3DT6A

Crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by paraoxon
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQSEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Brain Platelet-activating factor acetylhydrolase IB subunit
total genus 76
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dt6A00
1ESCA 4K3UA 4RW0A 3U37A 3PT5A 3KVNA 5BN1A 1DEOA 2Q0QA 3RJTA 5A4AA 3HP4A 4IYJA 2HSJA 5HOEA 4HYQA 3SKVA 4JJ4A 4K40A 1IVNA 4HF7A 4S1PA 5CD9A 5JD3A 1DEXA 3BZWA 1FXWF 4TX1A 1BWQA 4K9SA 5B5SA 3MILA 1FXWA 1ESDA 4Q7QA 4DEVA 1BWRA 2W9XA 4JGGA 4H08A 4PPYA 1PP4A 4OAOA 4OAPA 2APJA 1K7CA 3DT8A 1ZMBA 4K7JA 3P94A 2WAOA 3DT9A 3SLRA 1V2GA 2WAAA 1BWPA 2Q0SA 3DT6A 3W7VA 1YZFA 1ES9A 1Z8HA 3C1UA 1ESEA 1U8UA 1WABA 3DCIA 1J00A 3DC7A 4I8IA 4M8KA 4JHLA 1VJGA 4NRDA 4JJ6A 1VYHA 4LHSA 4RSHA 4XVHA 1JRLA 2O14A 2VPTA 4Q9AA 2WABA 4JKOA
chains in the Genus database with same CATH superfamily
3P2EA 4AKIA 1Q0SA 1PFGA 2V6FA 3HMKA 3NU1A 1CNEA 4B3XA 2A86A 1M0TA 2UYOA 2O2GA 1OV4A 2ZSAA 4OEHA 4G5HA 4RMGA 3AVWA 2JGNA 2RGYA 4HZUB 1IQ0A 2RGWA 3ZVNA 2A9OA 4QAQA 1FSGA 1BVHA 2YHAA 2SHKA 3L18A 4UTXA 1BX0A 4RZIA 4FOSA 3BD7A 4Y9TA 4YJ3B 1XTQA 2ZTVA 5JISA 1N1MA 2GPNA 3P0IA 2VO1A 1M10A 2DPGA 1OD6A 1U2EA 3DXXA 4O8CA 4MMYB 3RFUA 3ODPA 5BNWA 3OHSX 1UK7A 4AO6A 1EVYA 1TCUA 2ZJYA 1I1QB 5LVAA 3VHQA 5IBQA 1OLUB 4UOQA 1R3UA 3COYA 1RI4A 1YU6A 2Q3LA 5I01A 3TZKA 1Z7WA 1PG0A 2YHBA 4P92A 4NCAA 4KPFC 4JYPA 2O06A 1SKUA 1NDHA 2X5XA 2HX1A 4WCFC 3D2CA 4F72A 2GHIA 3PFBA 2DWPA 1KBQA 1E96A 3ROXA 1T8WA 3CV3A 3W8DA 3CMMA 5DGIA 5CD1A 3COSA 4PQEA 3T94A 2Z4TA 1CUAA 4NMXB 1XVVA 4JP5A 1IUNA 1KRWA 3W9SA 2VC2B 4NG4A 1BX1A 1JJBA 4FDTA 1QCCA 3CO5A 1U2QA 3WNQA 3CJTA 1WLSA 3S1AB 3CEMA 2PBZA 2JARA 2OWDA 3E3OA 4ER0A 2NU7B 4WRRA 1KAHA 4XX0B 2H1RA 1SVNA 2NQTA 4IO0A 5FEMA 5FNVA 4GMXA 4NBRA 5DMXA 4KUGA 1Z4IA 3ZGVA 2HU2A 1HG0A 5KYUA 3E8MA 4PYRA 2ZCJA 2C1ZA 5DYYA 2ERXA 4NAUA 4P0PB 4EAQA 1C1XA 1U28C 4YFVA 4LJ5A 1W1IA 4W8OA 1E79A 3PTAA 3AOEA 3PK0A 1Y6FA 3KTOA 1SHKA 1DQZA 2F43B 1M8FA 3M34A 4TUYB 4EB3A 4ZI5A 3JWHA 2B94A 1EUDB 1MO3A 3BGIA 3EODA 4LHZA 2W48A 5CM8B 3RVPA 3S2FA 3WHKA 3L0CA 3GLGE 3IP1A 2JGIA 1R5JA 1QF7A 4HGYA 2A4KA 1SR8A 5DP2A 1Q1AA 3RUCA 3CH6A 4EENA 1UJ5A 4LF4B 2FCRA 2AS0A 3DCJA 4JP8A 5A5GA 5L3QB 3AEZA 5IT5A 3K5PA 1GSIA 4QLBA 2V55B 4GPTA 2XHZA 4HXEB 2QZ4A 2DFLA 2HWUA 2NSDA 2V6IA 4CEIB 1P9OA 3CUWA 1W6UA 3QHPA 1RM0A 2W8BA 4DRXA 1J99A 3A6PC 1SVWA 1T8PA 1D0SA 1WBJB 2HJSA 3RIGA 2HV8A 1LPNA 5FNZA 1XZDA 8OHMA 3HN7A 4P32A 1IE3A 3WR5A 4RTSA 4UEKA 2AQHA 3MJVA 4BRSA 2C77A 4J91A 3ZDXB 2BM8A 2QR5A 3QJ5A 4UHFA 5CDSA 2OBBA 1E6LA 2VAWA 3WMXA 1ZIDA 4X7RA 1U6KA 4C2BA 2P4UA 1X19A 4X6UA 2IEZA 1CD5A 4ZVPA 1HKHA 1NW6A 1RBMA 4OXXA 1IIBA 3KYDB 1O95D 5MGNA 2ZDGA 1SFRA 1BC5A 3KQLA 1SD1A 4AKGA 2V6JA 1GDHA 3DV0A 2CLCX 3ABQB 3NAMA 3T3DA 3SEZA 1XK7A 1QTQA 3ZPXA 4DYDA 1NFFA 4LNHA 4UTPA 3KVNA 3NHLA 2BZGA 4IGKA 3NHMA 4KIWA 1L6IA 2GJKA 4ZI7B 4M8LA 1Z0JA 2VWPA 2F3QA 3R3SA 5HDQA 3A7EA 3RLFA 1F38A 3I2IA 2WSYB 1LSSA 3LO5A 3LX8A 4FEGA 1B1CA 3G68A 2ORVA 3NO4A 4JSYA 2YFKA 3RJ9A 4K40A 4EHLA 1R0LA 3BFJA 2X6TA 3E1KA 4FD2A 4R9SA 4S1PA 4J0DA 4X8OA 2I4IA 3AFIA 4UCWA 3PNBA 1ND6A 3VC3A 1AM4D 4ND4A 5G3ZA 1SA0B 1LZKA 3EJWA 3T5CA 4Z4EA 3V9PA 4QBTA 4W7SA 4OHRA 4Y9DA 3X1DA 1TYCA 3TSWA 3HSSA 3MJRA 2AMLA 1QFSA 2ALJA 3I9V1 1JEQB 2CBGA 3K1JA 4LWZA 5FX2A 1N5RA 1QIJA 2WJPA 4RS3A 2WYIA 2XWBF 4U63A 1HTWA 1YI1A 4GP6A 2IHKA 5FOTA 5IH7A 3RVLA 5B3KA 4RETA 2O1WA 4LYGA 2BP7A 3K1ZA 4LHYA 4WGGA 1WR8A 3FA2A 4QXMA 5LPNA 3B38A 4W5NA 2FRVA 5LLTA 4WJKB 2R6HA 1PHPA 3WZLA 3DW1X 3DOFA 3CRRA 3H42B 5EWLA 4P7JA 2W6OA 1XO1A 3TR6A 3HKCB 3I04A 4AT1A 4JYZA 3PENA 1Q91A 5DNAA 1Y8ZA 3LYAA 1JHRA 1T8YA 4AJHA 3KZOA 2P9EA 3N7AA 3RQIA 2WNIA 1Z35A 4JQSA 2YYSA 3MOGA 4QYXA 2ZIXB 3VSBA 4P08A 3Q87B 1C4WA 1PZMA 2HBRA 2JAHA 3MT7A 4KXWA 5CPBA 4EGFA 4W5RA 2G40A 3L1JA 3OZWA 4O2RA 2ORED 2J3KA 3C98A 1JIXA 3KOZA 3LNTA 5FLEX 4Y2JA 1GG9A 1UEXC 1XZHA 3AI7A 3G1UA 3LBFA 4WLVA 3JTMA 2XKAA 1M1UA 1QX4A 4MH0R 2HMTA 2L19A 3OF2A 3QMWA 2A0KA 4JBGA 3FGNA 1T0PA 1CDOA 2EGHA 4IHJA 2GHTA 4Q4AB 3U4AA 1F51E 3KKZA 4DM4A 4PW0A 4LQCA 4MS4A 4AZVA 2BEUB 1Y9EA 3AUKA 4R1NA 5KNBD 4EL0A 1RJGA 1WZ2A 1E18A 1DHRA 5BV0A 3EPJA 1E0DA 4WA7A 3C3PA 3LCJA 4NXMB 5KTPA 2BSQA 2D5AA 5DYIA 1LLCA 2CNOA 2ZSJA 3RU9A 1JI3A 3PS9A 1H9BA 5CB4F 3PRHA 2ZU6A 3B20A 3FDZB 2AUTA 2VUHB 4G81A 5KWSA 2JAOA 4JP2A 1KBOA 1YMUA 3ZXXA 2WJJA 1PT9A 1XEXB 3LUBA 5IANA 3E3LA 3AHCA 3VU9A 4AJNA 1HDCA 1T6XA 1DO8A 2ZWOA 5DHTA 4ARZB 5EIWA 1U6JA 3JY6A 4CKWB 1AHNA 1Q50A 4DQDA 1WPGA 4UC0A 1NLZA 2C98A 1HT1E 2LDXA 4BLPA 4BZPA 4KSYA 5BUCA 5DB4A 1O0SA 1GDTA 4L7QA 1SKYB 1MMFB 4KTTE 4N03A 3W90A 3W2TA 3PJDA 2QLTA 3E4DA 3VYWA 3U7IA 2X2EA 1TZCA 3MMPA 4XB1A 1SWWA 1JG2A 3W4JA 3WRYA 4LVOA 4A9AA 2WILA 3PEEA 4NY1A 3LHIA 2NPOA 4JP1A 4HVLA 2O2IA 1N6LA 2RHTA 4BNUA 1VJ0A 4X66B 2XLBA 2Y1FA 1MXHA 2OCDA 3G8AA 1I2MA 1Y7LA 1ZY2A 2W58A 1P3DA 2HXYA 3KT3A 3MT9A 4TWJA 4UEQA 4PSKA 1ADGA 4IQGA 3IPYA 3KB6A 4D42A 4QYIB 5J2TB 4K0KB 1R27A 3OU6A 1G98A 2JAXA 3URMA 2OCBA 2DCMA 3ZWQA 4B7CA 