3DSZA

Engineered human lipocalin 2 in complex with y-dtpa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
172
Chain Sequence
LIPAPPLSKVPLQQNFQDNQFHGKWYQVGRAGNAALREDKDPQKMTAQIYELKEDKSYNVTAVRFRKKKCDYLTMTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFSITLLGRTKELASELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords engineered human lipocalin 2
publication title High-affinity recognition of lanthanide(III) chelate complexes by a reprogrammed human lipocalin 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 40
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3dszA00
4BQUA 1U17A 1KXOA 1FE3A 2RA6A 3TZSA 3FR4A 3WJCA 1QQSA 1LKEA 1AELA 2AT3X 5EEDA 3DSZA 4R0BA 4I3DA 5BVSA 1GT1A 3UEUA 3VG6A 5DPQA 1TOWA 2AH7X 1B0OA 3S26A 3L4RA 4OMWA 2K23A 2FLJA 4KIIA 4ES7A 3JS1A 4ZH9A 5L8IA 2XKLA 3CMPA 5H9LA 3KFGA 4HPBA 1AVGI 2CBSA 1DZJA 4NYQA 4GH7A 3TGAA 4CK4A 1OBUA 3NX2A 4ALBA 3PEDA 4MVIA 2A0AA 4DQ4A 1QABE 2CZUA 2R56A 2HNXA 4UU3A 4XMDA 4YH0A 4WFUA 2N93A 2CM4A 5B27A 1KZWA 4GNWA 5HA1A 3FW4A 4UU2A 5D4AA 3TGBA 1YP7A 4QZUA 1NGLA 4Y0QA 5LKFA 1CJ5A 3CBSA 4OMXA 1TXLA 1PMPA 3NQ9A 3P6EA 2KT4B 4NNSA 3BRNA 4YDBA 1DF3A 5HCDC 3FA9A 3BX7A 3FEPA 2LB6A 2AKQA 3VG4A 3HWGA 4A60A 4YCHA 1I05A 1EPAA 2CM9A 1S7DA 4AZMA 3C76X 2Q9SA 3QKGA 5JR8A 1IKEA 1DZKA 2FT9A 5EDCA 5HZ5A 5LJKA 4IB6A 4YGHA 1N0SA 5L8NA 1X71A 1BEBA 5FFHA 5H9KA 2FTBA 5HTEA 5D45A 3NQ3A 3VG3A 4MVLA 2L68A 2PY1A 1HBQA 1S44A 1PEEA 3BS2A 2L67A 2R73A 1A57A 3FELA 1KT7A 3BSZE 2MJIA 1GX8A 3HWEA 2YG2A 1I04A 2HZRA 4DQ3A 3ZQ3A 3FIQA 2LBVA 4YDAA 4HPDA 4ORYA 2HLVA 1NP4A 1SY2A 1DZPA 1EXSA 3BDRA 3WVMA 5HZ8A 5HZ6A 1OEEA 1GGLA 2G78A 2FRSA 5DG4A 3EM0A 3NP1A 1T0VA 1BJ7A 1SXYA 1EW3A 4AW8A 1KOIA 1YWCA 1LIDA 5HZQA 3KZAA 4I3BA 4EXZA 1OEJA 3WXQA 3AKMA 4OS8A 4ORRA 3ELZA 1TW4A 2L5PA 4IMOA 1CBIA 4HPCA 1GKAA 1X8PA 1S2PA 4QGWA 4GNYA 2JU3A 1RBPA 3P6CA 1BSQA 1KT6A 4ZHFA 1ZNKA 1RLBE 1YWDA 3WJDA 1GX9A 4EFGA 2X45A 4ZGUA 1ALBA 4ZR2A 5BVTA 1HMRA 2K62A 3MBTA 1B56A 4YCEA 3K3LA 4QGVA 3U0DA 2MO5A 4NLIA 2OVEA 1BWYA 3NPOA 2EU7X 5H9NA 1NP1A 2RCTA 1HMTA 1KGLA 4BVMA 1O1VA 1JV4A 3P6FA 4MVKA 4YGZA 1T68X 4GETA 2RD7C 3P6DA 4QGXA 1DZMA 1HQPA 3HK1A 2JN3A 1LFOA 2OFMX 1IFBA 4XMEA 4IB9A 4LZUA 3ZUOA 1CBSA 2G79A 2A3FX 1BM5A 1EQDA 1YUPA 4LZVA 4AZOA 4ZHGA 3STMX 2LBAA 3B2IA 2MM3A 4ZHCA 5F1EA 1ZNGA 3FA7A 2NNDA 5CE4A 4ORWA 4TNNA 1ICNA 4IB8A 3RSWA 1BRQA 4XMGA 4HFOA 3VG2A 1MDCA 1DV9A 2ACOA 3U03A 1VYGA 5F58A 1ERBA 2KTDA 1B8EA 1CBQA 4ORSA 3BY0A 4ALOA 2Q39A 1EPBA 2A13A 3UEWA 2GJ5A 5KIDA 2NNQA 1EALA 1I06A 5HCCC 1D3SA 5HWZA 4I3CA 1MUPA 4AZQA 5LJCA 5KHPA 2WWPA 2ACPX 5D48A 3CBCA 2A2GA 3PH5A 4TKHA 4D6BA 4YBPA 1LIEA 3APVA 4AZNA 1BLRA 3JSQA 3TF6A 5LJDA 1GKAB 3SAOA 1TOUA 5LKEA 3T1DA 1R0UA 1O8VA 4ORUA 2A2UA 1G85A 2G7BA 1ZRYA 4XMHA 3NADA 2WUTA 3DTQA 1FELA 1BSOA 5LJGA 4I9RA 1EIIA 1YWAA 4YBUA 1G7NA 1YP6A 1ZNHA 2OFRX 3BX8A 1QWDA 3WJGA 1O1UA 3MVFA 4HPAA 3IFBA 3D96A 2OVDA 4XMFA 4M6SA 3FMZA 3PECA 1VPRA 4QYNA 1H91A 1E00A 3B2JA 1SXWA 1QFTA 3P6HA 1DC9A 4QYPA 1KT5A 1E5PA 1LNMA 2HZQA 5HAEA 1TVQA 4D6AA 5LJEA 1MX8A 2FS7A 2OZQA 3CWKA 2CZTA 1IIUA 2W2BA 3KFHA 1SA8A 2Q4NA 2WQ9A 3FLLA 4A1HA 1ADLA 3EBWA 3B2HA 5H8TA 5EZ2A 5FENA 4EDEA 2HMBA 2R74A 2P8GA 2BLGA 1KQXA 4TKJA 2ALLX 2Q2MA 3Q6LA 4Y0SA 5EEEA 1JYJA 4PSQA 3FW5A 3RZYA 4GRJA 1FENA 1GM6A 1QY0A 5HTDA 4NNTA 1L6MA 2JOZA 2FWVA 1JJJA 4IAXA 2QOSC 4A1YA 1OBPA 3BU1A 4NYRA 3STKA 2WQAE 1SXUA 3FEKA 4QAEA 2WEWA 1CBRA 3STNA 1CRBA 2LKKA 3FENA 3ZUIA 1SY0A 3WJEA 2FS6A 2WSJA 1MVGA 1YWBA 4ZJ0A 4YGGA 4ODDA 4M7MA 1QY1A 4BOEA 4O9SA 1JBHA 2WEXA 2E4JA 1OEKA 3G7XA 1HN2A 4YFQA 2QM9A 3B2LA 4TLJA 2GC9A 1P6PA 3I0AA 3UEXA 4YKMA 1XKIA 1SXXA 2AT5X 3F9DA 3OJYC 1FEMA 3B2KA 2X46A 1G5WA 4N7DA 3TGCA 1X8OA 4GE1A 3EYCA 2W2FA 1UZ2X 4AZPA 2OVAA 5LJBA 3KFIA 1A18A 4ZHHA 2IFBA 3C77X 1GT4A 3I17A 1ZNEA 4WFVA 4IB7A 2ANSA 3VG5A 4A8ZA 4TQ2A 3CQRA 4TJZA 1OPBA 5F7GA 1X8QA 2XSTA 4LKPA 3ELXA 1XCAA 3FA6A 1AQBA 4NLJA 1VYFA 3O2YA 4YMYA 1X8NA 1T8VA 1KT4A 1B4MA 2POAA 2L9CA 4Y0RA 4RUUA 1E06A 4ARHA 1D2UA 1KZXA 4ORXA 4NP1A 4Y0PA 1OPAA 2LFOA 1LPJA 4GKCA 2FR3A 2RQ0A 5EDBA 5K06A 1X89A 1E02A 3BU9A 5HA0A 5IO7A 3C78X 3AKNA 2W2AA 1HMSA 2JU7A 1GT5A 3UEVA 3BLGA 2RCQA 2AMMX 3PP6A 4IBAA 3PH6A 5IO5A 4IAWA 3KFFA 5LJHA 1EIOA 1ICMA 4YFRA 2NNEA 4ZHDA 4YKOA 4ZH6A 5BVQA 2AT6X 1GXAA 3VG7A 4AYHA 1BSYA 2QO6A 2O62A 3EBKA 2NP1A 2WR6A 1JYDA 3O22A 1JZUA 2F73A 4WBKA 2QO5A 3WJFA 3NR3A 2GTFX 2AL0X 2AT0X 1IW2A 1ERXA 3WJBA 5AQ6A 5IO6A 1MX7A 2CBRA 4RUNA 3WBGA 4AZRA 4K19A 4XMCA 4ZCBA 5L8OA 5FAZA 1SY1A 3FA8A 3APWA 5HZ9A 2JU8A 1ZNDA 3PPTA 5F6ZA 5C0NA 1FTPA 1LF7A 1U0XA 3U9PC 1HBPA 1PBOA 3APUA 1ML7A 1IKJA 1AB0A 5D8JA 1SY3A 5HCEC 4OS0A 4ZFXA 3F8AA 5EPQA 3EMMA 2FR2A 5B29A 3O19A 1A2DA 1QG5A 1ZNLA 3APXA 2AT8X 5HBSA 4YFPA 1LIFA 3CQNA 3FR5A 1Z24A 1X8UA 2QO4A 1YIVA 1BBPA 3CR6A 1LIBA 1UREA 1GT3A 1KT3A 3IA8A 3GAQA 1QY2A 4I9SA 4N7CA 2Q2PA 4QZTA 5KICA 3P6GA 2HYSA 1A3YA 4OS3A 3HWDA 1G74A 1ACDA 3D95A 4EEJA 1KQWA 4TKBA 2DM5A 3D97A 1JJXA 3FR2A 1BRPA 1QFVA 3KQ0A 3NX1A 1U18A 2ASNX 1IFCA 1OBQA 4IMNA 5F6BA 1FDQA 4LKTA 5H9AA 1DFVA 1PM1X 5D47A 1I4UA 1LICA 3HWFA 1EUOA
chains in the Genus database with same CATH superfamily
