3DSGA

Xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
94
Chain Sequence
QGILSLALKDKAALYSAYMPFVKSGGIFVPTPKRYMLGDEVFLLLTLPDSSERLPVAGKVVWTTPNRAAGIGVQFPDGPEGEAVRNKIETLLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type IV fimbriae assembly protein
publication title XC1028 from Xanthomonas campestris adopts a PilZ domain-like structure without a c-di-GMP switch.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Unknown function
total genus 18
structure length 94
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3dsgA00
2L74A 5KECA 2RDEA 4P00A 5EIYA 4XRNA 1YWUA 4I86A 3KYGA 5KEDA 3DSGA 5EJLA 4FOUC 2GJGA 4P02A 5EJZA 3CNRA 5KGOA 4RT1A 3KYFA 1YLNA 4RT0A 5EJ1A 4HG6A 4F48B
chains in the Genus database with same CATH superfamily
3TK6A 1C1OA 1C1QA 1UCYK 3H09A 4FUGA 5TCAA 1A3BH 3RXFA 3OE7D 3QWCH 3GISB 2F9UA 2AEIH 1ANEA 1OWHA 1ELAA 1GMCF 1UVTH 1TBZH 3MTYA 3VB3A 1J9CH 1O5DH 2BD9A 5GXPA 1QQ4A 5A0AE 1A61H 3EA7A 3LIWA 2JDID 4ZXXH 2KM0A 1TGSZ 4P02A 1MU8B 1EJNA 3RXKA 2ZDVH 2A4QA 4ACBA 1AVXA 1EOJA 4RKJB 4AB8A 1VJAU 4E06H 1RTFB 4Y8YA 5HGGA 4AZ2B 3OAAD 3HKJB 1DLEA 1T4VH 1SGRE 3RXAA 3EGKH 3PLBA 2GVFA 3LGYA 2QE7D 3K2UA 1Z8JB 2NU1E 3SU3A 1BRAA 3PTBA 1Z1JA 4X8SH 2FOAA 3TK9A 3ZZ4A 2BD4A 2K0QA 4ASHA 1EX3A 2ODYB 4Q2KA 2DE8A 1AVWA 2BDAA 2FLRH 1GMHG 2AYWA 4I8KA 1DS2E 2TGTA 4CH8B 4X8UH 1A5HA 2GZ9A 3PTNA 2XC5A 1C5VA 2CXVA 1K1OA 4X6NA 5J4QA 1GCTB 1HGTH 5C1YA 3QLPH 1MH0A 2AFQB 1AMHA 3LGTA 1GBFA 4ABAA 1MTSA 3L3TA 1AD8H 2STBE 3UR6A 4ISOA 1QL8A 2ZFFH 5GPIB 5DGJA 4MVNA 2M2AA 5T1VA 3SGAE 4TWYA 3WWFA 4AFZA 2FXRA 3LC3A 4FOUC 1W0YH 4Q7YA 4ABGA 1SLUB 1JBUH 2FO9A 4FVBA 1BRCE 5DP8A 1KXEA 1LHCH 4BAQB 1QTFA 1GJ5H 6LPRA 1ZTKA 3MU0A 4ABDA 1SQAA 2CHAB 4AFUA 4XDEA 1TRNA 2J34A 4X2WA 3UIRA 1TRYA 1UTKA 1B0EA 1HAZB 1WQSA 1GDUA 1A7SA 4ZROA 2K1QA 1PPBH 1YGCH 4FUBA 3MO6A 3ZYEA 3E16B 4ZUHA 4Q4LA 1SB1H 5HYOA 2AHME 3Q76A 3QGNB 4F55A 1C5UA 3VFEA 4X6MA 3SU2A 4YLQH 1BMNH 4M7GA 1ZMNA 2Z9KA 4MTBA 3SJIA 1ABIH 1Y59T 2QN5T 1UVSH 1O5AB 2A5KA 2ILNA 2J4IA 2A7JA 4IMZA 2P95A 1UK2A 4DT7B 4UD9H 1EQ9A 1PPCE 4NZLA 3MFJA 1HXFH 4E05H 1OYTH 1EFRD 4WMFA 1E1QD 1SLWB 1GBJA 1BTPA 1ELDE 1QJ7B 1ZSJA 5JB9S 1O38A 3K9XB 2GGVB 2OQ5A 4I8GA 4ABHA 3JZ2B 1GHXH 1QJ1B 3QUMP 1C1UH 1O3MA 2ODQA 1DFPA 1ETSH 1O2NA 4U2WA 2XCFA 3RP2A 3HGPA 3MO3A 1FLEE 2R0LA 2TBSA 2XWAA 3A82A 2A45B 5E8EH 2B9LA 1YC0A 5DSFA 2FTLE 2ZFPH 3HGNA 1O3EA 2F9BH 1GCTC 5FBEA 5KECA 3SV9A 1FQ3A 2ZFSA 2FDAA 4HFPB 2GMTC 3SQHE 1G3CA 2GV6A 1FY4A 1DT2A 1S6LA 3LGVA 4F4OC 1AZ8A 2QXHA 5FBIA 2GCTB 3NXPA 4K1SA 1LVMA 1TNIA 2SGAA 2BZAA 1TA2A 2VVCA 2DE9A 2GKVE 2ZHEH 3ZZ5A 2W7SA 1IQEA 1CA0B 4INLA 1HPGA 2CHAC 5JBAS 1SI5H 1HAGE 2PWXA 3ZVFA 1JIRA 4XBCA 3P95A 3RC4A 3MNXA 1JWTA 2BDYA 3MNCA 1F0RA 1HB0B 2OTVA 1C1NA 3TPIZ 2F43B 1TA6A 2D2DA 1GHAF 1HJ8A 1XX9A 2TIOA 1FN8A 2UUYA 3A7VA 4ZHLU 2M5TA 4ACAA 2IN2A 1O2RA 1QBVH 1C9TA 1DY9A 4NIWA 4K2YA 3MU1A 4ZMAH 3DFLA 1LHGH 1SGTA 2OD3B 2BX4A 5EU8A 1GI4A 1EAIA 3OEED 3PM3A 1C5SA 1BTYA 2PTCE 2F83A 1XUGA 2W5EA 4YT7H 3DD2H 3D62A 1AB9C 3SNCA 1WTGH 4CHAC 4BAOB 4NSVA 4YO9A 3FO8D 2KAIB 2VIWA 4BOHA 4BXSA 1Z6JH 3OEHD 3Q00A 2OUAA 1ZHRA 2H1UA 1YPMH 7LPRA 3BV9B 4MNWA 3PLPA 1BZXE 1EZQA 3C27B 1FNIA 3UQOA 1PYTC 8GCHG 1MTNB 2VWMA 5C0UA 1YLCA 1RXPA 5KEDA 3GY7A 1Z8RA 1VCWA 1SOTA 1A2CH 2F3CE 1GBEA 5HIZA 1GG6B 1YF4A 3F9EA 3KGPA 5JBCS 1O2ZA 2Z9IA 2CF8H 2C8WB 1TOMH 2VH6A 2XNDD 2ZHWH 3GY2A 4IBLH 1J8AA 1P9SA 3EE7A 1V2QT 2VINA 1D3QB 1O2KA 3STIA 3TJNA 1TPSA 1Y8TA 3CP7A 3U8OH 1O3HA 5A8YA 4VGCB 1IQHA 2WPLS 1O2VA 1D3DB 3PV4A 1LVBA 1OP2A 1M9UA 3R3GB 5F6MA 5GIBA 1BJUA 1F5LA 1AKSA 1AO5A 2WV4A 1QJ6B 3H7OA 3RLWH 1SBWA 1IQNA 1NU9A 3OYPA 1GI5A 1IQMA 2GCTC 2XXLA 5EXMA 4AOQA 2ZQ1A 4WXIA 3PV2A 4IN1A 1SG8B 2EC9H 1DXPA 1P2JA 4RT0A 3SUFA 1BRBE 1FIWA 4TPIZ 3UWIA 3MH7A 3GDVA 4Y79A 2WPJS 1MKWK 1C5LH 2RDLA 2G8TA 4FUFA 2H6MA 4GPGA 3SJOA 1P2KA 1MKXK 4OS1A 1C2JA 2BY7X 1H8IH 2TGDA 2UUKB 2V3HH 3URCA 5LPRA 5LPFA 1Z7KA 1YPGH 5EGMA 2ZDLA 1RTKA 2W3IA 1GPZA 1PYTD 1TALA 1EOLA 3SI3H 3A86A 2J2UA 1ZHPA 1TPOA 5JBTA 1GJ6A 1HDTH 4E7RG 2C8YB 4NA8A 4DW2U 1P8VC 1PPEE 3I77A 4KTUA 2HVYB 2ZC9H 1YCPM 2UUJB 3BTQE 4B1TA 1GBCA 5EPYA 5GDSH 1LHFH 1P2NA 4K8BA 1TBRH 4X1RU 1W10U 3ZIAD 2YMSB 3HK6B 1C4U2 1C5MD 4THNH 5HIYA 3LONA 5DP9A 4J2YB 3D65E 5FPYA 3MO9A 1QA7A 2GT7A 2BHGA 1GI9B 1QR3E 3EYDA 2A5AA 3A83A 4Q63A 1OP8A 3BSQA 4A1XA 1F92A 4NFEA 3FVFB 1AQ7A 4H6SB 1Z1IA 1FXYA 4GLYA 2WYGA 2BOKA 4JZDH 1HUTH 1L4ZA 4K69A 1K28D 1NT1A 2BD5A 2H5DA 4TWWA 1K1NA 2J97A 1SGPE 1MTNC 4Q7XA 2Y82A 3N7EA 3TJOA 4ISIH 2PLXA 2ZTYA 2TPIZ 2CGAA 1KSNA 2OBOA 3PRDA 1L1NA 1W3CA 4ASUD 1W2KH 2YNAA 3F3BA 1AE5A 4OS7A 2BDGA 1K1LA 4TPYA 5A0BA 3AW1A 3L33A 3SNBA 1A5GH 2HPQH 4AFSA 3T62A 1MCVA 1P11E 1O3PB 4VGCC 4UE7H 4X8VH 2EEKA 5FXLA 3AAUA 3MHWU 1O2OA 1O3BA 3ZVDA 2HPPH 1DOJA 3FZDA 1VGCC 4WF8A 1O5CB 1XXFA 1UCYH 4WH8A 3T27A 1N6XA 2IPQX 2SNVA 4XFQA 4E7NA 3VB6A 3ZZ3A 3GY4A 1LHEH 1UK3A 2XBYA 2OLGA 1CA8B 3U28C 5T6FA 2BM2A 2AMPA 2CF9H 1GHVH 1TMTH 3D23A 3M7TA 4K8YA 2EQNA 5IK2D 1BT7A 3VB7A 4ZCNA 3V13A 1TGCA 3SYJA 1JXPA 4Y6DA 1NRRH 3BTKE 2WZQA 1V2WT 3A81A 4ZXYH 2Q6FA 8KME2 4AG2A 1ANCA 2GD4B 3WW7A 4X1SU 3ZVEA 1COWD 3FANA 3KQCA 3UFAA 4YESB 2WPMS 1E38B 2HWLB 5GNDA 1PPHE 2VBCA 1KXDA 1D6WA 1C2LA 1KYNA 4CRCA 4NFFA 3AASA 3BIUH 3B8JA 1OS8A 1B5GH 2UWLA 1D9IA 1FN6A 4I33A 2Z3EA 2FIRH 1QBOA 1ZTJA 1NRSH 1TGNA 1BDAA 2Y81A 1QHRB 1PQ8A 1ZPBA 1GJ8B 1J17T 2FOCA 2YMSC 4A1TA 1QL7A 1GJ9B 