2GBIA 4QG7A 1L4KA 4QGGA 1OR8A 1X7WB 3CZAA 1U11A 4BWYA 3BL6A 1MX9A 4EJ6A 4JH0A 3SC2A 3LT1A 5BWNA 1BIFA 4BLSA 2YMMA 3O4HA 4DUGD 4GZMA 4MPDA 4UM7A 4BZXA 721PA 5KUTA 4FFNA 3TN7A 2FSUA 1K1EA 5CT8A 3E7WA 1CEYA 5C34B 2XUIA 4MR9B 1N3BA 1GFZA 2F3UA 1DKMA 3LA6A 3OM8A 2RGEA 1XTUA 3FH0A 4PHCA 4JSRA 5BMOA 5L53A 1TVKB 2ZJ0A 2O8EB 5BVHB 2WAYA 1WB9A 2AFIE 1JLKA 4C29A 4EG1A 1FY2A 1WDWB 2DTDA 2IF0A 1NLYA 4Y9SA 4B6OA 3LLUA 2GPJA 1CNFA 2YJ4A 4WKNA 4NE9A 4AZSA 2Z1MA 4NPHA 3A3KA 1YXMA 3AKEA 2APJA 3DTVB 1JEQA 2BHTA 3KBBA 4J0KA 3WWDA 3H9EO 5G0VA 3QOWA 1QH8B 4NCIA 4EY8A 3SBOA 1FS5A 1JQBA 3EUAA 2W70A 3QKSB 1LNZA 4R8LA 4RLSA 3FY4A 2B1RA 5IAAA 1HNXB 2G1AA 1PR3A 1ES9A 1NYRA 1USGA 4QOFA 1J2TA 4Z86A 1KAGA 1A2OA 1XMPA 4LHXA 1CRWG 3V97A 3IUJA 2QYHA 3PQ8A 2OQVA 1O9BA 4LRYA 5FPQA 3T5GA 4B34A 4Z4QA 1ZITA 1Y6GA 4II2A 5KMGB 1P6QA 4IQ8A 4FOOA 1EH5A 5E3IA 4ZMRA 2CFRA 2WKWA 5D85A 2P30A 2GRJA 3OWHA 4ZOEA 1JDUA 3WKCA 1T0BA 4N5HX 4PNHA 4X9XA 1H2EA 1MAWA 2ID7A 1Z0IA 4JLOA 3SZOA 3C45A 4AI6A 3HCPA 1PLJA 3T9BA 3PJGA 1KO7A 3ROGA 1JQDA 1N8NA 1RWVA 4QTTB 3U3ZA 4A2WA 5GJBA 2DP4E 5CW2A 4WBNB 2QJFA 2CLOB 2OBXA 1KO8A 1LLUA 1T9AA 2PS9A 2GZMA 2PMFA 3C1TA 3QWHA 3MUOA 4Q19A 1U9ZA 2Z2KA 4QU8A 3ZCXA 2ES4A 1E2QA 4RQTA 2A84A 5EHIA 4ALIA 1CW2B 2OV8A 1SOUA 1YU9A 1EHYA 3L46A 3IOEA 2YQZA 3HP7A 4Q9AA 3OFSA 2FMHA 2BV3A 4WN9B 3WRXC 4GFDA 2PHZA 3PX7A 4WZBA 2PJUA 4IMJB 1XZFA 1JHPA 4KX5A 1UXJA 3EIQA 4LJ7A 4PLPA 1MG5A 2XUPA 1M0WA 1PUIA 1K5PA 3BTVA 4FZRA 4RELA 3WDSA 3NIGB 4GKVA 4L16A 3WYAA 3M6UA 4BMCA 2Q5LA 1OA0A 2O1XA 3H65A 2D1FA 2HBYA 2J3LA 4JMPA 3VSAA 1UM9B 1AZSC 1QYRA 4TLAA 4GGMX 4X1IA 2D13A 2QTTA 4RSRA 5HGXA 2SKEA 1G21B 2ZU0C 2IVZA 4PR0A 3AUAA 1Z33A 4DDTA 5CDGA 2OXEA 3WYBA 2GJ8A 4FYPA 1D07A 1SIUA 4KRYA 1JIJA 4R54A 4UTRA 3HA3A 1ZJYA 3ITKA 1I24A 4M9UA 3B6KA 1ZRNA 1IHUA 3MJFA 3OLWA 4GXQA 2QJTA 2WYWA 1KY2A 2VTEA 1L9XA 1PZGA 3BMNB 2ORYA 4U7WA 2F4NA 3K0FB 3ONEA 1DQRA 5D1HA 5HKBA 4M0EA 1WUYA 5ECYA 2YJ5A 5JXHA 3TDMA 5BPFA 1NX6A 3REQA 1WBDA 4OI0A 1SKMA 1ADFA 1AIPA 2DFKB 1LNSA 1GZUA 1CUBA 3D3QA 4G41A 1UADA 3LH5A 5C7IO 1NUSA 2N75A 4N0EA 5B4UA 5JHGB 3NIBA 3EVZA 5E4YA 2IRWA 2HCRA 2JPDA 2ZJ7A 1M7BA 4X95A 4XJXA 4IJ5A 4R1SA 4R9UC 4A8JA 4HNTA 5IRCD 1P17A 4RORA 1RACA 2MSWA 2HPVA 5DHQA 2XF8A 3H19A 4US0R 3TUIC 4E3WA 2IBTA 4IRUB 2BJHA 1MOQA 3NWEA 2D4AA 3HSKA 2CMFA 1IZYA 2JJ1A 2JGDB 2NUTA 3DLBA 3NHAA 5EIBD 4YT5A 4HYYA 4CKYA 1AHIA 4LVUA 4XQ0A 4R9RA 4E2WA 1XR3A 3BRSA 3ORSA 2I54A 1WPQA 1RYYA 1ZJZA 3VC7A 4CDGA 1KAMA 2EG5A 1ADJA 3FOAA 1R7RA 4F8JA 1ZISA 5IFKA 1A2KC 3AVTA 4BEWA 2IEIA 2Z8YA 4AJ4A 3GRKA 4HNUA 3NHFA 3JARB 5BN3B 4NK4A 1QIHA 4DR2B 4LAFA 3CUVA 2ZVPX 4U9IS 5ALZA 5AW6A 5KS2A 5M29A 4L5BA 3G0GA 3IS3A 4QTZA 4S2UA 3FRHA 3N2YA 3RSCA 1NDUA 2H1WA 3AJDA 1YH3A 5B37A 3PCXA 3V42A 5IDYA 5I4CA 1ZJWA 2J67A 1PD0A 4RTRA 1TI7A 4R83A 1RWOA 2Q4BA 5KVVA 4DKJA 4IICA 4FNAA 1UMBB 2CEKA 2ID8A 4O3FA 4MYRA 2OM6A 3UXHA 2WQZA 2ZYDA 5J1SB 1IG3A 1GL7A 4O08A 3W79A 1ZH8A 5T3UA 3RABA 2KS6A 1CUGA 2GCGA 5ALDA 2OGTA 4AMGA 1C7FA 1ISSA 4DSNA 1N2CA 5FV7A 1H4SA 3BWMA 2RH4A 3DOHA 1CLUA 3IR5A 4HDAA 2XZOA 2JC3A 4YRNA 3ESCA 3SC6A 4BQQA 1NXVA 1Z7YA 4E08A 1AMNA 1SOMA 4ZCSA 1NVVR 1ZHHA 4P6VF 3BWXA 4Q1DA 2ZZNA 5FPHA 1ZPDA 4IEIA 1AKMA 2WPDA 2VDWB 1VB3A 4K81B 4EM6A 5IT0A 3ZHXA 2P75A 2Q1SA 3CXUA 3EGCA 1Y5LA 3R74A 3ZU3A 1OZHA 2VS1A 3C74A 4ZU1X 4GUDA 1ZM2A 4L4SA 1QE0A 1UMCB 2XKJE 5K3AA 1DO0A 3H3JA 4MJXA 5DNUA 1M2HA 2WABA 2KYRA 3R3VA 4LJ8A 4RAQA 4F9FA 2ZOSA 3NDBB 3U2QA 5K5EA 4PS1A 1SO8A 4P4SA 4PAGA 1EIWA 1QHHB 3G49A 1WTAA 4C7BA 2DBQA 2I1LA 3E05A 1PEYA 4L6IA 4D9NA 3CWCA 4QWWA 1PK9A 1TT7A 5AKJA 1X7YB 1OBHA 1WRBA 3V1LA 2GZDA 2AC7A 2JH8A 2GTHA 4LYDA 4BYMA 4FFOA 4DC9A 2XB9A 4D81A 1NW7A 4QATA 3UCXA 3FXAA 1NR1A 3EZYA 1LF5A 1NIPA 3AI1A 2O3RA 2Z04A 3PA6A 5HILA 4DV7B 2P77A 1WZUA 1OXMA 2B4KA 1D1TA 2H2GA 2PVSA 3UJ7A 1GGJA 5BRAA 3OCYA 4FP9A 3V4ZA 1T2VA 2PIAA 3L8GA 1PFUA 4RU1A 1KH1A 1A95A 1Y1LA 4A23A 3L3BA 1PWYE 1K4YA 1EJBA 3BQNB 3E6AA 4UDNA 1R16A 1RPZA 1AO3A 2BKXA 4LDNA 3SR3A 1X42A 3NTVA 4PGHA 2G09A 3HBLA 1KFBB 1DAOA 4KXFB 5DH9A 1TQDA 1ZD3A 5FTNA 1NNI1 4PAOA 5D3KA 3RFFA 2XTZA 4G37A 1PZNA 4AULA 4YQFA 2WTAA 4ZOQI 5CFRA 2CL6X 4BWGA 5BSTA 1WKBA 3JS5A 4FK8A 1YKGA 4NOLA 3FTFA 3DMFA 1V4NA 2ZBVA 3W3ZB 1JWLA 4Y2GA 1T2FA 3DOCA 5IKOA 2AFHB 1KJYA 1W6RA 1E66A 5ER9A 4EYEA 1HURA 1LTQA 3ONFA 4NYMR 4JLAA 1HOTA 4Q21A 1Y4AE 3I83A 5INTA 1H8HD 2X6RA 4YP7A 1WOMA 1VP9A 2Y92A 1Y9ZA 2Q5QA 5AVYA 4ZCPA 2XITA 3KELA 4HWOA 3MS4A 3W9YA 3PC6A 2FYTA 3HFJA 4JT8A 1UJ2A 3U0BA 2O59A 6ADHA 5CDFA 1FYVA 2PZJA 4OHWA 3EXEA 1N3YA 3THOA 1FNCA 2FY8A 5F1PA 5BQXA 3EUEA 1LKZA 4KE9A 1J2RA 4P7FA 5EVJA 1WMBA 1ANKA 1DRJA 5EZYF 2O5EA 4HMOA 1X1CA 4HQNA 2XNSA 4DJ5X 3HCDA 4G0UA 2VYND 5JTTA 5CAEB 3WRWA 3V7NA 2I4MA 3HWWA 5FP0A 5I5GA 2PBFA 1HNNA 2XGMA 2XMPA 2P3SA 3FHOA 3F6YA 1T5DX 2P27A 2IYNA 2NAFA 1YR1A 2BJWA 3OT1B 4NU0A 4PPQA 5HEKA 3LIIA 4A92A 4DM3A 2H17A 4OI1A 5L3SA 1POWA 1Z18A 3QE9Y 2QXTA 1IM2A 3K9HA 5HBGA 4WL0A 1MA3A 3GLQA 4Q93A 3BIWA 1ODCA 3Q9SA 3T8YA 3UPDA 4XOIA 1WY7A 5TPZD 1MV5A 3K31A 4P2GA 1Z47A 4ZANA 