1SWGA 4BQUA 1WUBA 1U17A 3OD9A 1KXOA 1FE3A 2RA6A 3HPEA 3TZSA 1SWLA 3FR4A 2AVIA 3WJCA 1QQSA 1LKEA 1AELA 4ON1A 2AT3X 5EEDA 3VHMA 3DSZA 4O4XA 1I9HA 4R0BA 4I3DA 4ML7B 5BVSA 2RTMA 4QQ1A 1EI5A 2BS5A 1GT1A 3UEUA 3VG6A 5DPQA 1TOWA 4O3WA 2AH7X 1B0OA 1LCWA 3S26A 3L4RA 4OMWA 1VWCB 2PI3O 2K23A 3EC5A 2FLJA 2ZSCA 4KIIA 2OFBA 3JS1A 4ES7A 2RTGB 4ZH9A 3WZPA 5L8IA 4BX5B 2XKLA 3CMPA 5H9LA 2BSZA 4Z6JA 3KFGA 1LDOA 1SWPA 1NC9A 4HPBA 1IJ8A 1AVGI 1RXHA 2CBSA 1DZJA 2MWHA 4GGZA 4NYQA 4GH7A 4QNIA 3TGAA 4CK4A 1OBUA 4Z2VA 3NX2A 1VWLB 4ALBA 3PEDA 1RSUB 2A0AA 4MVIA 3WZNA 1QABE 4DQ4A 2CZUA 2R56A 2HNXA 4UU3A 4XMDA 3EW1A 4WFUA 2N93A 2CM4A 4YH0A 5B27A 4GNWA 1KZWA 1VWPB 1RXJA 3VE1A 5HA1A 4MIRA 2IZKA 3FW4A 4UU2A 5D4AA 2YMSA 3TGBA 1YP7A 4QZUA 4JO6A 1NGLA 4Y0QA 5LKFA 1CJ5A 3CBSA 4GDZA 1HXZA 3PDFA 1TXLA 4OMXA 3ZZVA 1PMPA 3NQ9A 3P6EA 2KT4B 1RAVA 2RTKA 3BRNA 4NNSA 4YDBA 2FGSA 5HCDC 1DF3A 3FA9A 3BX7A 3FEPA 2KW1A 2LB6A 2AKQA 3F6ZB 1SLEB 3VG4A 3HWGA 4A60A 4YCHA 3SZJA 1I05A 1KL3A 5B5FA 1N4JA 1EPAA 1SWUA 1SWEA 2CM9A 1S7DA 4QRLA 4AZMA 3SZIA 3C76X 2Q9SA 3QKGA 4CDEA 5JR8A 1RXKA 1IKEA 1DZKA 4OELA 2FT9A 5EDCA 2IZCB 4PJ2A 5HZ5A 4Z27A 2RTDB 1VWQB 5LJKA 4IB6A 4YGHA 1N0SA 4Z28A 3RY2A 2OY8A 5L8NA 3GE2A 1X71A 1BEBA 5FFHA 5H9KA 2FTBA 5HTEA 4GJVA 5D45A 3NQ3A 3VG3A 2F01A 1SWNA 2L68A 3P02A 4MVLA 1VWBB 2PY1A 1HBQA 1S44A 2JMBA 1PEEA 3BS2A 2X8SA 2L67A 2DJGA 2R73A 3QQ2A 5AJCA 1A57A 1VWAB 1KT7A 3FELA 3BSZE 2MJIA 1GX8A 3HWEA 2YG2A 1I04A 2HZRA 3RDSA 4DQ3A 3ZQ3A 3FIQA 2GTLM 2LBVA 4YDAA 3MX7A 4HPDA 4ORYA 5FQ7E 2HLVA 4BJ8A 1NP4A 1SY2A 1DZPA 1EXSA 3BDRA 3WVMA 5BYPA 3RDMA 3ZWEA 3RBYA 5HZ8A 5HZ6A 1OEEA 1GGLA 2G78A 2FRSA 2DJFA 2QMIA 5DG4A 3EM0A 3SZHA 2C1QA 3NP1A 1T0VA 1BJ7A 1SXYA 3Q34A 4EKVA 1EW3A 4AW8A 1KOIA 4U46A 2X32A 2X4MA 1YWCA 3T6LA 1LIDA 5HZQA 3KZAA 4I3BA 1Y9LA 3VGWA 5IXGA 4EXZA 1OEJA 3WXQA 2IZDB 3AKMA 4MVEA 4OS8A 5AJBA 4ORRA 4CDDA 3ELZA 1TW4A 3P24A 2L5PA 4IMOA 2RTLA 1CBIA 4HPCA 1GKAA 1X8PA 1S2PA 4IABA 4JGLA 4QGWA 4GNYA 2JU3A 1RBPA 2MHDA 3P6CA 1BSQA 1KT6A 4ZHFA 1ZNKA 1RLBE 1YWDA 3WJDA 2QOMA 1GX9A 2X34A 4EFGA 4CPEA 2X45A 4O3XB 1ALBA 5B5GA 4ZGUA 4ZR2A 4INNA 4COTA 5BVTA 1PBYA 2Z4IA 2OF9A 1HMRA 1VWHB 2K62A 1B56A 3MBTA 4YCEA 3K3LA 4QGVA 4FBRA 2MO5A 3U0DA 4NLIA 2OVEA 1BWYA 3NPOA 2EU7X 5H9NA 4CPHA 1NP1A 2IZFB 4GJSA 2VDFA 2RCTA 3ZW0A 1HMTA 4U8UN 1KGLA 1MOYA 1KL5A 4BVMA 4O4SA 4I60A 1O1VA 1JV4A 3P6FA 4MVKA 4YGZA 4LQZA 2RTEB 1T68X 3HOLA 4GETA 2RD7C 2IZLB 3P6DA 3SLJA 4QGXA 1DZMA 1HQPA 3HK1A 3ZI8A 2JN3A 1LFOA 2OFMX 1IFBA 3MM0A 4IB9A 4LZUA 4XMEA 3ZUOA 1SRHA 1CBSA 2G79A 3CKFA 4O4UA 2A3FX 1BM5A 1EQDA 1YUPA 4LZVA 4ID2A 4AZOA 4ZHGA 3STMX 2LBAA 3B2IA 2MM3A 4ZHCA 5F1EA 1ZNGA 3FA7A 2NNDA 5CE4A 4ORWA 2UZ2A 4TNNA 2HKDA 1ICNA 2WPUA 4IB8A 3T2XA 1SWJA 3RSWA 1BRQA 3WOVA 4XMGA 4GD9A 4HFOA 4MISA 3NQKA 1SMPI 1MDCA 1HY2A 2ACOA 2I5VO 2IZIA 3VG2A 3U03A 1DV9A 1VYGA 5F58A 1ERBA 2KTDA 1B8EA 1CBQA 4ORSA 3BY0A 1N9YA 4O4OA 3RDOA 4ALOA 1UYNX 2Q39A 1EPBA 2A13A 1FJ1E 2GJ5A 2RTFB 4L3RA 3UEWA 3ZW1A 5KIDA 4BX7A 2NNQA 2RTHB 1EALA 1I06A 5HCCC 1D3SA 5IRAA 5HWZA 4I3CA 1MUPA 4AZQA 3FIDA 2ZAGA 5KHPA 2WWPA 5LJCA 2ACPX 5D48A 3CBCA 2JW1A 1SWRA 2A2GA 3PH5A 4TKHA 4D6BA 4YBPA 2KD2A 1LIEA 3APVA 1W4TA 1SLDB 3JSQA 4AZNA 1BLRA 3TF6A 5LJDA 4DCBA 2X55A 3VE2A 1GKAB 4HWMA 2Y3EA 1MEPA 1TOUA 3SAOA 4YVBA 3T1DA 5LKEA 1R0UA 1O8VA 4ORUA 5FQ6E 2AF5A 2A2UA 1G85A 2G7BA 1ZRYA 1KL4A 2GTLO 4XMHA 3NADA 3RE6A 2WUTA 3S5XA 3DTQA 3CKGA 1FELA 1BSOA 1N9MA 5F2BA 4I9RA 1HXLA 5LJGA 2G5LA 5IRUA 1EIIA 1JQPA 1YWAA 4YBUA 1G7NA 1YP6A 1ZNHA 2OFRX 3BX8A 1QWDA 3WJGA 5L3YA 1O1UA 2GH7A 3MVFA 3IFBA 3D96A 4HPAA 4GK9A 5B3MO 3VHHA 2IZHB 2OVDA 1STRB 1Y52X 3WZOA 2OF8A 2JGSA 3HTYA 1NQNA 4CPHB 4XMFA 2UYWA 3ZW0B 4M6SA 1SRJA 3FMZA 5K68A 3PECA 1VPRA 4MEEA 4QYNA 1H91A 1E00A 3B2JA 2VFCA 4JNJA 2X8FA 1SXWA 1QFTA 1SWFA 3P6HA 3ZW2A 1DC9A 3S5VA 4QYPA 1KT5A 1E5PA 1LNMA 2HZQA 5HAEA 1TVQA 3FDCA 2OYBO 3MG5A 4D6AA 1MX8A 2FS7A 4GU8A 5LJEA 2OZQA 1SWCA 3CWKA 2CZTA 1IIUA 1SRFA 2W2BA 3UAQA 3KFHA 1SA8A 1VWDB 1VYOA 2Q4NA 2WQ9A 3FLLA 4A1HA 4KC8A 1ADLA 4EQAC 4FBOA 4KH8A 1SWOA 2FKGA 3EBWA 3B2HA 1Y55X 3PK2A 5H8TA 5EZ2A 5FENA 1SLFB 4OEMA 2RTRB 4EDEA 2HMBA 2C4IA 2R74A 2P8GA 4CPIA 2BLGA 1KQXA 2OVSA 4TKJA 2ALLX 2Q2MA 3Q6LA 2X56A 4Y0SA 1JYJA 5EEEA 4PSQA 4OKAA 3FW5A 3LHNA 3RZYA 4GRJA 1FENA 4GZVA 1GM6A 2A5BA 1GX3A 1LCZA 1QY0A 5HTDA 4NNTA 1L6MA 2JOZA 2FWVA 1JJJA 2RTNB 4GDAA 4IAXA 2QOSC 4A1YA 1OBPA 3ZW1B 4BX7B 3HOEA 3BU1A 4NV7A 4U9CA 3RE5A 4NYRA 4KCAA 3STKA 2WQAE 1SXUA 3FEKA 2FHLA 4QAEA 1SREA 2WEWA 2OY1O 3WYPA 4BBOA 1CBRA 3STNA 1CRBA 2LKKA 2IZBA 4NW4A 3FENA 3WYQA 2QCBA 3ZUIA 1N43A 1LDQA 1SY0A 3WJEA 2FS6A 2WSJA 1MVGA 1YWBA 4ZJ0A 4YGGA 4ODDA 4M7MA 1QY1A 3RDQA 4O9SA 4BOEA 1NDJA 1LELA 1VWIB 1SWHA 2WEXA 2E4JA 1OEKA 3G7XA 1HN2A 4YFQA 3RWXA 2QM9A 3B2LA 4TLJA 2X8TA 2GC9A 1SLGB 1P6PA 3I0AA 3UEXA 2C1SA 4O3ZA 1SWSA 3EW2A 4YKMA 1XKIA 4WHIA 4Y59A 1SXXA 2A8GA 2AT5X 4Y5DA 4BCSA 3F9DA 4ZGFA 3OJYC 1FEMA 1LUQA 3B2KA 4GUZA 2X46A 1VWFB 2IZGB 3PQSA 3T6FA 4N7DA 1G5WA 2OFAA 1Y53X 3TGCA 1JJUA 1I78A 1X8OA 4GE1A 4O49A 2IZJA 3EYCA 2W2FA 1UZ2X 4FGIB 3KVNA 4AZPA 1STPA 2OVAA 5LJBA 3KFIA 3VHIA 2OY7A 1A18A 4ZHHA 2IFBA 3C77X 5CSEA 2OL7A 1GT4A 1W6FA 3I17A 4NV8A 1ZNEA 1HQQA 1DF8A 4WFVA 3OBLA 3V8UA 4IB7A 1NQMA 2ANSA 1VWEB 1W5RA 1SWKA 4U8UM 3VG5A 4A8ZA 4TQ2A 4I6SA 3CQRA 1KFFA 4TJZA 1VWNB 1OPBA 5F7GA 2BT9A 1X8QA 2KTSA 2RTQB 2XSTA 4JHQA 4LKPA 3ELXA 2RTBB 4BX6A 2M4LA 1XCAA 3FA6A 1AQBA 1AVDA 2RTCB 4NLJA 1Y9TA 1VYFA 3O2YA 4KT5A 2RTIB 1X8NA 1T8VA 4YMYA 1KT4A 1B4MA 1VWJB 2POAA 2ZAIA 2L9CA 4Y0RA 4RUUA 5IRWA 3LTWA 1E06A 3SLTA 4ARHA 3NBXX 1D2UA 1KZXA 4ORXA 4NP1A 3H3IA 4Y0PA 5JD2A 1OPAA 2LFOA 1LPJA 4GKCA 2Z4HA 2FR3A 2RQ0A 5EDBA 3T2WA 5K06A 1AVEA 1E02A 1X89A 3BU9A 5HA0A 4FBVA 5IO7A 3C78X 3VPJE 3AKNA 2W2AA 1HMSA 3D4RA 5CYBA 1MM9A 2JU7A 2Y3FA 1GT5A 5CHKA 2Y32A 3UEVA 4B55A 3BLGA 2RCQA 2AMMX 1JMXA 