA 1E3QA 5DYYA 3GUUA 4ITVA 1YB7A 1U4NA 3FBWA 4OYYA 4QDZA 4MYDA 4UBMA 2PPLA 2H7CA 1VXOA 1DTEA 1CUSA 4KRXA 2I3ZA 2WG2A 3FLAA 3H2HA 3TJMA 2XMRA 1B6GA 3MVEA 2WFMA 1N8SA 3FLBA 2GYWA 4B0OA 1XRRA 2Y2VA 2Q0XA 5AI9A 1G5FA 2FUKA 2QMQA 5JADA 5ALDA 4UBIA 2XE4A 3I28A 5JD4A 5ALSA 2EDCA 4GHWA 4AO6A 4RE6A 2CZQA 2O7RA 3UMJA 3LLCA 3SWWA 1XRLA 5ALRA 1HQDA 4Q82A 4UBLA 1EA5A 4ZV9A 3C45A 4DLNA 5D6OA 1XFDA 3L1HA 4P9NA 2XMGA 4LXHA 2Y6UA 5AKJA 5C7YA 2FJ0A 5CBKA 4H7FA 3WK4A 2CB9A 1O6GA 2K2QB 3I2KA 2WFLB 3G0BA 2O2IA 1MTZA 3I6MA 3W2TA 1EI9A 5CRIA 3V1LA 1GQSA 3WK5A 2WIGA 5CT9A 1F0PA 1XLUA 5JD6A 2JGFA 1MN6A 5JASA 1UXOA 1QFMA 3KWJA 1MNQA 3R40A 3AFIA 2H7XA 1WB6A 4W1PA 4KACA 2DQYA 4Y9SA 1WB5A 3HC7A 1HBJA 4Z49A 5A6VA 3WK7A 3WL7A 3KXPA 4K6KA 3VJKA 4CFSA 1WHSA 5ALKA 4KJXA 1B41A 1HLGA 4WY8A 5CT6A 2VATA 5E2IA 1QJ4A 1XZAA 3AZQA 3FWHA 2GBFA 3VVLA 3F67A 3C87A 1CEXA 2HA4A 2HA7A 2DHEA 5I8PA 2JGKA 3RK4A 1XZCA 5ALNA 4H7IA 3ED1A 3U1TA 3QVMA 2PUHA 4ZGBA 1LPAB 3LCRA 2VT6A 5ALFA 4ARAA 4CCWA 4WFIA 4TPKA 1TIBA 3D2BA 4Y2PA 2CEKA 2XMDA 4M0EA 2QOEA 4X6YA 3KSRA 1XZLA 1VE6A 4DIUA 1YASA 1IUOA 1EH5A 3O95A 2QRUA 4FWBA 2ZSHA 5LZ5A 3H2GA 1VA4A 3EIOA 1J1IA 2WUGA 3GFFA 4J0IA 4O08A 4U2GA 1GKKA 3T52A 1TRHA 3IDAA 5HF9A 4GEGA 2OGTA 2XQIA 5KBYA 2ZYHA 2WUDA 3WL6A 4DM7A 2HA3A 1JU4A 4MQLA 3DD5A 4DMCA 3WWCA 4Q3LA 5IVKA 5K3DA 3W9UA 1ODSA 1YAJA 1K8QA 5JZ9A 1BCRA 5DNWA 4H7HA 5KWIA 4OB8A 1LGYA 1R9NA 1H23A 2G5PA 5ALLA 3DL4A 5AI6A 1HPLA 5T4FA 4KRYA 5CURA 1AC5A 4BBZA 3FSGD 1W76A 1N5RA 3IA2A 1MU0A 2PSHA 1O6FA 1VJ5A 5K3AA 1J06A 1A88A 2HFJA 5A7HA 1LPPA 1DT3A 4JYPA 2HU5A 3WZLA 5BWCA 1L7AA 1QIEA 1EK2A 3S2ZA 3QPDA 5K5EA 3HI4A 3G0IA 3FVTA 4ZV7A 5DTJA 4G4GA 3CCCA 4HS9A 1SFRA 4C87A 3WIOA 5A7GA 4TGLA 4PF1A 1QIGA 4DSAA 4J0CA 2Y6VA 4GXNA 4JUIA 2ZYRA 4AN1A 1A8SA 4U2CA 3ICWA 2RONA 5AJHA 5AM5A 1XRQA 3GA7A 2HA6A 3WWOA 1EX9A 1UWCA 2V96A 2XMSA 3NUZA 3NWOA 2VQ6A 1ZGBA 2YH2A 3CXUA 4Q1VA 1N5MA 1ZD5A 3LIPA 4U2DA 3IVMA 5ESRA 4C4ZA 2XMZA 2VEOA 5ALIA 1BE0A 1CUAA 5T4HA 5ALTA 1CPYA 5EHZA 4MQMA 2RIPA 1K63A 5ALYA 2OCGA 4DTCA 1QOZA 2C58A 4BVLA 5LLSA 1MX5A 1H2YA 5DJ5A 2B61A 5ISMA 3ANTA 3DDUA 2JGIA 5DYTA 1UKAA 4BRSA 1GPNA 3FYTA 4TVKA 1DX4A 1ZJ5A 2ZYIA 1UOQA 4YASA 2CUTA 3DYIA 4IH4A 2JGEA 4YX9A 5FPQA 4CI9A 5IVHA 4YK7A 3W06A 4EUSA 3WA6A 2XDWA 1CLEA 1MJ5A 1XZDA 5JIBA 1WB4A 5HCUA 3C6BA 7YASA 3W9BA 1GGVA 1ACJA 3LS2A 3PF8A 1J07A 1Q0ZA 5JZBA 4Q34A 5CXXA 2BUCA 4MEBA 4MJ3A 4KE6A 3R3WA 3JW8A 2XLCA 2HA5A 3O0DA 3SC2A 5AKYA 1BCSA 2XUPA 4X94A 3IULA 1TCCA 2HDWA 1ZD4A 4ETWA 1CV2A 5A62A 2PM8A 1NX9A 1LPNA 2C4HA 3D59A 2VAXA 1QO9A 1CUJA 1YR2A 4J03A 5FLKA 5K3FB 1IUPA 1CUWA 2H7YA 1LZKA 3STWA 4OPMA 4QLAA 1UOOA 2VTVA 3W05A 2RGUA 1WM1A 2OGZA 2X5XA 5CW2A 2HRQA 2WTNA 4KE9A 3VVMA 4GECA 3G7NA 3QH4A 1QIIA 1Y37A 1CUEA 1F8UA 2DQZA 5E4TA 3C8DA 4OUKX 3WJ2A 2OCLA 3W04A 3STYA 4H7JA 4RE5A 1RP1A 2XUQA 1CQZA 1KU0A 1SOMA 4J0KA 1CIJA 2DHCA 2XUGA 3CN9A 4M0FA 3QITA 4X85A 3E4DA 2I78A 5A71A 1TAHA 4H18A 1IUNA 2WIDA 5K3BA 2XQJA 1R50A 1YS1X 3ESAA 1R1DA 4AZ3A 2PBLA 2WUEA 3H2KA 4Y2SA 3U0VA 4C4YA 4FTWA 5HZGA 2AJLI 4J0HA 3BF8A 3BE8A 3TGLA 4G8CA 1H2XA 3DKRA 1AURA 3HABA 4AX4A 1QIFA 2ACKA 3E0XA 3WWDA 1LNSA 4Y2YA 2O2GA 1H22A 3F96A 1KEZA 4AXBA 4W1QA 4G1FA 2VJAA 1THGA 5AIAA 4QEKA 4FFWA 1Y7IA 2D0DA 5FV4A 4IO0A 2QTBA 5AO9A 3GROA 1CUCA 4AZ0A 2C0PA 4EZIA 4UHEA 3WK8A 1UK9A 5AP9A 1CUHA 4MWSA 1LLFA 1C7JA 4K5QA 2WHPA 2EDAA 1G42A 2Y2UA 1DINA 5T4EA 4C6HA 3D5EA 3H0CA 5CH8A 4KE7A 4MXDA 4B6GA 4BP8A 1RWQA 3DYVA 4X7BA 5K3FA 3K2IA 1TK3A 4H7DA 5LIPA 5D3ZA 1QLWA 5AK3A 2ES4A 3BXPA 1EB8A 4HAIA 2EEPA 3E1GA 1GKLA 2RHWA 1U8EA 3IUJA 3OPMA 4UFOA 4KEAA 5JALA 2Z8ZA 2C5FA 2XMCA 4FLEA 2QZPA 2WTMA 4RNCA 4JEIA 5JATA 4HXGA 2OPHA 5JAHA 1MPXA 1DQYA 4YPVA 3AILA 4BCBA 3WYNA 1GPLA 2OG1A 3ZLVA 3JYHA 5EIHA 3DNMA 2ZJ6A 5AI4A 2PSFA 3R3VA 2VJBA 3BDVA 3ESCA 6YASA 1OILA 1UFOA 2GBCA 4FFVA 4G8DA 1XLWA 1CR6A 4X90A 4EY7A 1W1IA 3FOBA 4DMHA 4QDXA 2WJ4A 4ROTA 4K6HA 1BEZA 2B4KA 2VSQA 1U65A 2GZSA 4WCVA 1XZBA 3FNBA 1GZ7A 2V98A 3HLKA 1E5TA 1AZWA 2H9YA 1XZFA 1AGYA 3SK0A 4A23A 4BAUA 5IVIA 3ESDA 1SCKA 4XX1A 1EDBA 2WLSA 4BB0A 4F60A 2WIKA 3V1KA 1FFDA 4DYHA 3EQ8A 3F9CA 3QBJA 5YASA 1XRPA 3WKBA 4AB1A 2I03A 1X2EA 3TRDA 3RKSA 1L7QA 2WHPB 3A2LA 2PX6A 4PV7A 3R0VA 1VKHA 1IMJA 2RI6A 4PQEA 3R3ZA 3WWPA 3KD2A 3TEJA 4XVCA 2GYVA 4E46A 4KAFA 4DMFA 2OCKA 1U2EA 1WPRA 4BZZA 3K9BA 2HL6A 4QDUA 2O7VA 4U2BA 2AJDA 4UFNA 2RAUA 3ZLTA 1EK1A 1TKRA 1XQXA 3WA7A 1IVYA 4Q3OA 1XROA 1XRMA 5AI8A 2GZRA 2PVSA 1MAAA 4B0PA 4E11A 3ZLUA 5E4JA 2ZYSA 3BWXA 1VZ3A 3A70A 4UBNA 3WYDA 4EA6A 1GPKA 4LKOA 4X71A 4C89A 1XQYA 5AM0A 3STUA 3DKKA 4P92A 1XKTA 4EY5A 3G9ZA 3H1BA 4X91A 2XUIA 4FDMA 5FRDA 2IIVA 5JZSA 1QTRA 3WI7A 4OU5A 2QS9A 1NU6A 1K5PA 2P8SA 1QIKA 1P0IA 1ZIXA 5JD5A 4OYLA 3RM3A 2NW6A 1X2BA 3PICA 1PFQA 1F0NA 3FSGA 4J0GA 3QZUA 3AJAA 3UUEA 1HL7A 4H0CA 1MNAA 2WG1A 1QFSA 4Y2XA 5FDFA 3F98A 3IB3A 1S8OA 1DQZA 3LP5A 3KWFA 4NZZA 2W22A 3HACA 4WDRA 1SC9A 1JU3A 3EQ7A 1J2EA 4KYVA 4UHBA 3DOIA 5AM3A 5HKAA 3I6YA 5C8ZA 1ZI9A 3VJMA 1DX6A 2AJCA 