3DSFL

Crystal structure of anti-osteopontin antibody 23c3 in complex with w43a mutated epitope peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
YIQMTQSPASLSVSVGETVTITCRASENIYSFLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQFSLKINSLQSEDFGTYYCQHFWGTPFTFGSGTKLEIKRSDAAPTVSIFPPSAAQLSSGGGSVVCFLNNFYPKDINVKWKIDGAERGNGVLNSWTSQDSADSTYSMSSTLTSGGDEYERHNSYTCEATHKTSTSPIVKSFNRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab fragment of anti-osteopontin antibody 23C3, Light chain
total genus 49
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2008-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dsfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dsfL01
2BC4A 1RFDH 1CICA 5T33H 2DIBA 3OKLA 1ZTXH 2X89A 1P4IH 1NFDF 4WV1C 1YEEL 4G6MH 5ETUA 3RX8A 1X6LA 1GGTA 4MXVE 4MX7B 4Z95H 1FZJB 4KI5E 3GSQA 4X80H 4HLZH 3IDUA 2FX7H 3CVHA 3RIAK 4BA8A 2HJKB 3ZTNH 1YEEH 4HWZA 4KV5E 3FOMA 4ONHB 4RAVA 3SGDH 1HZHH 4I48A 2BDNH 4M61A 2W60B 5I8OH 4K8RH 4AQOA 4Z7QF 3VGEA 3TO4D 3MCLH 2YWYA 4PD4J 5IEHB 2B1HL 1VPOH 4JKLA 1CGWA 43CAA 4JG1H 4Q58C 1UJ3C 4DK6A 3EOTH 1Q9OA 4EQ3A 1CBVL 1RU9L 1JFQL 4FMKA 5J3HC 5DD1L 1VKXA 4U1GB 4KHXL 3F12B 4HUMB 3L95B 3IF1B 3VXTA 1CR9H 4QRQA 1S7QB 1F58L 3AS0A 4OZIF 3PWNA 4RISL 2EE9A 5DMGD 1KG0A 4IMKA 1QBML 4U4BA 3FQXA 2I9LA 3FFCB 2V2XA 3GRWH 3BGAA 3BW9B 2JCCE 3GMOA 1HKLL 1CLZH 4L3CB 1TQBB 2R2EB 4G8GB 4WI3A 1FBIL 2VR5A 1DBBL 4POUB 1H3VA 1CFTA 3WLBA 3JWOH 2BVOB 2VH5L 4O2EA 3D3VB 5E4EC 1DFBL 5HGAA 3FQWA 4Z7VE 5F88B 1FCCA 1T66C 3ARBB 3RKDD 3QI9A 4N0UB 4U2ZA 4GRWB 2VN7A 3P0GB 4FZEH 4C58B 3F8UB 1K3ZA 3WDIA 1IGCL 4ZXBC 3RX5A 4ENED 5DC4B 4L8BA 3EZJB 3SJVA 4UT9L 2D7PA 3S8WA 1L0QA 2ENYA 4OD1H 4FFYL 3ZHKA 1CQKA 2NY2B 3IXTB 2FEEL 4JFPA 3G6JF 1QKZL 2XQYG 3GHEL 1UENA 2BOBA 1XGRA 1MCJA 4JLRB 3QHFL 4OLXH 5DFVC 1TETL 5E24E 2CUMA 3VXUD 4HWEH 2R0LL 4HGKC 5D1ZC 4MD0B 3QZWB 3MFGB 4OLZH 4KMLB 3CSBA 4HIEB 1TJIL 4XNQA 2IMNA 1MCLA 4H26B 2PXYC 4FZ8H 1I1AD 1QACA 3CZJA 3BP6B 4JHZA 2DDQH 1QUNA 2ZUWA 2ARJQ 3QWRA 5BJTA 3DO7B 4LSVL 3FRPG 4RFNB 3LDBC 2YSSA 4JRXD 5DURD 1K4CB 3K7UA 5L88L 1UWEH 4KMTL 2IFFH 4DKFL 3EFFA 4GQ9L 1M6OA 1RJZA 2V7NA 5DEZA 5EUKA 1QKZH 4TN9A 5DDHB 2ADIB 3L95A 3C5ZB 1KNOB 4L3ED 4GAJL 1PDKA 3MRIB 4NUGH 4RQQB 3KPTA 4FNLH 1B0RA 2Q7NA 3QWOA 5KSUB 2DB8A 5KSBE 3H8NA 1B0RB 2YPLB 4I3GA 3HCVB 4YPJA 4YBHA 1KNOA 1KIRB 3EYSL 1AGDB 4Y2OA 3O2WH 4IRJC 2VLKD 4PJAE 2ADIA 3QDJE 5JW4N 5FO7B 1I8IA 4Z6AT 4MS8C 1IBGL 5H35B 4X6EA 5IJVB 3SKJH 1K4DA 1GL4B 1XCQB 1WIPA 3BIKB 4KZEH 5C9KA 1B4JL 2Y7QA 5L2KA 2A2QT 1OTUC 4MA3A 3QEQE 3IAPA 2JB5H 3CPLB 3BKML 4YHYB 4XWOC 1I7RA 5KZCD 1FYTA 1MI5D 2A83B 5T1KD 4DZ8A 2J8UE 3M8OH 5J0BA 5F1SA 3T0DA 1O0VA 4JM4H 4LBEB 5GGTH 3MRLB 1T3FA 4HUVA 1Y18A 1MRCH 1IKFL 5K9JH 3VWKC 5IV2B 1S7XA 3FAXA 5SWQB 5CZKA 4YE4H 4TNVK 2VDRH 4K9EL 3MBEC 3HB3C 5DD6A 2AXHA 1L7TH 4UAOC 3HR6A 5ITBL 3RVTC 3STBA 5LVEA 2OJEA 1T1ZB 1X7QA 3UJIL 1XH3A 3VI3E 4QRUA 1CFSA 2ADGA 3ARDB 3NZ8A 4XP1H 2UY6A 1J1OH 2EIZB 4P5MA 4Q6IB 1XGUA 5I8EA 5IKCA 4GJTB 3AAZA 4Y16C 3BESR 2ZUTA 5GQBA 1AQDB 4XVTH 2WBJD 4PJFB 5CD3B 5E9DD 4XPTH 4NZTH 3QI9C 4LSPH 5CFHA 1T21B 4Q0XL 1DE4A 4AG4H 4PJIA 2NY0D 5GSVB 3W82A 2NXZC 4JANB 4KMQA 5HYSB 1Q9KB 3VXSE 1LE9A 2AS5M 2ZNXA 1KIQA 4C83A 1A3RL 1A6TB 2B8OT 2XY2A 2YKLH 3GMOB 1ORSA 1CD1A 3CSYB 2YC1B 2GSIA 3RWEB 3WE6A 1QEWA 4H25B 3MJ9A 1S8DA 2Q76B 4JFOB 3ULSB 3OKOA 5C0RL 2UWEA 4N68A 4O4YL 1KG0B 5I1CH 4G6AC 2DQJH 1GGBL 3VXTB 2QHLA 3IF1A 3P73B 2CJUH 2AJUL 3F12A 3MXWH 3QQNA 1XF3A 2CH8A 5GHWH 5LCVL 1CU4H 4PJEE 5IBUB 4GRWE 5IB3B 1GGCH 4U2YA 3HI5H 5BRZE 5DR5L 1OW0A 1OWWA 1F4WH 4DAGH 3I75B 1CICC 1I9EA 3FL7A 4C59B 1JZ4A 4WW1B 1IT9L 2X44D 1ACYL 4PJ9B 2V5RA 2HJKA 4JFEA 3FB5B 5D72L 4QYOA 3VXQB 3ULUH 4OQ1A 4OZGB 2H1PH 2Z8RA 4FQCL 1QRNA 5I76A 3QIUB 2BY0A 4LRNL 4KROC 1C5DB 3D0VB 3L3DB 1AC0A 2VLJD 2EIEA 3HC3H 4ODSH 4WNQA 2FJGB 2NY7H 4WWKC 3O3BA 3VG9C 4K23L 3VG0H 3S37H 1C7SA 5I71C 1F3DJ 4FQCH 2X1OA 5GS0H 3R06A 4QXTA 5E4EB 1PLGL 4J6RL 4OZHF 1G6RB 4HPYH 5DHYB 4OGXH 4WI8A 1I3GL 4JN1H 4IRZL 4HXBL 3HA0A 4P5TC 1ZT1B 1K85A 3N1QC 5HDOA 3BJ91 4V1DE 5GISH 3NPSB 3VCLA 2YA1A 4HS6A 4XNMA 2G60L 3JBG7 3TA3C 5DVLA 5MEOB 1MCNA 1BBDH 2GUOB 3HI6L 3MRFA 1GVIA 3IS1X 3V4UL 4HT1L 5E8DL 4MXQC 5EOCJ 5SX5K 4JB9L 5HTSA 5I1CL 3F5WA 4HUNB 3IXAB 1LMKA 2KQNA 1O7VA 1CFQA 1BVKB 3ARYA 3S96B 4P9MH 3N85L 5KOVC 4EDWH 2AK1H 2YWZA 4HC1H 1AD0A 2ICCA 2Z4QA 2D7TH 4JPVL 2NW3A 3VH8B 1IQDB 4D9RE 5C08D 1JHTA 2FO4B 2EDWA 2C7UB 3NABL 4GLRI 5ESQB 5IHZA 2JKXA 3MV9E 1KB5H 1A6AA 1L7IH 1PGRB 1EO7A 1U92A 1BBJB 5DK2A 4MCYA 4XPTL 1IC5L 4XP5L 2DLFH 4EKXA 4GAFB 4TUOB 1MNUH 4DKEH 4ERSL 3W81A 3LV3A 2AQ1A 1G9EA 3OKDA 2DKSA 5GGSB 2ADJB 4XMLL 4WWKB 5DJ0B 3UC0L 1RK0A 3O4LD 1RJYB 1LGVA 2AJVL 4LVHB 3LPGA 5I73B 4KRMB 5DJZB 5GJSL 3BKYH 1ED3B 2ICES 4K07A 1OSPL 1JIBA 1OPGL 3U9PL 4A6YL 5BVPH 3O6FC 1WQVT 3DURB 2PXYA 4ZFFA 3OXSA 4Y1AA 4DGIH 5IT2H 5C0AE 3S9DB 4WV1A 3QDMB 3KPMA 5MEPA 2X4UB 3NFPA 1MCOH 2VN4A 1FFRA 1O7SA 4WUUB 5IFJB 4LCUA 2WWMC 1HWHB 3KLHD 4S1SL 3C2SA 4N8VA 2CLRB 3VXOA 1VFAA 1BGXH 2CGRL 5AUMB 1FJ1B 5E0QA 5EZLB 4ZMAT 3TO4B 5EBLB 3W9DA 