4KKDA 3RMOH 1HAVB 4DOQA 4ZKNU 2F9NA 2WINI 3SU1A 2C90B 3VGCC 4RI0A 2J94A 1OSSA 3I78A 3BTWE 4MLFB 1HXEH 2H5CA 2WUCA 1FUJA 1BIOA 2ZU1A 1RJXB 1J16A 1UHBB 1T7CA 4X1NU 1C2KA 2KX4A 3PWCA 1V2TT 2FOEA 2ZHQH 1GMDF 1UTLM 2PTNA 2HNTC 2WV9A 2AGGX 1EATA 1CVWH 5JPMH 2QCYA 1QB9A 3E91A 2QXIA 5EQRA 4A1VA 3IG6B 1FJSA 1TONA 3RXQA 2YNBA 1TPPA 4NCYA 5LH8A 8ESTE 2XNIA 1TBQH 4K1EA 1HLTH 1K9OE 2Z9JA 5IDKA 3TJUA 5AVDA 1ETTH 2FOMB 3NCLA 1W7XH 2KCPA 2JH6D 3A8AA 1A3EH 1FY8E 4WJG2 2GDEH 4ISLA 4KP0A 2FWWA 3ZZCA 1V2UT 2BXUH 4ISHH 3ATLA 1QGFA 4WWYA 5EJLA 1DXWA 3E0NB 3LGUA 2ZDKA 3P8FA 3A85A 4O03A 1THPB 1GHBF 1THSH 4K1TA 3BEUA 2BQ7B 2OINA 2YMSD 2EY4C 8GCHF 1ZPZA 3U69H 3BIVH 5A8XA 5JB8S 1GHAG 2ZFRH 1Z71A 3PB1E 1CGIE 3EQ0H 2FS9A 3K65B 3QN7A 1XUJA 3SO3A 4DG4A 1ZGIA 1YPHE 2QXGA 1E79D 1LQEA 1O3CA 5I25A 2G4TA 1P57B 1BITA 1DITH 1NFYA 1ELCA 3RMNH 1KTSB 1LO6A 1TIOA 3RXOA 1W7GH 4XD7D 1DE7H 2A0QB 5EJZA 3RMMH 4H42U 1GGDC 4RT1A 1UVUH 1BBRE 4O97A 2C8XB 1ELGA 3GYLB 1TFXA 2VIPA 4BANB 4KTSA 1KXCA 1Q31A 1O30A 1RTLA 1TX6A 2SGFE 2W6JD 2RDEA 3BF6H 5DJ7A 1H9LB 1UW7A 1SMFE 3Q3YA 4CBOA 1T4UH 1WQVH 3M3VA 1CQQA 3E1XB 1HCGA 4MPXA 4NWKA 3UNRA 3DUXH 3VB4A 2SGPE 3N7OA 3C1KA 1FIZA 3L6PA 1D4PB 1SGFA 1AN1E 4SGBE 3P17H 1JMOH 4F48B 2ZGCA 3ZZAA 1UJ1A 1UTJA 4LZ1H 3ATMA 4A5TS 1NRPH 3SZEA 1V2PT 3M35A 4WH6A 5DP5A 3SQEE 3SHAH 1O2YA 1C1RA 4JYTA 1DUAA 1C5XB 2VNTA 1MABB 1EKBB 1O39A 3LGIA 3T28A 3QX5H 3K6YA 2ZI2H 3A88A 1WYKA 1TE0A 5K0HA 2JKHA 1NC6A 1SGNE 1J15A 2VB0A 7GCHG 1K0HA 1SOZA 2F9OA 3MH6A 2AH4X 2QF3A 2F9PA 2QGRA 2BY8X 5ESBA 5IYTA 3LGWA 3P8OA 4CBNA 2BD2A 1PFXC 2ZCKP 3QTVH 2P94A 5C3NA 2A7HA 1ABJH 3GY3A 2J95A 2O8TA 1IHSH 4B2BA 2G4UA 4HG6A 3S7KB 2GP9B 2OC1A 3TLOA 1MAYA 5PTPA 9ESTA 1GL1A 1YPLH 1YM0A 2Y7XA 1TNJA 5CHAB 1AU8A 3LH1A 1Z8IB 3RLYH 1NM6A 1ELEE 5I46H 4IS5A 1EJAA 1TNKA 4BAMB 1TABE 1TGTA 4D9QA 4XSKU 3ZZ6A 2QYIA 2P59A 1BB0B 4AG1A 4CRGA 1XVMA 4JK5A 2BVSH 1GJDB 3QZRA 1S83A 4BAHB 1DWDH 3KHVA 3NRLA 1XKAC 2O9QA 2OP9A 3I29A 4GVUA 3TIUA 3KQ5A 4AYYB 4JYVH 3CS0A 1S85A 1OWEA 5ETXA 2PFEA 1O3JA 4NWLA 1C5OH 1V2JT 1OXGA 1WV7H 1E0FD 1OWDA 5FHTA 1BTZA 3KN2A 3TU7H 1GBTA 1LKBA 1H4WA 1O3FA 5FPTA 3SJ9A 4Q80A 1WCZA 1DPOA 1HAPH 3LJOA 1QA0A 3SV7A 2QA9E 1MD7A 3DFJA 8LPRA 4B75A 3CENA 3EA9A 3EAJA 3F0OA 2O8WA 2LELA 3FP8E 4KGAA 4X8TH 2Y80A 4X2YA 3UR9A 2BB4A 3S9CA 3SORA 1TQ0B 2BQ6B 3QO6A 2AS9A 3F0PA 5H4IB 2NU0E 4CRBA 3GCTF 3BEFB 1ZRKA 1AFEH 3PMHB 4K60A 5FX5A 1EJMA 1SGIB 1QURH 2ANWA 1ELVA 1MUEB 2BDBA 2D26C 5F03A 1CE5A 4OS5A 1S5SA 2G00A 2XBWA 1W11U 4ZHMU 1FPHH 2GT8A 1O2TA 3G01A 4UONA 4FUEA 2BDHA 4OGXA 1O34A 3W95A 2Y6TA 1W0ZU 1MKWH 3ZV8A 1JRTA 2QXJA 3SHCH 3PO1B 3KYFA 2JH5D 3A7ZA 1QNJA 2BMGB 1ELFA 1EPTB 1YY3A 4JMYA 3T25A 3FP7E 1Z6EA 5AF9H 1UTQA 4CRDA 1HAIH 4YXWD 5CHAC 1O35A 1GBDA 1P09A 4LZ4B 4HTCH 2WPIS 1H9IE 3QDZB 1UMAH 1Y5UT 4GCHG 1V2VT 4FUDA 1T32A 6GCHG 3NKKA 5CMXH 1SVPA 1ZMLA 1PQ5A 1DWBH 1L1JA 3NPSA 1BJVA 4HZHA 1TLDA 2FYRA 4ZAEA 1C1SA 4X6OA 4KELA 4X1QU 1N1LA 4Y0YE 1C1TA 2WPKS 1YKTA 2A2QH 3QTOH 3OY5U 3T29A 4B76A 2JETB 2WPDD 1S0RA 1WDIA 2FX6A 3EE0B 3SOSA 1K21H 1XKBC 4ABIA 1AE8H 3PRBA 1GMDG 3TGKE 1C9PA 2FOHA 1AUJA 1QL9A 2ZEBA 3BEIB 4Y7BA 3RXSA 3T26A 1EB1H 3A8DA 1LVOA 2W7UA 2VGCB 5EODA 1TOCB 3RMLH 4IW4E 2I6QA 5BPEA 4AYVB 2GZ7A 4DIHH 2FZZA 2HOBA 4FUJA 1ACBE 2CV3A 1S0QA 2PKAB 3B23B 1Y3XA 4NSYA 2WPHS 3ENSB 2RA0A 5CE1A 3MH4A 3M7QA 5J4SA 3ZZ9A 2ZHFH 1XUKA 2XOKD 3U98H 1KLTA 1GHBG 2NU2E 4B6FA 5F8ZA 3RU4E 1O2UA 4KTCA 3S9AA 2O8UA 3TGIE 1SHHB 2J38A 3QZQA 2DUCA 2AGEX 3A7WA 3OX7U 3M5OA 4NA9H 4ESTE 1BBRK 1ZMJA 3NWUA 3F6UH 2ZDAH 1P02A 1F5RA 4A7IB 4AFQA 3PO1C 2A32A 2AGIX 1UCYE 1QY6A 2QF4A 5C0TA 1HNEE 3O8DA 5DO4H 1O2LA 1EPTC 3LOXA 1ELBA 2P8OB 4ABJA 2ULLA 2EA3A 1UO6A 2ANYA 1BMFD 1QRWA 2FMJA 2FESH 1T31A 2SNWA 7KMEH 7GCHF 1ZPCA 1C2HA 1RFNA 2AMQA 4ABEA 3E6PH 4YOIA 2R3UA 3RXGA 1O33A 1P0SH 2ZGJA 3VEQB 2BLWA 1LPZB 5JBBS 1VITF 2XBVA 3LKWA 3A8CA 2GCHF 4RSPA 3U1JB 1A46H 2B8OH 3ZVGA 4DVAU 3P8NA 4UEHH 1CA0C 1TMUH 1JRSA 1IOEA 5TCCA 1V2ST 3OFND 1E1RD 2OC8A 4R0IA 5L2ZH 1ANBA 1YCPK 3UB0A 1C2IA 1KTTB 2JETC 2VU8E 1SFIA 4OS6A 3GY8A 5BRRE 2J9NA 3ODDA 3SUDA 5B6OA 3A7YA 1OWKA 1P03A 1HAXB 2PUXB 1WOFA 1OHHD 3N99A 4M9FA 1PPFE 1NY22 3MU4A 2ZFTA 4DURA 3PLKA 1VCPA 1MTWA 2G81E 2V3MA 1F5KU 2VGCC 1O5GH 4ZKSU 1ZSLA 1GBMA 2PKAA 2KAIA 2ASUB 1HYLA 3AAVA 1DUEA 2XTTB 2A1DB 2EI8A 2PGBB 5CHBA 3BTEE 1TPAE 3RXRA 4NG9H 3UPEA 4I31A 3ELAH 2ZGXH 1LQDB 1TQ7B 1CSOE 2FLBH 1SLVB 2BY6X 3SW2B 1INCA 1Y5BT 3M3SA 2KCAA 3RXVA 1TNHA 2SGQE 2C4FH 1G3EA 2FI4E 2BQWB 1KY9A 4X2XA 2EI7A 1C2FA 3BTGE 2VIVA 3MYWA 1D3TB 4ZH8A 1T8OA 5EPNA 1BTUA 1CBWB 1DDJA 2BD8A 2PV9B 4BTIB 3F9FA 3M5MA 2BTCE 5HKKD 2ZDMA 3M5NA 1WUNH 1GG6C 1AY6H 2ANKH 2IJOB 2PP6A 2V6NA 1V2MT 5DN6D 1K22H 1EAXA 2J92A 3GS9A 1QBNA 3U8TH 1C1WH 1BQYA 3BG4B 2ODPA 3SN8A 2PHBA 1GDQA 1YPKH 1NRQH 1P2IA 2P8OC 3S9BA 5C5NA 3HATH 3KIDU 3BTME 1O32A 5EW1H 3KNXA 5JYIA 5C20A 6CHAB 4RKOB 1O3AA 3S7HB 1F0SA 2HVXA 4YTAA 1NBME 4AGJA 4BTTB 3ZZ7A 1MBMA 4Y7AA 5EJ1A 1WBGB 2BVXH 2BDCA 3O8CA 1HRTH 3PMAB 1BMAA 3RXTA 1P01A 1LPGB 3FP6E 4NA7A 3SNAA 1E35B 1J14A 1MCTA 4DCDA 1V3XA 2VWLA 3F1SB 3MOCA 2BLQA 1V2RT 1ZJDA 3UAIC 1YYY1 4DIIH 2ZP0H 3A7TA 3KYGA 2RFKC 1EASA 2J5UA 2XYAA 3E0PB 1IHTH 3IWMA 4UFEH 2P3FH 2ZG0H 5T3HA 2J98B 3LJJA 4XBBA 1CHGA 4A6LA 3SV8A 1LTOA 5ABWA 3SNEA 1ARBA 3URDA 1BRUP 3ZZ8A 1DWEH 3MU8A 3EA8A 1SGEE 3UQVA 3UNQA 2ZPSA 4TYDA 6ESTA 3DCLA 4HI3A 2P93A 4BNRA 4GCHF 1GJ4H 4NIYA 2V7QD 