4D9FA 4DQLA 5BN3A 4TZTA 2CV0A 3CG4A 5ALIA 1SOAA 5BNFA 4Q3KA 4GE3A 3AJEA 2PEYA 1YB2A 3P0HA 4HWKA 4M0UA 1K66A 1GTMA 2R5NA 4KE7A 4QUDA 2JFNA 4HWRA 2ODTX 5EOVA 1ZI8A 5FKJA 3UCFA 1UMBA 1VKRA 3C7KA 5E7JA 4RK7A 3W6PA 4QOIA 4IFEA 1QE3A 1OXSC 4P0TA 1DEKA 1WW2A 4N5LA 5IMBA 3G5MA 4GOND 1KJQA 3GD7A 4C7JA 4GP7A 4B2IA 4R71A 4B80A 1I5RA 3QQ5A 2DTXA 1JHOA 1B3RA 1Y5NA 1C81A 4TTIA 4GG1A 5JJCA 4HH1A 3LVQE 1KP2A 4ZHQF 2WINI 5J4LA 4FYWA 3JPYA 4C0WA 4MV5A 3AQ4A 3OZUA 5CIQA 4M6WA 2AN5A 3AFOA 3A6LA 4XKJA 3BC1A 2X3YA 2RHDA 4I1UA 4PPGA 3ZE0B 5CNJA 4BNFA 1IUOA 5BT8A 4RYLA 3CX7A 5LP6A 3DAOA 3RD5A 4UPEA 4RPIA 4WZZA 1GCUA 5TDHA 3W1WA 3KP1A 3D8NA 4EQ6B 2DERA 4W5HA 3ML1A 3UTDA 2RCNA 2CBXA 4RCVA 4IDAA 4BMVA 3IEIA 4B85A 1YFZA 3NBAA 4QBFA 5E7MA 4CG2A 4M22A 4UQPA 1QHHA 1PKEA 3TI9A 3W05A 3DBRB 5HM6A 4EMUA 1GQ2A 4C0HA 4GVPA 4OLJA 1FVXA 1Z0UA 3K2EA 2YOHA 4RGYA 2OXIA 2NTJA 4MEJA 3VV3A 1I4TD 2Y1DA 4AYXA 1P75A 1LWNA 1R4NA 3GARA 3NT4A 4QA9A 3VOAA 3R44A 4MGHA 1E2KA 4FCWA 3MTQA 4IF6A 4FEEA 4J0IA 3PI6A 4X8LA 4MNTA 4OQPA 4AUEA 3LQ4A 1OIXA 3RTEA 1EE9A 1L7DA 1U80A 4WXHA 4XJVA 1JSRA 3UWPA 3AEKA 4NYIR 1FSSA 2A35A 2H65A 4DQUA 2HHLA 1THTA 2VJQA 3THWB 2AN9A 4HB0A 4IMIB 3QITA 2B1QA 3D59A 1J06A 3AINA 3LFUA 1F6BA 2QENA 2R9VA 3E9DA 4B74A 4KK3A 5FTLA 4FE7A 4JI7B 1RZRD 3JQEA 3QKIA 1P0MA 2GJAA 2I80A 1OH7A 2D2VA 3FYUB 2G77B 4O02B 3HLKA 4ZVSA 1R0RE 3WGJA 1IQRA 4UZFA 1KORA 1BHQ1 2D0OB 2OB1A 2W6JD 2O3SA 3A3NA 1A2QA 2YCLA 4A6DA 4DLZA 3NRCA 4TS1A 1JVSA 1AMUA 1BDMA 2QXYA 1ZESA 4LDPA 3UWKA 1XWIA 2FEWB 3I5XA 1C9NA 4MQEA 4MAFA 3ICOA 4YRRA 4EY3A 5B6IA 3LBIA 3SCZA 2QUAA 2FMTA 1N6PA 1V5IA 3UYKA 2RHGB 1P5ZB 3ZU5A 3VO2A 4NAHA 1FOEB 1GPUA 4H3VA 4E51A 4YXWD 5JG7A 2O0HA 3UATA 3E84A 3I2JA 2G1UA 3VHRA 5FDFA 1JDBB 4PXYA 4XJSA 4G1EB 1I3NA 2GCEA 4URFA 5KC9A 1LI7A 2WQ7A 4ETWA 4WKCA 5AW1A 5HIAA 1WHSA 1ZN8A 4NZMA 4M9QA 5AM0A 1O9GA 5FPYA 3D0RA 4Q3BA 1W35A 2RHJA 3G0BA 1GDDA 4D9CA 3TLCA 4MW5A 3FGPA 2BBWA 3ZI0A 4RPJA 1M0EA 2WSIA 1I4LD 1UPTA 2CVZA 2PFKA 3B48A 2RK3A 1CFJA 2DFDA 1JUDA 3SY8A 1TKAA 2R7MA 1E59A 2E0IA 3G2JA 1YA4A 2G7ZA 4GX5A 1GTVA 3H83A 1UP7A 2BT4A 2FW0A 2X13A 3D0QA 2FP3A 4FMPA 4AJLA 4FYYA 5C5IA 2QRQA 4YBRA 5EP3A 1A04A 3BXFA 4RJIA 4CR6A 1SXHA 3QKRB 1ZZEA 3HBNA 6CHYA 4IXWA 1S8NA 2ZBGA 4MTCA 1C1XB 1MRNA 2HIGA 1DEOA 4Y2YA 1N8KA 1IMJA 1N2HA 1TEXA 3HVHA 2CJXA 4YT4A 1PR4A 5GJVC 2ZAMA 1U1DA 1RWPA 1P1KA 1YULA 2NO4A 2HC9A 2VDMB 3ZJ5A 3BRQA 1ZXLA 3WWOA 4DCTA 3W5CA 2GESA 1QYCA 3O93A 3DDCA 2G1PA 1XKTA 1ONSA 2QQ0A 3GLKA 3FPCA 4W6ZA 1UOOA 4F7DA 3T1QA 2ZAYA 2XYHA 5C32A 4DYVA 2JI9A 3A11A 1VG8A 2PS1A 1G5TA 1LBTA 1M8GA 2VOJA 4ZCQA 4JLUA 3RWBA 3TWOA 4CEIA 1ISJA 2WWVD 1RYMA 3Q40A 3SJAA 3ESDA 3JRNA 4C4PA 1FX0B 2F3RA 1VYTA 4JC5A 2C92A 3WP1B 4ENSA 5EMKA 5FYQA 3PP8A 3L8HA 2RAVA 4EPVA 4S05A 1NW8A 1Y3BE 2WIJA 3MF4A 4LE1A 1D03A 2BELA 1BXGA 2X9NA 4QT4A 4DB4A 3EEYA 1CQJB 2SKCA 5JNTA 3IIEA 2F1JA 3CUTA 3L8FA 3NVMB 3C6BA 1HEYA 3LG2A 5C8YB 4EQ6A 1DX4A 1JTVA 2PWZA 3KYDA 3LP6A 3N2ZB 3SSMA 4YT2A 3O83A 2D06A 1KAOA 3ZU6A 2LW7A 4PF1A 2XEDA 3U9SA 4COKA 3GLGB 5CR9A 1QQAA 1L8LA 1S6YA 3BICA 1HC7A 4PR3A 4CLEA 1AB5A 3PC4A 1A8SA 1H2BA 2QE7A 2W00A 4DLBA 3RVOA 1QFYA 1NN0A 2A92A 3OFNA 4ITVA 3LECA 3ZNPA 4D43A 4DIUA 4KNYA 1GD1O 4Q9LA 1N2CE 2F4VB 5DW0A 3E35A 1I7SB 3ETEA 4NJEB 1N6RA 1BS2A 4RA6B 1F4PA 1Z0FA 3K70B 2TSYB 1W2WB 3CF4A 3BSWA 3VBEA 5BR1A 3DVSX 4QYMA 3SHOA 3FCOA 1XKLA 4C0KA 1DFGA 2QD1A 5IVHA 3AY3A 4Q3LA 4PTZA 5BSRA 1M34E 3HE3A 1U8TA 2PM8A 3WMWA 1Z4PX 3P9ZA 2Q6TA 4K03A 4PC7A 3H4MA 4PX2A 2MU1A 1WWKA 4IINA 2DUJA 1NHWA 2XH8A 1F2DA 3HNRA 4MJLA 3HEBA 5FTJA 4BGUA 5J4HA 5JMTA 2ZIZA 2XT9A 1SURA 3RHZA 2J9XB 1NZDA 2VIIA 3JRXA 3OJWA 1ENZA 4KPGA 1GYRA 5LZ8A 1B2LA 1J22A 3CKLA 4FX2A 4CMJA 3WWYA 2A5FA 4YRKA 1VE7A 3FPBA 4ZYTA 1UJ4A 4NWIA 2QR2A 2PCLA 3MUNA 3Q5DA 3KB2A 4Q7MB 4V39A 4BN0A 3KLPX 4F85A 5JV5A 1WCYA 2H51A 1JHQA 3COWA 3DE6X 2H07A 3DS8A 4U39A 3SQLA 2O2SA 3WGKA 4YO8A 1XJCA 1CJMA 3FWYA 3DDZX 3QU9A 3H0EA 2A88A 3I76A 5EJ4A 5C5CA 1JWBB 1VL6A 1F3OA 2OZPA 3DZGA 1NNSA 3OEEA 2HY7A 3PHIA 3QXHA 1GPAA 3H6GA 4JL8A 3M7IA 3U3OA 3W4IA 3CC8A 2ZUUA 4CM3A 3FWZA 1T5LA 3M3HA 2R8ZA 4P3KA 3TEMA 4DY6A 2O8FA 3NTQA 2J5XA 3IHLA 1DKRA 3CF6R 4PG4A 3OPYB 2PZAA 4KDRA 2OO7A 4WLFA 5FAKA 2CXTA 2ZDHA 5I9TA 3DC2A 3QU7A 4LZJA 4EO9A 4DR6B 1K7YA 3VR4D 1CF4A 1H69A 3ITNA 4LV8B 5IXSA 3AR7A 4BFWA 3I61A 4LC1A 4L0CA 1SN7A 1X70A 4DR5B 2PMCA 1XJ0A 3QLEA 5CA1F 2B36A 4LCJA 3QFTA 5CP8A 1NBMD 4YRQA 5BP7A 5EHGA 5ENZA 3FG9A 4V2UA 1V5WA 2IUFA 4LXHA 1GN9A 4LOLA 4AURA 5KOHA 3AWIA 2ZVJA 2DECA 1DT5A 1JR3A 2W2XA 3HBMA 3IMKA 3LQYA 5LZ5A 5ALLA 4H0CA 2R8EA 1VHWA 3IALA 1LBSA 2YWDA 3IUBA 3FD8A 2VSNA 2FFAA 4EH1A 3HM9A 1GXSB 2JHGA 5DKFA 1P80A 1HV8A 6ABPA 1FP1D 2CVHA 3ECAA 4BFZA 3U1BA 2AR9A 4B3SB 3WLLA 3VZPA 1FTNA 2EJVA 2G25A 4JBXA 4MVCA 4YJHB 4ZA2A 2I03A 1V45E 4V0RA 1XX6A 4E4RA 4KXUA 2AGVA 1NV9A 1RBQA 3HU1A 4HYTA 4GZLA 5D6OA 3UK7A 3R3JA 2H1VA 2W6CX 3TOSA 4EI9A 2RI0A 5CFQA 3OQOA 2R7AA 4U6SA 4R05A 1R9MA 2BM9A 1SVOA 1XKXA 2Q4RA 3TLZA 3ANLA 1DRUA 3BD8A 5T4BA 4B4VA 1I9CA 4FFWA 4EP1A 4V24A 2VHVA 2Z30A 