4ZSOB 1FRGL 2A74B 2N1KA 1BFOA 4BQBA 3DRQA 4HQQL 1BPVA 5JOFA 4FS0A 3WV0A 2DMBA 2ZG1A 2M26A 4PJBA 4WHDA 3R0MA 1XFPA 3GNML 1G7JA 1IAOB 3GJFA 4L4VA 1IM3B 1S5HB 3TJEL 4P99A 1CIDA 4ZFGL 1YEGL 3VXSB 5GIRA 4YDLB 1TNMA 4ESKA 4NJ9H 1NCCL 4JFQA 3CLFL 3G6JE 3WS3B 1JWMA 2CQVA 5JNYB 3MRDB 1D9KA 3MLXH 4QXUH 1FO0A 4M93C 5DMYA 4FG6C 1AP2A 3H0TA 2Y4SA 3U4AA 2I9TA 2GHWB 5JTWA 3OSKA 5ALBH 4JDTH 1C16A 2FB4L 5EN2A 1Q0XL 8CGTA 1JZ8A 1I7UA 3MTRA 2QSTA 3HPJA 5D7IE 5GRUL 4FQ2H 4J2XA 3RKDC 1OTSC 1J8HA 4LLDA 3MREB 2X4UA 3NFPB 2V2TB 4XNYL 2EYRA 3VWKB 3QEGL 5IGXH 3GSXA 4KKBD 4OLZL 4Y8DC 3LEVL 4PJ5E 3AGVA 2BXZA 2FH6A 3FHQA 3WN5C 3MZGB 1WTLA 1NGPL 4QHKI 3FN9A 4XXDB 3H3KA 4MA7L 5H94B 3DXAB 3VFMA 5CEXA 3LKNB 1JV5B 3BSZL 1JYNA 2R1WA 4JRYB 3SDYL 2W65B 4M02A 4FMFA 4F58H 3W39A 4Y19D 3CFBA 3NGBB 1S5IH 1TZIA 4JE4B 1SEQL 3EBAA 2A1WL 5F97E 1PKQE 3BXNA 4Y5XC 4K7FB 1L0YA 2D31B 5SWSB 5BVJB 1WCBB 5FYLE 1FFNB 4O58L 3QIBA 1J88A 2DMCA 3J7HA 5TDOA 1AGFA 2YK1H 1D9KC 5HDQH 3C5SB 3OR6A 3QO0A 1RIUL 4DN4L 3FT3B 3ARGA 1KEML 1JNJA 3JV4A 1BVKA 5FYJE 1UADC 3S96A 2B4CH 3MNZB 5I1KL 4U1SA 2X1PA 3MUY1 1XIWB 1F3JA 2E9BA 1UVQA 3M1BA 1RIUH 4JRWA 3AREC 3MJ8A 1A7PL 2BOCB 2JF1A 4AMKL 4XB8A 1A8JH 3ILQD 3RWHA 2XV6B 2D3VA 4LMQI 2D03L 5C09E 4NQCE 4KHTL 3RBSA 3VE0A 2VISB 4P57A 1MHHA 4NN6C 1FAIH 4MQ7A 3FT2B 4J3SA 5CUSH 5EA0H 1MH5B 3HG1E 4X6DE 3ZE2E 1DLFL 2OR8A 3HE6D 4RX4A 2EIDA 3T08A 3BSZH 4J3TA 1NCNA 1NBVL 2PTTB 1ADQA 3MV9D 3K8KA 3L3DA 4PJHF 1CLYH 3RZWA 4XCEB 4Z5RA 1YJDL 1T22A 3RY6A 1T7ZA 4ZUWA 1DUZA 1FIGH 4PJHA 2GW5A 5ERWB 4D9LH 3RUGE 4D0DA 3GSRA 2NQCA 5AZ2H 2XWJA 2EH8L 1I1FA 5D8JL 1U95A 2V2WB 1QFWM 1Z0MA 4KJPC 2NY2D 1AQKH 3BD3A 1OAQH 4HS3A 3TV3H 5I1AB 3CUPB 5ACZB 3IFPB 4TULH 4S1RH 4FABH 4PJXF 4U0RB 2R4RL 4NWTH 4LHUG 3MA9H 5JW4R 2GK2A 2OTWB 3GSVB 3RJDA 4PYHA 5I2IA 3O9WC 1UEMA 1NJ9A 3FJTA 1CTNA 2PTVA 1KUMA 2ZG3A 4JM4L 1VFBA 4R26H 5DRZB 5DJAA 3Q3GB 1LD9A 2VXQH 5BVJA 2D31A 3HE6A 5DMIL 5KVFL 4OF7A 3S6CA 1PKOA 3BYYA 5E8NB 3JWOC 5I6XB 3OJ2C 4LEXH 1JNLH 4KK5D 2EYSB 3S36H 3IAGC 4NIKB 2ZUYA 3CMGA 2W65A 4UU9B 3ELAT 2R2HB 3QP3A 2WUBL 4L3AA 4V2CB 3L5IA 2F5AH 2DL9A 3QCUH 2AXJA 5LBSH 3IVKA 5H94A 4RFEA 4KY1L 1PX3A 1X3DA 2FLBT 3OAYH 4NN5C 3L5WA 2IBGA 3U7WH 1MJ8H 1MPAH 1EFXB 4Y1AE 4N1EA 2HT4D 1UM5L 2JJUA 5JOPD 3D69A 3DX7A 3QCUL 4D3CH 3U82B 1CFBA 3PWPB 2K7QA 5DEFB 4PB0L 3U0WH 1PSKL 2DKUA 1F11B 2L4OA 4GQPH 2X4OA 3WLWD 2OJEB 3NCFB 1H3XA 4PRIE 1NKRA 1FZKA 4NQCD 5KBNC 1DBAL 4NQEB 5C09D 4D0BB 1FL5B 4X6CE 3VMNA 4LCIH 3ARFD 4JO2L 2ZPKL 4PV8B 1U8IB 4NQSA 1MJ7L 4FTVB 3WXVH 1A4JA 3KPSE 1Y18B 2I9TB 4P2QB 1KB9K 4WFEE 3AREB 1MIEH 5HHQA 3RTQD 2ESVB 3VU2A 4W6YB 5HHVH 2P45B 3SBWA 3KNBB 3LEYL 3WFZA 1E4XL 3IRZA 5J1SC 2F8OA 4Y2DC 1WF5A 4F2MB 1AHWB 4Y5XA 4F9PC 2CK2A 4LLWA 2J5LC 4HJJH 2P5EE 1JWSA 4JO1L 5DJYA 5C07D 2OR9H 1IM3A 1S5HA 2ZOLA 3BP4A 4XP5H 4MLSA 1MAJA 4WJ5A 4H5SA 4FA8A 5SWSE 4IOIB 1JWUB 4LLYA 2AEIT 4P2RD 3HRZB 1BJ1H 4RCAA 5JXEC 1S9WA 3ROLA 2A74A 2P8PA 3G6DH 3CC5A 5GXBB 2GT9B 1RUPH 1KFAL 2F74A 3GSUA 3X14A 3OGOE 5JDSA 4JKPH 2I60H 1CTOA 1YPZE 1MHPH 4EN3D 1N2RB 4WO4D 4ELKB 3P0YL 4WUUA 5IFJA 3X3FL 1M6OB 1RJZB 3HZYA 1F4YL 5TH2A 3RRQA 5DD5H 4PJCA 5C7XH 3T0AA 1LO5B 1KCSH 4PJDF 3FQRA 4M5ZL 1MHPL 2J7LA 5ANMA 2HWZH 4Z7WB 3MRBA 2G60H 4EI5B 3BPCA 3NA4A 1BQHB 1AGEB 1S9VA 4LPXA 1F4YH 2QQNH 4U6TA 4EI5C 3I2CL 3RVVC 1AJ7L 4ONGL 2VLJB 5T3XE 1LP9B 4HLZG 3WNOA 4HPYL 5FYLH 4OB5H 3S4SA 1YEJL 1RUPL 3B9DA 4JPIA 1QQDB 5DC9B 3OF6D 3MLSL 3QIUC 3T2QA 1OF2A 3VRJA 3VDAA 2FEDD 4MQTB 2MWCA 1ND0B 2R4SL 4GKZA 4WHYG 2DQIL 3PQYD 2XRAH 2VXVH 1SJXA 3L3JA 2Q6WB 3L9RA 2ED9A 1PAMA 1CLCA 4UINH 5DMKB 4JZJB 4L1HA 1ZOXA 3MYZA 3QNZA 4HV8B 4FP8L 1MIEL 5L2JA 1R3LB 1ZANL 1HHJB 4P3WA 1B2WL 5EO0A 4JPKL 5HGBB 1DL7L 1EERB 5JW4M 2PYEA 4LASH 4XPAL 5T1MB 4OLYL 1U6AL 4XPBH 3EJYD 1KXVC 4M03A 5CJXA 1P4IL 3Q1SL 4JFZL 1KJMB 4XP9H 5ISZE 3U0TA 3MJ6A 3NCYP 1AH1A 3TJHD 4EEEA 1BFVH 1H8OA 5EO9B 3UTPD 5HI3C 5E95B 3WIFB 3BPNB 3MRJB 1AC6A 1IFHL 2BERA 2VZOA 4OUOA 2Y5EA 1FH5H 1I8LA 1PLGH 4R4FH 2WZPD 4TYUA 4XRCB 4MJ6B 1IC4L 4M8VA 3VXRE 2DQDH 2DD8H 3WXWL 2A73A 3INUH 3QFJB 2AEQL 3CCHA 1NBYB 1NFIA 2AK4A 4UT6H 4NZRH 4AG4L 3QG6A 4R9HA 4GMSL 1G7MB 4UDTA 1Q9OB 4NPYB 4YUEL 3B9AA 7FABH 2ZCLL 5CSBA 3L6FB 4YXKL 1U8PB 2DQEH 1MUJA 5CMAA 1GOFA 5L6YH 5CJXC 1F2QA 3FOMB 4TPRL 3WCYA 3QXDA 3UDWA 1PZUB 1U93A 3C60B 1I7TA 4KVNH 3WNPA 1OP5H 1KCUL 3OTTA 1FAKT 4O02H 5FUZL 4Y2DB 3L6FA 4JQVC 4X6CB 3GKWL 1BJ1J 3MXWL 4MB4A 3JV5A 1AY1L 1H8NA 2HVJB 2A6IA 4ODWA 4AL8L 4RDQF 3ETBF 1CE6A 2VMFA 1QSFB 3QFJA 3SE3C 1GGIH 1GIGL 5HGHB 4JZJC 1IM9B 3O41A 3BKJH 3QQ3B 4NO2B 5DS8A 3VFUA 5GS0D 2JJSC 4HZLB 2Q86A 1QBBA 4S0SD 2ZCHL 4CGTA 5HYSA 5EOTB 4L5FH 3GJFH 1EHLH 5DT1H 2EDRA 1U6AH 3FQNB 1KJMA 2EZ0C 3KPOB 3I02A 3OHXA 1I1AC 1J5OL 4IDJH 4JPKH 4YHIA 1QZ1A 1KTLA 4IRSC 4U49A 5TDPA 2PYEB 4HK3N 5FGRA 5T1MA 2AJZA 1EIBA 4YZFF 3AAZB 4F80A 5L7XH 2NX5A 5ANME 2JJVA 5JHDA 4RAUB 1IEBA 1H9VA 1IGCH 1BOGB 1MCPL 1WISA 1NCUA 1QHPA 4XNUH 4IBLT 5H2BA 3KYOA 43C9A 3TT1H 1BJ8A 1JI1A 3KR3L 1N64H 5E99L 5F9OL 4AY0A 4PRHB 2FX8L 1BEYH 3MRPA 1NCBL 2IGFH 3PJSA 4CVXB 2O5XL 3IS0X 4CU6A 1YPZA 3I50L 