1G2LA 6GCHF 3MMGA 1KLIH 4CR5A 2CK3D 4B71A 1ZR0A 3QK1A 3RC5A 2UUFB 3GCTG 3KF2A 3GCHB 1DM4B 2QY0B 2AIPA 2QC2A 2RCEA 3GCOA 4YLUA 3BTHE 1Q3XA 5T6DA 1YLDA 1Y3VA 4FVDA 4J1YA 4GHQA 4LK4A 3HK3B 5C1XA 1KMHB 1V6DA 5FPSA 3SNDA 1C4V2 5EQQA 1RRKA 1O0DH 3QGJA 4RN6A 2WV5A 3F2HA 1A5IA 3M61U 1BTWA 1XUHA 1F2SE 5A8ZA 2H9HA 1VZQH 3TGJE 4AX9H 1YPHC 2FX4A 4WMEA 1VKYA 3OTJE 4UDWH 3TH4H 2ALVA 2CN0H 1B0FA 1KXBA 3ZVAA 1O2PA 4LXBH 1K2I1 2W6ID 1AGJA 1EAUA 2VVUA 3LH3A 3VB5A 4AB9A 1W13U 3RXIA 1QQUA 1GL0E 5HMAA 2XRCA 3SGBE 1E34B 3SU6A 1ZJKA 2TGPZ 2XCNA 1ZSKA 3OU0A 4JZFH 1HAHH 1YPEH 2Y5FA 5LGOA 4O3UA 1GBIA 2ZFQH 1TX7A 1O2MA 3RM2H 5HM2A 1WSSH 4A92A 1L2EA 6CHAC 4NIXA 2Y5HA 4MPUA 5AFZH 4DT4A 1OKXA 3PYHA 1TAWA 2ZU3A 2Z94A 2H2ZA 1DY8A 1P12E 2XWBI 1OP0A 3FFGA 3ITIA 3K6ZA 1GI3A 3A87A 4CH2B 1O2XA 1DSTA 5F8XA 1O3DA 1CHOF 1SKYE 2ZQ2A 4Z6AH 2GX4A 1GI6A 3GDUA 1C1MA 3SJ8A 4CRAA 1QB6A 2BYAX 1GVLA 1ANDA 3VXFH 4DGJA 1IQKA 1GBKA 3R0FA 4Y71A 1N6YA 1NTPA 1BTXA 3KCGH 5GCHG 2BXTH 2CJIA 1OYQA 1P3CA 2D1JA 2XC0A 1MTUA 5C5OA 5C2ZA 3KQBA 2KR7A 1C1VH 1HAVA 1KDQB 2KCOA 4AGKA 4NZQA 2VJ1A 1NZQH 3DA9B 1PPGE 4B74A 1KLJH 1G36A 4U32A 1OWIA 3HPTB 3GCHC 3H5CB 1UHBA 1P06A 1DSUA 4XBDA 2NU4E 3LT3A 1T8LA 1ZTLA 2C93B 1NU7B 4I32A 2YOLA 2QIQA 1SPJA 1X7AC 1IQLA 1EZUC 2Z3DA 2SGEE 5F8TA 2THFB 3FZZA 1ZHMA 3RXLA 2FI5E 2R0KA 4MNXA 1C5TA 3U8RH 2R2WU 1P3EA 3UWJH 2P16A 4B2CA 2VWNA 4BAKB 1DANH 3F68H 1E37B 3RXPA 1C5YB 2OBQA 1SC8U 2OC7A 3V0XA 3A8BA 1GDNA 4Q7ZA 1C2GA 3TJVA 1QCPA 1UVOA 5AFYH 3RXBA 3S0NA 1A0JA 1VITG 4Y10E 2GCHG 9LPRA 5FCKA 1CT2E 2LPRA 1O3KA 1V2OT 1W0KD 1EZXC 2Z9LA 1MZAA 4FU7A 1GCDA 4H6TA 3ZVCA 1G2MA 1HV7A 4FUIA 1Y3UA 2STAE 4WVPE 3V3MA 2JJ2D 1AFQB 2WHXA 1SQOA 4I8JA 4INKA 4H4FA 3T5FH 5TJXA 1SFQB 4GHTA 1C5ZB 3LPRA 2VIDA 3GCNA 2WSSD 3SUEA 2ZCHP 3RM0H 1T8NA 1YBWA 2AERH 3A84A 1ESAA 2ZU4A 1EP6A 1KDQA 3UOUA 2R9PA 3SU4A 1VCQA 3ESTA 1O3NA 4UFFH 3ZVBA 2K8IA 4TT3D 1SLXB 2GMTB 4U30A 4GUXA 1UTNA 2HLDD 5GWZA 1RS0A 1AIXH 2O8MA 1XMNB 1WAYB 2GDDA 2UWOA 3DSGA 3KL6A 2GTBA 1K1JA 1UTOA 3ZZDA 1L4DA 2ZF0H 4FETA 4ABFA 2ANMH 2FPZA 3M3TA 4JZ1A 4WY3A 1FDPA 3AVZA 1YLNA 3TK5A 1W14U 1PJPA 4MNYA 1P10A 1D3PB 3VG8A 3M36A 2C3SA 5EW2H 1SHYA 1CT0E 1GI1A 1B7XB 5DP7A 3F9HA 4Y8ZA 1IQGA 1BBRH 4MPWA 1K1MA 1O2HA 1GVKB 4XOJA 3SZNA 2A31A 5G4BA 1S6FA 1C5QA 3TH3H 1PPZA 2A4GA 2WUBA 2ZO3H 4X2VA 1MTVA 2ZPQA 4I8HA 1ZLRA 2L6OA 3MNBA 2V3OH 1XXDA 4OGYA 1O5BB 3DSOA 4PROA 2PGQB 1K1IA 4IGDA 3RUOA 2GZ8A 1BA8B 4YOGA 3W94A 4B73A 3LDXH 4FU8A 3P8GA 2Y5GA 1AB9B 1H8DH 1C5NH 1FX0B 2PSYA 2JJ1D 4IMQA 4CHAB 5AHGH 1Q2WA 2QF5A 1F7ZA 1HIAB 3UNSA 1BOQA 2KFWA 1K1PA 2ZTXA 2ZU2A 3SU0A 1GBBA 3KQEA 1TYNA 3GDSA 1AHTH 3SJKA 4TY6A 1SGQE 5JDUB 2VIOA 1XUFA 2ZGBH 2ZKSA 1MKXH 3Q3XA 3RXHA 3TNTA 3M37A 3AW0A 2XBXA 3ZYDA 1XUIA 2F91A 3TITA 1FAXA 1EZSC 2FI3E 1ID5H 2IOTA 1YCPH 1AFQC 1EB2A 3V12A 4XRNA 5EOKA 1MQ5A 3SV6A 5E0GA 2HALA 1GJBB 1XVOA 2F4LA 1CT4E 3P6ZB 1LVYA 1UVPA 1O3IA 2O8LA 2G5VA 3ZV9A 1BUIA 1O2GH 3UUZA 1WU1A 1F0UA 2ZIQH 1N8OB 1RD3B 3SGQE 4ZKRU 3DT0H 1OOKB 3SUGA 5A0CA 2BY5X 2B0FA 1W0JD 3FAOA 1NFUA 2A7CA 3P92A 2NWNA 2QF0A 1ZRBA 4CREA 5DP4A 1TMBH 1VR1H 3GY6A 2ESTE 2VVVA 1YPJH 3PV5A 2Z3CA 2Z6BD 5T6GA 1AWFH 2ZNKH 3IITA 4FU9A 2Z7FE 1IQFA 1THRH 5KGOA 2SFAA 3E90B 2B5TB 1H1BA 2SGDE 2AMDA 1ZGVA 1AKSB 3FN8A 5A2MH 1HBTH 2Q6GA 2HRVA 4NIVA 1AZZA 5DP6A 2IPHA 3GOVB 1GI8B 1S6HA 3ATKA 4YZUA 4JYUH 2BLOA 3TVJB 3A89A 1O2QA 4NGAH 4IC6A 5K7RA 1P9UA 2BVRH 5GCHF 1BCUH 1MZDA 3SU5A 4ZHAA 3RXUA 1O3OA 1P2MA 1HJAB 1FMGA 3MH5A 3VPKA 3RDZA 5EXLA 1A1RA 4D8NA 3GYMA 2W26A 1DWCH 1HIAA 4SGAE 1BHXB 3CS7A 5EXNA 2CMYA 1MBQA 1Z8GA 5DK1A 2OQUA 1IQJA 1H8ED 4OM9A 1ZZZA 4Y76A 1NFWA 1NPMA 4D7FA 1EPTA 1AVGH 1KXAA 5E0JA 2UWPA 1CHOG 3BTTE 3RU4D 1XM1A 3CNRA 3BG8A 2V0BA 4INHA 1QZ8A 2Q1JA 2RA3A 3WWBA 5E2PA 4JCNA 3MNSA 1W12U 1HAOH 1TWXB 4Y11E 2BY9X 3V7TA 3BN9A 2A2XH 3W1EA 1NRNH 4AORA 3Q77A 1C4Y2 1QB1A 1DX5M 3RXJA 1UK4A 1LPKB 1IQIA 3A80A 1U6QA 2XW9A 4AC9A 3DHKH 4X0WU 1UTPA 1O5EH 4TSFD 1O3LA 1N8OC 3RC6A 1DLKB 1H9HE 5ESTE 1GHWH 3FKSD 1Y3YA 1G30B 1GI0A 3LU9B 4JZIA 5DPAA 3A7XA 1SGFG 1KXFA 2FOFA 2PW8H 2PUQH 3EDXB 4O9VA 4P00A 5FAHA 4I86A 3SBKA 3Q3KA 1MQ6A 4O3TA 5L6NH 1GWAA 1S82A 2A4RA 1VGCB 2BD7A 3E8LA 2FOBA 1O2IA 1TX8A 4U01A 1GMCG 2OCVB 1GMHF 1GVZA 1BMLA 1BHXF 4Z0KA 2BZ6H 4HGCA 3OY6U 1C1PA 1A0LA 1G3DA 4X6PA 1O2SA 1HFDA 3AK5A 1FZZA 3ODFA 3RXEA 1TNGA 1CGHA 2BDIA 1CU1A 5E0HA 3WY8A 1LDTT 2GV7A 2NU3E 2KZ4A 3O8BA 3D49H 1PQ7A 4X1PU 2AIQA 1IAUA 2PSXA 1CO7E 2ZDNA 4YT6H 2KCYA 2ZU5A 3NUMA 4D76A 2I6SA 1CGJE 2QV1A 1GHZA 1ZOMA 1L0ZA 1FAKH 1HJAC 4LOYH 4YM9A 4IN2A 1PQAA 1TGBA 1AI8H 3UY9A 1NO9H 1O2WA 1SL3A 3ATWA 2VWOA 3F9GA 3MU5A 1LKAA 2VIQA 1MAXA 1NFXA 4B6EA 1E36B 4DY7B 5B6LA 1OX1A 3VGCB 1FV9A 1BTHH 4GAWA 2EI6A 1O5FH 5EQSA 1TNLA 1YP9A 1W8BH 3O8RA 1GHYH 1NS3A 3B9FH 1ESTA 1EXFA 1JIMA 1FY3A 1GJ7B 2R3YA 5DP3A 3U9AH 3PROA 5HM9A 4QT8C 3BTFE 1WTHD 1GBAA 1QRZA 2FEQH 1SGDE 1V2KT 3T2NA 4AN7A 1Y5AT 7ESTE 5DKMA 3HKIB 2FS8A 1P05A 3PMJA 3KEEA 1C2MA 4OS2A 1A4WH 4Y0ZE 3DSPA 4TY7A 3KQDA 2V35A 2PKSB 4D7GA 2LNCA 5DG6A 1ZYOA 4MPVA 1DICA 1C2DA 4WXVA 4D9RA 1SQRA 3UTUH 1O31A 1QIXB 1NESE 5LPEA 1NBMD 4OS4A 1OWJA 1VJ9U 3SI4H 1GBHA 1MU6B 2HGTH 1GI2A 1Y3WA 3F2GA 1KIGH 4YOJA 3FOAA 2HLCA 3UREA 1LMWB 2FYQA 1BMMH 3PWBA 3BTDE 1C5PA 3RXMA 4Z1MD 2R2MB 1GJCB 1SQTA 3LC5A 2L74A 2ZGHA 3M5LA 4GSOA 1HJ9A 2C8ZB 4XE4A 2ZZUH 4Y8XA 1G37A 1H8HD 2Y7ZA 5EIYA 2A5IA 2TGAA 3MQKC 1P04A 1JOUB 3OTPA 1FY5A 1V2LT 