1QONA 3D2CA 1EXWA 2ORYA 2PSJA 1LPSA 1XQVA 2PL5A 1FFBA 3H17A 4S0XA 1EDEA 4NS4A 1A8QA 5ALZA 2XUDA 4DNPA 3BF7A 4L9AA 5LZ2A 4UUQA 4WY5A 4G4IA 2QKYA 2HA0A 1A7UA 2WHQA 1YCDA 4X3CA 2WU4A 1XKLA 2DHDA 2V97A 4N8SA 3VJLA 1OCEA 3B5EA 2O2HA 2LIPA 5C8VA 5AKIA 5LKAA 5JANA 5A2GA 3CN7A 1XZKA 5HK8A 2QT9A 4M0MA 4Y2UA 2HADA 1VLQA 1E8MA 5JARA 2QJRA 1ETHA 4W63A 4WDQA 4WFKA 2JGJA 3STXA 3I2IA 1CRLA 1JMKC 5EHXA 2WJ3A 4X6UA 3MUOA 3G9XA 1E89A 5HF5A 2JEZA 4F21A 4QZVA 2BCEA 3H04A 4LYDA 1K6EA 3ZV7A 5FOQA 3G02A 4UHDA 1MAHA 2BKLA 3OG9A 1BN6A 1VXRA 4B83A 4INZA 2HU8A 1DT5A 3WKCA 3FYUA 4DNFA 4CIBA 1CUGA 2GBGA 5F4ZA 1SCQA 4IQ4A 2HIHA 2JF0A 4Y7DA 2YYSA 5DNUA 3YASA 4GDMA 4HTAA 1M33A 2Z8XA 3WQHA 4NVRA 4OU4A 1LPOA 1T2NA 2JBWA 4QNNA 1AX9A 4CIAA 5HK9A 2ZJFA 5AOAA 4W9RA 2WSLA 1QIMA 2CKMA 4BC0A 4DNOA 5JYCA 4PSDA 1EHYA 2RHTA 5AIBA 5AKGA 4LXGA 1R3DA 1UK7A 2QJWA 5AK6A 3O4HA 3S8YA 1CUXA 3WK6A 3DQZA 5LP1A 1KU6A 4GW3A 5HKBA 2FX5A 5H3HA 2C0QA 3WZMA 3D4LA 4BYMA 3BJRA 4KAAA 3N2ZB 2OGSA 3WMRA 1CUIA 4UHCA 3I1IA 4B9EA 4PSUA 1LBTA 1YA8A 3P2MA 3A2NA 1P0MA 3IUNA 3X3HA 4ZI5A 3PE6A 4ZXFA 2JIDA 2ZSIA 3QPCA 2JGMA 2IX9A 5ALWA 1K4YA 1EB9A 1NU8A 4MYSA 3PF9A 5CTAA 4QA9A 2XUKA 1UZAA 2XQGA 4BVJA 1F6WA 4XIIA 2HRRA 3DEAA 4G5XA 3RARA 5ALMA 4CCYB 1E8NA 4H77A 3ZWQA 4FBLA 3BIXA 2WFLA 3C70A 1C4XA 1E66A 3O9MA 4QE3A 5ALEA 2BAGA 4UFPA 2ECFA 1ACLA 2DCMA 2HM7A 4ZREA 4PW0A 2OLEA 4UHFA 3WL5A 3WKDA 3L1JA 1OXMA 5AICA 5SYNA 2OAGA 1VE7A 3DJYA 4N5HX 1LPMA 5EHQA 1QE3A 1W6RA 4GLBA 1ZJ4A 2QXUA 1AQLA 1CUDA 1N1MA 5J3JA 4KR0A 3AIOA 1JJFA 2QM0A 5CXUA 1DWPA 2PU5A 2XQFA 4LHEA 2XUHA 3AUKA 1LZLA 3VDXA 1C7IA 4DNQA 1DWOA 4BTVA 1BEEA 3MGAA 3H1AA 5HF8A 3R3YA 1BROA 4Y2QA 5BV7A 3QMMA 1QIHA 2DR0A 4OD0A 5AM2A 4G8BA 1ZI8A 2YASA 3BL8A 5FKJA 3WKEA 4I19A 3C5VA 3QMWA 4WFJA 5BOVA 2XI4A 4QWWA 4B7ZA 4AQDA 3AIMA 3QMVA 1XRNA 5ALJA 3EQ9A 1VA5A 1HKHA 1P0QA 4Y2JA 3VKFA 1FFEA 3ANSA 4U2EA 5HFNA 4MEAA 4UBJA 4X95A 2WFZA 1FFAA 2G5TA 1BU8A 4OSEA 2OXEA 2JGLA 2XT0A 5AOCA 2VJDA 3R3UA 2GBIA 3SX4A 1G66A 4KAJA 5CMLA 4B9AA 4BDTA 1LBSA 5T4BA 2WG0A 4QLOA 3FAKA 3G0DA 5I9IA 1D07A 1CFJA 5ALGA 1I6WA 3H2JA 2BGRA 1ZIYA 4Y2VA 5EI5A 5KREA 3B3QA 5LZ8A 4K2AA 3WKAA 1QTIA 3PUHA 1RYYA 1CUBA 3WWEA 3AZPA 4Q3KA 5LYYA 5AKZA 2XMQA 2IITA 4E15A 3FCYA 4FNGA 3D2AA 1YAHA 3MUNA 3G9TA 3K6KA 3V1NA 4MWTA 1CVLA 5K3EA 3O4GA 3EBLA 3OC0A 3O9VA 4OB7A 3JWEA 1XZJA 4Y2TA 5E4YA 5EHNA 5ALUA 3HZOA 4AO8A 1L7RA 2VA9A 4H35A 3PI6A 1CUYA 4H7EA 2W6CX 4CG3A 4F5ZA 4J0JA 1P0PA 2CJPA 2QUAA 5FP0A 2VT7A 1XQWA 2HU7A 5EFZA 5C81A 4PNZA 3ZPXA 1Q0RA 2FJPA 3FVRA 4BE9A 3D3NA 3HXKA 2E3JA 3O4IA 3A2MA 1R4ZA 2XUFA 5DYWA 5KWJA 5CT5A 1G4HA 3AZOA 1JKMA 2VJCA 1ORWA 5AM4A 3KDAA 3HEAA 4QDOA 4RGYA 2ONCA 4OCZA 2G63A 4EBBA 2JEYA 4V2IA 4IH9A 2ROQA 1EDDA 3UUFA 3DS8A 1YSCA 3FYUB 1R88A 3C43A 1XZMA 4FLMA 2DSNA 2WQZA 4C88A 3ICVA 3DOHA 4BE4A 4XJVA 4HRXA 4K6GA 4EY8A 2XUAA 4XWGA 5AKXA 4BATA 2PUJA 3IUQA 4ZRDA 4FNMA 1UK6A 2PU7A 5DLPA 4CG2A 3G0GA 3I2GA 5DNVA 3BJMA 4AN0A 4HZGA 3DCNA 5LZ7A 4BDSA 1USWA 5AI0A 4A16A 5ALXA 2B20A 1DU4A 1ZD2P 2D5LA 2R11A 4P93A 1EINA 1MO2A 3DLTA 2HA2A 3I2JA 1ZI6A 1E8DA 4H7KA 2WIFA 4X92A 2ZJ7A 3I1YA 4EY6A 3VXKA 2X8BA 5I7UA 4AO7A 5EIEA 5LKRA 2Z3ZA 4I4CA 1H2ZA 1QGED 4BAGA 3V1MA 4G4JA 2WJ6A 5LZ9A 4X6XA 2J3QA 5IVDA 4GWLA 1WHTA 2BFNA 1MX9A 5FPPA 2AJBA 4PO3X 4FHZA 1X70A 4RPCA 5AHXA 5A7FA 1QIDA 1AKNA 3STTA 4FLFA 4BAZA 5HQ3A 1TCBA 5FUMA 3G8YA 2ACEA 5D7BA 1TCAA 3OM8A 4N5IX 1SCIA 3OTQA 2BUBA 5LZ4A 3M82A 3FLEA 1JFRA 5AKKA 3QPAA 1UKBA 5EGNA 4X93A 1XZEA 4E14A 4FKBA 4FOLA 1YB6A 3IIIA 2H1IA 3R3XA 2J4FA 5D3KA 1AMNA 2J3DA 3BIWA 2Z5GA 2XMBA 3I2FA 4EB0A 4KE8A 5AK5A 3NGMA 1VZ2A 3LIIA 2QR5A 4HXEB 2OCIA 2XUJA 4ZWNA 1W4LA 3HRHA 2ZVDA 1Q84A 4U2FA 3Q8WA 3OURA 3M3DA 2PSEA 2XLBA 1ZOIA 4LIPD 1ISPA 1UT6A 4B84A 3HYSA 3GZJA 1IZ7A 5HFAA 3H2IA 1W52X 4BTLA 1W75A 5AH0A 4B80A 2X76A 3C6ZA 5CH5A 3PDCA 2CBGA 2WUFA 1R9MA 2XUOA 2Z3WA 5SYMA 5DWDA 2WU3A 1CUUA 2J4CA 4BRZA 1WPXA 2G4LA 5AKLA 3V48A 3ESBA 1JJIA 3QYJA 3IUMA 3WK9A 2R8BA 5AKHA 4F0JA 1WOMA 3C8HA 2WILA 5FXMA 5JAUA 2XB6A 4N8DA 5C8XA 3OOSA 4W1RA 3E3AA 1UK8A 5AI5A 3F97A 1GXSA 5JAOA 5DTIA 3QM1A 4LXIA 2WHRA 4J0DA 4JYMA 4BCCA 4EHBA 4B85A 4X97A 1FFCA 3T4UA 3AINA 2AJ8A 4L0CA 3M81A 2QVBA 3GBSA 4J7AA 1H2WA 3EF3A 4HXFB 3C6XA 3G9UA 4C4XA 3DL7A 4N8EA 5EIAA 4AMZA 3V9AA 2HFKA 4UHHA 1XZIA 4Q05A 5ALHA 2B9VA 4GI1A 4D9JA 3ILSA 4NMWA 3STVA 1CUVA 1EVEA 1CUFA 1JI3A 3GELA 4UPDA 4FBMA 4Y2RA 1ZICA 4A5SA 1BRTA 3F8SA 3WJ1A 4DSZA 2PSDA 3I6ZA 3C5WP 1ORVA 2AXEA 1FSSA 1LPBB 2XQKA 1BS9A 2QUBA 4B81A 3IURA 2VAVA 4JH0A 4IHAA 4PSCA 1UOPA 4L72A 4G9GA 1AUOA 2OQVA 5HQ3B 1IZ8A 3HSSA 3NOXA 1CUZA 5ALPA 3N0TA 1QIJA 5CH3A 1YS2X 5CT8A 1ODTC 1ZGCA 1ODCA 4DGQA 5CT4A 3Q0TA 1T4MA 2C7BA 1Q83A 1GQRA 3G0CA 4JNCA 5IKXA 2DFPA 3CCBA 2BGNA 4BVKA 4I3FA 4X00A 1MX1A 2VF2A 5ALQA 2HHAA 3A6ZA 4UBOA 4HRYA 1UKCA 3BDIA 1JJBA 3PUIA 3PFBA 2I3DA 5K3CA 5BWBA 5AKEA 2WM2A 5JAPA 4IH1A 1MT3A 1YA4A 3WIBA 2PKYX 4BP9A 3D7RA 3VISA 3WLAA 3RLIA 4HVTA 1XZHA 2WIJA 4W1SA 4AMYA 3D0KA 2OAEA 4CG1A 5IH7A 2BJHA 2GYUA 1QZ3A 2V9ZA 1Y7HA 1DWQA 4B82A 1XLVA 1CQWA 4BZWA 4L3WA 4GBGA 3H19A 2UZ0A 1PJAA 2OQIA 4CCYA 3H18A 4G9EA 4FMPA 2BUAA 1VOTA 3KOOA 3AIKA 1THTA 3PFCA 3WL8A 3ZI7A 5AM1A 1GT6A 1A8UA 5ALOA 1HDEA 3HJUA 1Z68A 2C5GA 5AK4A 1PV1A 4WJLA 1BN7A 1WCYA 3L1IA 2CMFA 3C6YA 5HF6A 3FCXA 1JMYA 4P08A 3B12A 3O4JA 1JT2A 4LYEA 5AOBA 1XZGA 4OB6A 4EY4A