3NIDE 5D70H 1P7HL 3MODL 2E8ZA 4H8WL 3BZEA 2W07A 3VWKD 2NW2A 3GMNA 5F3HB 4BH7B 2H8PB 3REWA 3QIWB 1NQBA 3Q5OA 1A02N 4YHPB 5ESVA 2VLJA 1FNGB 3LKRB 5CSZA 5LGKA 1HYSD 3QUMB 5JORA 1GPOL 1QTYT 3TZVA 2DQTH 2W9LA 4NKOB 3WFBL 4Z7OF 5CGYD 4NHUB 1PY9A 5LCVH 2I5YL 1JL8A 5HHME 5T5FL 4P4RB 4Z7WA 3SDDB 2Y7QB 1UG9A 2IMMA 3MRQA 4Y2DA 3N9GL 1QLRB 5F1IA 4TULL 2QJDA 1WWAX 3QHFH 4WGVB 3TV3L 4KK8C 3NAAH 2HJFA 3D39D 4OGYL 4UUJB 1UQSB 1NEUA 3Q0HA 3TBYB 2P49B 5ADPH 1R0AH 1RZGB 4OD1L 1CDGA 3NCJH 1MVFA 5KSUA 3BN9C 3SO3C 2ORBL 2P8PB 4RQQA 2EICA 1IGFL 2DLGA 4QTIL 3O2DH 2GJ6E 4Y19A 3IRPX 3MCKA 1ZLSH 4WWID 4GRLC 2P5EB 4XHJC 2HFFB 3UTTB 4G6AD 3E6FB 2BJMH 3IDNA 3RNKA 1OLZA 3DIFA 1F00I 4J8RB 4LLWB 3EJJX 3GJEA 2AABH 5FECB 4XNYH 1ERNA 5JW5B 4I4WB 1A1NA 5IBLD 2DQCH 1L7TL 2NY3C 1JRHH 2HT3D 2NY6C 2ESVA 1GAFL 4HIEA 4JGMA 4LFHD 4M1CC 5ID1A 4KPHH 4WTZG 4HJ0C 1QSED 4A6YA 2JB6A 5E5RB 2MQCA 5IJKC 4BKLA 4MLIA 3LPFA 5KSVA 4KWUA 2VXUL 3BDXA 3RBGA 3MA9L 1YECL 1RUQL 1U8IA 4PV8A 1JUFA 4OIIH 5FM5O 5KS9A 4LCCC 1S9KC 4I18B 2EDTA 4IMLB 3B9KC 2O5ZL 2YKLL 4YBQC 1PW3A 1W0YT 4M8QB 4ZODA 1ZEAL 4EVNA 3P9LA 1KB5A 2LE9A 3PHQA 2VSDA 1QSVA 1TQBC 4PJ7B 4PRNA 4TTDD 4CN1A 3V6OA 4YDLC 1HQRA 1YJDH 3VXUE 4G6KH 4RFEB 2PETA 4JREB 3TZVC 3K4AA 4BFIA 1TJGH 5AWNL 3NCCB 5D9SA 3WO3B 3SDYH 1B90A 3RWJA 1D5IH 4UIMA 4DN3H 5CUSL 3MJ9H 4FNLL 5J6GA 3ZL4H 1QSEE 1R0AL 3I84A 1AKJD 4X7DC 2H2PD 1D3CA 2OK0H 5M94B 2V2XB 1LD9B 4GQ9H 2NY6B 4LCCA 4YFDB 4WTZA 2WIMA 4QY8B 1AO7A 1MHCB 2EE6A 1OM3H 5I2IB 5D1QC 1P7KA 4Z77B 2X4TA 4IIQC 2EC8A 2BY2A 4G7VH 5D7IB 4GG8B 2KQMA 4P46A 2ARWA 2WBJB 4X4MA 1MCSA 3DYMA 5ISZB 2DLFL 3VGGA 2W60A 4LLYB 3BJLA 1JWUA 1AGCB 5DZOA 2M8XA 5IG7A 4NQVA 1ZE3C 3RTQB 4P2OA 1MHEB 3GSNL 4Z7WF 4NQXA 2YR3A 5I1LB 3MV9B 3BPNC 2RR3A 2EE2A 3HUJF 2XACC 1RZKL 1NLBL 5HHPA 4XTRC 4OCNC 4WFED 1ZTXL 2ZSVB 4LPWA 4OZFG 1UT9A 1RHHB 3O6FD 5GGTA 2H26A 4ZOAA 1KCRL 3SO5A 1T4KA 3V5DA 5C0CE 2IPTH 4WUUE 4BQCA 3AREA 5CBAA 1ITCA 2AK1L 1PKQB 4YQXH 1GHFL 1G0DA 4WU7A 4OKVB 4UQ3B 1PEWA 3ZDXF 1OAXH 5CD5D 2N4IA 4QF1A 3BZDA 3C09C 3P0YH 4NQEA 4NO0A 5ECJE 1ZLVH 3PDDA 5BRZA 3T4AB 3CSGA 4U31A 4OZHE 2CR3A 2XKNB 4JM2A 1RVFL 4E41B 5F71A 1NMAH 5C0CD 1XIWA 5DMGC 3MOQA 3L7EB 4PJGF 5GRVK 2QSVA 3QEUB 1OW0C 3SOBH 4KZDL 4IRZH 4Z8FH 1KIUA 3EGSB 4NUJA 3QWRD 3LQZB 3UYRL 5CINL 3C5SA 4U33A 3A0OA 4XBPB 3H3PH 5F7NC 3TO2B 1J7VR 4AK1A 4ZUUB 3D1MC 2YEZA 4PJ7F 4DAGL 4JHAH 3QXAA 5C9JA 1Z3GH 1YEDB 1C08A 2YBRA 5F7LB 4ZUUA 5GJTL 1KPVB 1JPFA 3BOVA 4PGEB 3IETB 5AD0B 1JV5A 3EKCA 1NJ9B 1CXEA 1SMAA 2OZ4A 1VGEH 1TVBB 2DTSA 3HFMH 1OGTA 2R29L 4F3FB 1VSCA 3SGKA 4D9QE 5JPNB 5HYJB 4NRZB 2H3NB 3CK0H 1EFQA 5DEGB 3HI1B 5DJ6A 5BV7L 5KSAC 4UNVA 1FRGH 3P0VL 5JA9A 1FO0L 1AXIB 1W0VA 4LOUC 3HC4L 1WC7B 1T1WB 4PJBE 1S7TA 5F1NA 1T0NA 3RGVC 3T4AA 1KPUA 5J1TC 3O6LL 2HTKD 4L29B 1PVHA 1IAMA 2ICWI 4LARL 5FYKD 1A1MA 4HKZB 3IAQA 1MIMH 4X99B 3NFSH 1CK0H 4NZTL 1A3QA 1MFEH 4P5TB 4NNPL 3V0WL 1T22B 4XVUC 3O0RL 2BVPB 2J8OA 2IPKA 1U3HC 3BO8A 3ARGC 3VXRD 1KSRA 4QXUL 3SE9L 2H9GA 5HHOB 1GXEA 4BELD 5F9JB 5E4IA 1CR9L 5DQ9B 2COQA 2CDEB 1LEIB 3GDBA 1SQ2N 1BZ9B 2XIDA 1CCZA 5CLTA 3ECBA 4KGLA 2XFXB 3V95A 4Z7NF 3CFCH 4KKBC 1ACYH 3DLQR 2ATKB 3FQTB 3JV6A 2HJLA 1U3JA 1QLEL 4YC2C 4N8VG 1RULH 1J05A 4UDUB 5DRWB 1UCBH 3LS5H 4NQXB 2X7LA 3S5LA 3V6BR 4WDIA 2AJSL 2PR4H 1GRWA 2C3GA 4J12A 5SWZD 3DMMC 3IYLW 4XBEH 2DQIH 2MFNA 4N9GB 4HULB 4YDKH 2FL5B 4R90L 3BE1H 4GAYA 4B5EA 3BHBB 3RDTC 4U1SB 4MS8D 4ODHL 5J8OA 4XPFL 1MWAH 2ZSWB 4M43H 4POZD 3W0WD 5D6CA 3EOBA 3QO0B 1QBLH 5DZNA 1WBZA 2NY4B 3U0PA 2OL3A 4OT1H 1E27B 1RZKC 1EMTL 1Q9LA 4XT1C 5IK3A 3HE7A 5CLWA 4HZAA 3BXNB 3CFEB 3O2WL 2GY5A 4S1QL 1KGCD 3E6HA 3UTQA 3I6LD 4GUPA 2QSCH 4LLAA 1D5BB 1DSFH 5IJKA 4M6OH 1XF2A 2P46B 1AIFB 1CL7H 1NDMB 4NM4H 3P11H 1QFWI 2DWEA 2R15A 3BISA 4XXDA 1YPZF 3WJJC 4YBLB 4B7LA 3D39E 1HQRB 4UILL 3SDCA 3O8XA 1CXIA 1OWRM 3PHQB 1H3PL 1MRDH 3VXME 3VG0L 3CJJA 3QO1A 1NGWA 2VNCA 4NNYA 4MCYB 2WLZA 3L5XH 4K3GA 1YMHB 3BH8A 1RY7B 2XICA 4XP1L 3IJHB 5C07A 3D5OF 3U0PB 3WKMH 1DEEA 4JPVH 1M1SA 4JY4B 1HOCA 1MSPA 2IWGA 2FJFB 3GUTB 3DV4A 5D7SH 5ILTL 4PRBA 4LIQE 1G7IA 1QRNE 1Y6MR 3TYGL 1HHGA 1GCFA 4NO0D 4KFZC 2ICWJ 1WVZA 1V5JA 1ETZB 5TE6L 2HFEA 5DUMH 1R3IL 1YYLH 3NZHH 2JTDA 4HWEL 4GRLB 1P84K 1P4LA 3VFRB 2R39A 3BQUA 4HDIA 4GW1B 1HSBA 5F7MC 3BVNB 4JO2H 3DGGA 4N8CL 2FNBA 4NHCL 3GMQA 5T5NG 5D93C 1AD9A 1FGVL 5SWSD 2AERT 2VWEE 3SO3B 5ICZA 3HS0B 4G43B 3JV6B 4LQ1A 5D2NC 4Z7OE 2DS4A 4JO3H 1YDPB 5IMKB 3CVHH 4XHJD 3VGDA 4JY5H 1OSZA 2OTUA 4D8PB 3KYAA 4D3CL 4QRRA 3DRQB 2D2OA 4KH2A 1J8HE 2BVEA 2FJGA 3BPLB 3T0EB 2VL5B 4YHLL 4HW6A 1HXYB 2AXFA 3GEWB 4ZSOA 2FH8A 3ARQA 2IFFL 1MEXH 2BVPA 4U1MB 4YC2B 2YD5A 4Y4KA 3PNWA 2HT3C 2AEPL 2JCCF 3VXQA 4HSQA 4M00A 1RIVH 1NANI 4N8VB 1ORQB 2O61B 4KXZI 1A7NH 4BSJA 3VWJA 1TZGH 1INDH 1U58A 3TF7C 4OZIE 3H9ZA 3A6CL 4B41A 1OM3L 3E3QC 2XZZA 1L9NA 1G84A 2PXYB 3DURA 4GAGL 4LF3A 2V6HA 3SKUD 3SDDA 3H3BC 4NRZA 4KKLD 3OZ9L 4JN2B 1TNNA 3OKMA 5E70A 5BZWB 4F3FA 1YC7A 4NKOA 5T3XH 3TZVB 3RGVB 1VACB 2AJ3A 3FFCD 4EDXA 1FFOB 5J13C 3TA3D 5DJ0A 4XNZC 1KC5L 4NJ9L 4HCRA 5T1KA 2VZVA 1VPOL 2EH8H 3R0NA 1LDPH 