2H9EH 2FP7B 1GJAB 4CR9A 1GGDB 1ETRH 2RG3A 2ZPRA 3TNSA 1RIWB 3STJA 3JZ1B 5C17A 2HNTF 3RXDA 1MD8A 3GICB 4BXWA 1C5WB 5F53A 3NZIA 2OC0A 3ZZBA 3RXCA 4DJZB 1D6RA 1AUTC 1O2JA 1G3BA 5FX6A 1RGQA 1C5RA 1GI7B 5EG4A 2FODA 4ABBA 2OXSA 5FCRA 1DVAH 3H7TA 1F0TA 2Q6DA 1O36A 1T8MA 4MNVA 3ATIA 5C94A 1UTMA 1P2OA 2B7DH 1CBWC 1AWHB 4UFGH 1ORFA 4WMDA 3MI4A 4R8TB 5SGAE 2ZHDA 1MMJN 1LHDH 2G52A 3MWIU 3UOPA 2ZA5A 1P2QA 1O37A 3F2FA 1SSXA 2BOHB 3RU4T 1NROH 3GY5A 1ELTA 1ESBA 4FUHA 3BG4C 2G51A 1ARCA 1EUFA 2IJD1 4JK6A 1V2NT 2BD3A 5A09A 3S69A 1TRMA 2FM2A 2G55A 2GJGA 4ISNA 4FUCA 1G32B 2A4OA 2JH0D 4I8LA 3TH2H 5HXFA 2FTMA 2G5NA 2Z9GA 5L2YH 1HAYB 1SGCA 1SR5C 2PKSC 1OPHB 1GBLA 5FL7D 4MQAA 4K5ZA 4FXGH 2J98A 4JZEH 5L30H 5E2OA 3NK8A 1WXRA 4BTUB 2FOGA 2BLVA 3M7UA 3N7DA 3VXEH 2VH0A 3OSYA 1C2EA 1SGYE 2WYJA 1FPCH 1S84A 4UFDH 1EAWA 2QAAA 2ZECA 4CRFA 1G9IE 1VITH 2ZCLP 4MG3A 2D8WA 1TB6H 1L1GA 2LP6A 1O3GA 2HNTE 2P3UB 2XC4A 3P70B 4F49A 2TRMA 4K3JA 2PR3A 1EP5A 5CDFE 2W3KA 4ZKOU 5GJ4B 1YWUA 5C67A 4MDSA 1QRXA 2ALPA 1A0HB 1LCYA 2F9VA 2ZWLH 5C1UA 1FI8A 3SV2H 2OK5A 1NN6A 1QFKH 3PMBB 1S81A 2ZTZA 4IC5A 2JIZD 4B2AA 1RIWC 3U1IB 3E3TA 1FONA 1FY1A 2BX3A 2P3TB 4I7YH 2H9TH
chains in the Genus database with same CATH topology
2L74A 5KECA 2RDEA 4P00A 5EIYA 4XRNA 1YWUA 4I86A 3KYGA 5KEDA 3DSGA 5EJLA 4FOUC 2GJGA 4P02A 5EJZA 3CNRA 5KGOA 4RT1A 3KYFA 1YLNA 4RT0A 5EJ1A 4HG6A 4F48B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L74 A;  5KEC A;  2RDE A;  4P00 A;  5EIY A;  4XRN A;  1YWU A;  4I86 A;  3KYG A;  5KED A;  3DSG A;  5EJL A;  4FOU C;  2GJG A;  4P02 A;  5EJZ A;  3CNR A;  5KGO A;  4RT1 A;  3KYF A;  1YLN A;  4RT0 A;  5EJ1 A;  4HG6 A;  4F48 B; 
#chains in the Genus database with same CATH topology
 3TK6 A;  1C1O A;  1C1Q A;  1UCY K;  3H09 A;  4FUG A;  5TCA A;  1A3B H;  3RXF A;  3OE7 D;  3QWC H;  3GIS B;  2F9U A;  2AEI H;  1ANE A;  1OWH A;  1ELA A;  1GMC F;  1UVT H;  1TBZ H;  3MTY A;  3VB3 A;  1J9C H;  1O5D H;  2BD9 A;  5GXP A;  1QQ4 A;  5A0A E;  1A61 H;  3EA7 A;  3LIW A;  2JDI D;  4ZXX H;  2KM0 A;  1TGS Z;  4P02 A;  1MU8 B;  1EJN A;  3RXK A;  2ZDV H;  2A4Q A;  4ACB A;  1AVX A;  1EOJ A;  4RKJ B;  4AB8 A;  1VJA U;  4E06 H;  1RTF B;  4Y8Y A;  5HGG A;  4AZ2 B;  3OAA D;  3HKJ B;  1DLE A;  1T4V H;  1SGR E;  3RXA A;  3EGK H;  3PLB A;  2GVF A;  3LGY A;  2QE7 D;  3K2U A;  1Z8J B;  2NU1 E;  3SU3 A;  1BRA A;  3PTB A;  1Z1J A;  4X8S H;  2FOA A;  3TK9 A;  3ZZ4 A;  2BD4 A;  2K0Q A;  4ASH A;  1EX3 A;  2ODY B;  4Q2K A;  2DE8 A;  1AVW A;  2BDA A;  2FLR H;  1GMH G;  2AYW A;  4I8K A;  1DS2 E;  2TGT A;  4CH8 B;  4X8U H;  1A5H A;  2GZ9 A;  3PTN A;  2XC5 A;  1C5V A;  2CXV A;  1K1O A;  4X6N A;  5J4Q A;  1GCT B;  1HGT H;  5C1Y A;  3QLP H;  1MH0 A;  2AFQ B;  1AMH A;  3LGT A;  1GBF A;  4ABA A;  1MTS A;  3L3T A;  1AD8 H;  2STB E;  3UR6 A;  4ISO A;  1QL8 A;  2ZFF H;  5GPI B;  5DGJ A;  4MVN A;  2M2A A;  5T1V A;  3SGA E;  4TWY A;  3WWF A;  4AFZ A;  2FXR A;  3LC3 A;  4FOU C;  1W0Y H;  4Q7Y A;  4ABG A;  1SLU B;  1JBU H;  2FO9 A;  4FVB A;  1BRC E;  5DP8 A;  1KXE A;  1LHC H;  4BAQ B;  1QTF A;  1GJ5 H;  6LPR A;  1ZTK A;  3MU0 A;  4ABD A;  1SQA A;  2CHA B;  4AFU A;  4XDE A;  1TRN A;  2J34 A;  4X2W A;  3UIR A;  1TRY A;  1UTK A;  1B0E A;  1HAZ B;  1WQS A;  1GDU A;  1A7S A;  4ZRO A;  2K1Q A;  1PPB H;  1YGC H;  4FUB A;  3MO6 A;  3ZYE A;  3E16 B;  4ZUH A;  4Q4L A;  1SB1 H;  5HYO A;  2AHM E;  3Q76 A;  3QGN B;  4F55 A;  1C5U A;  3VFE A;  4X6M A;  3SU2 A;  4YLQ H;  1BMN H;  4M7G A;  1ZMN A;  2Z9K A;  4MTB A;  3SJI A;  1ABI H;  1Y59 T;  2QN5 T;  1UVS H;  1O5A B;  2A5K A;  2ILN A;  2J4I A;  2A7J A;  4IMZ A;  2P95 A;  1UK2 A;  4DT7 B;  4UD9 H;  1EQ9 A;  1PPC E;  4NZL A;  3MFJ A;  1HXF H;  4E05 H;  1OYT H;  1EFR D;  4WMF A;  1E1Q D;  1SLW B;  1GBJ A;  1BTP A;  1ELD E;  1QJ7 B;  1ZSJ A;  5JB9 S;  1O38 A;  3K9X B;  2GGV B;  2OQ5 A;  4I8G A;  4ABH A;  3JZ2 B;  1GHX H;  1QJ1 B;  3QUM P;  1C1U H;  1O3M A;  2ODQ A;  1DFP A;  1ETS H;  1O2N A;  4U2W A;  2XCF A;  3RP2 A;  3HGP A;  3MO3 A;  1FLE E;  2R0L A;  2TBS A;  2XWA A;  3A82 A;  2A45 B;  5E8E H;  2B9L A;  1YC0 A;  5DSF A;  2FTL E;  2ZFP H;  3HGN A;  1O3E A;  2F9B H;  1GCT C;  5FBE A;  5KEC A;  3SV9 A;  1FQ3 A;  2ZFS A;  2FDA A;  4HFP B;  2GMT C;  3SQH E;  1G3C A;  2GV6 A;  1FY4 A;  1DT2 A;  1S6L A;  3LGV A;  4F4O C;  1AZ8 A;  2QXH A;  5FBI A;  2GCT B;  3NXP A;  4K1S A;  1LVM A;  1TNI A;  2SGA A;  2BZA A;  1TA2 A;  2VVC A;  2DE9 A;  2GKV E;  2ZHE H;  3ZZ5 A;  2W7S A;  1IQE A;  1CA0 B;  4INL A;  1HPG A;  2CHA C;  5JBA S;  1SI5 H;  1HAG E;  2PWX A;  3ZVF A;  1JIR A;  4XBC A;  3P95 A;  3RC4 A;  3MNX A;  1JWT A;  2BDY A;  3MNC A;  1F0R A;  1HB0 B;  2OTV A;  1C1N A;  3TPI Z;  2F43 B;  1TA6 A;  2D2D A;  1GHA F;  1HJ8 A;  1XX9 A;  2TIO A;  1FN8 A;  2UUY A;  3A7V A;  4ZHL U;  2M5T A;  4ACA A;  2IN2 A;  1O2R A;  1QBV H;  1C9T A;  1DY9 A;  4NIW A;  4K2Y A;  3MU1 A;  4ZMA H;  3DFL A;  1LHG H;  1SGT A;  2OD3 B;  2BX4 A;  5EU8 A;  1GI4 A;  1EAI A;  3OEE D;  3PM3 A;  1C5S A;  1BTY A;  2PTC E;  2F83 A;  1XUG A;  2W5E A;  4YT7 H;  3DD2 H;  3D62 A;  1AB9 C;  3SNC A;  1WTG H;  4CHA C;  4BAO B;  4NSV A;  4YO9 A;  3FO8 D;  2KAI B;  2VIW A;  4BOH A;  4BXS A;  1Z6J H;  3OEH D;  3Q00 A;  2OUA A;  1ZHR A;  2H1U A;  1YPM H;  7LPR A;  3BV9 B;  4MNW A;  3PLP A;  1BZX E;  1EZQ A;  3C27 B;  1FNI A;  3UQO A;  1PYT C;  8GCH G;  1MTN