3E27A 3QVXA 3UAWA 4CHTA 3SIPA 3T7KA 5C35A 1AZWA 3E5MA 3BERA 4E21A 1KGDA 2TRSB 2QTVA 2VRWA 3G8YA 1CUJA 1HDXA 4AS1A 5CGZA 3BB1A 1G2IA 3X2SA 1PQUA 2F8SA 3IBTA 4OMDA 4DT1B 1KWKA 2JJ2A 2WWTA 2FPWA 2V4UA 4ND8A 4DRYA 4TYYA 4HH0A 2PUEA 3PDUA 2F67A 3LY8A 3Q3VA 2H1HA 3CH5A 5ILOA 2G0TA 4HWPA 5DXAA 4B47A 4HX2A 4M8SA 5BW8A 4MROA 3HU2A 5HZMA 1KIMA 2JGEA 3OZSA 3D0KA 4C5BA 2OL4A 5J47A 3GFQA 1YRHA 1MX5A 4WK6A 4L4RA 4MICA 4N6GA 3PYLA 4UBIA 3PPXA 1PZHA 3AIOA 3HJGA 1K4KA 4JCOA 4LUCA 5CH5A 5BYJA 4U9UA 5EE3A 4OJYA 1ZSYA 4E2FA 1EB8A 3GXBA 1KZ1A 4HVTA 2ZUBA 3O5AA 3F8SA 1YVUA 1T4DA 2VSXA 4DLPA 3Q8MA 4BMSA 2AOXA 3BWVA 4QM7A 4JB0A 3ABIA 1JG4A 4I6EA 4ECAA 4UNPA 3QE2A 3RS3A 2Q3MA 2PT7A 4GSLA 2R7KA 2YV3A 2YXLA 1QGUA 4IIGA 1JRLA 4ZTBA 5A02A 4JVLA 1XCMA 2QVGA 2VPTA 2HFKA 3TW6A 4ACAA 3VJRA 4IZHA 1V5EA 1ST2A 2CFCA 1MXFA 5JPDA 1TLTA 4GAEA 3OE4A 2C82A 4XSHA 1CULC 5JYEA 5KSYA 3HG7A 3D5TA 3CEHA 1XA3A 2VN8A 1OFVA 3KXDA 5DBIA 5CCEA 4ZYZA 1Y4DE 2KSQA 2FOLA 3T9FA 4W1SA 3V8PA 1SUFA 3JD2A 3SF8B 3VSDA 2GZ2A 4J4BA 5DTRA 3RSFA 4HOYA 5JZBA 1GUYA 2BSXA 3Q8WA 2GR9A 4MVJH 5DK4A 4ZAYA 2G8NA 5GONF 4HPXB 5EJFA 3DBHB 4BO6A 1EZ4A 1RM5A 1K06A 3QOXA 2A3NA 1HT3A 2B8WA 1PTJA 3KYIB 1J8DA 4K05A 4LV6A 2ICAA 4WBNF 4FGJA 1S96A 3DHWC 3GEPA 2PBLA 1AHPA 2QVBA 2ODAA 3IDFA 3GEMA 1A27A 3ONVA 5EIFA 5FH9A 3AEQB 1G8YA 2YFYA 4ARSA 2EP5A 2WM8A 4OBBA 4HMQA 1ABBA 1F2UB 2QMEA 4M89A 1EDOA 3UOWA 2EIXA 1G8HA 5C1BA 1ZDMA 5K01A 1TW2A 5EG5A 1W36C 3TZQA 1QDEA 3H2KA 2CKMA 3MQ2A 3OE5A 3PDCA 3UMJA 4ZDJA 3DAPA 4OL0A 5LQMA 3LBYA 3GVPA 4N5DA 1NT2A 3HY3A 2VLIA 4JR0A 4X41A 2QDKA 3SXPA 2XD4A 4JXJA 2ZAIA 3P52A 5F98A 3KKNA 3OTHA 1IAVA 1YDWA 2PSHA 2K7FA 1KO4A 3VTKA 2R4TA 1P6UA 2QRGA 4F2PA 4CKXA 1UK8A 1E3WB 2VHEA 3D6UA 1Z5GA 4BNIA 4D5GA 4QGHA 1DXOA 2CYCA 3TVTA 3NWPA 1PR1A 1ZGJA 1XNHA 5BVGB 1ZUIA 1XCGB 1X1DA 3MNFA 3OP1A 2W83A 4QOJA 3FSJX 4Z9XA 1MW9X 1ZC4A 3K6KA 2PY6A 2Y9PB 4FFDA 3VNAA 4X63A 1O89A 3HUDA 2VDRB 3B78A 3EB9A 3FTQA 1XTZA 2ECQA 3QPBA 4L2IA 3EY4A 3M6LA 2DY0A 4RFLA 4CTOA 3U4GA 4A36A 5FT9A 3JWPA 4K8RB 4DBLC 1UM9A 3JX9A 1Z45A 4RO0A 2P3QA 4OBXA 4F4FA 2RH5A 3B1VA 3BUSA 1XL0A 4KWTA 2TMGA 4P36A 1GXSA 3W7VA 4OOEA 2NV2B 3RVDA 1WMEA 1Y9DA 1XQVA 3FROA 2GN9A 4A3SA 3QW2A 3CX3A 1NJSA 3N70A 3FMVA 1QZZA 1P74A 4FYVA 4NJMB 3C5VA 4O5AA 4Y6GB 3V33A 1KEVA 1XEAA 2VJYA 5L4SA 2JRCA 2GYVA 2H54A 4S0ZA 3D8RA 1EAMA 3L0OA 3HO1A 3ZGZA 1QM5A 3GPBA 5KU7A 1QS0B 3X1JA 2QN8A 2AFHE 1L7PA 1UOQA 2WA1A 5LZ7A 1JSZA 2EX1A 2PN1A 3ST7A 4BNMA 3FTPA 5KJEA 2N46A 3H8WA 1D1SA 2RKOA 3HACA 2WKQA 4ZARA 4L78A 4U4AA 3D1JA 4P38A 1NSTA 2VZLA 2XMBA 4RY8A 3MTEA 3WK4A 2X5NA 5H9WA 4DFDA 3I2HA 1XG5A 3W5JA 3HBJA 4BTLA 3AR5A 3IC5A 5IBCA 4OI2A 1T25A 1ATIA 5A4FS 3MMNA 1UOEA 1FL9A 2GKGA 3OQJA 4GWKA 1T1EA 5JBQA 1JR2A 2A57A 3I1JA 3NASA 1P5RA 3UZUA 5DCYA 1U7OA 4MV1A 2JCSA 2WJZB 3DKRA 2D8AA 3ZQ6A 1DAEA 2JJQA 3IT2A 3W1EA 1A2BA 3GMDA 1IC6A 3EWNA 1E1LA 4MV6A 2AH5A 1YRAA 4PYLA 3IMCA 4WOKA 2P79A 2R97A 3VUFA 2ZROA 4WD3A 2C96A 5IEJA 1G4UR 5TQ0A 1CUYA 2VJOA 1E32A 4OFXA 1PGJA 3Q2KA 4GDMA 3K0SA 2X0KA 2LKDA 5BO5A 2P2NA 2ZGVA 4DLTA 1SBCA 2BIFA 3BWDD 4MUYA 4W1RA 2C9OA 3GJSA 1Y81A 4FW9A 1DBWA 3SFTA 5JJ5A 1GR0A 1IQPA 4PVCA 1YACA 2AFIA 5CT5A 3PFIA 1IWPB 2J08A 2F90A 2W6MA 3D7MA 1P9NA 3QIAA 2VYNA 1L4NA 2HO5A 4LE0A 4B4DA 10MHA 1V8ZA 5B55A 1N1EA 1Y33E 3OFVA 4HB2A 1K3FA 5JO9A 3AC0A 3ORRA 4UHKA 4DR1B 2G5CA 2C5EA 2XUOA 3HA2A 2DH5A 5J58A 1N2CB 1XQ6A 2GJ4A 2VP2A 4HSGA 3CW9A 4J9VA 6NULA 5KSZA 3D5EA 2ZI9A 5EKSA 1M1YB 3B8HA 3H8JA 3B70A 1AGNA 3ILSA 4XE5A 3IUSA 4B83A 1IK6A 1LB1B 1UXKA 1W30A 3DD1A 2O6HA 3SM9A 3T35A 1FRVA 4OSPA 3WMGA 2F9LA 4C2AA 2Z57A 3DLAA 1D2AA 4FR2A 1SUDA 2XLCA 2FEOA 1YRQA 4EKDA 2J0QA 4V3CA 3PQCA 4O1MA 4EJSC 4RABA 4YR9A 1SCNE 1BMDA 4PLHA 2IF2A 3BXZA 4JS0A 3WIVA 4RVSA 2BSAA 4OMUA 4PQGA 3A7DA 1XU4A 3QIVA 4FI3F 2P1ZA 3K4QA 5ALMA 3ME5A 3W78A 4C4SA 4P4SB 4EI8A 1PV2A 1YZNA 2XCSB 3F1LA 1LXCA 5FOQA 5BMVF 3PU6A 1XMVA 3KTAB 2XDAA 1ULSA 4BS9A 3WLAA 3LGXA 4K88A 4YWHA 1N9ZA 4ZCRA 4NICA 2IZ7A 5SYMA 1ZGZA 4HG2A 4HPWA 1XJ5A 5GONA 2XYPA 4XM1A 1AN0A 1P61B 1SKQA 2YJZA 3IV7A 3QH4A 3I45A 1UIRA 2VK4A 4B3HA 1KDTA 2DSTA 1WOYA 4K6MA 3JSAA 5DTEA 1ZEMA 1KWGA 3L05A 3GJ6A 1EK5A 4DL9A 4X7BA 1IB0A 1VIAA 3OVMA 5ESDA 1OY1A 4K1XA 4WECA 5I47A 3TTUA 2QQFA 4DF3A 4BQRA 5AESA 2LDBA 3PFWO 5AT1A 2XGSA 1ISIA 3S5UA 2CJWA 1Q1BA 5HE9A 1Z5PA 3R77A 1YMQA 4FR0A 4M9CA 5L45A 3S1SA 1KARA 1FMJA 4CGZA 1IYZA 1QPZA 2JS7A 1M5TA 2HPHA 2RB4A 3HNPA 3SEQA 1JKXA 2HN9A 3D6MA 4TGLA 3IP7A 1K97A 1SUBA 1X1AA 1JMKC 4GBJA 4IG4A 1H42A 3UF0A 2YC4C 3B1XA 3F3SA 4KXNA 4ED9A 2D2FA 4L9AA 3H6HA 2A5YB 4GU5A 2H4WA 1TYDE 2ISQA 1GCIA 2NADA 5HYVA 2I4TA 3N0RA 1GQFA 4XDZA 3RYFA 1RRFA 2M6SA 4OP1A 3ELBA 5FF9A 1XEWX 4PZLA 4RDCA 4KLCA 1D2MA 1V6CA 1QK4A 2NZ2A 3IE2A 4G8JA 5K7SA 1ZRSA 3AJAA 5THQA 4A8TA 2I55A 3WHLA 5JAPA 1YDFA 2Q2OA 1VBNA 1CUSA 4C6HA 3Q8LA 1Z8DA 5JW6A 4RV5A 1UUFA 4C3UA 4AMZA 4QM6A 3L1UA 3G79A 3G59A 2GZSA 5DLEA 1WV1A 3G2IA 3HB4X 3OM1A 3A6GA 1SQFA 5FQNA 3A9UA 4PG5A 5EKXA 2W6ID 2H4FA 2HSJA 3R0XA 1DAMA 3OQIA 3HVRA 3BSFA 4TKLA 2ZBRA 3Q12A 3T4XA 3E5RA 