3EJZC 5HJ3A 4I0PD 1ORSB 3BZEB 4G8FB 4WFHD 3C6LA 3OV6A 2VLLB 2XWTA 4ODBD 1RZKH 2HRPL 1P5UA 1YPZB 5J1AB 3ZTNL 1EK3A 2HFTA 4WTWA 1JYWA 3ARRA 3WHE0 4HWBL 4CAGA 4Z7UE 3F6LA 4YPGB 2H2PC 2N7AA 4L8DB 5FCUH 5L2KE 4ETYA 3EW3B 5EOQH 4CJ0A 2WUCL 3EFDL 3F5WB 4HPOL 1I3RA 2RBLA 5I74B 3UX9B 3GK8H 5D71H 1JTPA 4DWHA 1HSAA 4P4KC 3KPOA 1X9QA 4QRPD 1JTTA 3MRHB 5AG9A 3QH3B 3PWVA 5ID0B 2YPVH 3A6BH 5C8JA 3MUHL 3QBTB 5JQHC 1U0QA 2MQ3A 5GJSH 3AVEA 2CK0L 4NZDA 2B4CL 3KYNA 4M48L 4NO2A 4BQ6A 3P9MA 3QR2A 3O9WB 3WEXA 1G6RA 4Q9QH 3D85A 4N90E 5F89B 3D25A 2NZ9C 3UTZA 3ISWA 1CE6B 2ZZUT 4DKAA 1ZA3B 2YRZA 1TPXC 2GYSA 5IMMB 1XMWA 2AKRB 3I50H 1J11A 4OGAD 3V6OE 5B38B 5MENB 1WBXB 1XIWC 2YK1L 1F8TL 3HG1D 3RKPA 5HDQL 5LAXB 3E2HC 2FHFA 3HE7D 1YYMH 2YN3A 4K3JH 4X6EB 2RFXA 1OAKH 5HHXH 4JRXB 4F7EA 3BQUC 4MNQD 4S1DD 3V4PH 4OGYH 2PO6C 1B0GA 4NNXB 5INCA 4RGND 4FHBD 3UPCA 4HS8L 3V5HB 2VOTA 1LDPL 4GG8A 5D7IA 4Z7UA 4YHKH 1SYVA 3O3EA 4ISVB 1G7MA 5D1ZB 1CGSH 2LTQB 4PGBB 2A6KB 1Z5LA 2ID5A 1Z2KA 4N0FA 4NRXA 5FGBC 5KVEL 1MCBA 1JZ2A 5I8KH 1A7OL 1S3KL 4XRCA 12E8H 1T2JA 1BREA 2CIKB 2HH0H 5IR1B 4G80B 4M48H 3HUJE 5LWYH 4IJ3C 3OKKA 1WAAF 3VD9A 2Y07L 4Y4FD 3U0TB 5LXGH 2CLVB 1UACL 5DK0A 1TQCB 4DGVH 5C71A 5KG9B 3UPAA 1CFVL 2Q8AH 5F44A 3PGDA 5GSRB 2MKWA 1DBKH 3GIVA 1U36A 1UH3A 4PJ7A 4PRNB 3W2DL 3QPQD 4QHUA 2E7BA 4Y5YB 3QISA 4ZDHB 1EEQA 3K74B 1WWWX 5DSCA 1HHJA 3V79C 1BD2B 3F58L 2PW2B 2BOBB 2W0PA 4QRUB 2V5MA 1JBJA 3SGKC 2GI7A 1DQJA 1TMCB 5F7KC 3VWJC 2PO6A 2YZ1A 4B50A 1A7QH 1JPGB 2ATPB 2C1PB 1C5CL 4MQXD 1NC4D 1XR9A 1QPXA 1BD2D 3L9RB 1VEOA 4M93B 3QUML 3SJVB 3SKOA 4F33A 5FA4A 4KI1A 3QUKA 1A1OA 4MA8L 3SKNB 5IEKB 5KSVB 5TQ2L 1MAKA 4U1GC 4OM0H 4BKLB 1PZ5B 2ITCB 4HUUA 4JPIB 1EV2E 3HI6H 1T80A 4PG9A 3I6LE 3H9SE 3ARBA 3QEGH 1Q9WA 1KLFA 1AE6H 1G6RH 2X42A 2ZUQB 4PJDB 5E9DE 3IFNL 5IF0B 3PXHA 2V5YA 1QOKA 1A1NB 4I4WA 4BH8A 5C0DA 1AGEA 3G6JB 1UXWA 4PJXB 5L2KB 4L3CA 3SDAC 4NGHH 4OFDA 2F15A 3WFDH 1GIGH 4ZFOA 1X5LA 2W38A 2Z9TA 3FFCA 5IJVA 1I8KB 1AXTL 1SJHB 4QRSB 3TIDB 1OSPH 2FD6L 1DL7H 3JWNC 4HUXA 1Z5LB 5F7DB 4XAWL 4YXLH 1RUKH 3O4LE 1KIRA 1JGDA 1RUML 2ZUUA 2NLJA 3EDEA 1YEHH 3LQMA 4HFWA 5CIPB 4TVPH 1KTKE 5IEHA 2RAMA 4HKBA 3O6FB 1JGDB 1UH2A 3QHTC 1Z9OA 2NY4C 3MBXH 3VDBA 3FFDB 4HUXB 5F7DA 5LKNA 5DDHA 3MOAL 2A38A 4I0PA 1YMME 1MFAH 5EBWB 5HYIA 1XGYL 4MDIA 3RDTD 1H3UA 4LVHC 4ODVH 1KGCE 1J0HA 2MQ0A 1JE6A 1RV6X 5LQBL 1CK0L 5GPRA 1WBXA 2D9QB 1R3KA 1U3HB 2GK0A 4G9DB 4P4RA 4PJXA 1RZFL 4OM1H 3ZMRA 4HAGA 3VRLF 5L8JB 4HC1L 3GI8L 1NEZA 4X8JA 3L1OL 1N6QH 2R8SL 1OT1A 4XNQB 3RPIA 1Q9WB 3OBAA 4XI5D 4JGJA 3C6SB 3WUWG 2RQ8A 2NW2B 3GMNB 4PG9B 5F3HA 1NGXB 1B88A 1EJ6A 4M6NL 3FCTA 1D7FA 1URLA 1NAKL 1PG7X 1QFUL 2J6EL 4DVRL 4YDJB 3GB7B 5C92A 1MFAL 1ZHLA 4JFPB 2NR6C 4G6FD 3MMEB 3PJSB 4CVXA 4D0CB 3G9AB 1ZLWK 4JRXE 4BFEA 1N5AA 4OZ4B 4TNVF 4QHKJ 1M7DA 5HI4C 2KZWA 3HZKA 5FKAB 3LRSA 2VTFA 1MREH 4WFGD 1ZANH 2BSRA 3D69B 3TT3L 4FP8H 2CRYA 1DQTA 1BLNB 1LILA 2AJZB 3OWEA 1FGNL 4XH2A 4HCRL 5EIQA 4MSWB 1QR1B 4NNPH 4RGOL 5GSRA 1ACZA 1ZV5A 4LCWA 1FDLL 3LKQB 4V1DD 4OCXL 4MD4A 5FKPA 3KJ6L 5IVZB 2ZOKA 4ZAKB 5C0GA 4YGVA 4M1CD 4NN7C 1FL3B 4NCDA 4XP6L 3STLB 2R2EA 5A43C 3VFPB 4GRMA 1FO0H 4KK9D 4OZFA 3U30C 3IFNH 5E6IA 4ZOBA 3TBTB 4F7CA 2LU4A 2Z31B 2FR4B 4EXKA 1A6VH 5HGHA 2CUHA 3DVGB 4GW5B 5DRZA 1VFBB 1EEZB 3OB0H 1E28A 3PWNB 1JNHA 4S2SA 5CILH 3HNSL 1FFOA 4N0FB 4MYWB 5D1ZA 3ULVD 1R6VA 2OTWA 3B9KD 1LO0L 4I5BA 1MCCA 1J1PH 3DBXB 3JUYA 4X6CA 3TYGH 4U7KA 5CEZE 3HHRB 1IGML 5MERB 3HNSH 5GISL 1R5WB 4H88L 4PJ7E 4JHAL 5I15L 2VZTA 1U8LB 4NBYB 2LTQC 1K2DA 2D4DA 1BFTA 3N1GC 2R1YB 3V6FB 1YZZA 1N0LA 1G7LA 2MSPA 4CUCA 4KAQH 3RTQC 2YOCA 4F7TA 4YDIH 3VFSB 1BF2A 4Y4KB 4GS7C 5HHXL 5E2TL 2IAMD 1YEKL 2CLZB 2VDNH 4PRAB 3FQUB 2JE8A 4ELMF 4U6XA 1MCWW 4J3XA 3SDCC 1CE1L 3F7PC 4X7CC 1E4WH 3MRMA 1HILA 5BRZD 1CICB 3D25B 4HCRH 4PLNC 3OKEB 1FBIH 3VFWB 1BX2B 3VXSD 4MJ6A 4GG6A 2QSQA 3ZE1E 2ZCKL 1YNTB 5ICZB 2FIKB 2DDQL 4KKLC 4WUUD 3T3PF 2CRZA 1PD6A 4KJYB 2YD3A 2FZ3B 3OGCA 3TBSB 3ZDXE 4QHLB 4LVNB 3FRPA 1F13A 5T3ZH 3BQUB 5L9DL 3VXMD 2CKBA 1EEUA 4R3SA 1KCLA 3MJ8B 4MHHI 5F96H 1HXMB 4RWYH 2C3XA 2VDOH 4PG2A 2DL2A 1BP3B 1A9BA 5DGRA 2OK0L 4LAJH 3LSOB 2EKJA 4NZUH 5EUOE 4U3HA 1F3JB 3WXVL 4DZBA 1NCWL 3KPRB 4YNYB 2BNUB 1WAAA 1QO3B 4PJAA 3ARGB 5A3IC 3C08L 3MFFA 4L8DA 1A3RH 1UM5H 4IEFB 5BQ7A 5F7UA 4JY4A 1IM9D 2XKUA 4ALAL 2C4FT 4I3SH 2IAMB 5DMKA 3WD5H 1D6EA 5C3TA 1T2XA 4K7PY 3HTLX 1KJ2B 4M9OA 4PREB 2Z93A 3BH8B 1G7QB 5SWSA 3C8DA 4PP1D 5HHOE 3WS6C 1MJ8L 4NNYB 1A21A 2D0FA 4HH9A 4G42A 2YMXL 1SMOA 2XNAA 4KTEH 3DX8B 3CFBB 3WFHA 2VR4A 1KN2H 4LRIC 4HIIA 3GGWB 4OFKA 5DMIH 3QNXB 2WINA 4PYGA 4HFUH 1BFSA 1T5XA 1YQ2A 4JRYD 2FX9L 2XPGB 4PBWD 5IM7B 3OKMB 3SE8H 1T7VA 4YDVA 1N8ZA 5A1AA 3E6HB 4PGZA 1S3KH 2VQTA 3F65A 2VLKE 3WDHA 4OCSL 5D71L 2BXYA 4HUKB 3WNMA 2Q7YB 1NDGB 4RSVA 5C0EA 4RRPA 1ZA6A 4ELKA 2LVCA 3IFOB 4PRIA 1DUYA 4LFHG 1ZSDB 4KRLB 4OZHB 1G1CA 3MO1B 1MELA 4EUPH 4FFVD 4HLJA 3AMKA 5FCUL 5C0FA 5JA8B 3ZDYF 1D5IL 1S7UB 5IQ7L 3QDJD 5K9QI 2R0LH 3EYFA 3BHBA 1HXYA 3V4PL 3ES6A 3BEVA 2E7LA 1IGIL 4N9GA 1NBVH 1E6OL 2VDML 4D8PA 2YPKA 3AXLA 3DUHA 4H5SB 3CDCA 