B;  2VWM A;  5C0U A;  1YLC A;  1RXP A;  5KED A;  3GY7 A;  1Z8R A;  1VCW A;  1SOT A;  1A2C H;  2F3C E;  1GBE A;  5HIZ A;  1GG6 B;  1YF4 A;  3F9E A;  3KGP A;  5JBC S;  1O2Z A;  2Z9I A;  2CF8 H;  2C8W B;  1TOM H;  2VH6 A;  2XND D;  2ZHW H;  3GY2 A;  4IBL H;  1J8A A;  1P9S A;  3EE7 A;  1V2Q T;  2VIN A;  1D3Q B;  1O2K A;  3STI A;  3TJN A;  1TPS A;  1Y8T A;  3CP7 A;  3U8O H;  1O3H A;  5A8Y A;  4VGC B;  1IQH A;  2WPL S;  1O2V A;  1D3D B;  3PV4 A;  1LVB A;  1OP2 A;  1M9U A;  3R3G B;  5F6M A;  5GIB A;  1BJU A;  1F5L A;  1AKS A;  1AO5 A;  2WV4 A;  1QJ6 B;  3H7O A;  3RLW H;  1SBW A;  1IQN A;  1NU9 A;  3OYP A;  1GI5 A;  1IQM A;  2GCT C;  2XXL A;  5EXM A;  4AOQ A;  2ZQ1 A;  4WXI A;  3PV2 A;  4IN1 A;  1SG8 B;  2EC9 H;  1DXP A;  1P2J A;  4RT0 A;  3SUF A;  1BRB E;  1FIW A;  4TPI Z;  3UWI A;  3MH7 A;  3GDV A;  4Y79 A;  2WPJ S;  1MKW K;  1C5L H;  2RDL A;  2G8T A;  4FUF A;  2H6M A;  4GPG A;  3SJO A;  1P2K A;  1MKX K;  4OS1 A;  1C2J A;  2BY7 X;  1H8I H;  2TGD A;  2UUK B;  2V3H H;  3URC A;  5LPR A;  5LPF A;  1Z7K A;  1YPG H;  5EGM A;  2ZDL A;  1RTK A;  2W3I A;  1GPZ A;  1PYT D;  1TAL A;  1EOL A;  3SI3 H;  3A86 A;  2J2U A;  1ZHP A;  1TPO A;  5JBT A;  1GJ6 A;  1HDT H;  4E7R G;  2C8Y B;  4NA8 A;  4DW2 U;  1P8V C;  1PPE E;  3I77 A;  4KTU A;  2HVY B;  2ZC9 H;  1YCP M;  2UUJ B;  3BTQ E;  4B1T A;  1GBC A;  5EPY A;  5GDS H;  1LHF H;  1P2N A;  4K8B A;  1TBR H;  4X1R U;  1W10 U;  3ZIA D;  2YMS B;  3HK6 B;  1C4U 2;  1C5M D;  4THN H;  5HIY A;  3LON A;  5DP9 A;  4J2Y B;  3D65 E;  5FPY A;  3MO9 A;  1QA7 A;  2GT7 A;  2BHG A;  1GI9 B;  1QR3 E;  3EYD A;  2A5A A;  3A83 A;  4Q63 A;  1OP8 A;  3BSQ A;  4A1X A;  1F92 A;  4NFE A;  3FVF B;  1AQ7 A;  4H6S B;  1Z1I A;  1FXY A;  4GLY A;  2WYG A;  2BOK A;  4JZD H;  1HUT H;  1L4Z A;  4K69 A;  1K28 D;  1NT1 A;  2BD5 A;  2H5D A;  4TWW A;  1K1N A;  2J97 A;  1SGP E;  1MTN C;  4Q7X A;  2Y82 A;  3N7E A;  3TJO A;  4ISI H;  2PLX A;  2ZTY A;  2TPI Z;  2CGA A;  1KSN A;  2OBO A;  3PRD A;  1L1N A;  1W3C A;  4ASU D;  1W2K H;  2YNA A;  3F3B A;  1AE5 A;  4OS7 A;  2BDG A;  1K1L A;  4TPY A;  5A0B A;  3AW1 A;  3L33 A;  3SNB A;  1A5G H;  2HPQ H;  4AFS A;  3T62 A;  1MCV A;  1P11 E;  1O3P B;  4VGC C;  4UE7 H;  4X8V H;  2EEK A;  5FXL A;  3AAU A;  3MHW U;  1O2O A;  1O3B A;  3ZVD A;  2HPP H;  1DOJ A;  3FZD A;  1VGC C;  4WF8 A;  1O5C B;  1XXF A;  1UCY H;  4WH8 A;  3T27 A;  1N6X A;  2IPQ X;  2SNV A;  4XFQ A;  4E7N A;  3VB6 A;  3ZZ3 A;  3GY4 A;  1LHE H;  1UK3 A;  2XBY A;  2OLG A;  1CA8 B;  3U28 C;  5T6F A;  2BM2 A;  2AMP A;  2CF9 H;  1GHV H;  1TMT H;  3D23 A;  3M7T A;  4K8Y A;  2EQN A;  5IK2 D;  1BT7 A;  3VB7 A;  4ZCN A;  3V13 A;  1TGC A;  3SYJ A;  1JXP A;  4Y6D A;  1NRR H;  3BTK E;  2WZQ A;  1V2W T;  3A81 A;  4ZXY H;  2Q6F A;  8KME 2;  4AG2 A;  1ANC A;  2GD4 B;  3WW7 A;  4X1S U;  3ZVE A;  1COW D;  3FAN A;  3KQC A;  3UFA A;  4YES B;  2WPM S;  1E38 B;  2HWL B;  5GND A;  1PPH E;  2VBC A;  1KXD A;  1D6W A;  1C2L A;  1KYN A;  4CRC A;  4NFF A;  3AAS A;  3BIU H;  3B8J A;  1OS8 A;  1B5G H;  2UWL A;  1D9I A;  1FN6 A;  4I33 A;  2Z3E A;  2FIR H;  1QBO A;  1ZTJ A;  1NRS H;  1TGN A;  1BDA A;  2Y81 A;  1QHR B;  1PQ8 A;  1ZPB A;  1GJ8 B;  1J17 T;  2FOC A;  2YMS C;  4A1T A;  1QL7 A;  1GJ9 B;  4KKD A;  3RMO H;  1HAV B;  4DOQ A;  4ZKN U;  2F9N A;  2WIN I;  3SU1 A;  2C90 B;  3VGC C;  4RI0 A;  2J94 A;  1OSS A;  3I78 A;  3BTW E;  4MLF B;  1HXE H;  2H5C A;  2WUC A;  1FUJ A;  1BIO A;  2ZU1 A;  1RJX B;  1J16 A;  1UHB B;  1T7C A;  4X1N U;  1C2K A;  2KX4 A;  3PWC A;  1V2T T;  2FOE A;  2ZHQ H;  1GMD F;  1UTL M;  2PTN A;  2HNT C;  2WV9 A;  2AGG X;  1EAT A;  1CVW H;  5JPM H;  2QCY A;  1QB9 A;  3E91 A;  2QXI A;  5EQR A;  4A1V A;  3IG6 B;  1FJS A;  1TON A;  3RXQ A;  2YNB A;  1TPP A;  4NCY A;  5LH8 A;  8EST E;  2XNI A;  1TBQ H;  4K1E A;  1HLT H;  1K9O E;  2Z9J A;  5IDK A;  3TJU A;  5AVD A;  1ETT H;  2FOM B;  3NCL A;  1W7X H;  2KCP A;  2JH6 D;  3A8A A;  1A3E H;  1FY8 E;  4WJG 2;  2GDE H;  4ISL A;  4KP0 A;  2FWW A;  3ZZC A;  1V2U T;  2BXU H;  4ISH H;  3ATL A;  1QGF A;  4WWY A;  5EJL A;  1DXW A;  3E0N B;  3LGU A;  2ZDK A;  3P8F A;  3A85 A;  4O03 A;  1THP B;  1GHB F;  1THS H;  4K1T A;  3BEU A;  2BQ7 B;  2OIN A;  2YMS D;  2EY4 C;  8GCH F;  1ZPZ A;  3U69 H;  3BIV H;  5A8X A;  5JB8 S;  1GHA G;  2ZFR H;  1Z71 A;  3PB1 E;  1CGI E;  3EQ0 H;  2FS9 A;  3K65 B;  3QN7 A;  1XUJ A;  3SO3 A;  4DG4 A;  1ZGI A;  1YPH E;  2QXG A;  1E79 D;  1LQE A;  1O3C A;  5I25 A;  2G4T A;  1P57 B;  1BIT A;  1DIT H;  1NFY A;  1ELC A;  3RMN H;  1KTS B;  1LO6 A;  1TIO A;  3RXO A;  1W7G H;  4XD7 D;  1DE7 H;  2A0Q B;  5EJZ A;  3RMM H;  4H42 U;  1GGD C;  4RT1 A;  1UVU H;  1BBR E;  4O97 A;  2C8X B;  1ELG A;  3GYL B;  1TFX A;  2VIP A;  4BAN B;  4KTS A;  1KXC A;  1Q31 A;  1O30 A;  1RTL A;  1TX6 A;  2SGF E;  2W6J D;  2RDE A;  3BF6 H;  5DJ7 A;  1H9L B;  1UW7 A;  1SMF E;  3Q3Y A;  4CBO A;  1T4U H;  1WQV H;  3M3V A;  1CQQ A;  3E1X B;  1HCG A;  4MPX A;  4NWK A;  3UNR A;  3DUX H;  3VB4 A;  2SGP E;  3N7O A;  3C1K A;  1FIZ A;  3L6P A;  1D4P B;  1SGF A;  1AN1 E;  4SGB E;  3P17 H;  1JMO H;  4F48 B;  2ZGC A;  3ZZA A;  1UJ1 A;  1UTJ A;  4LZ1 H;  3ATM A;  4A5T S;  1NRP H;  3SZE A;  1V2P T;  3M35 A;  4WH6 A;  5DP5 A;  3SQE E;  3SHA H;  1O2Y A;  1C1R A;  4JYT A;  1DUA A;  1C5X B;  2VNT A;  1MAB B;  1EKB B;  1O39 A;  3LGI A;  3T28 A;  3QX5 H;  3K6Y