1K8XB 3V4RA 5D7NA 3KSBC 2VQFB 1XLUA 4BYGA 2COEA 5HE8A 4DARA 3L04A 5BQFA 4NNJA 1EEXB 2AHRA 2VH1A 1N75A 3IESA 3LQ1A 5K4AA 3TDNA 4A16A 1FDTA 2JVIA 3LL7A 4DMCA 4ND6A 1ITZA 1K89A 1JKJB 5EEGA 1BNCA 3USZA 4BBZA 1WMSA 4NL4H 3V1KA 5EKTA 4Z0PA 1THZA 3OE7D 5C52B 1II8A 2CMKA 1H0HA 1XJWA 2DFVA 4YS6A 1PT7A 3X1MA 3AP3A 3J7AC 5KOIA 5D3MB 1JAXA 2JLCA 4QRHA 3SC3A 1NUUA 2DLDA 4ZMBA 2XW6A 1QR6A 1RU3A 2IXGA 1U7XA 2FQ1A 4AG6A 4D6PA 4IFBA 4CMHA 1WCIA 2PD4A 2PR7A 3O0TA 1T36A 5FV4A 1C5KA 1E8DA 3O4IA 4JA2A 3ZNQA 3NMUF 4WKOA 3VKGA 1QRRA 5HTKA 4H6PA 1WS6A 3N3AC 4KI7A 3DTYA 4KQGA 2W6JA 2MHCA 2E1PA 1JAZA 3LPDA 2DB3A 3RW9A 3O94A 1P0FA 4DBZA 3JQ6A 2ZULA 1MB9A 3A1UA 2JIMA 2F3TA 1V48A 1E7QA 5TIIA 4J16A 1KJNA 4KFTA 4G5SA 4JFAA 4UCXA 3PI7A 1ZSVA 1RLOA 1A5BB 2O3JA 4LYYA 3T9AA 5L6LB 1GYQA 1SRQA 3FZEA 4Y18A 3DEAA 1UF9A 1CUHA 3WV4A 4CI9A 1NW4A 3F49S 5K0LA 3TD9A 1BCSB 1W7AA 2WTNA 5EMHA 2ZSBA 2IV7A 4C0QC 4LXIA 2GD2A 3TFOA 1Q1EA 2VK1A 4Z0TA 5F51A 2Q5OA 4POAA 4YIKA 4JX9A 5ALVA 4HZIA 3AIMA 3IBCA 5GOTA 2QLMA 5KNBH 3B6JA 4R8VA 3QEAZ 2CFSA 3TMAA 5DVZA 3WSWA 2FEAA 7AT1A 1ND5A 3QY0A 4OQNA 4XR9A 1FRNA 2CHEA 3IVGA 5D3QA 3CRZA 1NUAA 1WU8A 3PDWA 4NEGA 2IZ0A 3WNVA 1F6DA 3V7WA 1G5QA 5EJ9A 2ZE5A 2PXXA 2V5UA 3HB0A 1QHNA 2HMVA 1ARZA 2VRNA 2VT2A 4HX9A 1FJXA 3H9UA 1BQ3A 5EZ6B 1J2UA 1W4RA 3EVDA 1EXMA 4YP6A 5CLJA 3MCWA 5HF8A 4YUVA 1A9QA 4WLUA 2A5JA 3EF3A 3IODA 4QBHA 1ZZGA 3L4JA 3NI2A 3JD4A 2RHLA 1B8PA 1R8YA 2PH5A 2VF7A 5GONB 3S6JA 3SYLA 5HPYB 4PAQA 5EWJA 1L7RA 1Q83A 2NXJA 3WLFA 3OPVA 3B6ZA 4ZICA 3DYIA 4Q24A 2L69A 2C84A 3RR2A 3KZKA 1HFKA 4GLFA 2AXEA 2ZDQA 1TPZA 3VZCA 2GBCA 1TIBA 4B8YA 1NAHA 5DTIA 5ES3A 1U9CA 5AVQA 5KYUB 1DIGA 2FJ0A 2HLDD 1X80A 4KNWA 1H4VB 3I3SR 4INZA 3T1OA 1EZZA 4A8PA 4YFYA 4FYHA 2ODEA 2UYGA 1E3JA 2WLTA 2OXRA 2C07A 1V6AA 5K3SA 3EBOA 5LU8A 4XYGA 5AI9A 4MW0A 5ED4A 2XRZA 5E1OA 1WBBA 1O58A 4MMZB 3ZH2A 2CY0A 2LVBA 1JTEA 2P78A 3GMIA 4D41A 3DE4X 2GCOB 3RYCB 3QWBA 3JWIA 3FNIA 2AG5A 4YP5A 2P9CA 3HB9A 1N92A 2G70A 3Q41A 3EZ2A 3OH8A 5HK9A 3PXEA 3SR0A 1TM7E 1MJ5A 1W87A 3JQ7B 4Q37A 4LHVA 4RZQA 1GQQA 1Q0UA 5FHQA 1V16B 2I4OA 5J4VA 4YASA 4OHYA 4BE7B 5FUYA 5ITWA 5B1IA 5JYDA 4PQRA 5G0WA 1PJLA 4FGLA 3HP1A 1RP1A 1U9IC 2E82A 3MUFA 3L4SO 4BBPA 2GWRA 4BCCA 5ICCA 4Z0HO 3V2UA 4MW6A 1DMSA 3HRIA 4PYOA 5KQSA 1HDOA 3PKIA 3A3OA 5ERXA 1X15A 1PBNA 4OFWA 3KFXA 4ANFA 2QUHA 3JQAB 4DQ0A 2GK6A 1RQ7A 2UU9B 3CN7A 1IIRA 1XF9A 1XVAA 2GD6A 1UT6A 1TOAA 3JTEA 1KETA 2VKQA 1F6WA 1QJCA 2OGZA 1GRNA 4I8XA 5A5EA 3EWSA 4HFJA 3JASB 1PS9A 4IO1A 3C1AA 3CLRD 3GZJA 1OH6A 1M6YA 3GIDA 3IDZA 4MIEA 1SQ5A 3I01A 1C1HA 4A91A 4L9RA 5LQJA 3TPFA 1SG6A 2IW3A 1K7CA 2FX5A 3VYSB 3WL6A 2C1EA 3CF0A 4F04A 3TL6A 1XRLA 2MSDB 5JLJA 3E7FA 2XVAA 3U7QA 5KVAA 5LZ9A 2EGUA 2QF7A 4DLAA 1YR6A 4CQNA 3DMYA 1CY8A 2PUWA 3CNOA 3L8ZA 3G2MA 3L8MA 4FT4A 4WADA 2KM1A 1X8KA 2J0UA 4HWTA 1EK2A 3ZGNA 1WCIB 5ILGA 1VKHA 1ZMTA 5C46F 5JTUA 5M2QA 1UXOA 1W0CA 2YVKA 3A70A 3ZWKA 4TKVB 3QXGA 5JCOA 4C2UA 1TZMA 2QRJA 2ENWA 4MP6A 4PG8A 5CK4A 2PMWB 2XHEA 4FIZA 4RE6A 1GPWB 1GG5A 3ASYA 5HCNA 1LGYA 2P11A 1JWAB 2XNKA 3AGPA 4G01B 1D6SA 1OU0A 2V3CC 2F3SA 2P69A 4NG5A 2GDZA 4J94A 2C9DA 4NYMQ 3ZBQA 3QJYA 5CJ2A 2KW5A 5CB4B 2P2YA 4IJUA 4QEKA 4RA9B 2FRDC 1EFRA 3RHTA 2BC9A 2QV0A 3N8IA 2IT1A 1YJCA 2OEPA 3IA7A 3JW8A 4QYTA 4ND3A 4BP9A 2ABWA 2HU5A 2JBWA 3N2EA 5B58C 4UHHA 3Q0TA 1KBZA 1KQOA 3GU3A 3NAZA 2IIBA 1HYGA 4X85A 3WADA 1R5OA 1MH1A 1RHKA 1VRVA 5LDGA 1QV9A 4EG3A 2ZJ4A 4F56A 2HPAA 3L6OO 4GUAA 1V96A 1G3UA 2FU5C 5C8YA 4TRRA 4US2R 3C6ZA 2BEWA 1M1YE 3QMMA 3AI2A 4IJVA 2NTVA 4R3NA 2FPPA 4JUDX 3OOWA 5H83A 2WF7A 1U5CA 3HPQA 2BH2A 4PG7A 3N8NA 4QEZA 1CZNA 2L0XA 4P53A 4XQGA 1KQGA 2PRZA 4LCBA 3UAVA 4NE7A 4A8HA 3RSHA 3U3XA 2IXBA 2AQ8A 4LTNA 1KYTA 3P26A 1UDAA 1YV9A 4HFNA 2FMKA 1Z38A 2B69A 2J5RA 3HCOA 1VECA 3LCRA 3MS2A 4WERA 5AM1A 4ZV7A 4ZXFA 3GGCA 5A03A 5MFZA 2PL3A 4PLGA 1QRUA 5CD9A 1BEEA 4RTQA 4ZO6A 1RSZA 4CCYA 4DVGA 1AF7A 3O4VA 3TSAA 5J5VA 3MQFA 4JUBA 4M0PA 4CUZA 1SXJA 1YTLA 4ESHA 2JJ2D 2P65A 1Z17A 3ZE6A 4ER7A 2WFAA 4QXRA 4RSMA 1ORRA 2FZWA 2RHCA 3N28A 1BEZA 1JALA 4ERNA 1KQPA 1FXWA 4J29A 3GJTA 2WF6A 1ZOOA 1MJGA 3GRAA 2ACWA 1XNQB 3LWNA 3DXYA 2NP7A 1V37A 1YQ9A 4MV3A 3HKBA 3IEUA 5SZHB 1P4HA 3P97A 2QG6A 1WSDA 3MAAC 1TQ6A 3R0JA 4ARZA 4O2BA 4BFCA 5BSFA 1GTZA 2J33A 2X4LA 3UN1A 2OG1A 4KR6A 1E2LA 4NFLA 4GI7A 3PL1A 4HLUA 2FUG6 5U4XA 1ZNZA 5AI0A 1C0EA 2O4CA 4QZVA 3KM0A 1DDIA 4MYHA 1IBSA 3BORA 2GVNA 1KO5A 4I55F 5CBKA 1C2TA 1OROA 1P0PA 4A2CA 4KR7A 2H6EA 3ZX5A 1HUQA 2K87A 3CIFA 1QX3A 1V16A 4YEDA 1SY7A 5G1NA 3RNLA 3EULA 3K9WA 1M2NA 3T3IA 1CEEA 4LGVA 1MCZA 3WXMA 5CTAA 1TTPB 2C7VA 4ABTA 1T5OA 2QVXX 5CBPB 5K8LA 4QYIA 1VRCA 1SUSA 2CHQA 4NFYA 4RQUA 3FHJA 4AS2A 5ITSA 4LSWA 1QGYA 5DLPA 3UK0A 3BE5A 1EWQA 3HVKA 4RPKA 2QTZA 3MGAA 1WD5A 5EJGA 2D62A 1J4AA 9GPBA 3MHTA 1BJTA 4X1YA 2QRUA 2R79A 1DG1G 2OFXA 2CLKB 1JBKA 2ZT7A 4QU0A 1Y6JA 2BDTA 3A6FA 1US8A 2O7VA 3A36A 1QCZA 3AO0B 1O95C 2XQGA 2EP7A 2FUNB 2ZB4A 3VZBA 1D2GA 3GFTA 1JT9A 4DJAA 5E6UA 4BP3A 3WWCA 3UJ8A 3OF3A 1TO6A 3OETA 2J9FB 3ZWYA 4HN4B 2VAXA 3DE2X 1AS0A 