2UY7A 5DI8A 1T2QL 2AQ3A 4RZCA 1T89C 4MXWL 4NO3A 2OI9C 2H2SC 4Q7DA 4TUKH 3MC0A 3QG7L 1QFOA 5JPMA 1NAMA 1KYOK 3VD7A 3NTCH 5JXAL 3FRUA 3VA2C 3H9HB 1MFBH 2QR0A 5D2NA 5DQ9A 1LEIA 4L8SB 2D03H 5FYJH 4K3DL 4K71C 5HYSG 4HXAH 1A4JB 3MXVH 1Z9LA 2WP3T 4YXHL 4ZUSA 1NPUA 2FJFA 4TQEH 1FG2B 2P5ED 2DM4A 2AXGA 2HKHH 5B4MC 1AQKL 1MFCL 5ICYA 1A7OH 5I8KL 1UKSA 3E8UH 1YMHA 3ARBC 4Y16A 3S97C 1T7XA 4X7SL 2HH0L 2LABA 4GKNB 3O45A 2Z91A 3T04D 1NGWB 3QO1B 4HGWA 4HIXL 5E56A 5HGGS 4DEPC 1KYOJ 3VRIA 4XZUB 3SJVD 3NH7L 5GS0C 4JHWL 4UZGA 2W59A 4WCYL 1OQXA 5FOBB 3KLAA 3QJHB 1WV7T 4PJ8A 3AROA 3RQ3A 3HR5A 1MREL 3QEQB 3N0PB 4PFEA 4UU9A 4GMTH 2EYSA 3HG1A 4X6DA 5DVOA 3QUXC 5F7YC 4OKDA 1V3LA 3O6MH 4GUPB 4IRSD 1T2QH 3RI5F 3QPXH 5DFTA 3ZSTA 4RMUA 2GJJA 4NQCA 4X7TB 1OAUH 2X70B 4WHCA 3Q3GA 5GRWA 4JFDE 4G6ML 5FF6B 3GM0A 1YJDC 4P2OC 2LFGA 4IRSB 1A14H 4BM7A 2OL3B 3ULVE 2IAMA 3CX5J 3PABA 1HIMH 1I1AB 2X2YA 5K33A 1TVDA 4M7JH 2R8SH 5TE7H 1CVRA 1KXTB 5D2LA 2QLVB 3BN3B 1UZ6F 3VD3A 1MRFL 2E27L 2FBJH 5JQ6H 3NIDF 4PLJC 1D5XA 4JQVA 4MNHA 1HKLH 1WEJH 4E41A 4ODHH 3GO1H 5EULV 5GGQL 3K2MC 4H8WC 3M07A 5F1KC 4R90H 2GUOA 5E00A 1QA9B 5H37H 5EO1A 1KJ2H 1OLLA 4UDUA 5HD8D 3MBXL 4PY7B 3RDTB 1JTOA 3H7BB 5FUCE 1R3JB 3OXRB 5JXEA 4RMTA 4JFDD 4Y5VA 2VLKB 1CT8A 2DLTA 1KLUB 4TSAH 3V0VB 4UNTA 1XF5B 2FECI 2IBZY 2QEJA 5CBAB 4OCYL 1RZJH 4HPOH 1NC4B 3UJTL 1NCCH 3QHZH 3BPLC 5HHNB 4WEBL 4MQ7B 3DETD 4W6WB 3O3BB 4KKCC 5EIVA 5JO5B 2X4SB 3V0VA 1FVCA 4ZFGH 4WU5B 1D6VL 4U6XB 3FQUA 3CLEH 4U1HA 1JZ6A 4KC3B 1C5DA 3D0VA 4GKSA 2FATH 4J7RA 1HH9A 5FHBH 2AEQH 3MV9A 4X99A 2CRIA 4RFNC 5EO1B 5K59E 1MQ8A 2DIJA 4PJEB 5DT1L 1VFUA 4LHJB 2AEWA 1K2DB 1HHHB 4RX4D 3QJFB 2IH3B 5GRYA 3LAFA 8FABB 2Q1EA 3Q6FB 2IADA 5DHVB 3W0WA 3HZVB 4PTTB 1AR1D 4GS7B 4M4PA 3ET9F 3BKJL 5IB3A 1RQ5A 5D2LB 4I5BB 4HT1H 1XF3B 3K81A 1IL1B 4A6YH 2JIXD 4RWYL 3IFLH 5BVPL 3OR6B 4U6HB 3G5YB 2Z0BA 4WFFE 2BZDA 3U4BL 2GTWA 4M7KL 3AM8C 3IETA 2G5BB 2YZ8A 25C8L 3MROB 4UNUA 2NY3D 5FF6A 2XG5A 4PJGB 3VFVA 4DFIA 1CD8A 4X7TA 4Q9BA 1IMHC 5ESAA 1JRHL 2JIXB 2C3WA 5EU4A 2QKIA 4RFOL 2VAJA 5IW3A 2WBJC 2PTUA 3LQAH 3CFCL 3G04A 3L3OA 5FYJD 3W39B 4YGVB 3LKQA 3K1DA 1DE4B 3HC3L 4TSAL 3AUVA 1L7IL 1Q38A 4QHNB 4HHAB 1T04B 3S3JA 3LZFL 4XP4L 3PQYB 4OCLC 1MFEL 4O2FA 3ARPA 4O9HH 3QCTH 2VUYA 1XGUB 4NN7B 4YAQB 4YBQD 3T0EE 5CJ5A 2YD7A 4HAFA 4APQA 3LCYA 3ORJA 3DUSA 3QT2A 2BSRB 2BY1A 2CGRH 3JWDC 5MHSE 5DTFA 1WJ3A 5ICYB 5IMOB 4Y19E 4P23B 3MMEA 3MA7B 1U2HA 4OZIB 2VDPH 1SJEA 4U6VH 2FRGP 4XPBL 3R8QA 1CLOL 3OQ3B 2UVEA 4PY8J 2R29H 4PR5B 3BGFB 1YMMD 3MRLA 4DVRH 1FHGA 3MRNA 3OKYA 4L8SA 4LMQE 2G2RB 2R1XA 2A83A 2AJVH 1NAMB 1ADQH 1DQLL 5K9KA 4AEFA 3QDGE 2VABA 3VH8G 2EO1A 3VXSA 3KDMA 2G9HA 4ZYKA 4C56E 1GOHA 1PFCA 1NFDB 3GJFB 4L4VB 4PJIE 1SYSB 2HLAA 5ADOL 5JW3H 5IFHH 4F37F 4YHOL 5F9AC 4C56A 3OB8A 3AXLB 4MDIB 5JOFB 5AYUL 4XBGB 4UBDD 3SE9H 3QDGA 4EI6A 1DQML 4L8CA 1JVKA 3V6ZA 4K3EH 2YA0A 4LPUA 4XPHL 4GBXC 3F6IA 3RL1A 3UTSA 4KTDH 2MMXA 2YD2A 4TVPL 3NN8A 2VR9A 2OJZH 3MRIA 1ZLUH 5J9PA 3P11L 4LEOB 1X4ZA 1AI1H 1KJVA 4MXQD 5DVKA 2GTZA 4KI5C 3EFFB 5TQ0L 3KXFE 3AS2A 4OF5A 2MCPL 2JJTC 4PJ5D 4IDJL 4RBPH 5BV7H 1K4CA 1TTUA 5F1IB 3SGDI 4ZFOB 4KKNA 1I4FB 5A3ID 1KF9B 1NAML 1NFKA 3EFDH 1N0XH 3FB8B 3LKPA 5CHNA 2E9WA 4U1NA 5C08B 5DA4A 4FXKA 3NTCL 1CFNB 1N6QL 3LB6D 5JORB 2JJTA 1RK1A 5I1EH 1QBLL 4BFIB 2NMSA 4YHPA 5ESVB 3GGWA 5BO1H 1QLFA 3SE3A 4S1DC 2AGJL 1TJGL 3GBNH 3QZWA 1YN6B 3M17B 4R0LC 1SM3H 3LV3B 2XT1B 3HMXL 4YR6B 4XGZA 2Z93B 3IXTA 4KQ4L 4MWFA 2OX5A 1AO7E 5ESQA 2OS7A 5IHUL 4IMKC 4LKXB 1MCKA 1U8JB 1S7SB 2H6PA 4R96B 5H2BB 4LPVA 3OMZA 2IANA 1J1OL 1QYGL 2NXYB 3QUZC 3RI5K 2DOCA 2ED7A 3H42L 2B5IB 4UI2A 1RVFH 2ZCLH 3IXAA 5BS0A 4MAUL 4Z7QE 1NCTA 5DF0A 1J9CT 1P53A 1EX0A 1MJ7H 4TSBH 4X6CF 3T3MF 2J6EA 5CEZD 3I3BA 1RHFA 2Y6SC 1HXMA 4PUBL 4OB5L 3H9YA 4OLEA 3PE9A 1PQZA 4P4KB 4KGJA 4X4YA 3PV6A 3DXAE 4X4XA 4QOKB 1BZ7A 1T66D 1CDJA 2BRRH 2WIIA 1NGYB 2H32B 4BK4A 5E08H 4J8RA 2YUVA 3UEZA 1RUAH 3O11A 4GG6B 3PDOB 1LEKA 1YNLH 5BV7C 3QIWD 3SKJL 12E8L 2CRMA 1FIGL 1GGUA 3VWJD 1QSFA 4OTXH 4Y19B 5LBSL 4GXUM 3CFDA 4XNZB 2X4RA 2P5WE 1FP5A 4PRAA 1A9EB 3DARA 2IANE 2X4NB 3I9GL 1S9XB 3P4OA 1FGVH 2R0KH 3MJ7B 1DLFH 5DJCB 1ZS8B 4N90D 4RDQG 1OTTC 3TBYA 4DW2L 1M05B 3G6DL 4WFHE 1NCAH 1H5BC 1SBBA 4PJ9A 5GGUA 3QFDB 3S36L 3DXAD 4HWZB 4NKMA 5EFIB 5KJRL 4OFPA 4JRXA 4FQQA 1YUHA 3CVHB 4R7NA 5F21B 5CEYA 1MUJB 3V52L 1S9XA 3P4OB 1ITBB 5C86A 5HYFA 2EC9T 3PGFL 3PIQA 2AKRA 5ETUB 5IQ7H 4TVSa 2APWA 4E42B 1UACH 3LN5A 1NLDH 1DANU 2KPNA 3QUMA 2BFVL 1HH6B 1GPOH 1YY9C 3DVGA 4GW5A 4LLMB 1S8DB 2Z31A 5ITFB 2YC1A 1X5GA 4NQUA 1WGOA 1RJLB 1NGYA 2WIIB 1DVFA 4PJGE 1EAPB 3GSOB 3C9NA 4QOKA 2HA1A 5D8JH 3U48A 4K9EC 1MVUA 4PS4H 5FKPB 5IVZA 3MRHA 1GC1H 4LSSH 1HSAB 2K7PA 1NH6A 2C4FU 4ZOCA 5FOJA 3MGTB 4QGTA 3CFJB 4UTAH 4YHNA 4RGMC 3QDJA 2DI7A 3QDAA 3B9EA 5I0ZA 3HZMA 3LRHA 1BLNA 3HLAA 4WHTB 4DN3L 4JO3L 3B2VH 2EIZA 3MV01 3U36B 1JZ3A 2R0KL 2XQBH 4R4BA 1EGJL 3QDJB 5TDPB 5DWUL 1M7DB 3MGTA 3A67L 2RCSH 1T1ZA 1KCVH 1SEBB 3N1PC 4LAQH 1PY4A 4HC1A 1AGBB 1JJUA 3G5ZA 1X5YA 2ZJSL 5F72S 3B5HA 5IQ9A 5IOPB 1TFHA 3OJDB 3C9NB 2HG5A 5TF1H 2L7JA 