A;  2ZI2 H;  3A88 A;  1WYK A;  1TE0 A;  5K0H A;  2JKH A;  1NC6 A;  1SGN E;  1J15 A;  2VB0 A;  7GCH G;  1K0H A;  1SOZ A;  2F9O A;  3MH6 A;  2AH4 X;  2QF3 A;  2F9P A;  2QGR A;  2BY8 X;  5ESB A;  5IYT A;  3LGW A;  3P8O A;  4CBN A;  2BD2 A;  1PFX C;  2ZCK P;  3QTV H;  2P94 A;  5C3N A;  2A7H A;  1ABJ H;  3GY3 A;  2J95 A;  2O8T A;  1IHS H;  4B2B A;  2G4U A;  4HG6 A;  3S7K B;  2GP9 B;  2OC1 A;  3TLO A;  1MAY A;  5PTP A;  9EST A;  1GL1 A;  1YPL H;  1YM0 A;  2Y7X A;  1TNJ A;  5CHA B;  1AU8 A;  3LH1 A;  1Z8I B;  3RLY H;  1NM6 A;  1ELE E;  5I46 H;  4IS5 A;  1EJA A;  1TNK A;  4BAM B;  1TAB E;  1TGT A;  4D9Q A;  4XSK U;  3ZZ6 A;  2QYI A;  2P59 A;  1BB0 B;  4AG1 A;  4CRG A;  1XVM A;  4JK5 A;  2BVS H;  1GJD B;  3QZR A;  1S83 A;  4BAH B;  1DWD H;  3KHV A;  3NRL A;  1XKA C;  2O9Q A;  2OP9 A;  3I29 A;  4GVU A;  3TIU A;  3KQ5 A;  4AYY B;  4JYV H;  3CS0 A;  1S85 A;  1OWE A;  5ETX A;  2PFE A;  1O3J A;  4NWL A;  1C5O H;  1V2J T;  1OXG A;  1WV7 H;  1E0F D;  1OWD A;  5FHT A;  1BTZ A;  3KN2 A;  3TU7 H;  1GBT A;  1LKB A;  1H4W A;  1O3F A;  5FPT A;  3SJ9 A;  4Q80 A;  1WCZ A;  1DPO A;  1HAP H;  3LJO A;  1QA0 A;  3SV7 A;  2QA9 E;  1MD7 A;  3DFJ A;  8LPR A;  4B75 A;  3CEN A;  3EA9 A;  3EAJ A;  3F0O A;  2O8W A;  2LEL A;  3FP8 E;  4KGA A;  4X8T H;  2Y80 A;  4X2Y A;  3UR9 A;  2BB4 A;  3S9C A;  3SOR A;  1TQ0 B;  2BQ6 B;  3QO6 A;  2AS9 A;  3F0P A;  5H4I B;  2NU0 E;  4CRB A;  3GCT F;  3BEF B;  1ZRK A;  1AFE H;  3PMH B;  4K60 A;  5FX5 A;  1EJM A;  1SGI B;  1QUR H;  2ANW A;  1ELV A;  1MUE B;  2BDB A;  2D26 C;  5F03 A;  1CE5 A;  4OS5 A;  1S5S A;  2G00 A;  2XBW A;  1W11 U;  4ZHM U;  1FPH H;  2GT8 A;  1O2T A;  3G01 A;  4UON A;  4FUE A;  2BDH A;  4OGX A;  1O34 A;  3W95 A;  2Y6T A;  1W0Z U;  1MKW H;  3ZV8 A;  1JRT A;  2QXJ A;  3SHC H;  3PO1 B;  3KYF A;  2JH5 D;  3A7Z A;  1QNJ A;  2BMG B;  1ELF A;  1EPT B;  1YY3 A;  4JMY A;  3T25 A;  3FP7 E;  1Z6E A;  5AF9 H;  1UTQ A;  4CRD A;  1HAI H;  4YXW D;  5CHA C;  1O35 A;  1GBD A;  1P09 A;  4LZ4 B;  4HTC H;  2WPI S;  1H9I E;  3QDZ B;  1UMA H;  1Y5U T;  4GCH G;  1V2V T;  4FUD A;  1T32 A;  6GCH G;  3NKK A;  5CMX H;  1SVP A;  1ZML A;  1PQ5 A;  1DWB H;  1L1J A;  3NPS A;  1BJV A;  4HZH A;  1TLD A;  2FYR A;  4ZAE A;  1C1S A;  4X6O A;  4KEL A;  4X1Q U;  1N1L A;  4Y0Y E;  1C1T A;  2WPK S;  1YKT A;  2A2Q H;  3QTO H;  3OY5 U;  3T29 A;  4B76 A;  2JET B;  2WPD D;  1S0R A;  1WDI A;  2FX6 A;  3EE0 B;  3SOS A;  1K21 H;  1XKB C;  4ABI A;  1AE8 H;  3PRB A;  1GMD G;  3TGK E;  1C9P A;  2FOH A;  1AUJ A;  1QL9 A;  2ZEB A;  3BEI B;  4Y7B A;  3RXS A;  3T26 A;  1EB1 H;  3A8D A;  1LVO A;  2W7U A;  2VGC B;  5EOD A;  1TOC B;  3RML H;  4IW4 E;  2I6Q A;  5BPE A;  4AYV B;  2GZ7 A;  4DIH H;  2FZZ A;  2HOB A;  4FUJ A;  1ACB E;  2CV3 A;  1S0Q A;  2PKA B;  3B23 B;  1Y3X A;  4NSY A;  2WPH S;  3ENS B;  2RA0 A;  5CE1 A;  3MH4 A;  3M7Q A;  5J4S A;  3ZZ9 A;  2ZHF H;  1XUK A;  2XOK D;  3U98 H;  1KLT A;  1GHB G;  2NU2 E;  4B6F A;  5F8Z A;  3RU4 E;  1O2U A;  4KTC A;  3S9A A;  2O8U A;  3TGI E;  1SHH B;  2J38 A;  3QZQ A;  2DUC A;  2AGE X;  3A7W A;  3OX7 U;  3M5O A;  4NA9 H;  4EST E;  1BBR K;  1ZMJ A;  3NWU A;  3F6U H;  2ZDA H;  1P02 A;  1F5R A;  4A7I B;  4AFQ A;  3PO1 C;  2A32 A;  2AGI X;  1UCY E;  1QY6 A;  2QF4 A;  5C0T A;  1HNE E;  3O8D A;  5DO4 H;  1O2L A;  1EPT C;  3LOX A;  1ELB A;  2P8O B;  4ABJ A;  2ULL A;  2EA3 A;  1UO6 A;  2ANY A;  1BMF D;  1QRW A;  2FMJ A;  2FES H;  1T31 A;  2SNW A;  7KME H;  7GCH F;  1ZPC A;  1C2H A;  1RFN A;  2AMQ A;  4ABE A;  3E6P H;  4YOI A;  2R3U A;  3RXG A;  1O33 A;  1P0S H;  2ZGJ A;  3VEQ B;  2BLW A;  1LPZ B;  5JBB S;  1VIT F;  2XBV A;  3LKW A;  3A8C A;  2GCH F;  4RSP A;  3U1J B;  1A46 H;  2B8O H;  3ZVG A;  4DVA U;  3P8N A;  4UEH H;  1CA0 C;  1TMU H;  1JRS A;  1IOE A;  5TCC A;  1V2S T;  3OFN D;  1E1R D;  2OC8 A;  4R0I A;  5L2Z H;  1ANB A;  1YCP K;  3UB0 A;  1C2I A;  1KTT B;  2JET C;  2VU8 E;  1SFI A;  4OS6 A;  3GY8 A;  5BRR E;  2J9N A;  3ODD A;  3SUD A;  5B6O A;  3A7Y A;  1OWK A;  1P03 A;  1HAX B;  2PUX B;  1WOF A;  1OHH D;  3N99 A;  4M9F A;  1PPF E;  1NY2 2;  3MU4 A;  2ZFT A;  4DUR A;  3PLK A;  1VCP A;  1MTW A;  2G81 E;  2V3M A;  1F5K U;  2VGC C;  1O5G H;  4ZKS U;  1ZSL A;  1GBM A;  2PKA A;  2KAI A;  2ASU B;  1HYL A;  3AAV A;  1DUE A;  2XTT B;  2A1D B;  2EI8 A;  2PGB B;  5CHB A;  3BTE E;  1TPA E;  3RXR A;  4NG9 H;  3UPE A;  4I31 A;  3ELA H;  2ZGX H;  1LQD B;  1TQ7 B;  1CSO E;  2FLB H;  1SLV B;  2BY6 X;  3SW2 B;  1INC A;  1Y5B T;  3M3S A;  2KCA A;  3RXV A;  1TNH A;  2SGQ E;  2C4F H;  1G3E A;  2FI4 E;  2BQW B;  1KY9 A;  4X2X A;  2EI7 A;  1C2F A;  3BTG E;  2VIV A;  3MYW A;  1D3T B;  4ZH8 A;  1T8O A;  5EPN A;  1BTU A;  1CBW B;  1DDJ A;  2BD8 A;  2PV9 B;  4BTI B;  3F9F A;  3M5M A;  2BTC E;  5HKK D;  2ZDM A;  3M5N A;  1WUN H;  1GG6 C;  1AY6 H;  2ANK H;  2IJO B;  2PP6 A;  2V6N A;  1V2M T;  5DN6 D;  1K22 H;  1EAX A;  2J92 A;  3GS9 A;  1QBN A;  3U8T H;  1C1W H;  1BQY A;  3BG4 B;  2ODP A;  3SN8 A;  2PHB A;  1GDQ A;  1YPK H;  1NRQ H;  1P2I A;  2P8O C;  3S9B A;  5C5N A;  3HAT H;  3KID U;  3BTM E;  1O32 A;  5EW1 H;  3KNX A;  5JYI A;  5C20 A;  6CHA B;  4RKO B;  1O3A A;  3S7H B;  1F0S A;  2HVX A;  4YTA A;  1NBM E;  4AGJ A;  4BTT B;  3ZZ7 A;  1MBM A;  4Y7A A;  5EJ1 A;  1WBG B;  2BVX H;  2BDC A;  3O8C A;  1HRT H;  3PMA B;  1BMA A;  3RXT A;  1P01 A;  1LPG B;  3FP6 