chains in the Genus database with same CATH superfamily
5DMXA 1HWYA 2CE2X 1TQHA 3K0FA 2OR3A 1QC5A 3E18A 3CINA 3IRVA 1WTCA 2XCOA 3M6FA 4L4YA 2SICE 4M49A 5HG0A 4DBLE 2E82A 3G79A 4OQLA 4OMFG 5DKFA 5KUTA 4EFLA 1GQQA 3UJPA 4TV8F 4B6QA 5JRDS 5JNLA 1WDWB 3R09A 2X0DA 1BHO1 3G1WA 5DI3A 4C01A 2YXPX 1RAEA 3QIAA 2RI0A 1EHIA 2QXTA 3SXUB 1KTVA 2BFBA 5JJLA 1R9GA 4WCFB 3VR3A 2ZZNA 1YACA 4G67A 4QDTA 3PHBE 3VGJA 3OZXA 1QO7A 4YRCA 3P2OA 4V03A 1WW2A 1YBAA 2R8OA 3MT8A 1SHTX 4B3GA 3BB3A 1T5HX 2REQA 4CIWA 1GL7A 4BC1A 5COAA 2P7IA 1TVKA 3PQEA 3TI7A 3V4FA 4PYNA 1E3QA 2FJUA 5J9FA 5JSYA 4POOA 3S81A 4P36A 3W2FA 1R18A 3GUUA 3MTGA 4ITVA 5M2QA 1JIKA 3WLTA 4QDZA 3O7WA 2JB9A 3AEKB 4KW7A 3O5AA 3RS4A 4DHWA 1PNRA 3LU1A 4UMFA 1KYVA 1QPZA 1XTBA 3GOHA 1KJJA 5BV8A 3DAOA 1ZCZA 2IELA 4TXJA 1ZK2A 5J2TF 4RENA 5A5DA 2YC4C 4JLNA 4NXMB 4R8LA 3D6FA 5IABA 2H63A 2ACWA 2E48A 3U7RA 2D6FA 3AIIA 4LISA 1B74A 1XMSA 1X13A 2FE1A 3H2HA 4PINA 3ZHXA 1H3NA 4FYMA 4YRKA 3I73A 1UH5A 1N6LA 3G88A 2XZDA 4J7UA 4LZOA 1YI0A 2WFMA 3VI3B 4QJ5A 4KRFA 2GYWA 4OUDB 5CGQB 3SSMA 1CP2A 4K9DA 1XRRA 2WNIA 2Y2VA 3E23A 2C0CA 2Q0XA 4U8HA 1V47A 1G5FA 3H6GA 2LWIA 3LUCA 2FUKA 2VF7A 1JKIA 3P9KA 4YT4A 3H9CA 3L04A 3ITDA 1UBMS 4GMHA 1JU9A 3AO0B 1Y4AE 3SIPA 2PG3A 2X1MA 2CUNA 5F3DA 1P33A 1RAAA 4PZDA 4GHWA 4WKNA 2HJVA 4X3PA 4C5BA 2ZJZA 4KYTA 2RD2A 2D1FA 4RE6A 3U0BA 5JJKA 4ZYWA 4GVLA 1KMMA 3ZCXA 4BN0A 1YS4A 3NEJA 5GTDA 5EWMB 4AJOA 1Z37A 1RJWA 1Y33E 3L43A 1V8FA 2JGNA 3QOYA 4HT3B 2RGEA 4DLNA 5KMGA 1MFPA 2G06A 3X0DA 4DIFA 1OFUX 1VM6A 1X1SA 4JU9A 4QUAA 1I2MA 4U7FA 1XFDA 4BVFA 3E8XA 3L1HA 2F9FA 2ZR8A 1U0GA 4ZDWA 4WV3A 2BHNA 2QUZA 1W4CA 3CPEA 2BEUA 1L5RA 5AKJA 1EZZA 2DERA 5C7YA 2OZPA 2CNBA 4H7FA 2BMVA 4US2R 4BVAA 2WMOB 4Q21A 3NTLA 5I4CA 4MINA 3SKYA 3F2VA 1UMCB 4NS1A 3GD7A 1AQUA 2Z1MA 2NSJA 2Q5HA 3ETHA 3SMQA 1H4QA 5J59A 1E9BA 2D74A 4PQGA 1EI9A 3UHJA 4DIEA 2V6JA 3PZBA 4H2DA 1XAJA 1E3MA 1MR3F 2FWIA 3I0MA 1SM4A 3ANYB 2EBUA 3WK5A 5JZVA 3QOWA 2CLMB 1U9YA 2WIGA 3LY7A 2ZTUA 3P1JA 4YAIA 2FMFA 2H4WA 2N0SA 3B78A 3O75A 4NESA 4ZVLA 4W99A 1XLUA 2CXUA 2Q2OA 1MN6A 2VQFB 1UEIA 2BW0A 1SXJB 3SICE 3GPCA 1QFMA 3QEOA 3KWJA 5DMHA 5C1PA 1VCMA 1MNQA 3MWGA 4LSWA 5LVAA 3AFIA 3CEHA 2WJJA 2H7XA 1ZVQA 4Q03A 2VYND 4X0EA 1JPUA 4KACA 4W1PA 4HVLA 5FUYA 2HQBA 4D1YA 3AHEA 3ZVLA 3L05A 4GR5A 4M9UA 1WDTA 2KBEA 1GTRA 3NNSA 3FHJA 4MUGA 1PR6A 2D1QA 2YN0A 4DR1B 1TC2A 4G24A 4XASA 2I65A 1U5BA 3VPCA 1HBJA 3KQKA 4Z49A 3R3SA 4COKA 1WF6A 3PU6A 4RY2A 5A9SB 4JR0A 1OBVA 1OH8A 4FWIB 2Z95A 3E9YA 3GLGB 1GUYA 3F6RA 3ONEA 2AOUB 4H1HA 4XYMA 4K6KA 5F64A 3RJ5A 1SXJE 4BNNA 3NXSA 2WU0A 4DVJA 1I6MA 2VUHB 1NYRA 3SNHA 1UDBA 3W90A 1VL1A 1S4QA 5CT6A 2VATA 2BF4A 3E7WA 1QJ4A 3U26A 1XZQA 5I7OA 1KH3A 1XEAA 1KBZA 4IJQA 4Z3OA 1VI5A 3AZQA 4TKVB 3IAEA 3CLSD 1QQ5A 4DA7A 1XNQB 3COYA 3VHQA 1GG9A 1U9IC 2DWCA 2H5JA 3KZVA 2WYOA 3W6PA 3C87A 5KU1A 3NLLA 4ZMBA 2GK7A 1WETA 4Y1EA 1W9MA 1CEXA 1JFFA 2R2GA 4LBZA 2H1SA 3L6DA 4EEZA 2I4NA 3B38A 3DV0A 2EBWA 3MQ4A 4QODA 4E3ZA 3QJYA 2A57A 1B3BA 1XDZA 1H0SA 1L5YA 2V4MA 5SYAA 4D74A 5I7HA 3QSYA 1N78A 3FLMA 2QQ0A 3J7AC 4LQLA 4D0SA 4IAOA 1LTHR 5KNCD 4EKEA 4PPYA 4YO8A 4IXMA 3VDQA 2AYYA 1P2GA 2PUHA 3C1UA 4NQZA 1INLA 4ZGBA 5REQA 3LCRA 4HN4B 5ALFA 5KYXA 1WB9A 4WBNA 4NNPA 2QRHA 1XMPA 4L4XA 1KI3A 4O2RA 1K7FB 1REQB 3GIDA 3OZFA 3QKSB 4DJFC 4DUGD 3C3CA 4JSRA 2BJWA 3EWNA 3QEMA 4OJMX 1G64A 3HFGA 3T5MA 4M0EA 3O0TA 4P1ZA 7GPBA 1JZQA 3SF8B 1SIOA 2SHKA 3MMZA 2C8VA 1U0HC 2MTBA 2WPDD 4MPTA 2D13A 2FGKA 3PTZA 3KV1A 1CIVA 4FOPA 1MEJA 2AOUA 3HV0A 1WZEA 1VE6A 1YASA 1EH5A 1VPTA 2AEFA 3JQRA 4FWBA 5LZ5A 2XECA 1GO2A 2VP0A 4X1KA 2IUUA 3DV9A 1O9GA 3RUPA 3LVQE 5FHRA 2VYQA 3WHLA 1HNNA 3G2HA 3IBCA 3JXEA 1J1IA 3LUAA 5E2BA 5IUNC 4ZO8A 2WF5A 1G63A 1T9KA 3GFFA 4EF6A 4WZBA 4FSXA 3JQ6A 3QEBZ 1GKKA 2DF8A 1TRHA 2XHZA 1SPXA 1AUVA 1LVUA 3IDAA 3TSYA 4PAGA 3HDYA 5HF9A 4RIFA 4MQLA 2FE4A 3PDWA 5ER9A 3UFXB 4YJFA 3LTEA 4UMVA 3WRVA 4YWJA 1NNUA 1ZN2A 1GCUA 3EFEA 3LNTA 5TQ2A 1CQPA 1AXEA 4DSOA 4UTRA 3BRSA 4DAEA 4RTOA 4YLGA 1X7YB 1C3LA 3ACDA 1E9EA 3O91A 4Q3LA 2D5BA 4S3MA 4XSGA 1QV7A 2YFKA 3CH4B 5FFNA 3W1VA 1YAJA 5ICEA 1R6AA 5ES4B 2FYTA 4N3AA 4UE2A 1X15A 1Z4PX 1BCRA 2QAGB 4K9RA 4J0EA 5DNWA 5HNKA 3CW9A 3KKLA 3TTTA 2Z9DA 5HKLA 2A7XA 3QFSA 4RDIA 3DC2A 2ZUFA 1JH8A 1LY1A 1P81A 2XJ9A 4JEMA 3W1WA 5TS2A 3CNHA 2DETA 4OYHA 5JSUA 3TW8A 4FYIA 3R7AA 4DW8A 1EIZA 1R4NB 2JLXA 1P80A 2BEUB 4LE2A 2O5CA 5AI6A 1KMHA 4MV4A 2QMOA 1SG6A 4W4TA 5T4FA 1NW3A 5EVCA 4F4DA 4OK5A 5IMSA 3TRHA 3R3JA 4C7XA 1EX7A 4RSRA 1T2VA 4ID9A 2N9UA 4R8VA 2Y27A 4FOTA 1YS7A 3BWVA 4I9NA 1YR8A 4CR8A 1VFNA 2ZTVA 1C8VB 1ZONA 1SQSA 2XZOA 3Q8MA 5HEKA 2VWGA 1M2VB 3NFRA 1KS9A 4BN4A 1RIFA 