4L1NA 1PTSA 3PP6A 5FQ8E 4IBAA 3E3CA 4CDCA 3PH6A 4DNEA 5IO5A 1K3BA 1VWMB 5B11O 4IAWA 3KFFA 4O3YA 5LJHA 1EIOA 1Y0GA 1ICMA 2GTLN 2NNEA 3LV4A 4YFRA 4ZHDA 4YKOA 2RTPB 4ZH6A 5BVQA 2AT6X 1GXAA 3WZQA 3VG7A 2FKJA 4C5PA 2G8CO 4AYHA 1BSYA 2QO6A 2O62A 3EBKA 2NP1A 2WR6A 1JYDA 2IZEB 3O22A 3OE3A 4KC7A 1JZUA 2F73A 2RN4A 2QO5A 1SWQA 4WBKA 1JIWI 3NR3A 1NBXA 1UYOX 2GTFX 3RY1A 3WJFA 2AL0X 2AT0X 3FYFA 4Z2OA 2I5ZO 2LA7A 1IW2A 1ERXA 4GGTA 3WJBA 5AQ6A 2OL8O 1VWRB 1JMZA 1WBIA 2BC3A 1MX7A 4BX5A 2CBRA 5IO6A 4RUNA 2RTJA 3AUMO 3WBGA 1N7YA 4AZRA 2CAMA 1OSPO 4K19A 4XMCA 2RTAA 1SRIA 4ZCBA 3N91A 5B2AO 3SOTA 5K67A 5L8OA 5FAZA 1SY1A 4BGFA 1SWAA 3FA8A 3APWA 5HZ9A 1RSTB 4FQBB 2JU8A 1ZNDA 3PPTA 5F6ZA 5C0NA 1FTPA 3RDXA 1LF7A 1LCVA 1U0XA 2OY5O 3U9PC 1HBPA 4CSBA 1PBOA 3APUA 1ML7A 1IKJA 1AB0A 5D8JA 1SY3A 5HCEC 4OS0A 1MK5A 1SWBA 4ZFXA 3F8AA 5EPQA 4Z2PA 3EMMA 2FR2A 5B29A 3O19A 3S60A 1A2DA 2FHNX 4BX6B 1QG5A 1SRGA 2A5CA 1ZNLA 1K24A 3APXA 2BS6A 2AT8X 5HBSA 4U3QA 4YFPA 1LIFA 3CQNA 4CDFA 1E2TA 3FR5A 1Z24A 1X8UA 2QO4A 1YIVA 1BBPA 3CR6A 2BHVA 5B10O 3X00A 4I95A 3PQUA 1LIBA 1UREA 1GT3A 1KT3A 2RTOB 3IA8A 3GAQA 3VU1A 1JBHA 1QY2A 4I9SA 2IZAA 4N7CA 2Q2PA 4QZTA 5KICA 1SWDA 2HYSA 3P6GA 1VWOB 1A3YA 1SWTA 1STSB 2F09A 1G74A 1ACDA 2OL6O 1VWGB 3HWDA 3JQOA 4OS3A 3D95A 3RKGA 4CPFA 4EEJA 5AEOA 1KQWA 4TKBA 2VFBA 2DM5A 3D97A 3SLOA 1JJXA 3FR2A 3RDUA 4GGRA 1BRPA 1QFVA 3KQ0A 4IRWA 3AEHA 3NX1A 4U8UO 1U18A 2ASNX 1IFCA 1OBQA 3D9WA 4IMNA 1FDQA 4LKTA 5F6BA 1DFVA 1VWKB 5H9AA 1PM1X 5D47A 4CV7A 2MF6A 1I4UA 1LICA 3HWFA 1EUOA
chains in the Genus database with same CATH topology
4BQUA 1U17A 3OD9A 1KXOA 1FE3A 2RA6A 3TZSA 3FR4A 3WJCA 1QQSA 1LKEA 1AELA 4ON1A 2AT3X 5EEDA 3DSZA 4O4XA 4R0BA 4I3DA 4ML7B 5BVSA 4QQ1A 1EI5A 2BS5A 1GT1A 3UEUA 3VG6A 5DPQA 1TOWA 4O3WA 2AH7X 1B0OA 3S26A 3L4RA 4OMWA 2K23A 2FLJA 4KIIA 4ES7A 3JS1A 4ZH9A 5L8IA 2XKLA 3CMPA 5H9LA 3KFGA 4HPBA 1AVGI 2CBSA 1DZJA 2MWHA 4NYQA 4QNIA 4GH7A 3TGAA 4CK4A 1OBUA 3NX2A 4ALBA 3PEDA 4MVIA 2A0AA 4DQ4A 1QABE 2CZUA 2R56A 2HNXA 4UU3A 4XMDA 4YH0A 4WFUA 2N93A 2CM4A 5B27A 1KZWA 4GNWA 3VE1A 5HA1A 4MIRA 3FW4A 4UU2A 5D4AA 2YMSA 3TGBA 1YP7A 4QZUA 1NGLA 4Y0QA 5LKFA 1CJ5A 3CBSA 4GDZA 4OMXA 1TXLA 3ZZVA 1PMPA 3NQ9A 3P6EA 2KT4B 4NNSA 3BRNA 4YDBA 1DF3A 5HCDC 3FA9A 3BX7A 3FEPA 2KW1A 2LB6A 2AKQA 3F6ZB 3VG4A 3HWGA 4A60A 4YCHA 1I05A 1EPAA 2CM9A 1S7DA 4QRLA 4AZMA 3C76X 2Q9SA 3QKGA 5JR8A 1IKEA 1DZKA 2FT9A 5EDCA 4PJ2A 5HZ5A 5LJKA 4IB6A 4YGHA 1N0SA 5L8NA 3GE2A 1X71A 1BEBA 5FFHA 5H9KA 2FTBA 5HTEA 5D45A 3NQ3A 3VG3A 3P02A 2L68A 4MVLA 2PY1A 1HBQA 1S44A 2JMBA 1PEEA 3BS2A 2X8SA 2L67A 2R73A 5AJCA 1A57A 3FELA 1KT7A 3BSZE 2MJIA 1GX8A 3HWEA 2YG2A 1I04A 2HZRA 4DQ3A 3ZQ3A 3FIQA 2GTLM 2LBVA 4YDAA 3MX7A 4HPDA 4ORYA 5FQ7E 2HLVA 1NP4A 1SY2A 1DZPA 1EXSA 3BDRA 3WVMA 5BYPA 3ZWEA 3RBYA 5HZ8A 5HZ6A 1OEEA 1GGLA 2G78A 2FRSA 2QMIA 5DG4A 3EM0A 3NP1A 1T0VA 1BJ7A 1SXYA 1EW3A 4AW8A 1KOIA 1YWCA 1LIDA 5HZQA 3KZAA 4I3BA 1Y9LA 4EXZA 1OEJA 3WXQA 3AKMA 4MVEA 4OS8A 5AJBA 4ORRA 3ELZA 1TW4A 3P24A 2L5PA 4IMOA 1CBIA 4HPCA 1GKAA 1X8PA 1S2PA 4IABA 4JGLA 4QGWA 4GNYA 2JU3A 1RBPA 2MHDA 3P6CA 1BSQA 1KT6A 4ZHFA 1ZNKA 1RLBE 1YWDA 3WJDA 1GX9A 4EFGA 2X45A 4O3XB 1ALBA 4ZGUA 4ZR2A 4INNA 4COTA 5BVTA 2Z4IA 1HMRA 2K62A 3MBTA 1B56A 4YCEA 3K3LA 4QGVA 4FBRA 2MO5A 3U0DA 4NLIA 2OVEA 1BWYA 3NPOA 2EU7X 5H9NA 1NP1A 2RCTA 3ZW0A 1HMTA 4U8UN 1KGLA 4BVMA 4O4SA 1O1VA 1JV4A 3P6FA 4MVKA 4YGZA 4LQZA 3HOLA 1T68X 4GETA 2RD7C 3P6DA 4QGXA 1DZMA 1HQPA 3HK1A 3ZI8A 2JN3A 1LFOA 2OFMX 1IFBA 4XMEA 4IB9A 4LZUA 3ZUOA 1CBSA 2G79A 4O4UA 2A3FX 1BM5A 1EQDA 1YUPA 4LZVA 4ID2A 4AZOA 4ZHGA 3STMX 2LBAA 3B2IA 2MM3A 4ZHCA 5F1EA 1ZNGA 3FA7A 2NNDA 5CE4A 4ORWA 4TNNA 3WOVA 1ICNA 4IB8A 3RSWA 1BRQA 4XMGA 4HFOA 4MISA 3NQKA 1SMPI 1MDCA 3VG2A 2ACOA 3U03A 1DV9A 1VYGA 5F58A 1ERBA 2KTDA 1B8EA 1CBQA 4ORSA 3BY0A 4O4OA 4ALOA 2Q39A 1EPBA 2A13A 4L3RA 2GJ5A 3UEWA 5KIDA 3ZW1A 2NNQA 1EALA 1I06A 5HCCC 1D3SA 5HWZA 4I3CA 1MUPA 4AZQA 5LJCA 2ZAGA 5KHPA 2WWPA 2ACPX 5D48A 3CBCA 2JW1A 2A2GA 3PH5A 4TKHA 4D6BA 4YBPA 2KD2A 1LIEA 3APVA 4AZNA 1BLRA 3JSQA 3TF6A 5LJDA 3VE2A 1GKAB 4HWMA 3SAOA 1TOUA 5LKEA 3T1DA 1R0UA 1O8VA 4ORUA 5FQ6E 2A2UA 1G85A 2G7BA 1ZRYA 2GTLO 4XMHA 3NADA 3S5XA 2WUTA 3DTQA 1FELA 1BSOA 5LJGA 4I9RA 1EIIA 1YWAA 4YBUA 1G7NA 1YP6A 1ZNHA 2OFRX 3BX8A 1QWDA 3WJGA 1O1UA 3MVFA 4HPAA 3IFBA 3D96A 4GK9A 2OVDA 3HTYA 4XMFA 3ZW0B 4M6SA 3FMZA 3PECA 1VPRA 4QYNA 1H91A 1E00A 3B2JA 2X8FA 1SXWA 1QFTA 3P6HA 3ZW2A 1DC9A 3S5VA 4QYPA 1KT5A 1E5PA 1LNMA 2HZQA 5HAEA 1TVQA 4D6AA 5LJEA 1MX8A 2FS7A 4GU8A 2OZQA 3CWKA 2CZTA 1IIUA 2W2BA 3UAQA 3KFHA 1SA8A 2Q4NA 2WQ9A 3FLLA 4A1HA 4KC8A 1ADLA 4EQAC 4FBOA 4KH8A 3EBWA 3B2HA 5H8TA 5EZ2A 5FENA 4EDEA 2HMBA 2R74A 2P8GA 2BLGA 1KQXA 2OVSA 4TKJA 2ALLX 2Q2MA 3Q6LA 4Y0SA 5EEEA 1JYJA 4PSQA 3FW5A 3LHNA 3RZYA 4GRJA 1FENA 4GZVA 1GM6A 1QY0A 5HTDA 4NNTA 1L6MA 2JOZA 2FWVA 1JJJA 4IAXA 2QOSC 4A1YA 1OBPA 3ZW1B 3HOEA 3BU1A 4U9CA 4NYRA 4KCAA 3STKA 2WQAE 1SXUA 3FEKA 4QAEA 2WEWA 1CBRA 3STNA 1CRBA 2LKKA 4NW4A 3FENA 3ZUIA 1SY0A 3WJEA 2FS6A 2WSJA 1MVGA 1YWBA 4ZJ0A 4YGGA 4ODDA 4M7MA 1QY1A 4BOEA 4O9SA 1JBHA 2WEXA 2E4JA 1OEKA 3G7XA 1HN2A 4YFQA 3RWXA 2QM9A 3B2LA 4TLJA 2X8TA 2GC9A 1P6PA 3I0AA 3UEXA 4O3ZA 4YKMA 1XKIA 4WHIA 1SXXA 2AT5X 4ZGFA 3F9DA 3OJYC 1FEMA 3B2KA 2X46A 3PQSA 1G5WA 4N7DA 3TGCA 1X8OA 4GE1A 4O49A 3EYCA 2W2FA 1UZ2X 4FGIB 4AZPA 2OVAA 5LJBA 3KFIA 1A18A 4ZHHA 2IFBA 3C77X 1GT4A 3I17A 1ZNEA 4WFVA 3OBLA 3V8UA 4IB7A 2ANSA 3VG5A 4U8UM 4A8ZA 4TQ2A 4I6SA 3CQRA 4TJZA 1OPBA 5F7GA 2BT9A 1X8QA 2KTSA 2XSTA 