4Y5VC 4AJ0A 2Q86B 4IRJD 1DN0B 2YPLE 1I9IL 3CZFB 4LEXL 1T3FB 2QQKL 4OUUB 4UOW1 1A6PA 5DUBB 3MLTA 3UJJH 5MI0B 4Q9QL 1FFPB 3K1KC 3TBVB 3PQYE 1OAZH 1X5AA 5DD3L 4G6JL 4P2RE 4X7FC 3BAEL 4E5XA 3DV6A 1FYTB 1KPRB 5C09A 5BZWA 2BFVH 2UZYB 3CPLA 4XCCH 1A0QL 3PWLA 1VB9A 3A6BL 2BJML 3PIQB 1OL0A 1R3KB 2SEBA 4AIZA 2OP4H 2IH1A 4OCRH 1IQWH 3KYMA 3GBML 3NACL 3GFUA 5I1GH 1U93B 5J13B 4Y16D 1G7PA 4QT5A 3U9UB 3WNLA 3O2VH 2ZUQC 3PWUA 5I8OL 5CMAB 5HGDB 4JFYA 3MLYL 1JYVA 2F19H 1JPTH 5E8PB 3HB3D 2NXZD 1NANH 3QWOB 4U1MA 3ZKND 3ZE0E 3GIZH 5I71B 2X4RB 1IC7H 5HYQB 3QDGB 4IRJB 4IOIA 3SE4A 5EC1A 3P3YA 5CJQL 4JFFE 4P2QE 3JXAA 3VJ6A 5IMKA 3UTOA 3PL6B 3KJ4C 4NQDD 4MCZB 5KVDL 3RU8H 2XTJC 3HC4H 4LLVA 2H32H 4TOYH 4ZPTA 1ROWA 2DM3A 3FHAA 5C0DB 4BH8B 4HDIB 3BD4A 1JNNL 1TXKA 1U8MA 1MWAL 5IF0A 2KH2B 2F54A 3L1OH 4AEHH 3B2UD 2HKFL 5DURB 1MFDL 3AFLA 3U1SL 4B0MM 4ZNEE 4OFYD 1B9ZA 3Q1SH 4JFZH 5I75B 1FL6B 4LHUB 1HHGB 2FB4H 5EU7C 5HGBA 1U8NB 3VI4F 3QNYB 3DSFH 3N1MC 4XCCL 3SKNA 1JGUL 4ODVL 5IEKA 32C2A 1FNLA 1CS6A 4PTUA 1BM3L 1U2CA 3BEWB 1RZ8A 1LO3L 3KPNA 4WW2C 5IVXA 4H1LA 4RMRA 5KSBB 1XR9B 1LWRA 2ATPA 3CLFH 2VDKL 3KJ6H 2Q6WA 3MRCA 5FCSH 1IC5H 1INEL 1ND0A 4GKZB 1OF2B 3UO1L 3QZWG 4MNQE 4KTYA 4HKJA 5DJXB 1TJHL 3EO0B 1BEYL 3QI9B 2J3SA 5FO8A 1C12A 1QLFB 4QHNA 1A6ZB 1KJ3L 5EZJB 1FNAA 1L9MA 4KAQL 4F58L 1XF2B 3QXUA 1DR9A 5EUOA 4K71B 4IIQB 2BVOA 1D5BA 1CIUA 3ZE0F 4FFWC 1J1XH 2F8VA 3CFKA 3UTQB 3TM6A 2AV1B 3FO0H 3IKKA 4DGIL 2DTMH 5SV3A 5EU4B 3FQRB 4I3RH 1I8MB 4MJID 1NAMH 1J0KA 3BUYB 5D7LD 3LMJL 4QRQB 5HHOD 2DTML 2IPTL 3MYJA 4J4PC 3O3AB 4LIQH 4MJIB 3NIGF 4FQ2L 1AKJA 2CKBL 4ZNEA 1K3IA 3CU7A 1CYGA 2ZSWA 1ZGLP 3LOWA 3MRRB 4EXPX 4OM1L 3SGEI 4JZOB 4BSVB 5MEQA 3BWAB 1EO8L 4L9LC 4UBDC 8FABA 1WZKA 4CVZB 3ZKMD 1MLCB 4XNXL 3QJFA 4I48B 4M61B 4FXGB 3I6KA 1ZGLA 1IKNA 5C6TH 3BI9X 4WUKL 3IDXH 4WDIB 4DKEL 4Z9KB 1EEYA 1H5BA 4PJ9C 2BSSB 4NBXB 1NFDA 1T5WB 3K8LA 1MCIA 2V9QA 4YDIL 3GSQB 1XZ0A 1ZMYA 5JZ7D 3BDYH 3P9WB 3B3IB 4FRWA 4HMEA 5C6TL 1KBGL 1U91A 2HJLB 4U3XA 1ZVSA 1IAIM 3JTSA 1YEIL 1QVOA 1A6UH 4YX2L 4XNUL 3QEHA 1I7ZB 1J10A 2H9GB 5HHOA 3TYFA 2XXMB 2CIIA 5EPMA 3JTTA 2JK5A 4PY7A 3X13A 3TFKD 4FTVA 5DK3A 4MVBD 4PPTA 1SJEB 1NL0H 5MI0C 3OAZK 5I30L 1IE5A 2V9TA 2A6DB 2XY1A 2Q87A 2EDLA 4MZ2A 4U6YB 2VXSL 4RMQA 5AWNH 1CXLA 2XXCB 4Z0BL 3VD5A 1J1XL 2DMKA 2P8MA 4HWBA 3TH4T 4NZJA 5M7QA 1UA6L 2NNAA 4R97C 5IWLC 2H3NA 3PQYA 1A3LH 3L5WB 2H2SD 1I1AA 1T04A 4HHAA 4LSPL 3KLHC 5LQBH 4MAYA 3FOLA 4QNPE 1KN4L 4FFZH 5E94A 3K2UL 2P8LA 3HMWH 5C0JA 3C2AH 1OARH 2X1XR 4JFFB 5E2VL 1J8HD 1TCMA 5E8NA 3B43A 4FN0A 3VMPA 1MNUL 2OI9B 3WHXA 4NJAL 3SDAB 4Y89A 3DGCR 4GLRH 2CKBH 4ZXBD 1N7MH 2R1WB 4JRYA 3TO2A 4XBPA 3HAEH 5E8OB 5TGBB 1GYAA 3LKNA 3Q6GH 3MV11 4EDXB 5FOBA 4ZPVA 2FHCA 1XF4B 4TNWF 1C7TA 4P46C 1EGJA 4N0CD 2NNAB 2YPVL 1F97A 2BMKB 3CUPA 3O45B 2YD6A 5CP7A 1DTUA 3BAEH 2MTPA 3QIWC 3Q6FA 4L1DA 3X12B 4Z7UF 4YHZH 5FDWB 2NY1B 2QQNL 3JVGA 4XVJL 5EZOH 2O61A 5I8CA 2VLRB 3KLSA 2HTLD 4PJEA 1A14L 4PJ5B 4K94C 2E6QA 2OXHA 3X13B 1F45A 4MJ2A 1A22B 2AV7B 2EDNA 4Z18A 1ES0A 3QUYB 1RZIA 3T0EA 4UAOB 5FV1L 5I18L 4P3CH 5HHNA 3MR9A 2PN5A 3EYSH 2DQFB 2DYPA 3B9KB 2XTJE 3QXWA 2ZNWA 1JNLL 1A6WL 1DQQB 5T5NF 2F58H 4N5UA 4JHBA 5GGVY 3LHPL 1PG7H 1IGTA 2IQAB 4OF3A 4LNRA 3B3IA 1CDUA 3T8XB 4NQTA 3RDTA 4IJ3B 1JMXA 5BW7C 4R8WH 1P4LB 1JI2A 4RA0C 5T3XL 4X7SH 3IJYA 4JRYE 1C1EL 1MLCA 5EU3A 3P4NA 1S7WA 3M8OL 4NSKA 2VKXA 4JFXA 4L4TB 3VD4A 1WT5C 1EHAA 1FG9C 4YHMH 4LPTA 2CUIA 4XCFL 4KJWD 1E4XH 1QFPA 3B4NA 2D7TL 5DGQA 4KDWA 4N0UE 1X5FA 4AEIL 4NWUL 5B38G 3IFOA 2DKMA 4G5ZH 1AGFB 5TF1L 5AZEL 3CX5K 4ZSOE 5C0EB 3MNWB 4H0HB 2X4QA 5GS1A 1M71A 3NVQA 3V4UH 4LDOB 1NCDL 4XMPH 1CGSL 3ROOA 3TLRA 1MWAA 2GJ6D 4ZO8A 15C8H 1N8ZB 2QHRH 5IBTL 3SY0A 1E4KC 2VL4A 5EOQL 2DLEA 4R7DB 4OD2B 3QYCA 2E7HA 3LN4B 1T5XB 2EECA 4GAJH 2VYRE 2WINB 3QEQA 5HDLA 4TUKL 5IBTH 4HIIB 4ODXA 3IDYB 3RVTD 3EO0A 1DQDH 4KUCF 3RVUD 1KB5B 3P9LB 4M6AA 2VIRA 4V1DA 1MWAB 3KPLA 4JQXA 4NOBA 3VWKA 5L8LB 4RMSA 1FZMA 3V5KA 2X4QB 5GS1B 5L88H 1E27A 4OQTL 1IAIH 1RSFA 1EXUB 1V3MA 3C5JA 3EYVB 2GCYA 2V7HA 4OV6F 3O9WD 4NT6A 3TBWB 4HJJL 3ZZ1A 4CU7A 3VFTB 5F9WB 1HINH 4DN4H 5TFSL 2A77H 1W72A 2XZQH 2QQKH 4P3DA 2MCG1 4R26L 1GGCL 4DZBB 2FL5A 2FIRT 3RUGB 3UTTD 1F90H 4BZYA 1A9BB 4K3DH 2C1OB 3FRUB 2VDLH 3D39A 3ABZA 2X7LB 4R2GB 3S5LB 4M1DL 1X4YA 1FN4A 3MRKA 3BN9D 3WS3A 1H3PH 2A9MH 4G8GE 5J6HA 3S98A 5GIRB 1WZ1L 2LAGB 3MCLL 2IEPA 4LNVA 3ULVC 3UTSD 2BVTA 1UC6A 4NQDA 3E6FA 1QSEB 2OXGA 2W9DH 3FQTA 2HFFA 2P5EA 1U8KA 2E8YA 1FAIL 3NCYS 3VFWA 3DO3A 2R69L 3PHOA 4HWNA 2YS4A 2F8XC 5JLZA 4PRPB 3WLWC 3INUL 3MLRH 3AC0A 3BEVB 4LLQA 4QCIB 3K3QA 2VDMH 2IPKB 1PJ9A 4YBLC 4N5EC 4AH2A 3FZUD 5K93A 5DMJB 3GIZL 1Z0NA 3GZKA 1F4HA 1PG7W 2NY6D 4F7TB 2IAMC 4PRIB 2FGZA 2DQGL 2VLRA 2A0LC 5T1LB 5FHAH 3H6JA 4X6BA 3JWOL 3KPPB 4MHHG 1IJ9A 4LKCA 1U8LA 1G7PB 2R0WL 1T0NB 4N0RA 4RGNE 2AJYH 3V9FA 3E1F1 4Y4FA 3G9VA 4JKKA 1G0XA 4PS4L 3I3EA 2BMKA 3X11A 1F6AA 2N7BA 1IVLA 1UWGH 4N8PA 5C0IB 4YZFE 1N4XH 1T0MB 2CPCA 2J8UB 5JPNA 3D87B 1LNUA 1ED3A 5C09B 3MLUH 5E2UL 5FA3A 1RJYA 1JNHB 4S2SB 3TNNA 5AD0A 1I9JH 4WWKA 1EEZA 2GJZA 