3NORA 1VJ5A 1RI4A 1J06A 1GZDA 4KB5A 2QW1A 4MWGA 5K3AA 1A88A 3K0AB 3BGIA 2PA0A 1YUBA 4FP9A 4BJ1A 3VNVA 1ZWLA 4CXMA 3OJCA 4HS4A 2GFHA 5F52A 4B7CA 4RS3A 4CKXA 2PAFA 1NURA 4TL8A 5DTMA 5KNBH 1GGMA 2D7JA 3TTVA 3U7FB 2VN8A 2H1OA 4M21A 2IPAB 4JQOA 2ZYTX 5JI3E 3D4NA 3FPFA 4LF4B 1VG1A 2UXCB 4HX2A 5U4XA 3WB9A 4YRMA 1NNLA 1ODJA 1YXMA 4MQ4A 3GLHE 1Z6TA 3KSBC 3ZDAA 2OSVA 3T06B 1NKVA 3KVVA 3G0IA 3FVTA 3QENA 5JLAA 2BHRA 2AZDA 4D41A 3CWCA 4RVOA 1N2SA 4QJ4A 3KLBA 4BKPA 2GPBA 1Z0SA 4D6PA 1U2GC 4PYMA 3SNKA 2Y8EA 1E1RD 3BTSA 4HGNA 1QF9A 2XY4A 2E4AA 4HRAA 4Q9NA 1Z56C 2BCJQ 2RGCA 4CL8A 4IIJF 2AK3A 2CYBA 5LOVF 1EQUA 4ZN6A 1OWOA 2WF8A 2Q3JA 3SDBA 5HUHA 4P22A 3TTSA 5JBIA 1WXQA 4JUIA 3IP8A 4NICA 2EKQA 4FZRA 4LJKA 4HRVA 4F3RA 4OHXA 3PUZA 1YZLA 5JDIC 1AUQA 4NOJA 4DR5B 3B2EA 1A8SA 3BH0A 4U2CA 1UIRA 5BPHA 1ZLYA 1IQPA 4FHGA 1UWKA 5IASA 3N6XA 3GUCA 4MW7A 3QF7A 4GDFA 2BFAA 1NVEA 2KLBA 2IYQA 4W5JA 5AJHA 4Q02A 1PU2A 4DA9A 1XRQA 3ZDQA 1PL6A 1S2MA 4XEHA 4UVEA 4FOSA 4LGYA 3WWOA 5BR1A 2Z4TA 3P32A 1VCIA 4JCOA 4RJKA 4YALA 3I83A 5DBFA 2FK7A 3AFNA 3NUZA 3S27A 3CIOA 4L0QA 3K71B 2IYLD 5GJVC 2GILA 2VQ6A 3GEMA 4MEJA 4QHSA 3L4JA 2ODBA 3C97A 1C4KA 1ZGBA 5J4LA 1WVGA 1HUQA 2WA2A 3CXUA 2JLYA 1OFIA 1TVMA 2AXNA 3C48A 2I7TA 2NV0A 5FTNA 1N5MA 3LIPA 1TA0A 1OXKB 4J3FA 3ZWCA 1EK6A 3ETJA 2WIAA 4U2DA 3BH7A 5ESRA 5LD2C 3A06A 2YY6A 2YIVX 1UJBA 4BNKA 2O5EA 1PK7A 4PZPA 3K0FB 1PFVA 1NR1A 4QXQA 4R1TA 3JU3A 2HMSA 4CDGA 1OFTA 4HB2A 1SVWA 5T4HA 3OZBA 2OWDA 4DV1B 4Z2YA 1ILEA 4MUJA 1CPYA 2I33A 4OHWA 1DFIA 4DV7B 5FBWB 2E7ZA 5F9FA 2IH2A 4GWKA 3EMKA 2QVLA 3FSRA 4HLNA 2E1RA 2TMKA 4ZXPA 3JQEA 2PX8A 4B40A 3E7PA 1HK7A 1YJXA 4IDBA 2D2FA 1R64A 1QOZA 2C58A 3H87A 3IXQA 4MWOA 4PAMA 1I1HA 2H8GA 4TWAA 3A37A 5LLSA 2AMYA 1GN8A 1L3BA 2C1EA 3ADDA 4ILKA 2WTXA 1OT3A 3GQBA 6LDHA 3N5KA 4ARUA 1TX4B 1E2IA 2QN1A 3ANNA 5EJAA 4ZEOA 1RJ9B 4Z9BA 2YWEA 3WSWA 3EVCA 2NSLA 3QF4B 2Y92A 3PEEA 2E4VA 3EFHA 4FDVA 4JN6B 4MRMB 4R98A 5FJIA 5KDLA 5FADA 1FFWA 3DDUA 4DLYA 4ENWA 2ZYAA 4K3VA 4MR9B 2H4XA 2CJWB 2IPNA 2JGIA 1RCTE 5DYTA 1H5NA 1F8FA 1MENA 1W29A 4IIJA 3L9XA 1N0HA 4O1IA 4BRSA 5EJ4A 5JS6A 5L3QA 4EA7A 4FZJA 3U9TA 5ECWA 3QFCA 5CA0B 1DRUA 4HDSB 2W4IA 4I4TB 2VNIA 2YVQA 5AQEA 2C9YA 4TVKA 2GA8A 3N8HA 3W34A 2WE8A 1E2JA 3G5TA 1UOQA 4EM6A 3ODPA 1G20A 2D8MA 1C4OA 4AW9A 3LT2A 2CUTA 3AC0A 2GETA 3PWTA 3DYIA 5A4AA 2Y0CA 2F67A 1YJQA 5IWAB 5F2OA 1J99A 3TLKA 5DT9A 2BHSA 2VWHA 4YX9A 2V9PA 1TMKA 1A8PA 4O4LB 3TH5A 2QNIA 2NG1A 1GUDA 2X0IA 2VSNA 3SM3A 4YK7A 2BGKA 1PG5A 2GEDA 3OQPA 4UULA 2I6XA 3FOWA 4G1MB 5FNVF 1CKEA 2VBIA 2P4SA 4PVCA 3TYXA 1KI6B 4LV6A 1MW9X 4DG8A 5JQGF 1N0WA 3OI7A 1G1AA 1CLEA 4LTDA 1LNQA 2WHEA 4HDMB 4J6FA 4O2LA 3RTGA 1E1KA 1FDWA 1GGHA 2ZQZA 5GVSA 3I9NA 1TCUA 2PQ0A 1XQ9A 2DH6A 4Q1EA 3SM9A 2YHIB 7YASA 5COBA 3VVBA 3K32A 4RPJA 2AN4A 1LDYA 2F43B 1ACJA 1SKQA 5IYZB 2P67A 1C0PA 1Q0ZA 1AK1A 1QM5A 4E5KA 3A6LA 3OLZA 4DAOA 2R79A 3DL2A 5K0GA 1EGQA 1QE0A 3SSOA 5AXDA 3KQVA 2BRUC 2D2IA 3K3PA 1VJRA 3KKQA 1MV8A 4KPGA 2BUCA 2VPPA 1A97A 2GRUA 4JHLA 4KIGA 3EXG1 3GFVA 3LLVA 3ZLJA 1SCJA 3QVWA 5H8WA 1RQRA 3SE0A 3R3WA 4XVUA 2DTEA 4C0JA 3SLKA 2HA5A 1U7HA 5AKYA 4F7WA 5BY2A 4GR4A 3QV1A 2QE7A 4QL3A 4YJ3B 4TMFA 1CV2A 4KVAA 3RS9A 2UUAB 3L8FA 4J29A 1U1DA 5BNIA 1PD1A 1ZH2A 5TPZD 5IP5A 3VC3A 3FOFC 3KTAA 2AOWA 1LPNA 1DC8A 2GS9A 2VAXA 4FWTA 4ENUA 1ESEA 2PCJA 5DM2A 2XCRB 1UPXA 3FJOA 1LC3A 2VXCA 1P17A 1ZAYA 4CM4B 1U0OC 5AW0A 1IUPA 1CUWA 3JQPA 3MN1A 2H7YA 2DPGA 3GJ3A 3IE2A 2B5OA 3T3IA 4I4TF 3WFIA 4F86A 1IIRA 3I39X 1MA3A 4KG7A 1BWQA 4YREA 2VOJA 4J07A 4RPLA 4RGBA 3FDFA 3C3JA 4IW3B 4ZU6X 3PFFA 3GUZA 4MUBA 1GSHA 1KQNA 3BMNB 1WM1A 2R00C 2OGZA 3P9QA 4HHEA 4Q1CA 4UNSA 5EPOA 3UAWA 3O1JC 1Y1PA 3UJCA 4JDUA 4CEIA 4MUMA 4XE5A 5KYVA 4CR7A 3RKUA 3VVMA 1EFHA 3M6WA 5EGSA 3C3XA 1I3NA 2RKBA 3F4LA 4HEA6 4XCQA 2VJQA 4AYWA 1QYCA 1XHLA 3ETEA 5GGYA 3B7WA 3T8YA 3JWJA 4W9MC 2FVYA 4OHPA 1U0NA 3QUAA 5B3LA 1Y37A 3WNBA 1CUEA 2VK2A 2RHBA 3EUEA 4RIHA 3IJEB 1AKRA 3BJIC 1O96B 5KYYA 4OUKX 4KQ2A 2Q7XA 1H94A 3W04A 3STYA 2HD4A 3INYA 4H7JA 3KWLA 3WDSA 3PPYA 4R9VA 5FR2A 2XUQA 5LDGA 2O4UX 1CQZA 1KU0A 1N6OA 1G5QA 1JG3A 1KAEA 4TSKA 4F2HA 1S8AA 2ZBDA 2CV1A 1TFRA 3ET4A 5IJ9A 5CNKA 2FR8C 2AR9A 1A76A 2D2EA 3BTOA 3NNDA 3JARB 3O2JA 4S0ZA 1SWWA 5SV2A 5HJEA 3WNVA 2IXDA 3QITA 3E4DA 4F9TA 5A71A 1PVVA 2HPVA 2H5EA 4HWSA 1DSSG 2P4QA 4EZBA 1TAHA 4YHHB 3P9PA 3HHPA 2WIDA 4PXYA 2RJNA 4DY6A 2C2MA 1WVIA 3MK31 1P75A 5DLQC 4HMOA 3B1XA 3ZR4B 1MB3A 3ESAA 4FGWA 3THOA 2W83A 4L8WB 4Y2SA 2C8JA 3NS7A 4M1MA 3U0VA 1RWXA 2YYAA 3LAWA 5HZGA 1H2RS 1MKYA 3IOBA 2YJZA 4L5YA 2VLIA 3LC7O 1MABB 2VKQA 2Y1DA 1C81A 3L2OB 4KGXA 1GAWA 4XTRA 3ZNQA 1FRZA 4DJ5X 4AX4A 1QIFA 4FQ8A 1SUCA 1UINA 1XLTA 3DE6X 4U6SA 4DE5A 5IJXA 2WIBA 1YVPA 1K0FA 3VV2A 1M0EA 1N6RA 2O2GA 1H22A 1A04A 4JBYA 3E9DA 1JQAA 5EEHA 4G1FA 10MHA 2VJAA 1THGA 3TIVA 4FDUA 2JCSA 1NATA 5LXTF 1AQYA 1ECPA 4LNHA 5TQ2B 2A9FA 1OA0A 3T12A 3BMCB 5KX5A 2R0QC 1SOVA 1IBRA 2Q6LA 1Y7IA 4B3HA 4UPEA 2X0JA 5FV4A 4IO0A 2YWFA 2ZT5A 3C41J 3G8CA 4TMXA 