4LKPA 3ELXA 2M4LA 1XCAA 3FA6A 1AQBA 4NLJA 1Y9TA 1VYFA 3O2YA 4KT5A 4YMYA 1X8NA 1T8VA 1KT4A 1B4MA 2POAA 2ZAIA 2L9CA 4Y0RA 4RUUA 1E06A 4ARHA 3NBXX 1D2UA 1KZXA 4ORXA 4NP1A 3H3IA 4Y0PA 1OPAA 2LFOA 1LPJA 4GKCA 2Z4HA 2FR3A 2RQ0A 5EDBA 5K06A 1X89A 1E02A 3BU9A 5HA0A 4FBVA 5IO7A 3C78X 3VPJE 3AKNA 2W2AA 1HMSA 3D4RA 5CYBA 2JU7A 1GT5A 3UEVA 3BLGA 2RCQA 2AMMX 4L1NA 3PP6A 5FQ8E 4IBAA 3E3CA 3PH6A 5IO5A 4IAWA 3KFFA 4O3YA 5LJHA 1EIOA 1ICMA 2GTLN 2NNEA 3LV4A 4YFRA 4ZHDA 4YKOA 4ZH6A 5BVQA 2AT6X 1GXAA 3VG7A 4AYHA 1BSYA 2QO6A 2O62A 3EBKA 2NP1A 2WR6A 1JYDA 3O22A 3OE3A 4KC7A 1JZUA 2F73A 2RN4A 2QO5A 4WBKA 3WJFA 1JIWI 3NR3A 2GTFX 2AL0X 2AT0X 3FYFA 2LA7A 1IW2A 1ERXA 3WJBA 5AQ6A 5IO6A 1MX7A 2CBRA 4RUNA 3WBGA 4AZRA 4K19A 4XMCA 4ZCBA 3SOTA 5L8OA 3N91A 5FAZA 1SY1A 3FA8A 3APWA 5HZ9A 4FQBB 2JU8A 1ZNDA 3PPTA 5F6ZA 5C0NA 1FTPA 1LF7A 1U0XA 3U9PC 1HBPA 4CSBA 1PBOA 3APUA 1ML7A 1IKJA 1AB0A 5D8JA 1SY3A 5HCEC 4OS0A 4ZFXA 3F8AA 5EPQA 3EMMA 2FR2A 5B29A 3O19A 3S60A 1A2DA 1QG5A 1ZNLA 3APXA 2BS6A 2AT8X 5HBSA 4U3QA 4YFPA 1LIFA 3CQNA 3FR5A 1Z24A 1X8UA 2QO4A 1YIVA 1BBPA 3CR6A 2BHVA 4I95A 3PQUA 1LIBA 1UREA 1GT3A 1KT3A 3IA8A 3VU1A 3GAQA 1QY2A 4I9SA 4N7CA 2Q2PA 4QZTA 5KICA 3P6GA 2HYSA 1A3YA 4OS3A 2F09A 1G74A 1ACDA 3HWDA 3JQOA 3RKGA 5AEOA 3D95A 4EEJA 1KQWA 4TKBA 2DM5A 3D97A 1JJXA 3FR2A 1BRPA 1QFVA 3KQ0A 3NX1A 4U8UO 1U18A 2ASNX 1IFCA 1OBQA 4IMNA 5F6BA 1FDQA 4LKTA 5H9AA 1DFVA 1PM1X 5D47A 4CV7A 1I4UA 1LICA 3HWFA 1EUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQU A;  1U17 A;  1KXO A;  1FE3 A;  2RA6 A;  3TZS A;  3FR4 A;  3WJC A;  1QQS A;  1LKE A;  1AEL A;  2AT3 X;  5EED A;  3DSZ A;  4R0B A;  4I3D A;  5BVS A;  1GT1 A;  3UEU A;  3VG6 A;  5DPQ A;  1TOW A;  2AH7 X;  1B0O A;  3S26 A;  3L4R A;  4OMW A;  2K23 A;  2FLJ A;  4KII A;  4ES7 A;  3JS1 A;  4ZH9 A;  5L8I A;  2XKL A;  3CMP A;  5H9L A;  3KFG A;  4HPB A;  1AVG I;  2CBS A;  1DZJ A;  4NYQ A;  4GH7 A;  3TGA A;  4CK4 A;  1OBU A;  3NX2 A;  4ALB A;  3PED A;  4MVI A;  2A0A A;  4DQ4 A;  1QAB E;  2CZU A;  2R56 A;  2HNX A;  4UU3 A;  4XMD A;  4YH0 A;  4WFU A;  2N93 A;  2CM4 A;  5B27 A;  1KZW A;  4GNW A;  5HA1 A;  3FW4 A;  4UU2 A;  5D4A A;  3TGB A;  1YP7 A;  4QZU A;  1NGL A;  4Y0Q A;  5LKF A;  1CJ5 A;  3CBS A;  4OMX A;  1TXL A;  1PMP A;  3NQ9 A;  3P6E A;  2KT4 B;  4NNS A;  3BRN A;  4YDB A;  1DF3 A;  5HCD C;  3FA9 A;  3BX7 A;  3FEP A;  2LB6 A;  2AKQ A;  3VG4 A;  3HWG A;  4A60 A;  4YCH A;  1I05 A;  1EPA A;  2CM9 A;  1S7D A;  4AZM A;  3C76 X;  2Q9S A;  3QKG A;  5JR8 A;  1IKE A;  1DZK A;  2FT9 A;  5EDC A;  5HZ5 A;  5LJK A;  4IB6 A;  4YGH A;  1N0S A;  5L8N A;  1X71 A;  1BEB A;  5FFH A;  5H9K A;  2FTB A;  5HTE A;  5D45 A;  3NQ3 A;  3VG3 A;  4MVL A;  2L68 A;  2PY1 A;  1HBQ A;  1S44 A;  1PEE A;  3BS2 A;  2L67 A;  2R73 A;  1A57 A;  3FEL A;  1KT7 A;  3BSZ E;  2MJI A;  1GX8 A;  3HWE A;  2YG2 A;  1I04 A;  2HZR A;  4DQ3 A;  3ZQ3 A;  3FIQ A;  2LBV A;  4YDA A;  4HPD A;  4ORY A;  2HLV A;  1NP4 A;  1SY2 A;  1DZP A;  1EXS A;  3BDR A;  3WVM A;  5HZ8 A;  5HZ6 A;  1OEE A;  1GGL A;  2G78 A;  2FRS A;  5DG4 A;  3EM0 A;  3NP1 A;  1T0V A;  1BJ7 A;  1SXY A;  1EW3 A;  4AW8 A;  1KOI A;  1YWC A;  1LID A;  5HZQ A;  3KZA A;  4I3B A;  4EXZ A;  1OEJ A;  3WXQ A;  3AKM A;  4OS8 A;  4ORR A;  3ELZ A;  1TW4 A;  2L5P A;  4IMO A;  1CBI A;  4HPC A;  1GKA A;  1X8P A;  1S2P A;  4QGW A;  4GNY A;  2JU3 A;  1RBP A;  3P6C A;  1BSQ A;  1KT6 A;  4ZHF A;  1ZNK A;  1RLB E;  1YWD A;  3WJD A;  1GX9 A;  4EFG A;  2X45 A;  4ZGU A;  1ALB A;  4ZR2 A;  5BVT A;  1HMR A;  2K62 A;  3MBT A;  1B56 A;  4YCE A;  3K3L A;  4QGV A;  3U0D A;  2MO5 A;  4NLI A;  2OVE A;  1BWY A;  3NPO A;  2EU7 X;  5H9N A;  1NP1 A;  2RCT A;  1HMT A;  1KGL A;  4BVM A;  1O1V A;  1JV4 A;  3P6F A;  4MVK A;  4YGZ A;  1T68 X;  4GET A;  2RD7 C;  3P6D A;  4QGX A;  1DZM A;  1HQP A;  3HK1 A;  2JN3 A;  1LFO A;  2OFM X;  1IFB A;  4XME A;  4IB9 A;  4LZU A;  3ZUO A;  1CBS A;  2G79 A;  2A3F X;  1BM5 A;  1EQD A;  1YUP A;  4LZV A;  4AZO A;  4ZHG A;  3STM X;  2LBA A;  3B2I A;  2MM3 A;  4ZHC A;  5F1E A;  1ZNG A;  3FA7 A;  2NND A;  5CE4 A;  4ORW A;  4TNN A;  1ICN A;  4IB8 A;  3RSW A;  1BRQ A;  4XMG A;  4HFO A;  3VG2 A;  1MDC A;  1DV9 A;  2ACO A;  3U03 A;  1VYG A;  5F58 A;  1ERB A;  2KTD A;  1B8E A;  1CBQ A;  4ORS A;  3BY0 A;  4ALO A;  2Q39 A;  1EPB A;  2A13 A;  3UEW A;  2GJ5 A;  5KID A;  2NNQ A;  1EAL A;  1I06 A;  5HCC C;  1D3S A;  5HWZ A;  4I3C A;  1MUP A;  4AZQ A;  5LJC A;  5KHP A;  2WWP A;  2ACP X;  5D48 A;  3CBC A;  2A2G A;  3PH5 A;  4TKH A;  4D6B A;  4YBP A;  1LIE A;  3APV A;  4AZN A;  1BLR A;  3JSQ A;  3TF6 A;  5LJD A;  1GKA B;  3SAO A;  1TOU A;  5LKE A;  3T1D A;  1R0U A;  1O8V A;  4ORU A;  2A2U A;  1G85 A;  2G7B A;  1ZRY A;  4XMH A;  3NAD A;  2WUT A;  3DTQ A;  1FEL A;  1BSO A;  5LJG A;  4I9R A;  1EII A;  1YWA A;  4YBU A;  1G7N A;  1YP6 A;  1ZNH A;  2OFR X;  3BX8 A;  1QWD A;  3WJG A;  1O1U A;  3MVF A;  4HPA A;  3IFB A;  3D96 A;  2OVD A;  4XMF A;  4M6S A;  3FMZ A;  3PEC A;  1VPR A;  4QYN A;  1H91 A;  1E00 A;  3B2J A;  1SXW A;  1QFT A;  3P6H A;  1DC9 A;  4QYP A;  1KT5 A;  1E5P A;  1LNM A;  2HZQ A;  5HAE A;  1TVQ A;  4D6A A;  5LJE A;  1MX8 A;  2FS7 A;  2OZQ A;  3CWK A;  2CZT A;  1IIU A;  2W2B A;  3KFH A;  1SA8 A;  2Q4N A;  2WQ9 A;  3FLL A;  4A1H A;  1ADL A;  3EBW A;  3B2H A;  5H8T A;  5EZ2 A;  5FEN A;  4EDE A;  2HMB A;  2R74 A;  2P8G A;  2BLG A;  1KQX A;  4TKJ A;  2ALL X;  2Q2M A;  3Q6L A;  4Y0S A;  5EEE A;  1JYJ A;  4PSQ A;  3FW5 A;  3RZY A;  