3UV3A 3ZTTA 1WY5A 3U5TA 3MJDA 4GMFA 4BGEA 3FDJA 4F4IA 3K2BA 2HWWA 2DZDA 2CNKA 2J0UB 4Y0VA 3ZCVA 3QKUA 4IVQA 3CA8A 3E7DA 3NC4A 1Y7IA 4ZPJA 4P2BA 4NU5A 3L4BC 4MPTA 2X8BA 3OPQA 1XCPA 3OKFA 1G7RA 1FDSA 1YZLA 2ZTLA 3NHWA 4Y9UA 2XV1A 4YAGA 2V9PA 1F8YA 1T5BA 3DTVA 3MHPA 2YVAA 4A03A 1AG9A 1BS9A 2FW6A 1Y7TA 4NENB 5TVKA 3OZRA 5DTQA 4MGZR 2QP4A 2PUHA 2XQJA 3LE8A 4XFJA 1GADO 2FMIA 1WF3A 4FU0A 3QKSA 4TSFA 3ZDRA 4B3RB 4MCAA 1K68A 2TECE 2PRKA 4GWGA 3T41A 1R9NA 1YI8A 1HZZA 3DKVA 1SXIA 3GGDA 2QZSA 3HLTA 4FFLA 4L6AA 3K6JA 4XD2A 1X2BA 3VRHA 4CIAA 1DBSA 4S1NA 3D7SA 4KVFA 4JJ4A 4D9KA 2D0DA 3TH5A 2X1LA 4FJ0A 2PRYA 5EMLA 3GLIA 1NQ5A 1QGED 4DCCA 2R6R1 4TKMA 3P8ZA 1UOPA 3PPVA 2C31A 4KODA 2FX2A 1HF3A 1KJ9A 3K72B 3KPJA 1W0KD 1KI7A 1W85A 2CD9A 2G9VA 2R6GA 3BG5A 3E2IA 4R7GA 4ARVA 4F5YA 4OYYA 2Z83A 3O03A 4A5SA 3ZZNA 3TRJA 4LX8A 1EUCA 3FFTA 4XLTA 2JL1A 4D99A 5I7RA 3T3EA 4X97A 5FBRB 1LK0A 4WZ6A 2CVOA 4WLOA 4DPLA 5M34A 3VU0A 1B23P 1NJ8A 1YONA 4BE9A 5CMLA 3T99A 4HQKA 1N0WA 1P1JA 3UJ3X 2YIJA 3W5BA 1BGXT 1RMQA 4MLZA 3SYMA 3TXYA 2EQAA 2FP4B 3PZBA 4CCWA 4F4UA 2C2GA 3D4IA 3ENNA 2YY5A 3D8HA 4C87A 4IUBS 4LXXA 4Z3DA 4AUKA 5DASA 4F3NA 3OIYA 3CLUD 5BOSB 3ABSB 1ZQ9A 2JGLA 1SOWA 1SXJB 3BF8A 4QPDA 4NOKA 2UVPB 3EMVA 3H5LA 4LRWA 3HO8A 5D00A 1U4NA 4L8VA 1O7JA 2WJ6A 4L4XA 2C1XA 2BMEA 1AKNA 4AN1A 4C5CA 2HA2A 2ZIVB 5AIBA 5AW3A 3FCEA 4MMXB 1GQRA 3U5ZB 2VP3A 3IELA 1MGPA 2XKBA 3O3MB 2HZBA 2QDXA 1QIDA 4ZGGA 3TTSA 1I4EB 3IVCA 1G21A 3KAJA 3GMTA 3OLQA 3GLFB 2P62A 3R1IA 3FNEA 5DWVA 3ETJA 3NTOA 1AUXA 3Q3IA 4MUMA 1C0LA 2XMZA 1QG2A 3DPUA 3CEAA 2PWYA 5DCUA 3BXOA 1M83A 4A2PA 1UFRA 2D2IA 2W2KB 1HDEA 5LQUA 3CH7A 3M9LA 1TXGA 2ZYIA 4M7WA 5IDXA 1P44A 3E58A 1O8BA 4OL9A 3C3YA 1IXKA 3K9BA 3PHLA 4DSUA 2JFZA 3LQRA 4MO9A 3VR6H 1F2UA 1G63A 1L7AA 1R6BX 2GVZC 3OLCX 2YY6A 4IXTA 4R2KA 2R1TB 1RPNA 5TGZA 3SVLA 4NU6A 1M54A 1S8FA 1QNFA 4G67A 2IHVA 1ODTC 1N4DA 5B3JA 1IY8A 2DX7A 1TZKA 4B46A 1JF8A 2O3QA 2X8WA 2E7ZA 1HDRA 1SCUA 4K2AA 3QEKA 4PGAA 4RFSB 1NF9A 2XSZD 2X0DA 2JKZA 3U7EB 1ZCBA 1QGOA 2HEGA 2PQ0A 5I3CA 1AH2A 2O14A 3DH0A 4ZRMA 3VVCA 1CHDA 3RTCA 4H7PA 4CV1A 3FWKA 4O59O 3OAAD 4LZNA 1Z5OA 3C43A 1OWMA 1WETA 4ZC8A 4HAIA 3WP0A 1KS2A 5CCDA 3ETGA 1QR2A 3DWEX 3LOPA 3MLAA 3AY6A 4ZO9A 4C7KA 1EQ2A 1P8JA 5JBIA 3COJA 3B6EA 3CTMA 4EGQA 2HQBA 4TT8A 4FOPA 4MQFB 2B4TO 4LWQA 4I46A 3A0UA 3WX0A 3M6FA 4YDRA 3HKDA 4FD3A 4ZRDA 5T6MA 3MJHA 1FP6A 2G0NA 2WHYA 1HE5A 2BGNA 4MQMA 3ZDAA 3RSZA 1B1AA 1JHYA 1O5IA 3LYUA 5KYXB 2OAQ1 3MIIA 2RJ3A 1UXGA 3QUTA 4HF7A 4RKRA 3ZCQA 4D4LA 3O8RA 1DCFA 4URXR 3NBYC 3BBLA 3BJRA 1V1JA 3EDOA 3H18A 3L7LA 1K4MA 5F21A 2Y0DA 4WZAB 1KTVA 3X2FA 4EPTA 1I4DD 3FPFA 1U98A 3EIFA 2X0IA 4MW9A 3DHVA 1GLVA 3K05A 4WESB 1WAMA 4GOJA 1VFPA 1DG3A 1SZCA 1YNSA 3S44A 1C8VB 1VI6A 2PYDA 1G6KA 4MR8A 3ZWXA 4BEVA 3K0AA 1VIMA 1IZ9A 2C0PA 3N0TA 4LGMA 4RD6A 3T1NA 4DBVO 1WNTA 1JVBA 1WKCA 1X7XB 2FG5A 4TTVA 2OYCA 1Q21A 2HK7A 4QGFA 3SHWA 1NR5A 3S2ZA 3EJ6A 4AYWA 2W2LA 2PT6A 3FRIA 4HAZA 1HDYA 1RJ9B 2XGGA 3WVNA 2Q3CA 1W0JA 2HHJA 1KKLA 2IYQA 1ULUA 3GOHA 1M2OB 1YA6A 4UUOA 1GPH1 5KOYA 1FYFA 2G4LA 2I3BA 3KZ1E 1U8CB 2FSIA 1Q7BA 2NG1A 2PQ6A 3OCJA 4PBTA 3DQZA 1OLUA 1RQGA 1EJ2A 1O6BA 2TMDA 4GPIB 3PNQA 3PQ5A 5DCWA 1GUAA 2YW9A 3AVQA 1J25A 5HGJA 1A9PA 3H5WA 3RB8A 4PYJA 5ALPA 1QRDA 1JILA 1Z0KA 1B42A 2BFDB 4AJ2A 1IVSA 2PUAA 3UM9A 4WCDA 4KLZA 4Q00A 2JNWA 1WVMA 1U0HC 1WUHS 1Z4LA 1U0SY 2VYVD 2W2QA 1UDXA 4AJKA 4IIHA 1HYEA 5CCBA 1HT0A 2HO4A 3CUUA 2PRIA 1PJ3A 3A28A 4BB5A 1DL5A 1E79D 1GZ5A 2JLRA 2V7PA 3EOAI 4J90A 4U7PB 2VYQA 4DA6A 4HTFB 3BIOA 4RXUA 4WZBE 1J0XO 1Q0RA 2O8VA 3PIDA 3AILA 3THXA 2BMJA 3QNMA 4LQ4A 4WOCA 1OB5A 2I3ZA 3KOUA 4MWCA 2WJ3A 1FA9A 3K20A 4KOAA 621PA 5IM4F 1AGXA 1SU8A 5EE5B 2DPHA 3LGSA 1TQ4A 1NLMA 5JMPA 5BOSA 3TF5A 3Q10A 1CDDA 4CEJA 3QNUA 1RMYA 1PQWA 3IXQA 4PO1A 2I6QA 4QPPA 4YDQA 3IULA 4BNWA 2FOIA 3NVDA 2QN3A 4NZOA 1VYVA 4XVRA 2EBFX 1GU1A 2VJMA 1HMYA 2WRZA 2EBWA 5AYVA 1UBTS 3R0IA 5A1TA 1HOXA 2Y1GA 1J70A 3L7BA 1ZCFA 4OHUA 4Q15A 3RTDA 3TAXA 3GGSA 3NAQA 3WGYA 2IS4A 2A5DA 3CVOA 3RUFA 1EUDA 3EMKA 4HNQA 3R3UA 5FOXA 1OH8A 4TZ0A 4FOTA 3QWAA 1JG7A 1S0UA 1E9RA 2EF1A 2OD2A 3GT0A 4HB4A 3ZWPA 1GRRA 2BF4A 1LK5A 1Q95A 2VRCD 2XUGA 3CS3A 4U8HA 1KK3A 4YCMA 3HSYA 5I51A 1ZYUA 3VX4A 1YZUA 5DSXA 3TW0A 2PGOA 5B1DA 2VT7A 1AGPA 4FDUA 2NZWA 2PQ2A 2ST1A 4GPEA 1YI0A 1NUTA 2VYCA 3FWNA 5COAA 1UXHA 4F6LA 4G5GA 4ZTZB 4CCAA 1YVRA 4L4YA 1KF0A 2OHXA 2WJYA 3UT6A 4BTVA 2OA0A 1U7WA 3UK2A 3UPTA 2Y2VA 1EE2A 3LD9A 1STOA 2BLNA 4ZO4A 5FWYB 5A9SB 3Q8XB 3A8TA 1NBEA 3IVMA 1GFSA 3CX4A 2NIPA 4NHEA 4Q7JB 3RRZA 3DCNA 3VSEA 2CCKA 3HJNA 2D8MA 4GR4A 3R76A 3RAJA 4KXQA 4BQFA 1KZGB 5KINB 4BNHA 1Z8FA 1NPTO 3S1AA 1P1BA 2QT0A 1DJLA 3D1VA 4FYKA 3TO5A 2OZEA 3QZUA 1RYHA 1EIZA 1EM8A 1FXWF 3VU3A 1NMSA 1BCRB 1NDQA 5EIXA 3OEWA 4Z54A 2IX3A 2CXOA 1UPCA 3KR9A 4KBGA 3O8OB 4DKXA 4DGSA 5A1JA 1YR2A 4OMCA 1APBA 2NYUA 1SVUA 2YICA 3R24A 4Z9FA 3N0XA 5K3CA 5HJEA 1NRWA 1RTTA 2WZQA 2AEMA 1B0UA 1UKEA 1C41A 3DBLA 3W2HA 1U5AA 1V2HE 1Y1PA 2PX2A 1TCVA 1JB1A 1Q3KA 3CRW1 2QW1A 3O3NB 4U5QA 1N3IA 4DEVA 4PZCA 