4G1UC 3WFJA 1R10A 1YZTA 1VG0B 2YRXA 3OFNA 4GP9A 3NXKA 5FBHA 1I7SB 1EUDA 4NMLA 4JYAB 4FZ5A 2QMYA 1SKAA 2J5QA 2VZEA 5L8VA 2CLIB 4B3JA 3RYCA 3NUGA 2QRJA 3PXCX 3AHFA 1E2GA 5JEEA 1UK9A 1UFKA 3PB3A 4IDEA 1RC0A 2JATA 1IM2A 3HLYA 5G0UA 4MWSA 1NMXA 4D9FA 1HYBA 2G83A 1ZRMA 3E3LA 3HSYA 2IEYA 4P4TA 2NIPA 4C3ZA 2QD5A 2PJDA 4JKYA 4CFZA 5D1NA 2WHPA 3OEHD 2AR0A 4HH4A 5T4EA 1DINA 3EZ2A 1SQ5A 4ENRA 3PKIA 2A30A 4J43A 3COWA 4US1R 4JLWA 4MXDA 5CPFA 5AQ1A 5HR5A 4HYQA 4U1RA 5JAZA 3W7AA 4B6GA 4JI4B 2OY0A 1C1DB 3VZPA 2JC3A 3MCAA 2V7VA 1NV8A 1G2QA 1ZJYA 2RGYA 3K2IA 5A6SB 5LIPA 3FTCA 4QEZA 3CKYA 1QLWA 4NWIA 4UPVA 5IMBA 4I46A 1H4TA 1PYOA 2IE8A 2XXJA 4OQDA 2ES4A 3UTCA 2RB4A 2L19A 3D0RA 3FB4A 3QTLA 4J76A 4ZJUA 4H3KB 5LP6A 5DSXA 3U44A 1GKLA 2QM7A 4P5PA 4HJXA 4X8OA 3VSAA 1XQ6A 1G3UA 1YTUA 3IUJA 1Z63A 1GA6A 4E09A 2IYVA 3KR1A 4KEAA 4BBJA 4Q4JA 1N2JA 1R6TA 2ON6A 4MR8A 3V2HA 4C04A 2DWOA 4L28A 3EY9A 2TECE 1LDBA 2QVGA 4R3NA 3URMA 2JAOA 2E85A 5EMLA 4DT1A 2JK1A 4TLEA 4I8IA 3MTAA 4OQQA 1TVCA 5DEOA 2W6QA 2RHJA 1KK0A 2H8KA 1IN7A 3PJGA 3JQAA 4ZQBA 3RW9A 4BZXA 3AXSA 3DCJA 1SVUA 3A1FA 4RZXA 4YPVA 1ISIA 3ECSA 2EU8A 1VCNA 3F74A 4PCUA 1R74A 3TLAA 3WB2A 3JYHA 5EMJA 2UZ4A 5EIHA 1SHJA 1C0IA 3DNMA 4OGLA 4UCWA 2QL9A 1NONA 3Q8LA 1G6KA 4L15A 3K0SA 3R3VA 1Z26A 2KI5A 3E3NA 5ETJA 3ZCSA 5CLLA 3L01A 5EUMA 5EKSA 3U3KA 1ZXBA 4OGKA 2ZXEA 1JLKA 1KY2A 2BGJA 2ZBEA 3KQUA 4ETIA 2YZNA 4ZODA 2Z2KA 4FD3A 1PBTA 1M8KA 1ZW6A 3H65A 3AFGA 4MGZR 1XL1A 1XLWA 1IK4A 1YZHA 4KUHA 2E18A 4DY4A 1QZXA 1X80B 5D01A 2EJBA 1M5TA 3CLKA 3B82A 3D8UA 4HFJA 1ML3A 4CU5A 4D82A 3N05A 2P6RA 1ZUNA 2P9FA 3BWDD 4BLSA 4XIYA 1NASA 3A1VA 1MO3A 5D86A 1EFLA 1EVYA 1W1IA 2Y1WA 3Q9LA 2O2JA 1WSAA 2NMVA 4N3BA 4NRDA 5LQNA 3OQ1A 4JV5B 3LUPA 5B57C 1BEZA 1EQ2A 1Y6RA 2B4KA 4YP5A 2NQTA 2X3FA 4QGSA 5BSRA 1J0CA 2FQQA 3B6ZA 1OJLA 3GZNA 3JRWA 4V39A 4G36A 1WBBA 1Y82A 1XZBA 1MJHA 4OFWA 3K9QO 5DGCA 1ODKA 4KQXA 3IR7A 3HLKA 1OI2A 1P5JA 2R7NA 1E5TA 5DOVA 5E1BA 1AZWA 1NRWA 1GQFA 1RU3A 4K9LA 2HDOA 4K8RB 5DPMA 4WXMA 5TEWA 2ZANA 3ITEA 3AVTA 3IKJA 1AGYA 3GT7A 4MQFB 1NC1A 3COVA 5C1DA 1JBKA 1S02A 3LKBA 3MSCA 5AVSA 1FZQA 1LVGA 1XD8A 1SCKA 1JALA 2J33A 3ESDA 1KFEB 3OECA 1G8PA 1JEOA 4I08A 2WF6A 1U9ZA 2VHQA 2V6GA 3GFQA 4BKOA 1GIAA 4BUCA 2PX5A 1FFDA 1PZEA 3FMIA 4UEKA 1GNLA 4YCJA 2H1CA 1BIFA 4I6GA 3INNA 5FFFA 2FW0A 4R1SA 4WKPA 1QP7A 4EW3A 2YJGA 2YR0A 4JBXA 3SFZA 3UQZA 5AUOB 4JSYA 4AB1A 3AHDA 3OAAA 3MOGA 2J41A 4YCBA 9LDTA 2QUIA 4XJSA 4C08A 4EABA 4M1WA 4QVKA 3F5MA 4IM7A 1PGQA 4OM8A 2I8CA 4MNTA 1R6DA 5K9ZA 3O74A 4ZCMA 4IHQA 4ND1A 1QG4A 3FNGA 2PO7A 2QJOA 2RHHA 1HZZC 4HJRA 3KOXA 4WUTA 5I7AA 1IMJA 1L5NA 2RI6A 4PQEA 5CM2Z 1JIQA 1K7CA 1DMRA 3UCXA 3TLMA 3CT6A 4H3HB 2HQ1A 1NNEA 1NFQA 3DQQA 3CV3A 4JLUA 2RH9B 4KSBA 4NOKA 2HUNA 4OEHA 1G55A 4U5QA 4UZEA 4B3IA 1FUUA 3FDZB 2PUEA 5CCDA 2GK4A 2E89A 2IHUA 3GLKA 3EW9A 1A5TA 1ZA2A 4MLZA 1OPXA 1YBVA 2GYVA 2D62A 3FDZA 4KAFA 5F3RA 5IBPA 4N0EA 3QWAA 1GPUA 3GAAA 3HRIA 4YAOA 4DMFA 2WJVA 2JLWA 2X6QA 1U2EA 1QH1A 3H4IA 1J8MF 1TAQA 1BEUB 1ZIOA 1EP1B 2AC2A 2PAAA 2GCIA 3GGSA 1T43A 2O7VA 5LXTB 1JIUA 3P9YA 4MCHA 4RMIA 2EFGA 1U4OA 2AF3C 2HMTA 3ADPA 4BNDB 4CDNA 1ZS9A 4ALLA 5IXYA 1FFGA 2QMEA 2AJDA 2X23A 5FA5A 3QW4B 2XXAB 4A73A 2Q6TA 2FPUA 3B1ZA 1NT2A 3K5HA 4NAVA 4Q4AB 3RYFA 1KDZA 1OXBB 4HR7A 4OVKA 3IEIA 4INAA 4M0PA 1XQXA 1CETA 4KQJA 5DX1A 3ZJUA 3CF6R 1IVYA 4Y6QA 1JHOA 4Q3OA 3B52X 2VK8A 1QGAA 4WEQA 4LPKA 2JLCA 1XRMA 3UOWA 1EBFA 4RSGA 4EPVA 4FB4A 1DWUA 3B3AA 1P2BA 3GLIE 3EZFA 1SUDA 4B0PA 2OP0A 3OM0A 5LMNB 1JEYA 2XHEA 3TW8B 1UT5A 2ZYSA 1YWGO 1X1CA 3BWXA 5ADVA 2OEPA 1XEXA 1RBYA 2QP9X 4JITA 3TOVA 4GOXA 4EYEA 3A70A 1QBGA 4GX1A 5DXAA 2IS2A 1TVKB 1E77A 4MMZB 1LRLA 8AT1A 1YVUA 1CULC 1WUIS 4MCJA 4O4IF 4CGZA 2BL4A 1L1FA 2JNWA 3QVJA 4HLCA 3ZWBA 3Q2KA 1Y8RB 4XOIA 1RWOA 3AT1A 2B0JA 1GRRA 2P40A 3BFKA 4JY7A 4HWRA 4MQFA 5BPFA 4F5DA 1ZPDA 2J9YB 4AJIA 3JAMA 3BICA 1L5WA 2H4HA 3GEIA 2R8XA 4B3CA 4GOMD 1E4EA 1SVOA 1KI1A 1Z16A 2YNMD 3GNTA 3TMAA 3HM9A 4JLJA 3HB4X 1JL3A 4UVDA 1C3VA 4IGAA 4BS9A 4YCCA 4K6OA 4QVGA 2NLOA 1M83A 4L6AA 2HTEA 3G9ZA 3H1BA 2FLVA 4IV5A 1VJ1A 2LZ0A 3AOGA 4X91A 3HFSA 5B7NA 1JA9A 1JEDA 2XUIA 3RU3A 1Y89A 1M8PA 5FRDA 4N4AA 2IIVA 2CFRA 2EKPA 1PFYA 3WI7A 4OU5A 3D7LA 1KJ9A 4MTLA 1LDGA 5K6TA 3F7MA 1M1NA 2BSQA 5GJWC 1PJCA 1D9XA 3EDMA 1KEKA 1UC5B 1Y5MA 3KG2A 2IUYA 3DZFA 2KX7A 1LK0A 3LDGA 3NATA 3QNWA 4PAOA 2OO3A 4XIJA 3QTTA 1ZRHA 2D8AA 2I3BA 2NW6A 2O14A 1QMGA 4PG6A 5SZKB 3RM3A 3HZRA 3PICA 4AP9A 2ZREA 3LMKA 1ADBA 3L8ZA 5AVUA 3WC4A 3QZUA 4V02A 3AJAA 3AQIA 1YKGA 1QG6A 1CR4A 1LXCA 3RSFA 3DDOA 2B83A 1MNAA 1Z4OA 2MOKA 4GR9A 3NAMA 4PG8A 4TXHA 3DE4X 5FDFA 1S8OA 1KOGA 1Q74A 4NZZA 2W22A 4OG2A 3HACA 1J8DA 5AJYA 3UT5B 2HLDA 1SC9A 1JU3A 2A92A 3GT4A 3ZUGA 2O8FA 2WWIA 4UQPA 1RBQA 5ILQA 3OU7A 1JT9A 5GM2A 2ATVA 1DX9A 1A2KC 1NJSA 2P30A 3PFIA 4NJMA 5AM3A 3VH4A 2HHHB 3Q10A 3EMDA 5HIAA 1IBLB 1T5OA 3I6YA 3RYHA 1ZI9A 2C8KA 2ZI3A 5C8ZA 3SOPA 4XGQA 4OXQA 3TZKA 1NW6A 2NPIA 1E3IA 3GVPA 3B5JA 4PNEA 1JLSA 5AUNB 3LQ1A 5IK2D 