4GRJ A;  1FEN A;  1GM6 A;  1QY0 A;  5HTD A;  4NNT A;  1L6M A;  2JOZ A;  2FWV A;  1JJJ A;  4IAX A;  2QOS C;  4A1Y A;  1OBP A;  3BU1 A;  4NYR A;  3STK A;  2WQA E;  1SXU A;  3FEK A;  4QAE A;  2WEW A;  1CBR A;  3STN A;  1CRB A;  2LKK A;  3FEN A;  3ZUI A;  1SY0 A;  3WJE A;  2FS6 A;  2WSJ A;  1MVG A;  1YWB A;  4ZJ0 A;  4YGG A;  4ODD A;  4M7M A;  1QY1 A;  4BOE A;  4O9S A;  1JBH A;  2WEX A;  2E4J A;  1OEK A;  3G7X A;  1HN2 A;  4YFQ A;  2QM9 A;  3B2L A;  4TLJ A;  2GC9 A;  1P6P A;  3I0A A;  3UEX A;  4YKM A;  1XKI A;  1SXX A;  2AT5 X;  3F9D A;  3OJY C;  1FEM A;  3B2K A;  2X46 A;  1G5W A;  4N7D A;  3TGC A;  1X8O A;  4GE1 A;  3EYC A;  2W2F A;  1UZ2 X;  4AZP A;  2OVA A;  5LJB A;  3KFI A;  1A18 A;  4ZHH A;  2IFB A;  3C77 X;  1GT4 A;  3I17 A;  1ZNE A;  4WFV A;  4IB7 A;  2ANS A;  3VG5 A;  4A8Z A;  4TQ2 A;  3CQR A;  4TJZ A;  1OPB A;  5F7G A;  1X8Q A;  2XST A;  4LKP A;  3ELX A;  1XCA A;  3FA6 A;  1AQB A;  4NLJ A;  1VYF A;  3O2Y A;  4YMY A;  1X8N A;  1T8V A;  1KT4 A;  1B4M A;  2POA A;  2L9C A;  4Y0R A;  4RUU A;  1E06 A;  4ARH A;  1D2U A;  1KZX A;  4ORX A;  4NP1 A;  4Y0P A;  1OPA A;  2LFO A;  1LPJ A;  4GKC A;  2FR3 A;  2RQ0 A;  5EDB A;  5K06 A;  1X89 A;  1E02 A;  3BU9 A;  5HA0 A;  5IO7 A;  3C78 X;  3AKN A;  2W2A A;  1HMS A;  2JU7 A;  1GT5 A;  3UEV A;  3BLG A;  2RCQ A;  2AMM X;  3PP6 A;  4IBA A;  3PH6 A;  5IO5 A;  4IAW A;  3KFF A;  5LJH A;  1EIO A;  1ICM A;  4YFR A;  2NNE A;  4ZHD A;  4YKO A;  4ZH6 A;  5BVQ A;  2AT6 X;  1GXA A;  3VG7 A;  4AYH A;  1BSY A;  2QO6 A;  2O62 A;  3EBK A;  2NP1 A;  2WR6 A;  1JYD A;  3O22 A;  1JZU A;  2F73 A;  4WBK A;  2QO5 A;  3WJF A;  3NR3 A;  2GTF X;  2AL0 X;  2AT0 X;  1IW2 A;  1ERX A;  3WJB A;  5AQ6 A;  5IO6 A;  1MX7 A;  2CBR A;  4RUN A;  3WBG A;  4AZR A;  4K19 A;  4XMC A;  4ZCB A;  5L8O A;  5FAZ A;  1SY1 A;  3FA8 A;  3APW A;  5HZ9 A;  2JU8 A;  1ZND A;  3PPT A;  5F6Z A;  5C0N A;  1FTP A;  1LF7 A;  1U0X A;  3U9P C;  1HBP A;  1PBO A;  3APU A;  1ML7 A;  1IKJ A;  1AB0 A;  5D8J A;  1SY3 A;  5HCE C;  4OS0 A;  4ZFX A;  3F8A A;  5EPQ A;  3EMM A;  2FR2 A;  5B29 A;  3O19 A;  1A2D A;  1QG5 A;  1ZNL A;  3APX A;  2AT8 X;  5HBS A;  4YFP A;  1LIF A;  3CQN A;  3FR5 A;  1Z24 A;  1X8U A;  2QO4 A;  1YIV A;  1BBP A;  3CR6 A;  1LIB A;  1URE A;  1GT3 A;  1KT3 A;  3IA8 A;  3GAQ A;  1QY2 A;  4I9S A;  4N7C A;  2Q2P A;  4QZT A;  5KIC A;  3P6G A;  2HYS A;  1A3Y A;  4OS3 A;  3HWD A;  1G74 A;  1ACD A;  3D95 A;  4EEJ A;  1KQW A;  4TKB A;  2DM5 A;  3D97 A;  1JJX A;  3FR2 A;  1BRP A;  1QFV A;  3KQ0 A;  3NX1 A;  1U18 A;  2ASN X;  1IFC A;  1OBQ A;  4IMN A;  5F6B A;  1FDQ A;  4LKT A;  5H9A A;  1DFV A;  1PM1 X;  5D47 A;  1I4U A;  1LIC A;  3HWF A;  1EUO A; 
#chains in the Genus database with same CATH topology
 1SWG A;  4BQU A;  1WUB A;  1U17 A;  3OD9 A;  1KXO A;  1FE3 A;  2RA6 A;  3HPE A;  3TZS A;  1SWL A;  3FR4 A;  2AVI A;  3WJC A;  1QQS A;  1LKE A;  1AEL A;  4ON1 A;  2AT3 X;  5EED A;  3VHM A;  3DSZ A;  4O4X A;  1I9H A;  4R0B A;  4I3D A;  4ML7 B;  5BVS A;  2RTM A;  4QQ1 A;  1EI5 A;  2BS5 A;  1GT1 A;  3UEU A;  3VG6 A;  5DPQ A;  1TOW A;  4O3W A;  2AH7 X;  1B0O A;  1LCW A;  3S26 A;  3L4R A;  4OMW A;  1VWC B;  2PI3 O;  2K23 A;  3EC5 A;  2FLJ A;  2ZSC A;  4KII A;  2OFB A;  3JS1 A;  4ES7 A;  2RTG B;  4ZH9 A;  3WZP A;  5L8I A;  4BX5 B;  2XKL A;  3CMP A;  5H9L A;  2BSZ A;  4Z6J A;  3KFG A;  1LDO A;  1SWP A;  1NC9 A;  4HPB A;  1IJ8 A;  1AVG I;  1RXH A;  2CBS A;  1DZJ A;  2MWH A;  4GGZ A;  4NYQ A;  4GH7 A;  4QNI A;  3TGA A;  4CK4 A;  1OBU A;  4Z2V A;  3NX2 A;  1VWL B;  4ALB A;  3PED A;  1RSU B;  2A0A A;  4MVI A;  3WZN A;  1QAB E;  4DQ4 A;  2CZU A;  2R56 A;  2HNX A;  4UU3 A;  4XMD A;  3EW1 A;  4WFU A;  2N93 A;  2CM4 A;  4YH0 A;  5B27 A;  4GNW A;  1KZW A;  1VWP B;  1RXJ A;  3VE1 A;  5HA1 A;  4MIR A;  2IZK A;  3FW4 A;  4UU2 A;  5D4A A;  2YMS A;  3TGB A;  1YP7 A;  4QZU A;  4JO6 A;  1NGL A;  4Y0Q A;  5LKF A;  1CJ5 A;  3CBS A;  4GDZ A;  1HXZ A;  3PDF A;  1TXL A;  4OMX A;  3ZZV A;  1PMP A;  3NQ9 A;  3P6E A;  2KT4 B;  1RAV A;  2RTK A;  3BRN A;  4NNS A;  4YDB A;  2FGS A;  5HCD C;  1DF3 A;  3FA9 A;  3BX7 A;  3FEP A;  2KW1 A;  2LB6 A;  2AKQ A;  3F6Z B;  1SLE B;  3VG4 A;  3HWG A;  4A60 A;  4YCH A;  3SZJ A;  1I05 A;  1KL3 A;  5B5F A;  1N4J A;  1EPA A;  1SWU A;  1SWE A;  2CM9 A;  1S7D A;  4QRL A;  4AZM A;  3SZI A;  3C76 X;  2Q9S A;  3QKG A;  4CDE A;  5JR8 A;  1RXK A;  1IKE A;  1DZK A;  4OEL A;  2FT9 A;  5EDC A;  2IZC B;  4PJ2 A;  5HZ5 A;  4Z27 A;  2RTD B;  1VWQ B;  5LJK A;  4IB6 A;  4YGH A;  1N0S A;  4Z28 A;  3RY2 A;  2OY8 A;  5L8N A;  3GE2 A;  1X71 A;  1BEB A;  5FFH A;  5H9K A;  2FTB A;  5HTE A;  4GJV A;  5D45 A;  3NQ3 A;  3VG3 A;  2F01 A;  1SWN A;  2L68 A;  3P02 A;  4MVL A;  1VWB B;  2PY1 A;  1HBQ A;  1S44 A;  2JMB A;  1PEE A;  3BS2 A;  2X8S A;  2L67 A;  2DJG A;  2R73 A;  3QQ2 A;  5AJC A;  1A57 A;  1VWA B;  1KT7 A;  3FEL A;  3BSZ E;  2MJI A;  1GX8 A;  3HWE A;  2YG2 A;  1I04 A;  2HZR A;  3RDS A;  4DQ3 A;  3ZQ3 A;  3FIQ A;  2GTL M;  2LBV A;  4YDA A;  3MX7 A;  4HPD A;  4ORY A;  5FQ7 E;  2HLV A;  4BJ8 A;  1NP4 A;  1SY2 A;  1DZP A;  1EXS A;  3BDR A;  3WVM A;  5BYP A;  3RDM A;  3ZWE A;  3RBY A;  5HZ8 A;  5HZ6 A;  1OEE A;  1GGL A;  2G78 A;  2FRS A;  2DJF A;  2QMI A;  5DG4 A;  3EM0 A;  3SZH A;  2C1Q A;  3NP1 A;  1T0V A;  1BJ7 A;  1SXY A;  3Q34 A;  4EKV A;  1EW3 A;  4AW8 A;  1KOI A;  4U46 A;  2X32 A;  2X4M A;  1YWC A;  3T6L A;  1LID A;  5HZQ A;  3KZA A;  4I3B A;  1Y9L A;  3VGW