3I3DA 4MMXC 3IDJA 4XCFH 4DJMA 4FXLA 1C08B 2B1HH 1OAZL 3ALWA 5D7JA 3PWJB 4OD3H 4P2QD 3T77B 1CE1H 3NIFE 3KPSB 4R4ND 4Y4HC 2XRAL 4OLWH 1P4BL 4JVWA 3N06B 2VRAA 1CVSC 3WYRA 2P8LB 5IQ9B 4O58H 3STZA 3FOLB 2O5XH 2GEEA 1A7RH 5IIEA 4KI5D 2R69H 1I85C 4PJFA 5CD3A 3CXHK 2OZ4H 1H3GA 1Y6NR 4I3SL 1BGXL 4L3EB 4M6OL 1A5FL 1WSST 4OSUL 1SM3L 4HMCA 5TPWH 1IEAA 4UV7L 4OBSA 3O4LA 2BNUA 3KPQA 2ADGB 3ARDA 1DEDA 3LRSB 2KUTA 4RMWA 1XH3B 1HEZB 4WEMB 1BQHG 4YHIB 5GZOC 2NY5H 3UYOD 3FQNA 4DVBB 3Q5YA 4TVPD 4AMKH 1KELH 1MVUB 5CILL 2EKSB 3B8YA 2C9AA 5JIIA 4I0KA 3GSOA 4QF1B 4U3CA 2I5YH 5SWQA 4MNQA 5IB2B 5CSGA 5I17B 4WO4B 2HYMA 3TVMB 2MCPH 5FYJU 5C0BD 3RAJL 4XCNB 3O41B 1AR2A 1SJVA 3QIUD 4M43L 3LVEA 4M5YL 4X0KA 1I7ZA 4HKXB 5F1OB 2R56L 1W0WB 1UH4A 5D6DA 1NUDA 4NOFA 4QNPF 2AABL 3JTSB 4K55A 2AJSH 2PR4L 2HVJA 4BZ1H 1U3HA 4G9DA 2KBGA 5HHPB 1P69B 3KJ4B 3NIFF 1UB6B 4JO1H 1MI5E 1EFXD 4OZGA 1FDLH 4MD5B 3ME0A 1QLEH 1IARB 3PUCA 5JW3L 3LHPH 4X9IA 1A7BA 2EYTB 2BNRE 3QRGH 5I1IL 1BMGA 5T3XD 1BWMA 1U8QA 1JPSL 4W68A 2WBJA 4MVBC 4PBVC 5MERA 4NO5A 4NQEE 1DQLH 3UBXA 4NPYA 1WWBX 4S1SH 4YXKH 1A9EA 2X4TB 5J11B 4C4KO 4XHQA 1J5OH 1HHIA 4YUEH 3P73A 3C5ZA 1KLGB 2J4WH 4M6ML 4OF8A 1YY8B 1DBJH 4LCCB 5BO1L 4W6XB 1G9MC 1I8MA 3L3KA 1T1YA 3TVMC 1A6TA 5BJTB 4C83B 5J7CC 4BYHA 3STLA 1DCLA 1LE9B 1Q0YL 3CFKB 1BZ7B 4UIMB 4IIQA 4X4YB 1A5FH 4OSUH 4NC1E 4OI8A 5I1JH 3BE1L 4GG6E 3PXJA 4AL8H 1FZOA 2UUDK 3BT2H 1C12B 4H8WH 1ZT4A 2C3VB 4XH2B 4MD0A 3SDXB 5DJXA 5GJTH 4XP4H 4KHXH 4ACPA 2OR7A 1UJ3A 1V7MH 4CKVX 3LQAL 1CFSB 1FNFA 4GFTB 1T1XA 5LGJB 1N64L 5E99H 5F3BA 3TCLA 2I25N 1KN2L 3GNMH 1Q1JL 3QFJE 4OZGE 1EO8H 2YMXH 4N0CC 2B0SH 3M45A 1YEGH 2P4AB 1WICA 3U4BH 4P3CL 4F9PA 3QUZA 4YR6A 3PP3H 1BD2A 2MPAH 4KDTC 5CIPH 4G8EB 2AJUH 3SEPA 4EIGB 5F6HI 5IBUG 1H3TA 1U8NA 1QQDA 3M17A 4G8IB 3ULUD 2C3VA 3FN3A 3RFZC 2HTLC 3FT4A 3PGDB 1BIHA 3KS0J 3HNTL 3FO2A 1ADQL 1F5WA 5EBMA 1MJUH 3ZLQC 1U8MB 4OLUH 5FAAA 4JG0L 3RZCB 2Y1VA 1CDBA 4LVEA 3BPCB 3BRFA 4G80A 1HIML 2CIKA 3EDKA 4HGMA 3DPBA 4LSUL 1CLOH 2WANA 3EDDA 3QULB 1MPAL 1NC2D 3HZYB 1ZHKA 1YY8A 3IDMA 3ZDZF 2GTZB 1NL0L 1KLGA 3Q6GL 3QPXL 1HDMB 4Z0XA 1VKXB 3HCVA 2F19L 5CEZH 5JDSB 2FCBA 3ILQC 1KBGH 3CC5B 5E8PA 4UMGA 4Q6IC 4BZ2H 2NLJB 1S9WB 3ROLB 4E9LA 4JJHA 4Z0XB 1LE5B 4KKAD 4ODTL 4OJFH 3S36X 4X7EC 1MCFA 4NUGL 2F54D 3MV8A 5EU6A 4OF0A 1ZHKB 3GSNH 3IDMB 1G0YR 4M1DH 1REIA 1DQMH 1IC1A 5CJOL 2VXUH 4UQ2A 3MLSH 3FKUS 4JAMA 3DETC 3BMVA 1UB6A 3DO7A 4XVSL 5DQDH 4Y4KD 3IDGB 1RAMA 3FB7B 3U7YH 1IT9H 4NHUA 4MJ4A 4BFBD 4FABL 5JUEH 3N85H 4HIHA 1OGAA 2XZQL 3UTZB 1P9MC 5C0AD 4Z0BH 5EBMB 3W11D 2EH7L 3FMGH 3ARSA 2NXYD 5EB9A 3WEXB 2DF3A 1IAIL 3MRNB 4QKXB 3G5XB 1NBQA 4PR5A 1N3NB 4HF5H 4ZS6C 3T0XA 5C0AB 3QUKB 5FGSA 3WUZA 4Y0GA 3QUZB 1VGEL 5BCAA 4FQPA 5EUOF 3D9AH 1BHGA 3GSWB 4D0BA 5ID0A 2ARJA 2P5WA 3ARFA 2RCSL 5TDNB 1AGBA 1JF5A 3GMMB 3BP5B 1T6VN 4Z7NE 2X9XA 2Z8VC 2VQUA 2X4OB 3DOSA 3RVXC 1DQJB 3ILPA 4JKPL 1OOAA 2P44B 1T1XB 2DWDA 5LGJA 4GRLD 2HT2C 4P59H 1JN6A 4L8BB 3DUSB 4WY7L 3ZHDA 3CMOH 1DDHB 5A2FA 5D7KD 3UMTA 3RL2A 5C2UB 2J12B 4QRRE 2VJXA 1ZT4B 3GIVB 1VFMA 1KJ3H 5IMLA 1FZOB 1UWEL 2APVA 3STZB 5F88A 4K3JL 5KG9A 1YYML 1B4RA 3MRGB 2GSGB 2YUZA 5E1AB 5J4MA 2FDBP 3VXPB 5K59F 2BNQE 2IQ9H 4X5XB 3MOBL 3SDXE 1TPXB 3WFCH 2F53D 4TQEL 1YEJH 4X9BA 3DWTA 3VFUB 2EDOA 5ITFA 2HT4C 3VFVB 5K9QG 4LLMA 3RNQA 3BKMH 1S7QA 1K6QH 1VACA 4PGBA 3RGVA 5DJ2B 5JHLH 2X41A 2HWZL 4HXAL 5C0CA 5INDA 1HNGA 2EDXA 1IBGH 2R0WH 5BMFL 3RWGA 1H0DA 1I7TB 1FFQA 3PG2A 1WTGT 2P24B 1MOEA 4TTDC 5ABDE 3QXDB 2V2WA 1SBSH 1U95B 3UAJD 3WKNA 2ITDB 2XWJB 1S78C 5D2LE 2Z92A 5LAXA 2VDQH 2MHAA 1IGIH 4GKSB 5B38A 1OAUL 4X9FA 3WNKA 3DTXB 3WIIL 2EXWD 4HG4J 4F15B 1XGYH 3AB0B 1FVCB 1MQKH 5HVFB 5IW1B 4PRPA 4Y7MA 4EQ2A 2VDQL 3HAEA 4QRPB 1IC7L 3CXDL 3PHOB 1P1ZB 2EIBA 1U8KB 2YRPA 4MAYD 1KLUA 2EDYA 4JJ5A 3VGFA 2ICEA 2HKHL 5JMOC 3OXRA 4J4PD 4WO4A 5AEAA 1O5DT 3IJSA 5I17A 3CDGB 4LGRB 1JK8A 1U9KA 3VI3F 3MXVL 1GC1L 3PWVB 4I13B 5MENE 3THMH 4IM8A 4J3UA 5E00B 3SCMD 3S35X 3L3HA 4ZO9A 3PGCB 2HVKA 2OP4L 1CGTA 1I75A 2FYYB 4ZAKC 4P9HH 5CWSA 5EO0B 2FLRT 4LLUB 3K46A 3VXNB 3HPLA 1EBAA 1IGYB 4Q9CA 3GUTA 3RU8L 5IIEB 3FAWA 4DKDC 4NFCA 4P0DA 4IRSA 2QADC 1OD7A 2CMRH 3C8HA 4PRPD 1IAKB 4MNGB 4H0IA 4GXVL 4QTHB 4KJQC 2GIYA 3V5KB 4XGZB 2X70A 4JY5L 2DQHL 2IBZX 2B2XH 1FSKC 4M3KB 1IRAY 3C6LB 2VIRB 5JMRA 3RP1A 4FQHA 1ODAA 4GXVH 1C5CH 3NIGE 2G75A 3RWFA 3HG1B 4X6DB 4EN3A 5FGBA 2Y5TA 3DRTB 1SEQH 1UXSA 2DD8L 5HSFA 4E0RA 4WTXA 3VFGH 2CXKA 4WI2A 3ZKXC 4FXKB 5JZ7C 1OAYH 4Q97A 3W2DH 1EBPA 3LRGA 1EHLL 2K1MA 3MRBB 4R97B 1F6AB 3P2TA 4JDVA 1IQWL 5KANG 4Y4FB 5EH1A 1G9NC 5TE6H 4X83A 3UP1A 3OX8A 4PY8I 3KPSD 5TH2B 1OCWH 4LLDB 4FZ8L 5F8QC 1R3HA 3S3SA 2OQJB 1RMFH 4I77H 4WI6A 1QNZL 4OI9A 4YGAB 5J56B 1YA5A 3PNWB 3EOBB 2AI0L 3RL1B 3UTSB 4ONOA 1RD6A 2FHBA 3RX7A 3V6ZB 3ZYJA 1UWXK 2VL5A 4GAYB 3HRZA 3KXFB 1BQSA 1S7WB 3P4NB 2XYCA 5E2WL 3EUUA 5IFHL 3F7YA 2NY0B 1D9KB 5I0DA 4E41E 4KDVA 1MLBA 1BAFL 5JPMB 1SYSA 2HLAB 4O2CB 4IOFC 4MGXA 5D1QB 3DHJA 3MNVB 5DRWA 2XN9A 3V6OC 5IP4A 5KSAB 5DWUH 4ODTH 1F4WL 3GM8A 3DGGB 2V9RA 3T8XA 2JELL 2VABB 3S35L 1HSBB 2Q8BL 1G7JB 1IAOA 