2H2DA 4Q4JB 2QRPA 4IWYA 5GONB 3CEPB 3Q7TA 1L5FA 5KVSA 1GADO 3D2CA 3HR7A 1Z5WA 2OBYA 2PSJA 4N82A 1P2FA 2OT3B 2P9TA 4URFA 2BGUA 5I4KA 3Q12A 4WY2A 1E63A 4F3TA 1JWLA 2PBZA 1LPSA 4UXHA 1Y81A 2PL5A 3V46A 3H17A 3THSA 1PEYA 1VBFA 2W6NA 1EDEA 2WM9B 5ALZA 1OTXA 2OZKA 4JODA 1O8CA 3IPYA 4O5OA 1QZZA 3ZU6A 5GV8A 3I53A 3K8OE 3PENA 2PFKA 2RAFA 1DG1G 3S99A 3G5LA 1GL9B 1Y4DE 2XWBF 4UUQA 5ECYA 3NRBA 3FPAA 4LRWA 4G4IA 4NJEB 4WLUA 3CPSA 3NC4A 3U7HB 5KTNA 5ARCA 3S68A 2BM0A 1UFRA 3CJTA 6REQB 1N8NA 1HYEA 3PP8A 4NYIQ 3ZV6A 4AKHA 1BHQ1 1HG1A 4OH1A 2PMBA 3VC7A 4Z7OB 2DHDA 1U5BB 1CYEA 1EFRA 1TF7A 4FMBB 3BZUA 3Q7EA 5D3MB 3B5EA 1CC1S 4RZHA 1EESA 3M9LA 3RYCB 2QZ9A 4OXNA 2JCGA 3JSAA 1UZNA 3SEFA 4B75A 3WVNA 3M2PA 1EGMB 2XYVA 3BE5A 1UXGA 4Z4CA 1FNBA 3WOHA 2JIRA 1X0VA 1XZNA 4RK5A 3PC7A 3THYB 1D2GA 2KJQA 1K9SA 2XNSA 4C4OA 5L7WA 3N53A 1M6WA 5HK8A 4CF4A 1TKAA 2QT9A 2XKBA 3KAQA 4JIMA 4RMHA 4QTZA 4YAWA 1JAYA 1E8MA 4W5HA 3OJLA 4FMCF 5BQ3A 1GVHA 5JARA 2JIOA 3OKAA 3IIJA 5ICMA 1O1YA 4IQFA 1YTLA 2PGXA 1K4MA 3S1AA 2DHRA 4QU5A 3K6SA 4LOHA 1T1SA 3OESA 4K6FA 1GZSA 1HQKA 2WF7A 5IF9A 2ABWA 2RMKA 3RSQA 4E03A 2CXSA 5EUQB 2HTFA 1NQUA 3ZK7A 2XGGA 1JXMA 2YDYA 5EE0A 1OLUA 2P78A 4RCYA 1QWOA 2V3CC 2Z4SA 1ST3A 2QW0X 3MUOA 1P7YA 2A6PA 4WX2B 1OKKA 2QSUA 4B3DA 4QZVA 3MC1A 4ZT3A 2WSMA 2D1YA 3PL5A 3PKZA 2B7LA 4IMIB 5FWYB 4LFAB 4QTXA 3V9AA 5G1PA 4LA4A 2G5GX 1BZYA 1IN5A 3AWIA 1NI4A 1RRMA 1U6KA 3UJAA 1T4DA 1OC4A 3FRHA 5IFLA 1IY9A 3ER6A 4DLBA 1BGVA 3SJAA 1MOPA 3FZQA 3PI7A 5A06A 1X7HA 4CV2A 1W85A 2HU8A 1DT5A 1V8DA 1XL0A 1PQYA 3ADBA 2OP1A 2CF5A 3FYUA 1AGXA 3O6VA 4BU1A 4AYXA 3C85A 4MKZA 4CIBA 5F1OA 1C0KA 4URWR 3WBJA 1CUGA 2A35A 5F4ZA 1SCQA 1J21A 1W5AA 5L3SB 1QNFA 1QYVA 4K03A 1J9ZA 1XMJA 2ZJ3A 2WYWA 3NHPA 5FTJA 3ENWA 2FRXA 4MQEB 3HJCA 1VKRA 4AMUA 3P4XA 1L7EA 4E5UA 3V8NA 4RL4A 5KKNB 3YASA 3CSUA 1J49A 2PGDA 4HTAA 1Y34E 4N03A 2P3QA 3JATB 1MIHA 2NO6A 3HA5A 5C80A 1M33A 3JS5A 1TM2A 5CDFE 5HRAA 4PC6A 1WCV1 3OLVA 2NO9A 4V0NA 2ZI4A 2NNWB 4NVRA 1WD5A 3OEED 2J3KA 1KZ7B 5BURA 1J33A 3PQ4A 4YI3A 5L40A 4UTVA 3MJVA 1T2NA 4QNNA 1AX9A 2H00A 4CLOA 5HK9A 3M2TA 2ZJFA 4RXTA 1MQ9A 2IYAA 4W9RA 5B7QA 3GA0A 4DIKA 1CCWA 2FN3A 4DXDA 1D7AA 4GKJB 2CKMA 3WNQA 5CX1A 2GJAA 3QEJA 4DNOA 4BO3A 1TFUA 1HDXA 5JYCA 4I5EA 1V39A 1SELA 3QUQA 4J0FA 5AT1A 1JWBB 4EUEA 4YCNA 3PUWA 1QXSA 2OKGA 2QL7A 3DFIA 3OUZA 4EI8A 4X41A 1KI9A 1GNRA 2P0AA 4J1QA 3MBIA 5EIBD 2JFYA 2BWJA 1R3UA 2VHYA 1OBCA 1QRRA 2PT5A 2ZCVA 1ZYUA 3LUHA 4NNOA 5DH9A 2CC2A 3EHDA 5BSTA 1NXWA 2HLDD 2VNJA 1WXIA 1M0TA 1SOAA 3AF2A 4H6WA 1DIHA 4WLOA 1NBMA 4NFHA 3V3KA 5C52B 4JBLA 2G88A 5H4GA 1C5KA 4AZ0B 3N0WA 4YNBA 1ORTA 2XBMA 5CB0A 4YRIA 2QE6A 4RTLA 5FIUA 4GW3A 1YDGA 4TQAA 4B3XA 2BOVA 1JHAA 4BGVA 5JXIA 3F5DA 1J0BA 3V5NA 4AP5A 2C0QA 5BQOA 3D4LA 1J1ZA 2QRMA 2WOJA 1O5OA 3BJRA 3ZG6A 4B6OA 4BYMA 3DMPA 1XEFA 2Y4OA 1E6MA 1JDJA 1UBNA 3E48A 3INTA 4GF5A 4OMDA 1GFWA 2JVIA 3A8TA 3KKEA 3LHIA 3HEBA 1BRMA 1DBWA 2QPLA 4YP9A 3VO8A 2IGBA 3PC3A 3KRTA 3ZZNA 3WMRA 3F78A 1GGKA 4IIHA 3R8CA 4OQFA 3NMUF 5JO9A 1N1GA 5EP4A 2W0MA 1GR1A 3DG9A 3R6GA 2O2EA 4OQPA 4X1OA 3PFNA 1W0JD 2Q5IA 3ESZA 3VHLB 1PL8A 2J08A 3GUHA 3I1IA 4B9EA 1UJ2A 2W48A 1RZ3A 2M6RA 5JCOA 4ZGWA 1LBTA 4EW6A 3TKLA 3EX7C 3A2NA 3IUNA 2QTNA 4A82A 1ZVKA 5C5CA 1E1YA 1NLYA 3KQOA 3ZDRA 3IAM6 1HDYA 3PE6A 1KEWA 2JIDA 1XTVA 4HSEA 1XTIA 1YGYA 2HREA 1MHTA 1JDPA 1TJNA 1VDZA 3IMKA 4MSUA 4GT1A 1R5OA 2ZEJA 1T2UA 4YONB 4HN2A 4IXNA 3LWBA 4AP6A 1EB9A 4RSHA 4RZUA 5AVOA 4EFNA 2BI7A 1CY1A 4H15A 1G6Q1 3UUGA 1FP2A 3R5SA 1F14A 1BFKA 3DE5X 1A82A 1VLLA 2IW1A 4AURA 3PBKA 2XE6A 1RYFA 3D7NA 2QAJA 1ISFA 4TTJA 5D85A 3ILVA 1CWUA 1YR3A 4QJ3A 3ETCA 3CIFA 5HCNA 1S8NA 2RGDA 5JOQA 1KJZA 4CQNA 3W9YA 4G5QA 4CCYB 1TD1A 4C4SA 1FTGA 4WKBA 2G7ZA 2XAAA 3A32A 3FHOA 3K4HA 3RWMB 4IUCS 1RAIA 3DOJA 3M5CA 4JJ6A 2HJHA 4A8TA 3OZVA 1GAJA 1XJCA 3KJXA 4QOSA 3KQTA 3VPXA 2V1UA 2V3VA 1CJUC 3VO9A 5L3QB 1DS6A 4IVPA 4KFCA 3C70A 3RS3A 1A2OA 1P3DA 1C4XA 1TYCA 1HURA 2WD7B 4D8UA 2LP4Y 2V7TA 3B85A 3N8NA 1LQTA 3FWNA 4REQA 3ISTA 3KTOA 2BH2A 1GA1A 2P2SA 2BAGA 1RIIA 2Q21A 3FFTA 4E12A 2BBOA 4IIBA 4ZREA 1ONOA 5GADl 4KIFA 3TQRA 4PW0A 1SUWA 2KB0A 3OIGA 3EYWA 3JV7A 5MN4A 3GC6A 2GVDC 3WKDA 5I7FA 2PV7A 1XWIA 3P2KA 4KVGA 4R16A 1GZ4A 1RJFA 2F2TA 1VHWA 2FW6A 1TQ4A 2Q4TA 4RPKA 1UJ4A 3JQGB 2G3YA 4R4JA 3VA7A 1CX9B 1QFZA 3IPXA 2W2KB 1SBIA 5EE5B 1RI3A 3LK7A 3IHWA 2BFCB 3ONFA 3AVYA 4KMMA 2WR8A 3NHAA 4IIVA 4L0MA 4LYHA 2WAYA 1R0CA 1TO2E 1BXKA 4N5HX 1U1EA 4PS0A 4Z8YA 1NJ6A 2H6EA 3N75A 4ZTUB 3GDHA 3JQ9C 1XCOA 1W6RA 5IK2A 4KSCA 5JVDB 1E1DA 2C2BA 4FIDA 1NLUA 3PE3A 4Z53A 1WCXA 3SS8A 1YULA 4QO8A 5GV7A 2XNDA 4DCNA 3IEVA 1B73A 1ZGGA 4BLTA 3WL4A 1BMFD 3AIOA 1ZCJA 5AVQA 4MUHA 1CQJA 1LS6A 2M9MA 4A6XA 3FHCB 2VT3A 3QIVA 1KAOA 4ESHA 4PXAA 5IS2A 2DLCX 2LDXA 2QSJA 3LDHA 5CTJA 4AMVA 4LHEA 2MT9A 2XUHA 1EGVB 1SCBA 2VZLA 3BVPA 4IOLA 4XDYA 4PU0A 3ER9A 4HQ0A 4TT3D 2QLLA 1JVBA 5B4VA 1HGXA 4Q93A 1IQ0A 1C7IA 1DWOA 2ISQA 13PKA 2W2XA 3O1LA 1T8TA 1G9XA 1SJ9A 2PMFA 5FO0A 2HQSA 4PRZA 4Y6OA 3Q3VA 