1QFMA 2YWCA 1II0A 3A4YA 4IV0A 4N7MA 3RYTC 4BVHA 1W59A 4H7DA 4OB6A 3AR2A 5ANRB 1FXSA 3DFFA 3QF4A 4IIEA 5C1OA 1T2EA 4H3KB 3G2NA 4ZZ3A 3TNDA 5IM4A 3MBKA 1ADBA 4CNQA 3BIFA 2R66A 1SOVA 2A9FA 5A6SA 1CIPA 2GM9A 2NGRA 4PRZA 4JJZA 4L9WA 4UBJA 2IU3A 5AW9A 3PFGA 3R3XA 4HNAB 4D9BA 4WESA 4HCJA 2W6IA 3LDGA 4FNGA 1SUAA 5AHOA 4YHHB 1IULA 3D4PA 1W5FA 3GGPA 2O8BB 1B41A 2B4RO 1JQ3A 3ANTA 2JAQA 1GGFA 1B00A 2CFOA 2P2CA 5IC6A 5C7OO 5E8RA 2JGRA 1M1XB 1I2BA 1RMTA 1V7ZA 3IOMA 5EIOA 4PNEA 1DBRA 1Q3TA 1AKQA 2JI8A 4JIGA 3UFXA 3NUQA 3GD5A 3MXOA 1JIKA 2LGJA 2GEUA 4BJ3A 2R6CA 1WZCA 2QG4A 1ZH4A 1BHO1 1R15A 1T5HX 2IC5A 3HY6A 2VNJA 4MKRA 4KYIB 3QVGB 3K53A 4Z4CA 1TM1E 1IY0A 1HEUA 2CN1A 1SM4A 3O31A 5EAIA 3VNSA 1F17A 5I9NA 1PR0A 4AY3A 4PZ9A 5BT9A 1CDEA 2Z08A 4NK5A 1TZBA 2RGNC 2V1XA 1C0IA 4PICA 4B3BA 1HORA 2ACKA 2LKCA 1E1CB 1GUZA 1QYDA 3U4IA 3BK1A 2B30A 4TPKA 4YMHA 4ZI7F 4TWZA 3GRZA 4ON9A 2WFLB 2ZJ6A 4LRXA 3DEIA 1N2SA 5CNKA 3PLNA 8ABPA 2H7CA 1WP9A 3AT1A 4OQMA 2FXVA 2EZUA 3EXAA 1Q7RA 2J3IA 5HCUA 4AMUA 4B87A 5E4TA 3FDXA 2GB4A 3BYZA 4DM7A 4F9GA 3INRA 5BR8B 3PPYA 1F7VA 2ZQZA 3H99A 2AUNA 1GCGA 2P35A 2PK3A 4KHPB 2YWFA 5A06A 4F4CA 3BEOA 1NBIA 3KV1A 4TTAA 1Z3CA 1P29A 3UMBA 2P9TA 5A5FA 5IM5A 2G5PA 1X1BA 3AVXA 3B3JA 3G8DA 5EZYB 1C8LA 2OENG 3TRHA 4X1OA 5E1MA 1NXPA 1J1ZA 1L4LA 3QLVC 1KIAA 3E70C 2D7CA 4N3CA 4QJIA 4UEWA 4E12A 4PIPA 2LIPA 1RI3A 1R88A 3R0VA 1PJQA 2I7XA 1E77A 3RRXA 4QKQA 3SZMA 1B6GA 2ZB7A 4L95C 4G5RA 1EMDA 4XGRA 1RZVA 4RK6A 4DSZA 4YUXA 1ZH2A 4KPEC 4HKTA 4RZ2A 3F3YA 1RQLA 2HRCA 3BSYA 1PJBA 4FLMA 5ENVA 1A5TA 4UKDA 3WQQA 5BORA 2L18A 1FW8A 3PQDA 3RYHB 1Y6QA 1G0OA 1Y89A 1U94A 5LQCA 4M0FA 5IKEA 1OGYA 3IHTA 1NG9A 1CU1A 1E92A 2A9RA 3BXHA 3M6XA 3UAGA 4DCGA 4X0EA 4PX9A 4F4DA 4Z49A 3SS9X 3UK1A 4EELA 1NVWQ 2X1MA 1RD4A 2C4VA 4GKKB 3D8TA 2P4HX 3DVAB 4LCEA 2Q6KA 1T3LA 5H3CA 4EL5A 1GUBA 4KV7A 5AVUA 3R3HA 3PXCX 2B37A 2FG6C 2CJFA 1WHSB 4KN8A 1G2QA 4MVJM 1G0NA 2BRUC 3TGPA 2ZUVA 5MN5A 3WQSB 2Y1EA 2CLIB 3QLVA 2QX4A 4IBOA 4MDEA 1R64A 3CLTD 2I5PO 2V3VA 2OCLA 2J5QA 1DBQA 1NVBA 4R40A 1U90A 4FXPA 2EFGA 4D98A 1QAOA 4QOSA 1JHAA 3KJXA 5L3ZA 2QQGA 3ETNA 3KXLA 2JIPA 4DCJA 4L08A 5F33A 5CK5A 3IKLA 1BCRA 1KEWA 2G3YA 2OD9A 3AB7A 4UTNA 2Z6VA 3PHBE 4ZN6A 1PR2A 1WMAA 1SCDA 5IWAB 5L6MB 2XTNA 1U2PA 2D0IA 1HFWA 3HXTA 3G5UA 2VATA 4S12A 2XDWA 3TLGB 2E89A 3OFND 1JMVA 1NOIA 2PJDA 1CRPA 2IYAA 2BCGY 5JWRA 1XEXA 3TS1A 2ZATA 5TRTA 1GKYA 3L01A 4RJKA 4ZU6X 1Y82A 2NUPA 2XTAA 4FKBA 4V0OA 3KYCA 1WDTA 1GJRA 2JA2A 3PGXA 1Y7HA 1OC4A 3U6KA 3WJ7A 2IPOA 1EFRD 3IUEA 4RKEA 1DKNA 1FDIA 2BF7A 4JLVA 1JU4A 3QTTA 4QD3A 4QECA 3LQFA 4HQOA 2HYIC 1DKLA 2BFWA 2LBPA 3ZY6A 3R2JA 2EFYA 5F7OA 3B5JA 4J76A 2RG7A 5A6SB 3DKPA 4XJTA 3ZKWB 2Q49A 4EA9A 3GP5A 1U8ZA 2YINC 3P2MA 2PLNA 4RHYA 3LSTA 1Z56C 5TJ9A 1WXXA 3O8DA 4FONA 1EUZA 1Z07A 2QGNA 4XD7D 4BNNA 4I8IA 5FOWA 3I9KA 4YAJA 4ZV4A 1LH0A 3N74A 4NS4A 1I0ZA 2C3PA 5EXEA 4F1WA 1SB8A 1Z12A 3OCUA 1E1NA 2PT5A 1T8RA 4EABA 5CG2A 3MB5A 4LSMA 3G0HA 4H6VA 4EJFA 4QPJC 1XHLA 3E23A 3VZRA 3AYXB 3DVRX 1PK7A 1BXZA 2AEFA 2VH2A 4L50A 1K6IA 2NAPA 1JFFB 2VEDA 2XB2A 3QVGA 2IODA 4DMMA 2FUCA 3S2GA 5AJZA 1AZTA 3G89A 4PYQA 3SICE 2BYTA 5JYCA 3ZXYA 1Q0LA 2AE2A 1PYGA 1G6OA 2XDQA 4HFMA 2IP4A 1FP4A 3KRTA 1F4LA 2IOFK 4GBED 1Z6QA 3LMKA 4M1TA 3BQ9A 5HKAA 4AW9A 4TXHA 5ECDA 3RG8A 4CQLA 2PGLA 4PWYA 1U7DA 2V7QA 3QX8A 4U00A 4OOFA 4OQQA 1H23A 2HK6A 1AE1A 1GARA 5K1ZA 2CLEB 4ZODA 3DMTC 4E31A 3K5HA 4MCHA 5AK6A 4FDMA 1QTRA 3O1IC 5KWIA 2FZEA 4N47A 3SDBA 3FSGA 1TRHA 2O2YA 3KYJB 1D8AA 3VSCA 4DXDA 3EMDA 4X54A 3N8HA 1JR3D 4PYMA 4TT3D 1G2OA 1AU9A 1P72A 1NULA 3G23A 3DOIA 4D56A 5FXMA 4MS3A 3RKSA 2AZDA 3M83A 4FC7A 5FNVF 3ZHCA 3FLEA 4M7RA 3GN1A 4OXNA 1ESDA 2EW8A 3KX2A 5G0TA 1MB3A 4QQNA 4RESA 1HE1C 4B3JA 2WWHA 2WBLC 2XIQA 1OXTA 2O8CA 1RHMA 2WWFA 1EGMB 5JATA 5JWOA 1J09A 1QH9A 4JFRA 5I8ZA 1BWRA 1E4VA 5BWOA 4L5YA 2A78A 3OCCA 3QFCA 5IDQA 3NHBA 1R6TA 4UVHA 5BYBA 3QYPA 4ARAA 4CTKA 2AOTB 2VTBB 2O7RA 2QI9C 3RUHA 3RYHA 3DFZA 3LQQA 3TW8A 3M9XA 4WJLA 2V7XA 1L5ZA 4RENA 4OUDA 1KMCA 4DEXA 2OP0A 5JD5A 2W0SA 3BMNA 4EGSA 3GQVA 3VBCA 1YE3A 4IHAA 5WRFA 1MAUA 4ZC1A 3WLOA 1H0SA 1YZKA 4TMXA 3VHXA 3EPLA 2FEKA 2B21A 1AJEA 1UMDB 3PEWA 2WYHA 2PUGA 1WUKS 4DMGA 2C5FA 3RJMA 3RQSA 2NOAA 4TKUA 4UHJA 3HJUA 3LRTA 4II7A 7ADHA 1ZM3A 1SH7A 3L7NA 5E9AA 3K70D 3A6DA 2CE7A 4EY4A 1EFAA 3ZCRA 3VC1A 4AK9A 4B73A 4Z4FA 2A9PA 4M8NE 4UU8A 4CIDA 1YBMA 2JDID 5DT2A 5EJAA 2QM3A 5KX5A 5I9BA 1KTIA 4MV8A 2UZ0A 4PRYA 1W4CA 2WWIA 1RCUA 1FNBA 5GINE 3P1JA 4HJRA 2X6QA 3EQ2A 3EA4A 5EVCA 3VQTA 3GG9A 4AQYB 3CR3C 4U7FA 2JD0A 1HLPA 2CUKA 2RSLA 1LPOA 2CB0A 3FNGA 4EW2A 1CE8B 1JPNA 3TGWA 4EX6A 1TLLA 1YVEI 1M6VB 3L1VA 2ZRMA 2V8OA 4LBZA 4TZKA 1MO6A 5CM2Z 2H4ZA 2QD2A 5GZ1A 3OQ1A 4TTQA 1JIQA 3U60B 3GBPA 1REQA 5JPCA 1DE0A 4XWKA 1R66A 3IX7A 2Y1CA 3OY2A 1MNAA 3E3AA 4QRIA 1MDFA 2R11A 1C7IA 3C48A 3JZMA 5BRJA 1UQTA 3FF4A 3T0GA 1ZOPA 4J3NA 1EFTA 2J41A 3L7AA 4E33A 2J6IA 5KTMA 5I8WA 1OASA 3EFOA 5LUBA 3W1VA 1FVOA 3SS8A 2JDIA 2NO1A 3P96A 1I14A 1J5PA 1R0CA 3F97A 4CHGA 3ZVMA 1FRQA 3OIFA 3DF7A 4EY6A 4A4DA 1EXWA 