E;  4NA7 A;  3SNA A;  1E35 B;  1J14 A;  1MCT A;  4DCD A;  1V3X A;  2VWL A;  3F1S B;  3MOC A;  2BLQ A;  1V2R T;  1ZJD A;  3UAI C;  1YYY 1;  4DII H;  2ZP0 H;  3A7T A;  3KYG A;  2RFK C;  1EAS A;  2J5U A;  2XYA A;  3E0P B;  1IHT H;  3IWM A;  4UFE H;  2P3F H;  2ZG0 H;  5T3H A;  2J98 B;  3LJJ A;  4XBB A;  1CHG A;  4A6L A;  3SV8 A;  1LTO A;  5ABW A;  3SNE A;  1ARB A;  3URD A;  1BRU P;  3ZZ8 A;  1DWE H;  3MU8 A;  3EA8 A;  1SGE E;  3UQV A;  3UNQ A;  2ZPS A;  4TYD A;  6EST A;  3DCL A;  4HI3 A;  2P93 A;  4BNR A;  4GCH F;  1GJ4 H;  4NIY A;  2V7Q D;  1G2L A;  6GCH F;  3MMG A;  1KLI H;  4CR5 A;  2CK3 D;  4B71 A;  1ZR0 A;  3QK1 A;  3RC5 A;  2UUF B;  3GCT G;  3KF2 A;  3GCH B;  1DM4 B;  2QY0 B;  2AIP A;  2QC2 A;  2RCE A;  3GCO A;  4YLU A;  3BTH E;  1Q3X A;  5T6D A;  1YLD A;  1Y3V A;  4FVD A;  4J1Y A;  4GHQ A;  4LK4 A;  3HK3 B;  5C1X A;  1KMH B;  1V6D A;  5FPS A;  3SND A;  1C4V 2;  5EQQ A;  1RRK A;  1O0D H;  3QGJ A;  4RN6 A;  2WV5 A;  3F2H A;  1A5I A;  3M61 U;  1BTW A;  1XUH A;  1F2S E;  5A8Z A;  2H9H A;  1VZQ H;  3TGJ E;  4AX9 H;  1YPH C;  2FX4 A;  4WME A;  1VKY A;  3OTJ E;  4UDW H;  3TH4 H;  2ALV A;  2CN0 H;  1B0F A;  1KXB A;  3ZVA A;  1O2P A;  4LXB H;  1K2I 1;  2W6I D;  1AGJ A;  1EAU A;  2VVU A;  3LH3 A;  3VB5 A;  4AB9 A;  1W13 U;  3RXI A;  1QQU A;  1GL0 E;  5HMA A;  2XRC A;  3SGB E;  1E34 B;  3SU6 A;  1ZJK A;  2TGP Z;  2XCN A;  1ZSK A;  3OU0 A;  4JZF H;  1HAH H;  1YPE H;  2Y5F A;  5LGO A;  4O3U A;  1GBI A;  2ZFQ H;  1TX7 A;  1O2M A;  3RM2 H;  5HM2 A;  1WSS H;  4A92 A;  1L2E A;  6CHA C;  4NIX A;  2Y5H A;  4MPU A;  5AFZ H;  4DT4 A;  1OKX A;  3PYH A;  1TAW A;  2ZU3 A;  2Z94 A;  2H2Z A;  1DY8 A;  1P12 E;  2XWB I;  1OP0 A;  3FFG A;  3ITI A;  3K6Z A;  1GI3 A;  3A87 A;  4CH2 B;  1O2X A;  1DST A;  5F8X A;  1O3D A;  1CHO F;  1SKY E;  2ZQ2 A;  4Z6A H;  2GX4 A;  1GI6 A;  3GDU A;  1C1M A;  3SJ8 A;  4CRA A;  1QB6 A;  2BYA X;  1GVL A;  1AND A;  3VXF H;  4DGJ A;  1IQK A;  1GBK A;  3R0F A;  4Y71 A;  1N6Y A;  1NTP A;  1BTX A;  3KCG H;  5GCH G;  2BXT H;  2CJI A;  1OYQ A;  1P3C A;  2D1J A;  2XC0 A;  1MTU A;  5C5O A;  5C2Z A;  3KQB A;  2KR7 A;  1C1V H;  1HAV A;  1KDQ B;  2KCO A;  4AGK A;  4NZQ A;  2VJ1 A;  1NZQ H;  3DA9 B;  1PPG E;  4B74 A;  1KLJ H;  1G36 A;  4U32 A;  1OWI A;  3HPT B;  3GCH C;  3H5C B;  1UHB A;  1P06 A;  1DSU A;  4XBD A;  2NU4 E;  3LT3 A;  1T8L A;  1ZTL A;  2C93 B;  1NU7 B;  4I32 A;  2YOL A;  2QIQ A;  1SPJ A;  1X7A C;  1IQL A;  1EZU C;  2Z3D A;  2SGE E;  5F8T A;  2THF B;  3FZZ A;  1ZHM A;  3RXL A;  2FI5 E;  2R0K A;  4MNX A;  1C5T A;  3U8R H;  2R2W U;  1P3E A;  3UWJ H;  2P16 A;  4B2C A;  2VWN A;  4BAK B;  1DAN H;  3F68 H;  1E37 B;  3RXP A;  1C5Y B;  2OBQ A;  1SC8 U;  2OC7 A;  3V0X A;  3A8B A;  1GDN A;  4Q7Z A;  1C2G A;  3TJV A;  1QCP A;  1UVO A;  5AFY H;  3RXB A;  3S0N A;  1A0J A;  1VIT G;  4Y10 E;  2GCH G;  9LPR A;  5FCK A;  1CT2 E;  2LPR A;  1O3K A;  1V2O T;  1W0K D;  1EZX C;  2Z9L A;  1MZA A;  4FU7 A;  1GCD A;  4H6T A;  3ZVC A;  1G2M A;  1HV7 A;  4FUI A;  1Y3U A;  2STA E;  4WVP E;  3V3M A;  2JJ2 D;  1AFQ B;  2WHX A;  1SQO A;  4I8J A;  4INK A;  4H4F A;  3T5F H;  5TJX A;  1SFQ B;  4GHT A;  1C5Z B;  3LPR A;  2VID A;  3GCN A;  2WSS D;  3SUE A;  2ZCH P;  3RM0 H;  1T8N A;  1YBW A;  2AER H;  3A84 A;  1ESA A;  2ZU4 A;  1EP6 A;  1KDQ A;  3UOU A;  2R9P A;  3SU4 A;  1VCQ A;  3EST A;  1O3N A;  4UFF H;  3ZVB A;  2K8I A;  4TT3 D;  1SLX B;  2GMT B;  4U30 A;  4GUX A;  1UTN A;  2HLD D;  5GWZ A;  1RS0 A;  1AIX H;  2O8M A;  1XMN B;  1WAY B;  2GDD A;  2UWO A;  3DSG A;  3KL6 A;  2GTB A;  1K1J A;  1UTO A;  3ZZD A;  1L4D A;  2ZF0 H;  4FET A;  4ABF A;  2ANM H;  2FPZ A;  3M3T A;  4JZ1 A;  4WY3 A;  1FDP A;  3AVZ A;  1YLN A;  3TK5 A;  1W14 U;  1PJP A;  4MNY A;  1P10 A;  1D3P B;  3VG8 A;  3M36 A;  2C3S A;  5EW2 H;  1SHY A;  1CT0 E;  1GI1 A;  1B7X B;  5DP7 A;  3F9H A;  4Y8Z A;  1IQG A;  1BBR H;  4MPW A;  1K1M A;  1O2H A;  1GVK B;  4XOJ A;  3SZN A;  2A31 A;  5G4B A;  1S6F A;  1C5Q A;  3TH3 H;  1PPZ A;  2A4G A;  2WUB A;  2ZO3 H;  4X2V A;  1MTV A;  2ZPQ A;  4I8H A;  1ZLR A;  2L6O A;  3MNB A;  2V3O H;  1XXD A;  4OGY A;  1O5B B;  3DSO A;  4PRO A;  2PGQ B;  1K1I A;  4IGD A;  3RUO A;  2GZ8 A;  1BA8 B;  4YOG A;  3W94 A;  4B73 A;  3LDX H;  4FU8 A;  3P8G A;  2Y5G A;  1AB9 B;  1H8D H;  1C5N H;  1FX0 B;  2PSY A;  2JJ1 D;  4IMQ A;  4CHA B;  5AHG H;  1Q2W A;  2QF5 A;  1F7Z A;  1HIA B;  3UNS A;  1BOQ A;  2KFW A;  1K1P A;  2ZTX A;  2ZU2 A;  3SU0 A;  1GBB A;  3KQE A;  1TYN A;  3GDS A;  1AHT H;  3SJK A;  4TY6 A;  1SGQ E;  5JDU B;  2VIO A;  1XUF A;  2ZGB H;  2ZKS A;  1MKX H;  3Q3X A;  3RXH A;  3TNT A;  3M37 A;  3AW0 A;  2XBX A;  3ZYD A;  1XUI A;  2F91 A;  3TIT A;  1FAX A;  1EZS C;  2FI3 E;  1ID5 H;  2IOT A;  1YCP H;  1AFQ C;  1EB2 A;  3V12 A;  4XRN A;  5EOK A;  1MQ5 A;  3SV6 A;  5E0G A;  2HAL A;  1GJB B;  1XVO A;  2F4L A;  1CT4 E;  3P6Z B;  1LVY A;  1UVP A;  1O3I A;  2O8L A;  2G5V A;  3ZV9 A;  1BUI A;  1O2G H;  3UUZ A;  1WU1 A;  1F0U A;  2ZIQ H;  1N8O B;  1RD3 B;  3SGQ E;  4ZKR U;  3DT0 H;  1OOK B;  3SUG A;  5A0C A;  2BY5 X;  2B0F A;  1W0J D;  3FAO A;  1NFU A;  2A7C A;  3P92 A;  2NWN A;  2QF0 A;  1ZRB A;  4CRE A;  5DP4 A;  1TMB H;  1VR1 H;  3GY6 A;  2EST E;  2VVV A;  1YPJ H;  3PV5 A;  2Z3C A;  2Z6B D;  5T6G A;  1AWF H;  2ZNK H;  3IIT A;  4FU9 A;  2Z7F E;  1IQF A;  1THR H;  5KGO A;  2SFA A;  3E90 B;  