2DQUH 3ULVH 4P48A 3KNBA 4JM2C 3MBEB 5I16B 3B9KA 2C1OA 1BZ9A 1R3IH 1YYLL 4XC3H 2X09A 4FTVD 5AAMA 3T2NL 3EYFB 2BVUA 2DQDL 5CP3H 5L9DH 3GBNL 2CDFA 3WN5B 5C7XL 2VWEC 3EHBD 3VGBA 1XCTA 4WHYH 2ZG2A 3WUWA 4JY6B 4RAHA 1DUYB 4G5ZL 4UB0L 1N5YH 3HMXA 4P23A 4P9HL 2MKLC 3RY5A 2Q7YA 3KPMB 5MEPB 1WAAE 1WC7A 3DSNA 1EVUA 2UWEF 1I1YA 2VLRE 3E3QE 5D70L 4Q9RH 4APQB 4JDVB 2X1WL 4YDKL 4ZTOL 1LP9E 5TQ0H 1NGQL 1RULL 5AYUH 1J8KA 1OQOA 1TVBA 4YFLF 5I66B 3X3GH 4U1JA 4APQD 3TC9A 5HHMD 2DBLL 3P4LA 4Z78A 2DBJA 2V17L 3ZKSD 1RZ7L 1HZHL 4EN3B 2W0LA 5T3ZD 2ZUXA 4UINL 4F57L 2XNAB 4DUXA 4HK3J 3TJEH 5GRJH 4JR9H 4OFVA 5I9QC 4L4TE 4ETQB 1L4IA 2VDRL 1RUKL 3CFEA 2BNQB 3WL9B 1A6WH 3SKMB 5BZDB 3ZE1F 2HLFC 5DO2D 4GH7B 2ERJB 5E2TH 4KJWC 2EDHA 4I2XE 4PJGA 5D2NE 4PREA 1KJ2A 3ESVF 3MROA 3KVQA 2G5BA 2HRPH 1P2CB 3TGXA 5FK9A 1UJTA 5C3LD 1UEYA 1GOGA 4PJCF 3EOAA 4NGHL 5HI5C 2CXGA 3V0WH 4ZUTA 2Z4QB 5FYKU 3NMEA 5E6IC 4M6NH 4HBCH 1UM4H 4Z76B 2VXSH 3SGEH 3DMMD 4NBZB 3Q5TA 1LK2B 2WAHA 3BUTA 4RA3A 4MDJA 1I1FB 3RVWD 4S11A 3AU1A 6CGTA 4G3YL 1JK8B 2NY5C 4WW2A 4HEPG 4M7ZB 1KCUH 5B39G 4XCEA 4Z5RB 2NY4D 3JTTB 2FJHB 5JOEA 4UV4H 3CXHJ 4AENA 1TZGL 4JJ5B 1KFAH 1MCQA 1A6UL 3E2HB 4YX2H 3LEXA 5E2VH 4PGCB 3KLDA 1G7HA 2DQFA 2DYPB 3VXUA 1T4KB 1MHHB 5F9JA 4PP2B 3X3GL 4CADB 2VLKA 4NN5B 2CLZA 1W8NA 2MHAB 3MLWH 4OLVL 4CDHA 3W11C 2VITB 5CZVL 4PJ5A 2BSSA 5I74C 1ONQA 5GGQH 3TT3H 4XI5C 1MAML 1CDHA 2ITDA 5SX4I 4NKIH 4KU1A 4ZFOL 1CF8H 4N0YH 1T1WA 1TJIH 1NKOA 5ISZA 1AE6L 1G6RL 3BWAA 5CP7B 3O6KH 3P40A 4JG0H 3DBXA 2NR6D 5INDB 4OQTA 2JJSA 2FGWL 1XF4A 2ZKHL 2W92A 4GKOA 1A2YA 1OGTB 5EOCL 3QIBC 1G9MH 1K5NB 2NPLX 4IOSD 4OAWB 4QY8A 5FK9B 3TPKA 2J88L 3QIBB 5E8OA 5TGBA 4X6DF 3EO9L 1HYRC 2APBA 3RNQB 1UYWL 2Q76A 5C1MB 4F7CB 2FR4A 2VDPL 1FNSH 1FQ9C 4QXWA 4JANA 2ZOKB 4ZAKA 2NY0C 2XKSA 4GSDH 5E1AA 1DBML 3AY4A 1YQVL 5A40E 1MF2L 1F8TH 1UKTA 5I1HL 1U8HB 4FQXC 3H3PL 3BFOA 5I1DB 1NLBH 4P49A 3VRLE 3RL2B 2C4XA 4XZUA 5BW7A 4B53A 2XG4A 2H1PL 4P5MB 1BQUA 4XVTL 3QEUA 4M8QA 2VB5A 4U1KA 3MV8E 5EU6E 1BVLA 3NABH 3ESUF 3ILPB 2ADFL 1WFOA 5D7LA 5LXGL 4IMLA 1X5HA 3MX0A 2NTSP 1J8HB 3FONB 1LDSA 4N5ED 2DICA 4NO0B 3T3ME 4L9DA 4HK0B 3KPNB 5IVXB 1JUFB 4RFOH 3GRWA 3T0EC 1FORH 3ARDC 5FYJL 3FTGA 5C0AA 2A9NL 4JB9H 5IV2A 5FUOH 5IB4B 1C16B 1CICD 2ENSA 2E7MA 2A0LD 4X98B 4IHOA 4HIJA 3DUUB 2BCKB 5LGHH 5B3NA 1S78D 2ZPKH 3ZDZE 4CDGC 3U2SA 4L9LA 3BRDA 2WWKT 4G8GD 3MRDA 4X8JB 4YHKL 1JGEA 4LSTH 2KZ1B 3O6ML 4MA3B 5E2JA 4L3EE 4M7LL 5C6WH 1ZT7A 3SDCD 1YEFL 1QRKA 4MCZA 1A64A 4HX1B 3DIFB 2CKNA 4HWBH 4J4PA 4RZCB 5I1LA 1MLBB 4KZEL 4NQVB 1D6VH 4I0PB 3MCKB 1P4BH 3S4SG 4MJ5A 5JHDE 2WUBH 4L4TD 3D85D 4J3OC 2DLIA 2X1QA 2Y07H 1S7UA 3V7AE 3OAZH 1X6NA 2XA8H 4OFIA 5A2JH 5EWIL 2IBBA 4I0CC 4JFYB 5HGDA 1RZJL 4KUCD 4OZGF 1JGLL 2OQJA 3DI3B 4H20L 1A47A 3OX8B 1B0WA 2ILLA 3SQOH 4DFHA 3KYMB 4M7KH 5D96C 4GBXA 1MY7A 4LU5H 2NZ9D 3MRQB 2XOTA 1WFUA 3U1SH 1NMCC 1KELL 4OV5B 4ODUB 4H20H 4JG1L 3RZCA 3RWJB 1XIWD 5DJZA 4KJQD 3HE7C 3MOBH 1FNGA 2VKWA 5F7WC 1KEGH 3ZHLA 5KVEH 1AFVL 2RIKA 3EYQC 4NFDA 3RWFB 2G75B 4DTGH 4G42B 4HH9B 3ARZA 3QQ4A 4PIRF 4FQHB 2Z8WC 3GMLA 5FA4B 4EZMA 5D7LE 3OJDA 5E6ZA 3IGAB 5J3HD 1JPGA 2C1PA 1EGJH 4MJIE 4F7PA 4TNWK 5J06A 1IEBB 1IGYA 3WIHA 4PTUB 1AD0B 1BOYA 3CH8A 1OP5K 3VXNA 1B6DA 5DVMA 4PJAB 4ZDHA 1CFQB 4Y5YA 3NA9L 3BWUC 3QNYA 3HZMB 3SDXA 4FQ1H 4K2UL 3VFNB 4XMKL 3PV7A 1YNKH 2WWMD 4XPGL 3D3VE 4A6YB 3S34H 3SBWC 5I1GL 3C5ZC 5HGAB 3KWWA 4PD4K 3WLBB 2Z35A 5DD3H 2IJ0C 3U9PH 5JW5A 4PGJA 3FO9B 4Q9RL 1TENA 4LLVB 3J8F7 5T1DH 3MV7D 4F7MA 5HDBE 2CK0H 3KGRA 3RNKB 3ZT5A 5M95B 2XA8L 1YNTA 4WRLA 4XC1L 1FYTD 1BWWA 5KSAD 2DQGH 5ALBL 4RNRA 5EC1B 1W2KT 5TF0A 5JDJA 3QXTA 1VADA 2YUXA 1LQSR 4KQ3H 2OSLB 4JQIH 3SCMB 3LN5B 4PJBF 5GS3A 1HHIB 3BPOC 4OCWL 2A6IB 3NBNA 1JGLH 1BD2E 2C26A 4FQ1L 4K2UH 4Z7UB 3T2PA 4BZ2L 4OBRA 1RZGA 3JWDH 2FX8H 4QYOB 3C60A 5T1LD 3LIZL 3MUGB 5KOMC 4FOMA 4WW1A 2DI8A 1X5XA 3C08H 3A6OA 3DJ9A 5DZLA 2RFXB 4PJ8C 1ZS8A 3EHBC 4MA7H 1JF1B 1EPFA 2SEBB 5C0CB 5E8DH 5D1XB 1OT2A 3S88H 2YPLD 4Z95L 5DJ2A 2EXYD 1EVTC 1UZ8A 3DV6B 1VADB 3LKRA 5CSZB 1TCRB 2D7OA 5E6YA 9CGTA 2ZCHH 3BRGC 4X0KB 4IS6B 5GRZA 3O9WA 1QEWB 2Y9RT 5D7SL 5ILTH 4CMMB 4ELME 5D1ZD 2Y36L 4FQIL 4F37K 1CN4A 4F7MB 1ZGLM 4DCQB 2B1AL 3ULUC 3MRJA 4X4ZA 2DJUA 3OAYK 3BZ4A 3SGJA 2HG5B 1N4XL 1GGIL 5DQDL 2E3VA 1MAMH 2QV2A 3QCTL 3QEQD 3VXPA 5GSVA 4MD4B 1U8OB 4ODSL 4KVNL 4KKAC 2X89D 3DX9B 3LKOA 1TETH 3UTPE 4MSWA 1QR1A 3VFNA 5C0BB 1A7NL 1BOGA 5BS0B 3KR3H 5F9OH 3KPQB 2AP2A 1RIVL 5I8EB 5IKCB 4QGYA 1IEAB 1DDHA 2OLDA 5EC2B 3I9GH 1V7ML 1CD0A 4YPGA 1NMCB 5IHUH 5C0BA 4P2OD 4R96A 4S1QH 1S7SA 2E9IA 2H6PB 3CFJA 4MXWH 4YHNB 1KTLB 3ARVA 1NCAL 1N5AB 4OZ4A 2IPUG 3DYPA 3I02B 4LP5A 3BP5A 1U8OA 4D0CA 3NZHL 1KB5L 1R5VB 3DMMB 3ARFB 1ZAGA 4QO1A 5KZCB 5J12C 2B2XL 3TPUA 1DVFB 5IGXL 1OD9A 4GMSH 1UZ6E 3R1GH 3BZFA 4LDEB 4QRRD 5DS8B 1FVDA 2J5LB 4G7YH 4NKDB 5DRNB 4ZS6D 1EUTA 3FCTB 5FYLD 4EDWL 3ARED 4LBEA 4OT1L 4Z7WE 2GJZB 5DXWA 1BFVL 1HH6A 3MBED 3ULVF 4F8TA 5J89A 3GKZA 2AJ3B 4NKIL 2YXFA 3DX6B 3SN6N 4OIBA 4LCWE 1T0MA 4XWGL 4I9WD 3B83A 3X11B 1Y6KR 3QUXA 1MY5A 4XWOD 1JF1A 1DP0A 1I4FA 1AY1H 3B5TA