A;  5IXG A;  4EXZ A;  1OEJ A;  3WXQ A;  2IZD B;  3AKM A;  4MVE A;  4OS8 A;  5AJB A;  4ORR A;  4CDD A;  3ELZ A;  1TW4 A;  3P24 A;  2L5P A;  4IMO A;  2RTL A;  1CBI A;  4HPC A;  1GKA A;  1X8P A;  1S2P A;  4IAB A;  4JGL A;  4QGW A;  4GNY A;  2JU3 A;  1RBP A;  2MHD A;  3P6C A;  1BSQ A;  1KT6 A;  4ZHF A;  1ZNK A;  1RLB E;  1YWD A;  3WJD A;  2QOM A;  1GX9 A;  2X34 A;  4EFG A;  4CPE A;  2X45 A;  4O3X B;  1ALB A;  5B5G A;  4ZGU A;  4ZR2 A;  4INN A;  4COT A;  5BVT A;  1PBY A;  2Z4I A;  2OF9 A;  1HMR A;  1VWH B;  2K62 A;  1B56 A;  3MBT A;  4YCE A;  3K3L A;  4QGV A;  4FBR A;  2MO5 A;  3U0D A;  4NLI A;  2OVE A;  1BWY A;  3NPO A;  2EU7 X;  5H9N A;  4CPH A;  1NP1 A;  2IZF B;  4GJS A;  2VDF A;  2RCT A;  3ZW0 A;  1HMT A;  4U8U N;  1KGL A;  1MOY A;  1KL5 A;  4BVM A;  4O4S A;  4I60 A;  1O1V A;  1JV4 A;  3P6F A;  4MVK A;  4YGZ A;  4LQZ A;  2RTE B;  1T68 X;  3HOL A;  4GET A;  2RD7 C;  2IZL B;  3P6D A;  3SLJ A;  4QGX A;  1DZM A;  1HQP A;  3HK1 A;  3ZI8 A;  2JN3 A;  1LFO A;  2OFM X;  1IFB A;  3MM0 A;  4IB9 A;  4LZU A;  4XME A;  3ZUO A;  1SRH A;  1CBS A;  2G79 A;  3CKF A;  4O4U A;  2A3F X;  1BM5 A;  1EQD A;  1YUP A;  4LZV A;  4ID2 A;  4AZO A;  4ZHG A;  3STM X;  2LBA A;  3B2I A;  2MM3 A;  4ZHC A;  5F1E A;  1ZNG A;  3FA7 A;  2NND A;  5CE4 A;  4ORW A;  2UZ2 A;  4TNN A;  2HKD A;  1ICN A;  2WPU A;  4IB8 A;  3T2X A;  1SWJ A;  3RSW A;  1BRQ A;  3WOV A;  4XMG A;  4GD9 A;  4HFO A;  4MIS A;  3NQK A;  1SMP I;  1MDC A;  1HY2 A;  2ACO A;  2I5V O;  2IZI A;  3VG2 A;  3U03 A;  1DV9 A;  1VYG A;  5F58 A;  1ERB A;  2KTD A;  1B8E A;  1CBQ A;  4ORS A;  3BY0 A;  1N9Y A;  4O4O A;  3RDO A;  4ALO A;  1UYN X;  2Q39 A;  1EPB A;  2A13 A;  1FJ1 E;  2GJ5 A;  2RTF B;  4L3R A;  3UEW A;  3ZW1 A;  5KID A;  4BX7 A;  2NNQ A;  2RTH B;  1EAL A;  1I06 A;  5HCC C;  1D3S A;  5IRA A;  5HWZ A;  4I3C A;  1MUP A;  4AZQ A;  3FID A;  2ZAG A;  5KHP A;  2WWP A;  5LJC A;  2ACP X;  5D48 A;  3CBC A;  2JW1 A;  1SWR A;  2A2G A;  3PH5 A;  4TKH A;  4D6B A;  4YBP A;  2KD2 A;  1LIE A;  3APV A;  1W4T A;  1SLD B;  3JSQ A;  4AZN A;  1BLR A;  3TF6 A;  5LJD A;  4DCB A;  2X55 A;  3VE2 A;  1GKA B;  4HWM A;  2Y3E A;  1MEP A;  1TOU A;  3SAO A;  4YVB A;  3T1D A;  5LKE A;  1R0U A;  1O8V A;  4ORU A;  5FQ6 E;  2AF5 A;  2A2U A;  1G85 A;  2G7B A;  1ZRY A;  1KL4 A;  2GTL O;  4XMH A;  3NAD A;  3RE6 A;  2WUT A;  3S5X A;  3DTQ A;  3CKG A;  1FEL A;  1BSO A;  1N9M A;  5F2B A;  4I9R A;  1HXL A;  5LJG A;  2G5L A;  5IRU A;  1EII A;  1JQP A;  1YWA A;  4YBU A;  1G7N A;  1YP6 A;  1ZNH A;  2OFR X;  3BX8 A;  1QWD A;  3WJG A;  5L3Y A;  1O1U A;  2GH7 A;  3MVF A;  3IFB A;  3D96 A;  4HPA A;  4GK9 A;  5B3M O;  3VHH A;  2IZH B;  2OVD A;  1STR B;  1Y52 X;  3WZO A;  2OF8 A;  2JGS A;  3HTY A;  1NQN A;  4CPH B;  4XMF A;  2UYW A;  3ZW0 B;  4M6S A;  1SRJ A;  3FMZ A;  5K68 A;  3PEC A;  1VPR A;  4MEE A;  4QYN A;  1H91 A;  1E00 A;  3B2J A;  2VFC A;  4JNJ A;  2X8F A;  1SXW A;  1QFT A;  1SWF A;  3P6H A;  3ZW2 A;  1DC9 A;  3S5V A;  4QYP A;  1KT5 A;  1E5P A;  1LNM A;  2HZQ A;  5HAE A;  1TVQ A;  3FDC A;  2OYB O;  3MG5 A;  4D6A A;  1MX8 A;  2FS7 A;  4GU8 A;  5LJE A;  2OZQ A;  1SWC A;  3CWK A;  2CZT A;  1IIU A;  1SRF A;  2W2B A;  3UAQ A;  3KFH A;  1SA8 A;  1VWD B;  1VYO A;  2Q4N A;  2WQ9 A;  3FLL A;  4A1H A;  4KC8 A;  1ADL A;  4EQA C;  4FBO A;  4KH8 A;  1SWO A;  2FKG A;  3EBW A;  3B2H A;  1Y55 X;  3PK2 A;  5H8T A;  5EZ2 A;  5FEN A;  1SLF B;  4OEM A;  2RTR B;  4EDE A;  2HMB A;  2C4I A;  2R74 A;  2P8G A;  4CPI A;  2BLG A;  1KQX A;  2OVS A;  4TKJ A;  2ALL X;  2Q2M A;  3Q6L A;  2X56 A;  4Y0S A;  1JYJ A;  5EEE A;  4PSQ A;  4OKA A;  3FW5 A;  3LHN A;  3RZY A;  4GRJ A;  1FEN A;  4GZV A;  1GM6 A;  2A5B A;  1GX3 A;  1LCZ A;  1QY0 A;  5HTD A;  4NNT A;  1L6M A;  2JOZ A;  2FWV A;  1JJJ A;  2RTN B;  4GDA A;  4IAX A;  2QOS C;  4A1Y A;  1OBP A;  3ZW1 B;  4BX7 B;  3HOE A;  3BU1 A;  4NV7 A;  4U9C A;  3RE5 A;  4NYR A;  4KCA A;  3STK A;  2WQA E;  1SXU A;  3FEK A;  2FHL A;  4QAE A;  1SRE A;  2WEW A;  2OY1 O;  3WYP A;  4BBO A;  1CBR A;  3STN A;  1CRB A;  2LKK A;  2IZB A;  4NW4 A;  3FEN A;  3WYQ A;  2QCB A;  3ZUI A;  1N43 A;  1LDQ A;  1SY0 A;  3WJE A;  2FS6 A;  2WSJ A;  1MVG A;  1YWB A;  4ZJ0 A;  4YGG A;  4ODD A;  4M7M A;  1QY1 A;  3RDQ A;  4O9S A;  4BOE A;  1NDJ A;  1LEL A;  1VWI B;  1SWH A;  2WEX A;  2E4J A;  1OEK A;  3G7X A;  1HN2 A;  4YFQ A;  3RWX A;  2QM9 A;  3B2L A;  4TLJ A;  2X8T A;  2GC9 A;  1SLG B;  1P6P A;  3I0A A;  3UEX A;  2C1S A;  4O3Z A;  1SWS A;  3EW2 A;  4YKM A;  1XKI A;  4WHI A;  4Y59 A;  1SXX A;  2A8G A;  2AT5 X;  4Y5D A;  4BCS A;  3F9D A;  4ZGF A;  3OJY C;  1FEM A;  1LUQ A;  3B2K A;  4GUZ A;  2X46 A;  1VWF B;  2IZG B;  3PQS A;  3T6F A;  4N7D A;  1G5W A;  2OFA A;  1Y53 X;  3TGC A;  1JJU A;  1I78 A;  1X8O A;  4GE1 A;  4O49 A;  2IZJ A;  3EYC A;  2W2F A;  1UZ2 X;  4FGI B;  3KVN A;  4AZP A;  1STP A;  2OVA A;  5LJB A;  3KFI A;  3VHI A;  2OY7 A;  1A18 A;  4ZHH A;  2IFB A;  3C77 X;  5CSE A;  2OL7 A;  1GT4 A;  1W6F A;  3I17 A;  4NV8 A;  1ZNE A;  1HQQ A;  1DF8 A;  4WFV A;  3OBL A;  3V8U A;  4IB7 A;  1NQM A;  2ANS A;  1VWE B;  1W5R A;  1SWK A;  4U8U M;  3VG5 A;  4A8Z A;  4TQ2 A;  4I6S A;  3CQR A;  1KFF A;  4TJZ A;  1VWN B;  1OPB A;  5F7G A;  2BT9 A;  1X8Q A;  2KTS A;  2RTQ B;  2XST A;  4JHQ A;  4LKP A;  3ELX A;  2RTB B;  4BX6 A;  2M4L A;  1XCA A;  3FA6 A;  1AQB A;  1AVD A;  2RTC B;  4NLJ A;  1Y9T A;  1VYF A;  3O2Y A;  4KT5 A;  2RTI B;  1X8N A;  1T8V A;  4YMY A;  1KT4 