1FVFA 3BKWA 4EKGA 2H4HA 3AFHA 1DAKA 3KCNA 4PTYA 2HIAA 3THSA 2QJWA 4V0NA 2PD6A 5JDCC 3HYSA 1IY9A 2ZANA 4YYZA 1PFWA 2ATCA 2DLNA 3F3MA 5A3RA 4R3UC 5TV2A 1EWRA 3UENA 1Y8AA 1PU2A 2JIQA 2UYQA 5AOAA 3OPYI 1J0CA 4YVFA 2NSYA 4HH4A 3FOEC 4P3OA 5EJ2A 2CUNA 4KC0A 4UUQA 1QLJA 1YDHA 2CVFA 3CHYA 2CNWD 2PU7A 1YGPA 2NUTB 3NWOA 4LGYA 1L9KA 4I99A 4LRUA 4Y8VA 4TTSA 4ZVVA 4CIWA 1VPDA 3ER9A 1YVDA 4TSKA 3DLCA 3KQOA 1NHGA 1JFFA 2R8PA 3RS0A 2HD4A 1JSXA 4X1YB 5K51A 4B2LA 5KPJA 1LQ2A 4Q7LA 2X1VA 4CV0A 2WU4A 3I58A 3DEYX 3M3PA 2ZJZA 3WL3A 2FN4A 4LF6B 1OMOA 5A4IS 2EKPA 5CVCA 3O82A 2VKTA 3C8UA 2VAVA 2WI8A 4QU9A 4BMOB 2AJDA 4OK6A 4BZWA 1H4TA 1VE9A 1X7YA 2QIPA 3QEMA 2W2NA 5HQ3A 4BQIA 3GC6A 1TYAE 1ZX1A 2G17A 2VDVE 3L6CA 5F52A 3JU3A 3WL4A 4CJXA 1XD2B 2OUIA 1ZINA 1EGVB 5KYVA 5IJ0B 2GK7A 1VJ5A 2VP9A 1TUIA 1IBCA 3WWEA 3ZY4A 4BO0A 5G4KB 1L0BA 4N8DA 5K99A 2P3LA 4OKNA 3R7NA 4E7OA 3SFVA 3LUJA 1XU7A 2IU4A 1G5HA 5E9JA 3IAS6 4J4HA 1OXXK 1JHMA 4HDNB 4UJ5A 2EVWX 3DUWA 4IDBA 5ALQA 5AVOA 4BFUA 4U2CA 4BPBA 2HXGA 3NEYA 1MPXA 2AQKA 1WPRA 3CJQA 5DU2A 5DWDA 4DLVA 2I6SA 1TMOA 2YXDA 2FN3A 3OCZA 1M34B 1MTZA 5IF3A 3FMFA 5KSPA 3DL4A 3G0IA 4QE3A 5LMCA 2C0CA 1BWPA 2FE1A 1XXLA 1L4YA 1EUYA 2XA9A 1MP0A 3USES 1Z26A 5AJHA 3VDNB 5AVVA 3H3XA 4G1VA 3HXMA 1ZMOA 2MOKA 2ZEJA 4PYKA 4R8RA 1TUBA 2JIBA 2AFHA 3T6KA 4Q4CA 5JARA 4GD3Q 3JVVA 1UQUA 1OZFA 4ILKA 1NE7A 1T4GA 4KQHA 1UPFA 1BVRA 1GU0A 1ACMA 3NEAA 1U3UA 4HL6A 4WI1A 4BHTA 4N6NA 5K4HA 2UYHA 3OOJA 1L1FA 3DC7A 3PVSA 3RVNA 4OLAA 2GLXA 3JQRA 1ZA1A 1ZK1A 4CN8A 4JLSA 3NHYA 4DCMA 1IVYA 4IXDA 5DBHX 2W6QA 3IPLA 3NR2A 3EA5A 3KPVA 1XROA 3E2MA 4L0QA 3TAHA 3PJEA 5H81A 1VMKA 3V2GA 3LX6A 4M38A 5LZ2A 2PTHA 4A0QA 2C7QA 3CZQA 4O1HA 7REQA 4NYIQ 2N1BA 5HR5A 3OTGA 1XYVA 4MVYA 4FDAA 4N82A 3DEHA 4C0SA 3L0YA 3L8CA 2MMGA 2Q9UA 5HBRA 1K5GA 1N6HA 1GSHA 5KCZA 1RQRA 4YBZA 3WIUA 1QVAA 4DLUA 4V0QA 3GMSA 1F0KA 4JBYA 3RTGA 2RKBA 3WMFA 4BV8A 3D3KA 3ZI7A 3HUFA 3GJ8A 2FFRA 3IOYA 5BVGA 1CG6A 1LS1A 4U0JA 3RAGA 2YYAA 3BE4A 1Q1QA 1GPLA 4EJMA 1W29A 2BUCA 3G5LA 1MIOB 1F8XA 4U1RA 1CY0A 2RHBA 3UWOA 1VHJA 3HXPA 1MEJA 3MGGA 4OU4A 1U7HA 2OBNA 1Q7CA 2QZPA 1XZGA 4J3FA 4EO7A 1BHJA 1W4ZA 1ZXBA 1QXSA 2QGZA 3L6DA 1VL5A 4G23A 4HQRA 3DULA 1GGEA 2FNAA 2Q6VA 1T4MA 5REQB 3HJCA 1MQSA 3C97A 1VCMA 3VFDA 4ZKDA 5KYWB 3DAGA 3NLLA 4KFUA 4QLOA 1QBGA 1UBMS 4JI3B 1ID1A 4B81A 4ZQHA 1Z0ZA 3O47A 4JEIA 3DWGA 3ZW9A 3EXFA 4EFDA 5BW4A 2C9YA 4F6CA 1MT0A 4EHFA 3CEJA 3RV4A 2VUIB 2UZIR 1B76A 3LC7O 4Q02A 3DMGA 1O6GA 3DHYA 3GFSA 4WY5A 5BYKA 3PUKA 1A71A 4R8SA 1Z6XA 4DUPA 4RDXA 1L8QA 1KZYC 4MAMA 3EGWA 2D00A 2IUYA 4UMFA 1G64A 4DLSA 2R1TA 3VA7A 4HLNA 1KZ4A 4RMHA 1NBME 4P4TA 5H3HA 1RIIA 4BMXA 3K2QA 2RAUA 1IPHA 5I7EA 5K3EA 1U81A 1GTL1 4AY6A 2HT1A 3D6JA 3U4CA 3E9MA 4A82A 1B4DA 2WSBA 2ZUSA 2PD3A 3P9IA 4AJ9A 4BUCA 5B1YA 3E3MA 3JQCA 3OIUA 1KR2A 1QKJA 3PT9A 3Q7SA 1MEEA 1FFBA 1K9SA 4CLOB 1Z0DA 4YT8A 2BKUA 3EXIB 3NDRA 4KWHA 1GAXA 2A0YA 2QLLA 4M0DA 1E8NA 3UT5A 1XRJA 2GZRA 1NBWB 2H9IA 1V71A 4CQMA 4HAOA 5I4BA 1NQWA 2MSKA 3KKPA 4HEHA 4F5EA 1JR6A 5ERYA 1YZTA 2YBDA 1ZIXA 1D7AA 4R6XA 5TF4A 4HV4A 1E4EA 4BE4A 4XARA 1YK1A 3NHKA 5AW5A 3P4XA 1AT1A 3OEHD 4WVLA 4Z5XA 3H1PA 1PJRA 3NONA 1U2GC 4D45A 4W99A 1BH6A 1C3LA 4B32A 1JYFA 1N2BA 2GZAA 2EZ8A 5BW5A 4P4NA 2VHXA 4HLDA 4HLCA 1FNMA 4HN2A 1PX0A 2XB8A 2EATA 3SD7A 4QJ5A 4B3TB 5DGDA 3RARA 2HI0A 2EL7A 2EW1A 2IUSA 1U0JA 3LXXA 3PDHA 2J0SA 3AHFA 4K2HA 1DC6A 1J56A 4XVCA 5DBOA 3F90A 4MI1A 3GRVA 5LQAA 4MR8B 2GUGA 1YZ3A 2I65A 1BDBA 1G1MA 2J3JA 2R7NA 2W11A 5FTKA 1RQ2A 1CVIA 2CHUA 2GQ0A 4EA6A 3SX2A 4LNUA 3H04A 2J9GA 4N49A 4MLDA 4GOXA 3UMGA 1E99A 3ETHA 4FKZA 5KWEA 2CNBA 2V7UA 3Q6NA 3AUYA 4QNRA 2B8TA 1YQQA 1ZK2A 3NRBA 1T3SA 2RJNA 3LPLA 1EHIA 5LP6B 2CLLB 4V3BA 4RSHA 4EF5A 2DH6A 3A6KA 2BFEA 2W2PA 1RE1A 2ZYAA 4K6FA 4EY7A 2WNHA 4WK4B 5AO9A 4E2ZA 2XMQA 3TSCA 2IS2A 2QLJA 5JC8A 2Q29A 4IILA 3HBFA 4HNGA 3U37A 2R1UA 4FMCF 1XMIA 3LZCA 3DBRA 4MV7A 4EKIA 5HRCA 1QOQB 4R0VA 4BIIA 4MA5A 3FHCB 4IKEA 3GDOA 1K2WA 4I36A 1IN1A 1IBMB 4I1OA 2VP4A 1IZ7A 1NVMB 5BNIA 4X65B 2QAJA 5A4AA 2VNIA 3PRKE 5AW2A 4CPDA 5DNVA 3DOEA 4OKSA 1G3QA 1J90A 4QELA 1JECA 3WO0A 2J3QA 4LF9B 4I5FA 5DV9A 2GSWA 4EB6B 2PX6A 1M33A 2QTGA 2J0EA 1IN6A 2F1HA 2RHOA 2V6MA 2C58A 1G17A 3V1NA 2QN1A 2B7BA 3W5HA 1TLFA 3H5RA 1JDJA 3T9EA 1L8OA 1YC2A 3QELA 5BSMA 4YRDA 1VLMA 4MV4A 2ZM6B 2QIOA 5CVDA 3LDUA 3TQHA 3KXPA 3F7MA 3R4VA 1YC5A 2VDLB 1OLSB 3BE6A 3EQ9A 4MVWA 4PEVA 4YROA 4ZAVA 1FU4A 3SX4A 5TLSA 2IPLA 2ONZA 3DEZA 4U7TB 3VXKA 1NXWA 2ZE6A 1AQNA 3O4GA 2YJGA 3TLAA 5KTOA 4NMMA 3HS3A 1QP8A 4DHWA 3P0FA 4J0HA 3TJMA 2YNMA 3U0VA 4ND5A 1EG2A 4KRXA 3RYFB 4KNVA 5CVTA 1BOFA 1KHHA 3CGGA 3OC6A 5FA8A 1KQNA 4RNDB 5G02A 2EQBA 2Y6UA 4OAOA 3OY7A 1AQJA 4QDTA 1K86A 3RM3A 3ORQA 3PQFA 1N5JA 1SPXA 2DPYA 3EXFB 4GMDA 3A06A 3JQDA 4MKGA 3IQWA 4MJ3A 4HFRA 1M2GA 2ZIWB 3M4XA 2FQWA 5BN4B 4ZJUA 1JHUA 1ESZA 5COBA 4C7OA 5LYJA 1NYLA 1CSEE 4XW2A 4R16A 3GRRA 1N6IA 2ZYVX 1PYOA 3O92A 3M49A 4YV7A 3AUSA 2OY0A 4NFHA 4MWBA 1R8XA 5IZCA 1S89A 1XRNA 2VFAA 3UPUA 1Z36A 1CJKC 2PL5A 4Z6KA 5IT9A 1IU9A 4M1KA 4FHGA