2B5T B;  1H1B A;  2SGD E;  2AMD A;  1ZGV A;  1AKS B;  3FN8 A;  5A2M H;  1HBT H;  2Q6G A;  2HRV A;  4NIV A;  1AZZ A;  5DP6 A;  2IPH A;  3GOV B;  1GI8 B;  1S6H A;  3ATK A;  4YZU A;  4JYU H;  2BLO A;  3TVJ B;  3A89 A;  1O2Q A;  4NGA H;  4IC6 A;  5K7R A;  1P9U A;  2BVR H;  5GCH F;  1BCU H;  1MZD A;  3SU5 A;  4ZHA A;  3RXU A;  1O3O A;  1P2M A;  1HJA B;  1FMG A;  3MH5 A;  3VPK A;  3RDZ A;  5EXL A;  1A1R A;  4D8N A;  3GYM A;  2W26 A;  1DWC H;  1HIA A;  4SGA E;  1BHX B;  3CS7 A;  5EXN A;  2CMY A;  1MBQ A;  1Z8G A;  5DK1 A;  2OQU A;  1IQJ A;  1H8E D;  4OM9 A;  1ZZZ A;  4Y76 A;  1NFW A;  1NPM A;  4D7F A;  1EPT A;  1AVG H;  1KXA A;  5E0J A;  2UWP A;  1CHO G;  3BTT E;  3RU4 D;  1XM1 A;  3CNR A;  3BG8 A;  2V0B A;  4INH A;  1QZ8 A;  2Q1J A;  2RA3 A;  3WWB A;  5E2P A;  4JCN A;  3MNS A;  1W12 U;  1HAO H;  1TWX B;  4Y11 E;  2BY9 X;  3V7T A;  3BN9 A;  2A2X H;  3W1E A;  1NRN H;  4AOR A;  3Q77 A;  1C4Y 2;  1QB1 A;  1DX5 M;  3RXJ A;  1UK4 A;  1LPK B;  1IQI A;  3A80 A;  1U6Q A;  2XW9 A;  4AC9 A;  3DHK H;  4X0W U;  1UTP A;  1O5E H;  4TSF D;  1O3L A;  1N8O C;  3RC6 A;  1DLK B;  1H9H E;  5EST E;  1GHW H;  3FKS D;  1Y3Y A;  1G30 B;  1GI0 A;  3LU9 B;  4JZI A;  5DPA A;  3A7X A;  1SGF G;  1KXF A;  2FOF A;  2PW8 H;  2PUQ H;  3EDX B;  4O9V A;  4P00 A;  5FAH A;  4I86 A;  3SBK A;  3Q3K A;  1MQ6 A;  4O3T A;  5L6N H;  1GWA A;  1S82 A;  2A4R A;  1VGC B;  2BD7 A;  3E8L A;  2FOB A;  1O2I A;  1TX8 A;  4U01 A;  1GMC G;  2OCV B;  1GMH F;  1GVZ A;  1BML A;  1BHX F;  4Z0K A;  2BZ6 H;  4HGC A;  3OY6 U;  1C1P A;  1A0L A;  1G3D A;  4X6P A;  1O2S A;  1HFD A;  3AK5 A;  1FZZ A;  3ODF A;  3RXE A;  1TNG A;  1CGH A;  2BDI A;  1CU1 A;  5E0H A;  3WY8 A;  1LDT T;  2GV7 A;  2NU3 E;  2KZ4 A;  3O8B A;  3D49 H;  1PQ7 A;  4X1P U;  2AIQ A;  1IAU A;  2PSX A;  1CO7 E;  2ZDN A;  4YT6 H;  2KCY A;  2ZU5 A;  3NUM A;  4D76 A;  2I6S A;  1CGJ E;  2QV1 A;  1GHZ A;  1ZOM A;  1L0Z A;  1FAK H;  1HJA C;  4LOY H;  4YM9 A;  4IN2 A;  1PQA A;  1TGB A;  1AI8 H;  3UY9 A;  1NO9 H;  1O2W A;  1SL3 A;  3ATW A;  2VWO A;  3F9G A;  3MU5 A;  1LKA A;  2VIQ A;  1MAX A;  1NFX A;  4B6E A;  1E36 B;  4DY7 B;  5B6L A;  1OX1 A;  3VGC B;  1FV9 A;  1BTH H;  4GAW A;  2EI6 A;  1O5F H;  5EQS A;  1TNL A;  1YP9 A;  1W8B H;  3O8R A;  1GHY H;  1NS3 A;  3B9F H;  1EST A;  1EXF A;  1JIM A;  1FY3 A;  1GJ7 B;  2R3Y A;  5DP3 A;  3U9A H;  3PRO A;  5HM9 A;  4QT8 C;  3BTF E;  1WTH D;  1GBA A;  1QRZ A;  2FEQ H;  1SGD E;  1V2K T;  3T2N A;  4AN7 A;  1Y5A T;  7EST E;  5DKM A;  3HKI B;  2FS8 A;  1P05 A;  3PMJ A;  3KEE A;  1C2M A;  4OS2 A;  1A4W H;  4Y0Z E;  3DSP A;  4TY7 A;  3KQD A;  2V35 A;  2PKS B;  4D7G A;  2LNC A;  5DG6 A;  1ZYO A;  4MPV A;  1DIC A;  1C2D A;  4WXV A;  4D9R A;  1SQR A;  3UTU H;  1O31 A;  1QIX B;  1NES E;  5LPE A;  1NBM D;  4OS4 A;  1OWJ A;  1VJ9 U;  3SI4 H;  1GBH A;  1MU6 B;  2HGT H;  1GI2 A;  1Y3W A;  3F2G A;  1KIG H;  4YOJ A;  3FOA A;  2HLC A;  3URE A;  1LMW B;  2FYQ A;  1BMM H;  3PWB A;  3BTD E;  1C5P A;  3RXM A;  4Z1M D;  2R2M B;  1GJC B;  1SQT A;  3LC5 A;  2L74 A;  2ZGH A;  3M5L A;  4GSO A;  1HJ9 A;  2C8Z B;  4XE4 A;  2ZZU H;  4Y8X A;  1G37 A;  1H8H D;  2Y7Z A;  5EIY A;  2A5I A;  2TGA A;  3MQK C;  1P04 A;  1JOU B;  3OTP A;  1FY5 A;  1V2L T;  2H9E H;  2FP7 B;  1GJA B;  4CR9 A;  1GGD B;  1ETR H;  2RG3 A;  2ZPR A;  3TNS A;  1RIW B;  3STJ A;  3JZ1 B;  5C17 A;  2HNT F;  3RXD A;  1MD8 A;  3GIC B;  4BXW A;  1C5W B;  5F53 A;  3NZI A;  2OC0 A;  3ZZB A;  3RXC A;  4DJZ B;  1D6R A;  1AUT C;  1O2J A;  1G3B A;  5FX6 A;  1RGQ A;  1C5R A;  1GI7 B;  5EG4 A;  2FOD A;  4ABB A;  2OXS A;  5FCR A;  1DVA H;  3H7T A;  1F0T A;  2Q6D A;  1O36 A;  1T8M A;  4MNV A;  3ATI A;  5C94 A;  1UTM A;  1P2O A;  2B7D H;  1CBW C;  1AWH B;  4UFG H;  1ORF A;  4WMD A;  3MI4 A;  4R8T B;  5SGA E;  2ZHD A;  1MMJ N;  1LHD H;  2G52 A;  3MWI U;  3UOP A;  2ZA5 A;  1P2Q A;  1O37 A;  3F2F A;  1SSX A;  2BOH B;  3RU4 T;  1NRO H;  3GY5 A;  1ELT A;  1ESB A;  4FUH A;  3BG4 C;  2G51 A;  1ARC A;  1EUF A;  2IJD 1;  4JK6 A;  1V2N T;  2BD3 A;  5A09 A;  3S69 A;  1TRM A;  2FM2 A;  2G55 A;  2GJG A;  4ISN A;  4FUC A;  1G32 B;  2A4O A;  2JH0 D;  4I8L A;  3TH2 H;  5HXF A;  2FTM A;  2G5N A;  2Z9G A;  5L2Y H;  1HAY B;  1SGC A;  1SR5 C;  2PKS C;  1OPH B;  1GBL A;  5FL7 D;  4MQA A;  4K5Z A;  4FXG H;  2J98 A;  4JZE H;  5L30 H;  5E2O A;  3NK8 A;  1WXR A;  4BTU B;  2FOG A;  2BLV A;  3M7U A;  3N7D A;  3VXE H;  2VH0 A;  3OSY A;  1C2E A;  1SGY E;  2WYJ A;  1FPC H;  1S84 A;  4UFD H;  1EAW A;  2QAA A;  2ZEC A;  4CRF A;  1G9I E;  1VIT H;  2ZCL P;  4MG3 A;  2D8W A;  1TB6 H;  1L1G A;  2LP6 A;  1O3G A;  2HNT E;  2P3U B;  2XC4 A;  3P70 B;  4F49 A;  2TRM A;  4K3J A;  2PR3 A;  1EP5 A;  5CDF E;  2W3K A;  4ZKO U;  5GJ4 B;  1YWU A;  5C67 A;  4MDS A;  1QRX A;  2ALP A;  1A0H B;  1LCY A;  2F9V A;  2ZWL H;  5C1U A;  1FI8 A;  3SV2 H;  2OK5 A;  1NN6 A;  1QFK H;  3PMB B;  1S81 A;  2ZTZ A;  4IC5 A;  2JIZ D;  4B2A A;  1RIW C;  3U1I B;  3E3T A;  1FON A;  1FY1 A;  2BX3 A;  2P3T B;  4I7Y H;  2H9T H; 
#chains in the Genus database with same CATH homology
 2L74 A;  5KEC A;  2RDE A;  4P00 A;  5EIY A;  4XRN A;  1YWU A;  4I86 A;  3KYG A;  5KED A;  3DSG A;  5EJL A;  4FOU C;  2GJG A;  4P02 A;  5EJZ A;  3CNR A;  5KGO A;  4RT1 A;  3KYF A;  1YLN A;  4RT0 A;  5EJ1 A;  4HG6 A;  4F48 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...