A;  1B4M A;  1VWJ B;  2POA A;  2ZAI A;  2L9C A;  4Y0R A;  4RUU A;  5IRW A;  3LTW A;  1E06 A;  3SLT A;  4ARH A;  3NBX X;  1D2U A;  1KZX A;  4ORX A;  4NP1 A;  3H3I A;  4Y0P A;  5JD2 A;  1OPA A;  2LFO A;  1LPJ A;  4GKC A;  2Z4H A;  2FR3 A;  2RQ0 A;  5EDB A;  3T2W A;  5K06 A;  1AVE A;  1E02 A;  1X89 A;  3BU9 A;  5HA0 A;  4FBV A;  5IO7 A;  3C78 X;  3VPJ E;  3AKN A;  2W2A A;  1HMS A;  3D4R A;  5CYB A;  1MM9 A;  2JU7 A;  2Y3F A;  1GT5 A;  5CHK A;  2Y32 A;  3UEV A;  4B55 A;  3BLG A;  2RCQ A;  2AMM X;  1JMX A;  4L1N A;  1PTS A;  3PP6 A;  5FQ8 E;  4IBA A;  3E3C A;  4CDC A;  3PH6 A;  4DNE A;  5IO5 A;  1K3B A;  1VWM B;  5B11 O;  4IAW A;  3KFF A;  4O3Y A;  5LJH A;  1EIO A;  1Y0G A;  1ICM A;  2GTL N;  2NNE A;  3LV4 A;  4YFR A;  4ZHD A;  4YKO A;  2RTP B;  4ZH6 A;  5BVQ A;  2AT6 X;  1GXA A;  3WZQ A;  3VG7 A;  2FKJ A;  4C5P A;  2G8C O;  4AYH A;  1BSY A;  2QO6 A;  2O62 A;  3EBK A;  2NP1 A;  2WR6 A;  1JYD A;  2IZE B;  3O22 A;  3OE3 A;  4KC7 A;  1JZU A;  2F73 A;  2RN4 A;  2QO5 A;  1SWQ A;  4WBK A;  1JIW I;  3NR3 A;  1NBX A;  1UYO X;  2GTF X;  3RY1 A;  3WJF A;  2AL0 X;  2AT0 X;  3FYF A;  4Z2O A;  2I5Z O;  2LA7 A;  1IW2 A;  1ERX A;  4GGT A;  3WJB A;  5AQ6 A;  2OL8 O;  1VWR B;  1JMZ A;  1WBI A;  2BC3 A;  1MX7 A;  4BX5 A;  2CBR A;  5IO6 A;  4RUN A;  2RTJ A;  3AUM O;  3WBG A;  1N7Y A;  4AZR A;  2CAM A;  1OSP O;  4K19 A;  4XMC A;  2RTA A;  1SRI A;  4ZCB A;  3N91 A;  5B2A O;  3SOT A;  5K67 A;  5L8O A;  5FAZ A;  1SY1 A;  4BGF A;  1SWA A;  3FA8 A;  3APW A;  5HZ9 A;  1RST B;  4FQB B;  2JU8 A;  1ZND A;  3PPT A;  5F6Z A;  5C0N A;  1FTP A;  3RDX A;  1LF7 A;  1LCV A;  1U0X A;  2OY5 O;  3U9P C;  1HBP A;  4CSB A;  1PBO A;  3APU A;  1ML7 A;  1IKJ A;  1AB0 A;  5D8J A;  1SY3 A;  5HCE C;  4OS0 A;  1MK5 A;  1SWB A;  4ZFX A;  3F8A A;  5EPQ A;  4Z2P A;  3EMM A;  2FR2 A;  5B29 A;  3O19 A;  3S60 A;  1A2D A;  2FHN X;  4BX6 B;  1QG5 A;  1SRG A;  2A5C A;  1ZNL A;  1K24 A;  3APX A;  2BS6 A;  2AT8 X;  5HBS A;  4U3Q A;  4YFP A;  1LIF A;  3CQN A;  4CDF A;  1E2T A;  3FR5 A;  1Z24 A;  1X8U A;  2QO4 A;  1YIV A;  1BBP A;  3CR6 A;  2BHV A;  5B10 O;  3X00 A;  4I95 A;  3PQU A;  1LIB A;  1URE A;  1GT3 A;  1KT3 A;  2RTO B;  3IA8 A;  3GAQ A;  3VU1 A;  1JBH A;  1QY2 A;  4I9S A;  2IZA A;  4N7C A;  2Q2P A;  4QZT A;  5KIC A;  1SWD A;  2HYS A;  3P6G A;  1VWO B;  1A3Y A;  1SWT A;  1STS B;  2F09 A;  1G74 A;  1ACD A;  2OL6 O;  1VWG B;  3HWD A;  3JQO A;  4OS3 A;  3D95 A;  3RKG A;  4CPF A;  4EEJ A;  5AEO A;  1KQW A;  4TKB A;  2VFB A;  2DM5 A;  3D97 A;  3SLO A;  1JJX A;  3FR2 A;  3RDU A;  4GGR A;  1BRP A;  1QFV A;  3KQ0 A;  4IRW A;  3AEH A;  3NX1 A;  4U8U O;  1U18 A;  2ASN X;  1IFC A;  1OBQ A;  3D9W A;  4IMN A;  1FDQ A;  4LKT A;  5F6B A;  1DFV A;  1VWK B;  5H9A A;  1PM1 X;  5D47 A;  4CV7 A;  2MF6 A;  1I4U A;  1LIC A;  3HWF A;  1EUO A; 
#chains in the Genus database with same CATH homology
 4BQU A;  1U17 A;  3OD9 A;  1KXO A;  1FE3 A;  2RA6 A;  3TZS A;  3FR4 A;  3WJC A;  1QQS A;  1LKE A;  1AEL A;  4ON1 A;  2AT3 X;  5EED A;  3DSZ A;  4O4X A;  4R0B A;  4I3D A;  4ML7 B;  5BVS A;  4QQ1 A;  1EI5 A;  2BS5 A;  1GT1 A;  3UEU A;  3VG6 A;  5DPQ A;  1TOW A;  4O3W A;  2AH7 X;  1B0O A;  3S26 A;  3L4R A;  4OMW A;  2K23 A;  2FLJ A;  4KII A;  4ES7 A;  3JS1 A;  4ZH9 A;  5L8I A;  2XKL A;  3CMP A;  5H9L A;  3KFG A;  4HPB A;  1AVG I;  2CBS A;  1DZJ A;  2MWH A;  4NYQ A;  4QNI A;  4GH7 A;  3TGA A;  4CK4 A;  1OBU A;  3NX2 A;  4ALB A;  3PED A;  4MVI A;  2A0A A;  4DQ4 A;  1QAB E;  2CZU A;  2R56 A;  2HNX A;  4UU3 A;  4XMD A;  4YH0 A;  4WFU A;  2N93 A;  2CM4 A;  5B27 A;  1KZW A;  4GNW A;  3VE1 A;  5HA1 A;  4MIR A;  3FW4 A;  4UU2 A;  5D4A A;  2YMS A;  3TGB A;  1YP7 A;  4QZU A;  1NGL A;  4Y0Q A;  5LKF A;  1CJ5 A;  3CBS A;  4GDZ A;  4OMX A;  1TXL A;  3ZZV A;  1PMP A;  3NQ9 A;  3P6E A;  2KT4 B;  4NNS A;  3BRN A;  4YDB A;  1DF3 A;  5HCD C;  3FA9 A;  3BX7 A;  3FEP A;  2KW1 A;  2LB6 A;  2AKQ A;  3F6Z B;  3VG4 A;  3HWG A;  4A60 A;  4YCH A;  1I05 A;  1EPA A;  2CM9 A;  1S7D A;  4QRL A;  4AZM A;  3C76 X;  2Q9S A;  3QKG A;  5JR8 A;  1IKE A;  1DZK A;  2FT9 A;  5EDC A;  4PJ2 A;  5HZ5 A;  5LJK A;  4IB6 A;  4YGH A;  1N0S A;  5L8N A;  3GE2 A;  1X71 A;  1BEB A;  5FFH A;  5H9K A;  2FTB A;  5HTE A;  5D45 A;  3NQ3 A;  3VG3 A;  3P02 A;  2L68 A;  4MVL A;  2PY1 A;  1HBQ A;  1S44 A;  2JMB A;  1PEE A;  3BS2 A;  2X8S A;  2L67 A;  2R73 A;  5AJC A;  1A57 A;  3FEL A;  1KT7 A;  3BSZ E;  2MJI A;  1GX8 A;  3HWE A;  2YG2 A;  1I04 A;  2HZR A;  4DQ3 A;  3ZQ3 A;  3FIQ A;  2GTL M;  2LBV A;  4YDA A;  3MX7 A;  4HPD A;  4ORY A;  5FQ7 E;  2HLV A;  1NP4 A;  1SY2 A;  1DZP A;  1EXS A;  3BDR A;  3WVM A;  5BYP A;  3ZWE A;  3RBY A;  5HZ8 A;  5HZ6 A;  1OEE A;  1GGL A;  2G78 A;  2FRS A;  2QMI A;  5DG4 A;  3EM0 A;  3NP1 A;  1T0V A;  1BJ7 A;  1SXY A;  1EW3 A;  4AW8 A;  1KOI A;  1YWC A;  1LID A;  5HZQ A;  3KZA A;  4I3B A;  1Y9L A;  4EXZ A;  1OEJ A;  3WXQ A;  3AKM A;  4MVE A;  4OS8 A;  5AJB A;  4ORR A;  3ELZ A;  1TW4 A;  3P24 A;  2L5P A;  4IMO A;  1CBI A;  4HPC A;  1GKA A;  1X8P A;  1S2P A;  4IAB A;  4JGL A;  4QGW A;  4GNY A;  2JU3 A;  1RBP A;  2MHD A;  3P6C A;  1BSQ A;  1KT6 A;  4ZHF A;  1ZNK A;  1RLB E;  1YWD A;  3WJD A;  1GX9 A;  4EFG A;  2X45 A;  4O3X B;  1ALB A;  4ZGU A;  4ZR2 A;  4INN A;  4COT A;  5BVT A;  2Z4I A;  1HMR A;  2K62 A;  3MBT A;  1B56 A;  4YCE A;  3K3L A;  4QGV A;  4FBR A;  2MO5 A;  3U0D A;  4NLI A;  2OVE A;  1BWY A;  3NPO A;  2EU7 X;  5H9N A;  1NP1 A;  2RCT