4J91A 4O4IA 4TTQA 4XXHA 5CVCA 3W8FA 1OIVA 1KMCA 2AN1A 3WIDA 5CBPA 2YIMA 3MIIA 721PA 3CLUC 3NVDA 2FF7A 5F9HA 1K4KA 1ZKMA 2ZAMA 3W8NA 1M6NA 1KQFA 4O4JF 1WQ4A 2KQUA 1UKZA 2DWUA 1VPVA 5JPCA 4M1TA 2J6HA 4DMRA 1IXSB 4HPWA 5KTRA 5IULC 2ZSUA 3C1AA 2DX7A 2PYIA 4XLLA 3JASB 4D9HA 3C4VA 3RSOA 1ODFA 4ARZA 3S7ZA 4CGYA 4GRDA 1CT9A 1HY3A 1PWEA 4RIGA 5IUJC 1T6XA 4LQ4A 5BR8B 4MCAA 3WKEA 2PTGA 3E8MA 1Z47A 1FOEB 3UOAB 1ZM3A 3C5CA 3WFZA 1O9HA 3GAZA 3JVEA 3PX3A 4EO9A 1DO8A 4JJ8A 1ZXLA 3AF5A 3E35A 4EDHA 4YY3B 1QLHA 4B7ZA 2BE9A 4OI0A 2XKJE 3AR9A 3BWMA 3NHUA 1JEQB 3QMVA 1OJ7A 1XRNA 3BAFA 1QRSA 3U6KA 1AMOA 5ALJA 5BN4B 1FPMA 3GHYA 4IJWA 1U8UA 5CB4A 2O0LA 5ITZA 1GP2A 4V0QA 3MRXA 1HKHA 3VNRA 1Z0FA 5CPBA 5JAMA 2EZ8A 3OZRA 3PNYA 5E6UB 4BJ6A 4HI0E 1Y7TA 4OXXA 4Z0NA 3W5CA 1FFEA 4MICA 4QOGA 3ZZTA 3QXHA 1LJLA 3EDCA 3FWZA 1X7WA 1L5OA 4WECA 2NZVG 5DGDA 3EQ2A 5IH3A 3OOYA 3V4LA 4A27A 3KJEA 1P29A 2FMKA 1GGJA 2NUAA 2OHVA 3OZ7A 4UBJA 3Q2IA 2N46A 5BNWA 2SKDA 3MCVA 3ZS9A 1H8ED 1OGJA 4PZLA 3TLJA 2OD9A 3ZHBA 5FPKA 1LW6E 3MQFA 4WZ6A 2G5TA 1BU8A 1T5SA 4R7GA 4C3OB 3W5JA 4ZIRB 1T9BA 2GJ8A 1R4NA 2B7BA 1FVOA 3S2IA 1KR5A 2QYTA 4FW9A 2H2AA 4LZNA 1AZSC 4NARA 5BQPA 2HOQA 5BNFA 1EE1A 1NVAA 2QM8A 2VJDA 3IPCA 2XZLA 3K8ZA 4WA8A 3R3UA 2MCFA 2DBRA 2GBIA 2VR1A 3LK6A 4PG7A 1XYGA 2FCRA 5K51A 4QOFA 3O83A 3SX4A 4D25A 4QRIA 1PTKA 4QQ8A 4UMDA 1GZVA 4PQYA 2K87A 2LCFA 1T5TA 3PFWO 5IC6A 4EMTA 1AF4A 1RJGA 1FDOA 5BSVA 3NEYA 4V0ME 5LU9A 1RPNA 4Q7KA 4E13A 1K88A 3IAHA 3BRWD 1I3OA 5EJ2A 1SG9A 4PGAA 1KXZA 2C82A 5G2OA 1PJ3A 1H3EA 2JVKA 3MRSA 4OQNA 4W8GA 3E7XA 5HIKA 1V8ZA 1F38A 3CJQA 5IJ0B 1CFJA 4NAHA 1I6WA 4O8CA 5BMVB 3CZPA 1J8YF 3H83A 2R6CA 3H2JA 2BGRA 4IDPA 2XVMA 4RMJA 4BMDA 4E08A 3TZ6A 4RIEA 2VDPB 1S01A 2Y1OA 4XLTA 4C3UA 3V2UA 4FW8A 4D4IA 2YFQA 2PZMA 3EGXB 5AHOA 1TF2A 1YJCA 4LGVA 3USCS 7MDHA 2ZE6A 4PLYA 3EIXA 4CTKA 4K2AA 1R4MB 5IBRA 2BDEA 1BVYF 3FGNA 3OT1A 1V5FA 2WKRA 3GGCA 1RYYA 3PWKA 5B1YA 2LGJA 1CUBA 1Q0TA 4IUDS 1T8YA 4Z9AA 2AQKA 4BEBA 1RBMA 3EDOA 1J6UA 3NYRA 4BV9A 1DQSA 2IITA 1U2ZA 1G5IA 1BGXT 1ZK0A 3I01A 2FUG6 1UEJA 3K0HA 3OQVA 4LDRA 4EG8A 4M88A 1I13A 4AMGA 1URPA 4L9RA 5CD1A 2O54A 1NAHA 3ICOA 4XX0A 1FDRA 4TM8A 1RQ7A 2VUUA 2YMQA 5AW8A 3HCEA 3I9LA 2QT0A 4PIPA 5CJPA 4P58A 4K0KB 5L53A 3T9CA 1DE0A 3KPVA 2DE0X 5CDTA 3K9FC 1G7SA 1W0JA 3FMFA 5DP2A 1L6RA 3K0CA 3JQ7A 3OC0A 1Y8ZA 1L4FA 3FM9A 1IIBA 1V2GA 1GUZA 2PPVA 3HKEB 3WXBA 3AKDA 4R2JA 3W2HA 3DLAA 1CK4A 2CF6A 1DUSA 4RTJA 5E4YA 1WAMA 2H1VA 2JAHA 5EHNA 3R0XA 1D2CA 4ZVSA 3R20A 4XJTA 4J2TA 1JGTA 3K9WA 4M7PA 4AO8A 3ASVA 2OFPA 2VA9A 4IIUA 1DLJA 3WLHA 2FN4A 3BA6A 2H29A 3PI6A 3H97A 4HY3A 4QHTA 4G0OA 1FNNA 1MA0A 1V11A 3G7UA 3MOSA 4R05A 4CG3A 2AUNA 4TKVA 1A9YA 1X19A 3VI4B 4AY4A 2GEKA 2XNCA 4J1TC 1LWNA 5TE9A 4HZIA 2PWZA 3G49A 3HBJA 1XQWA 1OPRA 3HGTA 4YRNA 3IBFA 2NX2A 1EM6A 3L7AA 1WCWA 3BSFA 3FFXA 2H9AA 2X8JA 3F90A 3TPFA 4M83A 1QHHB 3SFTA 3ZPXA 1Q0RA 3U16A 3RC9A 1JQJC 2O2YA 3AKCA 4S05A 1AF7A 3VNAA 3KPUA 2PK3A 3O4IA 2A14A 1WA5A 4G63A 4PM4A 3QEAZ 1YIAA 3A2MA 2YQ5A 2FWBA 1S8FA 5TVKA 1XZ8A 2PUFA 1K3TA 5DYWA 4DLAA 1G4HA 5I3ZA 1K9VF 1FL9A 1YL5A 2LXNA 2WQ7A 2FQ1A 4RY8A 1L9XA 1YBFA 1J24A 5ER6A 1NSTA 1RKUA 5AVJA 3U9SA 2AXQA 3NNNA 4AICA 3AKYA 3GJXC 1G3MA 1ZUHA 1ULAA 2Z1DA 2HK8A 5E7QA 3CW8X 5LJIA 5CJ2A 2PJRA 1GPWB 4NDNE 3ZXIA 1T0JB 2ONCA 4OCZA 1PQUA 2G63A 4MDEA 3V42A 2BM8A 2RKWA 3M3PA 4GD3Q 4R9UC 2YZMA 1EDDA 5I4BA 2ZPAA 1KSJA 2AX4A 3I2YX 3EVFA 2LV8A 4OI1A 1Y3IA 5LLTA 1Y7LA 3NPAA 2FOXA 3DS8A 3DT9A 1YSCA 1JZTA 3K16A 3SP1A 3TX6A 3UJ7A 1Z74A 4L2IA 2WE7A 4IDNA 4L9SA 3NHYA 1E9AA 4P32A 1ITZA 3D6HA 2CN1A 4MS1B 2JARA 2GAIA 4PRYA 4D0RA 3QA9A 1R88A 2W6MA 4YRJA 3I4FA 2HSEA 3FUVA 4RLHA 1ZCFA 4C88A 3AF6A 1MC5A 4A6EA 2FX2A 5COQA 1XF9A 2DQKA 4BE4A 2DECA 4F9EA 4B45A 2GR9A 2I1VB 4PLVA 2JG3A 2QE7D 1NQXA 4EY8A 2MR5A 3EZGA 3HR4A 5D2CA 2JHPA 5BWMA 3HB0A 4TMWA 1A71A 3ZJ5A 4AI6A 2O7QA 3RIXA 2FP4A 3K92A 1NMSA 2P9YA 4H6XA 1YI1A 1LTKA 1H6CA 5DLDA 1UK6A 2WW8A 3TIXB 3D6UA 3QLVC 2B8NA 4BYGA 1KK2A 3KZ1E 1OU4A 1I9GA 1RLIA 1CDZA 2A1TS 4GZMA 4DS3A 1WS6A 1H2EA 3CFYA 4QQKA 4BMNA 4TMVA 3BMQB 2XYQA 5LR6A 1U2PA 1WZNA 3GCZA 3TSAA 3R0IA 1EM8B 3QLEA 4O4JB 4EL0A 1HZZA 2JVJA 2AN5A 2DJ5A 3IUEA 4XVQA 1BXRA 1YFJA 1SC6A 2IUTA 2P3SA 5AI0A 2RBGA 2LCQA 5C0OE 3KOUA 2OHFA 3E2PA 5ALXA 4A16A 4G37A 3MJSA 4Z4IA 2B20A 3LC1O 3BHNA 3WDKA 1B76A 4ZI7A 2W9XA 2D5LA 4MV7A 2NOAA 4NBSA 4GLFA 2AN3A 4MQ6A 4O3MA 4U8GA 1HQYE 1L7MA 5FWXB 2WKSA 3F1LA 2F1RA 2VNKA 3AU9A 2HNAA 1Z35A 1TZCA 3DE7X 2CD7A 1ZI6A 4BLOA 1TDJA 2ATEA 3WBFA 5TMDA 1U7OA 1WZUA 4J4TA 4RVGA 3L0ZA 1Z2AA 5F73A 2R6GA 1U7UA 2TMYA 5IN5A 2QBYA 1AA9A 2Z3VA 3KVOA 1H1LA 4M46A 4EY6A 4D9GA 1E1LA 2MJLA 4YRPA 2PR2A 3K8YA 4BO9A 4V3BA 2DB3A 4KRGA 2IOYA 4D26A 3HVJA 121PA 2B4YA 2YWCA 3N2EA 4DMMA 4WBXC 1H2ZA 4DC0A 4TLDA 1VKNA 1D6NA 1NR5A 2NZ2A 4CQMA 4BAGA 3V1MA 2JIZA 2BTOA 4G4JA 3ND7A 4GC5A 4KO3S 5LZ9A 1JQLB 2DM6A 1NV9A 4Q3DA 3EG9A 4KMRA 1KVQA 1YQEA 5IVDA 2KM1A 1FSPA 3WMGA 1Z7WA 1P5ZB 2NPFA 2JLUA 1VSVA 3I9MA 1YKSA 2KLHA 5FPPA 6NULA 4BB9A 3IQIX 3DMDA 4PO3X 2QQEA 3GT0A 1NSFA 2XRFA 5D3QA 3WNZA 4CL0A 2IZ0A 1NQWA 3QI2A 1QIDA 3WZ2A 4PYOA 5H4HA 2JGRA 4RJLA 2FPKA 4P7JA 1PNTA 2UVPA 3LA6A 4H6PA 1X7DA 1AO3A 3FUXA 3VKVA 1RQXA 1W85B 1V9SA 2AMFA 3LLMA 1E6CA 2QPAA 1AS0A 1NLMA 4EL5A 3I6IA 2RDMA 5DHRA 4DBVO 3MSXA 1GAXA 1TCAA 5FHQA 2FUNB 2JIBA 1KKUA 1NVGA 2TS1A 3EXHC 5LZ4A 2FGJA 3GEEA 1J25A 3ZHUA 3AR8A 3ZXUB 2YWGA 2RH4A 4D9NA 5G1NA 4IG9A 1F2DA 1TYBE 2BLNA 4JZKA 3H5TA 3HKCB 1DAPA 1UKBA 1QH8B 2X8AA 3K7EA 4O2BF 3V7UA 2GAOA 2XCSB 4OHKA 2CZCA 2Y0EA 4RQBA 4CF6A 2OHJA 2FZLA 4DUPA 3GJ5A 4FKBA 1YQXA 2BJVA 1WMFA 4FOLA 4AF6A 1YB6A 2HIGA 2P9QA 1W9HA 2Z2IA 2H1IA 3A0UA 4M53A 4FIZA 3QKIA 4LZZA 3VNSA 4M7OA 5JHHB 5KOJB 1VFPA 2Z5GA 3CTMA 3ZQKA 2P6MA 4EJSA 1I94B 1NULA 4YP1A 5M3BA 5I8WA 3H2ZA 1G17A 4EB0A 3GLFA 5BOSA 1C7RA 5AHRA 4MS4A 5KSZA 5TQJA 1K08A 2G0AA 4KFRA 1IXKA 4CM1A 3AVXA 5AK5A 1AA6A 3KUUA 4IDHA 3OF5A 1YRYE 4ZT2A 3S44A 1F9EA 5CXQA 5LWQA 4CJXA 2QRLA 4NI5A 3IKTA 2BPOA 2CHVA 3KKMA 4CM7A 3IO5A 2XUJA 4YRLA 3TOSA 1XXLA 2WTAA 3DR3A 4B6JA 2F4NA 4P4UA 3IQHX 4YR7A 1CJKC 2FWNA 2H85A 2W8BB 3M6XA 2ET6A 1WNFA 4BMOB 1Q84A 3DR5A 3FPLA 3OURA 3A3PA 4XUGB 3M3DA 3OLWA 2PSEA 4ZJZA 3NHWA 3ZHSA 4C3VA 1B2RA 3VNQA 4LIPD 2EFYA 2YHBA 3VR6H 4GZLA 3REQB 4B84A 3H2IA 1NN5A 1W52X 2FSHA 1L4MA 5DXJA 1W75A 4B80A 3JVUA 1IPEA 1DDOA 3UGTA 1I6LA 2A2ZA 3PQ8A 5DN6D 2Y76A 3LL7A 4IRMA 2Q2VA 1FXUA 4NABA 3A7DA 3ZHZA 1X74A 2Z9BA 2V9CA 1NVBA 1R9MA 2XUOA 2Z3WA 5DHFA 4ZCSA 4LFCB 3X44A 5KZMB 2WSBA 2CL7X 4D8YA 3WWYA 1CUUA 2J4CA 3GLUA 4BNLA 3AI2A 4BRZA 1PR3A 4DNXA 2EWVA 5K4AA 4ZK2A 2AH5A 3GEPA 4B6SA 5CB4F 1A0OA 1DAKA 3A9WA 2OV1A 2HWWA 3EG5A 1E0JA 4OA5A 3SC2B 3ZV5A 3FUCA 1PT9A 1DRVA 4RMNA 5JCOC 4LJ6A 3NP7A 4JC0A 3SZMA 1T1GA 2JFHA 4DJDC 1N2ZA 4LCEA 1PFWA 2GAAA 4U7DA 3BXHA 3U56A 3PX7A 2DMRA 3PDIB 4TROA 3C6MA 4JLKA 4DOMA 4TVBA 2CVZA 3RWOA 4RFVA 2FZKA 3CXRA 1YBHA 3ZX5A 1L7XA 4GWGA 5DTQA 3AM1A 3PNSA 2Y71A 1E2EA 1Z15A 3WAGA 2YRWA 1C3EA 1QHYA 2WI8A 4MVJH 3IQGX 3MT7A 3LZCA 3OSZA 2VHJA 3E9NA 1UJNA 2AF4C 1M2EA 4YQFA 4XAQA 3BUSA 3CX8A 1EUCA 2VKTA 1W73A 2WHRA 3TLGA 3ZY5A 4QASA 2NZYA 5AVZA 1EKXA 1GDHA 4WXPA 4JYCA 3EMBA 4EHBA 4H1TA 4MUYA 1J42A 2FOLA 3TGWA 4B85A 5TIIA 3HXOA 4JX9A 4HC4A 2IY8A 1Z7EA 2XNJA 3DPSA 1BAPA 2AJ8A 3AINA 1P9WA 3QRWA 4KPFC 1VCOA 3ZN2A 2J32A 1L4KA 2LDBA 3T7IA 2FW7A 1E4YA 2QVBA 3KOYA 1GG2A 5G3YA 2G5CA 5C8YA 4TVSA 3KLMX 3BCUA 4DIOA 2CK3D 1RVV1 1IHOA 4H0FA 1WMDA 4CF3A 3DL7A 3JQBA 3TFOA 4RTMA 4N8EA 2PZJA 4AKEA 4DV5B 3EARA 1TU4A 1P4HA 2Q5OA 1ZY2A 2CUKA 3DDCA 3A4VA 4CHTA 4TLAA 3UHPA 2I9KA 4HH3C 2HFKA 3DWFA 2EQAA 1A77A 3DWIA 3KOZA 3TN7A 2BI4A 1U98A 3A1CA 2YC2C 1L5ZA 5ALHA 5T3YA 2VRBA 4HUJA 4NMWA 3STVA 2YMPA 1EFVB 4QYIB 4L6CA 1DUVG 1DCMA 4ZYZA 3LX5A 4E3WA 5TT0A 1BVUA 3B6EA 2WNHA 3DE0X 4N5LA 2W5UA 4MITA 3N2IA 4U7JA 4RPHA 3H8JA 4OLBA 3ACBA 5LSAA 1GWNA 4MKHA 2JFFA 3C1OA 4Z9YA 3F6EX 2QUKA 5G41A 4EH1A 4XW2A 1ORRA 1BRTA 1XG5A 2NADA 3JVIA 2O8NA 4LDZA 2YWBA 3F8SA 3WJ1A 4RFLA 3T0FA 4B6FA 2P9GA 5J4KA 4TKLA 4IUBS 1ORVA 1BC5A 4XKJA 3A3KA 2FZEA 4BXOA 1FSSA 1TK2A 4HB3A 3FW1A 3TR0A 1P18A 2B21A 2EYUA 2XQKA 3BL6A 3FN4A 3NO4A 1DP4A 3VKGA 1OASA 2A84A 1JEYB 3EIWA 3RRYA 4B81A 2X8WA 2QD3A 4Z9XA 5KTMA 4NZPA 3CEMA 5JNSA 3O38A 2Q45A 4JH0A 2WU1A 2EP5A 4ZU3A 4PSCA 1PF7E 2MSNA 2SBTA 4NP6A 4RGQA 2OQVA 4DXAA 1E5VA 4ZOLB 4UTPA 1L2TA 1W4BA 2QU7A 1U7DA 3DKVA 2L2QA 4MI9A 5LYJA 3RAPR 4YRDA 4UEJA 1KYTA 1YB2A 1FB5A 2C84A 1N2IA 2JJQA 1YIDA 1YL7A 2R5WA 3T7EA 4DEXA 5K3OA 3OZWA 3N0TA 4BNJA 4TZ0A 2CLCX 2VZ9A 3C0KA 3HGMA 3R8XA 2PZEA 5CYFA 5EYPB 5CH3A 4FM9A 2WA1A 4CMEA 3QX8A 1ODTC 4LZWA 4CCSA 2GEBA 2VYVA 3TQTA 3PQ7A 1FLDA 3MPOA 4WZAA 3WP1B 4J7XA 2QM3A 1Z83A 3Q0TA 3W5HA 3CR7A 1ETUA 2M6SA 1GQRA 2J3EA 2EHJA 3K1JA 4JNCA 1Y7PA 4PYKA 2DFPA 5DBEX 3T1OA 3ZE2B 2JFNA 4BVKA 5IDQA 5IKXA 3GLIA 1L7PA 2OBXA 4ID3A 3TINA 5JDCA 4MUFA 1W1UA 1X7XA 1YRWA 1ZD8A 2HHAA 3M6MD 3RU2A 4UBOA 1F3OA 1UKCA 4JASB 4KXVA 3JD2A 1IJFA 1JJBA 3FNHA 3ZIAD 5FEMA 5KC9A 4P3YA 5KNBD 2J85A 1A4IA 2VYNA 4EATA 1BE8A 3QBTA 1TECE 2HMWA 3HBLA 1SXGA 3JQDA 5F78A 2PIDA 5G4LA 1NGSA 2WM2A 4IH1A 3DLIA 4X62B 4WOCA 3UHOA 2G9NA 5HJ5A 2EW2A 3FRIA 3LDAA 1VPWA 3D7RA 1YF3A 3PXAA 2CFOA 3RYIB 4BO6A 1CG6A 4EG6A 3WLAA 1AGPA 1X0XA 4Y9TA 3RLIA 4EX7A 1YJBA 4HVTA 3MG9A 2AHRA 2ZSFA 3OT5A 3FFBA 3EGDB 3QVGB 1HFWA 3V2GA 3U39A 3KHUA 1QQ7A 4Q24A 4BASA 5KSPA 1X1QA 3G1UA 2BJHA 2GYUA 1O94C 2W2VA 1Y7HA 1YUMA 4BMSA 5JROA 1DWQA 5JSZA 4JELA 4S2EA 1N6NA 2QTHA 1XLVA 1ENPA 1ZNZA 3OOJA 4RSMA 3BKWA 2I2CA 3WLJA 3P19A 1X7ZB 4DRXB 5L3ZA 1GZUA 1ZL2A 3H19A 5AOVA 3BSSA 3RREA 1M1YB 1PZFA 3VAAA 4A2CA 2IVZA 1IH8A 3GZNB 3RBZA 3S5UA 1IJBA 4QT0A 5K6RA 2AW3A 3KOOA 1Y4SA 2V6IA 4ZCIA 3GN2A 5JH7B 3AIKA 3IMGA 2OAQ1 2ESRA 2IYWA 1Y42X 6ABPA 1LEHA 3QKRA 2IPMA 1Z73A 2C29D 5F7OA 5FAXA 5CM9C 5NULA 5ALOA 1NF8A 1KJWA 1Z68A 1TO1E 2ZFUA 3MRTA 5AK4A 3CONA 1PV1A 2ZBQA 2ZBUA 3K1AB 4OIMA 3PGA1 2CT8A 3G82C 4GGMX 1L8QA 4WJLA 3C6YA 1UDAA 2F3UA 2OMEA 1VRVA 3TDMA 1KC3A 5HF6A 3D1JA 4R31A 1AKMA 3IP3A 4P08A 2WQ6A 3B12A 3ZJTA