A;  3ZW0 A;  1HMT A;  4U8U N;  1KGL A;  4BVM A;  4O4S A;  1O1V A;  1JV4 A;  3P6F A;  4MVK A;  4YGZ A;  4LQZ A;  3HOL A;  1T68 X;  4GET A;  2RD7 C;  3P6D A;  4QGX A;  1DZM A;  1HQP A;  3HK1 A;  3ZI8 A;  2JN3 A;  1LFO A;  2OFM X;  1IFB A;  4XME A;  4IB9 A;  4LZU A;  3ZUO A;  1CBS A;  2G79 A;  4O4U A;  2A3F X;  1BM5 A;  1EQD A;  1YUP A;  4LZV A;  4ID2 A;  4AZO A;  4ZHG A;  3STM X;  2LBA A;  3B2I A;  2MM3 A;  4ZHC A;  5F1E A;  1ZNG A;  3FA7 A;  2NND A;  5CE4 A;  4ORW A;  4TNN A;  3WOV A;  1ICN A;  4IB8 A;  3RSW A;  1BRQ A;  4XMG A;  4HFO A;  4MIS A;  3NQK A;  1SMP I;  1MDC A;  3VG2 A;  2ACO A;  3U03 A;  1DV9 A;  1VYG A;  5F58 A;  1ERB A;  2KTD A;  1B8E A;  1CBQ A;  4ORS A;  3BY0 A;  4O4O A;  4ALO A;  2Q39 A;  1EPB A;  2A13 A;  4L3R A;  2GJ5 A;  3UEW A;  5KID A;  3ZW1 A;  2NNQ A;  1EAL A;  1I06 A;  5HCC C;  1D3S A;  5HWZ A;  4I3C A;  1MUP A;  4AZQ A;  5LJC A;  2ZAG A;  5KHP A;  2WWP A;  2ACP X;  5D48 A;  3CBC A;  2JW1 A;  2A2G A;  3PH5 A;  4TKH A;  4D6B A;  4YBP A;  2KD2 A;  1LIE A;  3APV A;  4AZN A;  1BLR A;  3JSQ A;  3TF6 A;  5LJD A;  3VE2 A;  1GKA B;  4HWM A;  3SAO A;  1TOU A;  5LKE A;  3T1D A;  1R0U A;  1O8V A;  4ORU A;  5FQ6 E;  2A2U A;  1G85 A;  2G7B A;  1ZRY A;  2GTL O;  4XMH A;  3NAD A;  3S5X A;  2WUT A;  3DTQ A;  1FEL A;  1BSO A;  5LJG A;  4I9R A;  1EII A;  1YWA A;  4YBU A;  1G7N A;  1YP6 A;  1ZNH A;  2OFR X;  3BX8 A;  1QWD A;  3WJG A;  1O1U A;  3MVF A;  4HPA A;  3IFB A;  3D96 A;  4GK9 A;  2OVD A;  3HTY A;  4XMF A;  3ZW0 B;  4M6S A;  3FMZ A;  3PEC A;  1VPR A;  4QYN A;  1H91 A;  1E00 A;  3B2J A;  2X8F A;  1SXW A;  1QFT A;  3P6H A;  3ZW2 A;  1DC9 A;  3S5V A;  4QYP A;  1KT5 A;  1E5P A;  1LNM A;  2HZQ A;  5HAE A;  1TVQ A;  4D6A A;  5LJE A;  1MX8 A;  2FS7 A;  4GU8 A;  2OZQ A;  3CWK A;  2CZT A;  1IIU A;  2W2B A;  3UAQ A;  3KFH A;  1SA8 A;  2Q4N A;  2WQ9 A;  3FLL A;  4A1H A;  4KC8 A;  1ADL A;  4EQA C;  4FBO A;  4KH8 A;  3EBW A;  3B2H A;  5H8T A;  5EZ2 A;  5FEN A;  4EDE A;  2HMB A;  2R74 A;  2P8G A;  2BLG A;  1KQX A;  2OVS A;  4TKJ A;  2ALL X;  2Q2M A;  3Q6L A;  4Y0S A;  5EEE A;  1JYJ A;  4PSQ A;  3FW5 A;  3LHN A;  3RZY A;  4GRJ A;  1FEN A;  4GZV A;  1GM6 A;  1QY0 A;  5HTD A;  4NNT A;  1L6M A;  2JOZ A;  2FWV A;  1JJJ A;  4IAX A;  2QOS C;  4A1Y A;  1OBP A;  3ZW1 B;  3HOE A;  3BU1 A;  4U9C A;  4NYR A;  4KCA A;  3STK A;  2WQA E;  1SXU A;  3FEK A;  4QAE A;  2WEW A;  1CBR A;  3STN A;  1CRB A;  2LKK A;  4NW4 A;  3FEN A;  3ZUI A;  1SY0 A;  3WJE A;  2FS6 A;  2WSJ A;  1MVG A;  1YWB A;  4ZJ0 A;  4YGG A;  4ODD A;  4M7M A;  1QY1 A;  4BOE A;  4O9S A;  1JBH A;  2WEX A;  2E4J A;  1OEK A;  3G7X A;  1HN2 A;  4YFQ A;  3RWX A;  2QM9 A;  3B2L A;  4TLJ A;  2X8T A;  2GC9 A;  1P6P A;  3I0A A;  3UEX A;  4O3Z A;  4YKM A;  1XKI A;  4WHI A;  1SXX A;  2AT5 X;  4ZGF A;  3F9D A;  3OJY C;  1FEM A;  3B2K A;  2X46 A;  3PQS A;  1G5W A;  4N7D A;  3TGC A;  1X8O A;  4GE1 A;  4O49 A;  3EYC A;  2W2F A;  1UZ2 X;  4FGI B;  4AZP A;  2OVA A;  5LJB A;  3KFI A;  1A18 A;  4ZHH A;  2IFB A;  3C77 X;  1GT4 A;  3I17 A;  1ZNE A;  4WFV A;  3OBL A;  3V8U A;  4IB7 A;  2ANS A;  3VG5 A;  4U8U M;  4A8Z A;  4TQ2 A;  4I6S A;  3CQR A;  4TJZ A;  1OPB A;  5F7G A;  2BT9 A;  1X8Q A;  2KTS A;  2XST A;  4LKP A;  3ELX A;  2M4L A;  1XCA A;  3FA6 A;  1AQB A;  4NLJ A;  1Y9T A;  1VYF A;  3O2Y A;  4KT5 A;  4YMY A;  1X8N A;  1T8V A;  1KT4 A;  1B4M A;  2POA A;  2ZAI A;  2L9C A;  4Y0R A;  4RUU A;  1E06 A;  4ARH A;  3NBX X;  1D2U A;  1KZX A;  4ORX A;  4NP1 A;  3H3I A;  4Y0P A;  1OPA A;  2LFO A;  1LPJ A;  4GKC A;  2Z4H A;  2FR3 A;  2RQ0 A;  5EDB A;  5K06 A;  1X89 A;  1E02 A;  3BU9 A;  5HA0 A;  4FBV A;  5IO7 A;  3C78 X;  3VPJ E;  3AKN A;  2W2A A;  1HMS A;  3D4R A;  5CYB A;  2JU7 A;  1GT5 A;  3UEV A;  3BLG A;  2RCQ A;  2AMM X;  4L1N A;  3PP6 A;  5FQ8 E;  4IBA A;  3E3C A;  3PH6 A;  5IO5 A;  4IAW A;  3KFF A;  4O3Y A;  5LJH A;  1EIO A;  1ICM A;  2GTL N;  2NNE A;  3LV4 A;  4YFR A;  4ZHD A;  4YKO A;  4ZH6 A;  5BVQ A;  2AT6 X;  1GXA A;  3VG7 A;  4AYH A;  1BSY A;  2QO6 A;  2O62 A;  3EBK A;  2NP1 A;  2WR6 A;  1JYD A;  3O22 A;  3OE3 A;  4KC7 A;  1JZU A;  2F73 A;  2RN4 A;  2QO5 A;  4WBK A;  3WJF A;  1JIW I;  3NR3 A;  2GTF X;  2AL0 X;  2AT0 X;  3FYF A;  2LA7 A;  1IW2 A;  1ERX A;  3WJB A;  5AQ6 A;  5IO6 A;  1MX7 A;  2CBR A;  4RUN A;  3WBG A;  4AZR A;  4K19 A;  4XMC A;  4ZCB A;  3SOT A;  5L8O A;  3N91 A;  5FAZ A;  1SY1 A;  3FA8 A;  3APW A;  5HZ9 A;  4FQB B;  2JU8 A;  1ZND A;  3PPT A;  5F6Z A;  5C0N A;  1FTP A;  1LF7 A;  1U0X A;  3U9P C;  1HBP A;  4CSB A;  1PBO A;  3APU A;  1ML7 A;  1IKJ A;  1AB0 A;  5D8J A;  1SY3 A;  5HCE C;  4OS0 A;  4ZFX A;  3F8A A;  5EPQ A;  3EMM A;  2FR2 A;  5B29 A;  3O19 A;  3S60 A;  1A2D A;  1QG5 A;  1ZNL A;  3APX A;  2BS6 A;  2AT8 X;  5HBS A;  4U3Q A;  4YFP A;  1LIF A;  3CQN A;  3FR5 A;  1Z24 A;  1X8U A;  2QO4 A;  1YIV A;  1BBP A;  3CR6 A;  2BHV A;  4I95 A;  3PQU A;  1LIB A;  1URE A;  1GT3 A;  1KT3 A;  3IA8 A;  3VU1 A;  3GAQ A;  1QY2 A;  4I9S A;  4N7C A;  2Q2P A;  4QZT A;  5KIC A;  3P6G A;  2HYS A;  1A3Y A;  4OS3 A;  2F09 A;  1G74 A;  1ACD A;  3HWD A;  3JQO A;  3RKG A;  5AEO A;  3D95 A;  4EEJ A;  1KQW A;  4TKB A;  2DM5 A;  3D97 A;  1JJX A;  3FR2 A;  1BRP A;  1QFV A;  3KQ0 A;  3NX1 A;  4U8U O;  1U18 A;  2ASN X;  1IFC A;  1OBQ A;  4IMN A;  5F6B A;  1FDQ A;  4LKT A;  5H9A A;  1DFV A;  1PM1 X;  5D47 A;  4CV7 A;  1I4U A;  1LIC A;  3HWF A;  1EUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...