3DT6A

Crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by paraoxon
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQSEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Brain Platelet-activating factor acetylhydrolase IB subunit
total genus 76
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dt6A00
1FXWA 1BWRA 2O14A 2Q0SA 3DCIA 1BWQA 1U8UA 4XVHA 4S1PA 3MILA 3SLRA 2WAOA 4Q7QA 2WABA 5B5SA 4K9SA 4OAPA 1JRLA 3BZWA 3U37A 4IYJA 4K40A 3KVNA 4I8IA 4Q9AA 2WAAA 1V2GA 4HF7A 4RW0A 1WABA 3HP4A 4TX1A 1ESCA 4M8KA 1BWPA 4K3UA 4RSHA 1ESDA 3W7VA 3SKVA 1YZFA 4OAOA 4DEVA 1VJGA 4PPYA 4HYQA 3DT9A 4JJ6A 5JD3A 3PT5A 1ES9A 3DT8A 1FXWF 3C1UA 4JJ4A 1IVNA 5HOEA 1DEOA 2W9XA 1J00A 4JGGA 2Q0QA 4H08A 1PP4A 1Z8HA 1VYHA 4NRDA 5A4AA 2APJA 4LHSA 5BN1A 1ESEA 4JHLA 3DC7A 3RJTA 1ZMBA 1DEXA 1K7CA 2HSJA 3DT6A 3P94A 2VPTA 5CD9A 4JKOA 4K7JA
chains in the Genus database with same CATH superfamily
3ACDA 3P96A 3U7FB 1L5QA 1L1RA 2HTFA 2O20A 3JVDA 3ELDA 3NNNA 2B21A 2OG1A 3RUCA 1KEWA 1R4NB 2YHBA 1XEXB 1T9DA 1YOVA 1NT2A 4RHUA 5D01A 4CM4A 2XKJE 3H0CA 1KZ7B 1DEAA 3T1NA 3II6X 4TRJA 2C8LA 2QL6A 2R3SA 1E6UA 3FN4A 4UZSA 5DYYA 3Q7RA 2HWUA 1ISSA 3W7BA 3WL6A 3GLSA 1TA4A 5CVUA 2BAGA 3CUVA 3P4XA 3LK6A 4E5UA 2YJ6A 3FI0A 1R3DA 3KR0A 4TT3D 5CFPA 4REOA 3QM1A 3HSSA 4K9OA 4M0UA 3BWXA 2F9MA 5B55A 5KPDA 1QPBA 4FGZA 2I5PO 3X1ZA 1NLMA 5KKCA 3HJCA 4E70A 3N9IA 5AXDA 4A26A 3IV7A 3UPTA 4KQGA 4RZQA 4RMNA 4D81A 3T5AA 2Y77A 5D3MA 1PLLA 4DDMA 5E95A 2ZVDA 4EFMA 1PCXA 2HO4A 1ZYUA 2OHIA 3PCTA 5IXJA 1ZOLA 4F3KA 2Q41A 3HBJA 1PGNA 2GAIA 2JVJA 1K86A 4P9NA 3IL2A 4OSPA 1O5TA 4BFZA 1QONA 2P78A 2HMWA 3GK3A 1UMBB 3SNHA 3V34A 2JI8A 4O63O 3AR8A 2GYVA 2QSZA 1U7UA 2Z5FA 1YK0A 3G2PA 4ZV9A 4BMPB 5HUQA 4HB0A 4CFSA 3AF5A 1SQ0A 3E22A 2OBFA 4FLEA 4R2HA 3BGSA 3K71B 1IQPA 2P9EA 2H1WA 3FOWA 2DQZA 2CNKA 1L9KA 2CD9A 2W00A 5KU1A 3Q8KA 2UVPB 2VF8A 3PHCA 4J2HA 3UHJA 2XQFA 5I48A 1PHPA 1QO9A 2I9PA 4ZMRA 1ACLA 5BNZA 4HNGA 3IKLA 1HEIA 4P6VF 4C0XA 2GF0A 2XBMA 4U3JA 3ICVA 2VUIB 3V9PA 4GI5A 4BMYA 4U6SA 1OLXB 2JFXA 1MNQA 4A16A 5HVNA 1X7XB 5CDUA 4DMFA 2E3JA 3KPYA 2E5LB 3DT8A 4P81A 4YJDA 4EVRA 3L93A 2C58A 3JALB 1P7CA 1W88B 3BRSA 2AOUB 5BORA 4IVQA 1RJ9B 2P8JA 3LBIA 1PJAA 3SLKA 3PTAA 5BSFA 4W9NA 4CT5A 4PS0A 1PTKA 2FJPA 3AY7A 1NQVA 4U8HA 5IEBA 1IJEA 5DLDA 1PDVA 1XMVA 4P82A 5J63A 3ZW8A 5KOHB 3LW7A 4OMFG 4X64B 4OUKX 1KU6A 4FHEA 1T2EA 3DZKA 4HGRA 3IT2A 4R2XA 5CCDA 3TEFA 6REQA 2O0HA 1UXHA 3EFBA 4NCBA 5FL3A 4RPGA 4FFNA 3ZU6A 2OM2A 2PJDA 5B1YA 1FJXA 2PNFA 1N92A 1X1DA 1XF9A 5BMVA 4WA8A 2O54A 4HDMB 3UPUA 3DCYA 1U1IA 2QDKA 1YR8A 2G1AA 4LHSA 3AL3A 3BHIA 2VQFB 1DC6A 3RSLA 5J2TF 3UC9A 4DPMA 4Z2YA 4YLYA 4YUWA 1DJNA 1Y6JA 2I1VB 3I09A 3QVGA 2WD7B 4TMKA 2Q2QA 1YRLA 3NIDB 3EYAA 5JO0A 5HM8A 1BDJA 3SMVA 1P74A 3DO5A 1WBDA 5JPCA 1E2PA 3ZHTA 1OX4B 2JI9A 3BX1A 1B0PA 1KVUA 1RPJA 2Q1SA 1I3MA 2WUVA 4N4AA 5ES4B 2C8VA 2NVBA 4JLUA 1JS1X 5F7JA 3ZY6A 4E21A 1ZU5A 1SCBA 4W8OA 1E8DA 3EIOA 3J81k 4A1OA 1NW4A 3P20A 2HV9A 3E05A 3MN1A 1XCMA 3CNHA 4EBFA 1G42A 1V4NA 2B7LA 4YAJA 5M2QA 3AHGA 1VOTA 2FN9A 2HQSA 1DEHA 2J3HA 3I1FA 4EVSA 5KOIA 3CUWA 2EGHA 2RI1A 2AXEA 2XYGA 1KAOA 2MOKA 3NM5A 4OHUA 3L3BA 2IEDA 3DZFA 4BX3A 1A2KC 3FZQA 4EW1A 1UJCA 3DO8A 1YSCA 1E1DA 1WCWA 3LDGA 4S0ZA 1HYBA 1YAHA 2J45A 3DHEA 5A5VA 1OQAA 1AK2A 2P4QA 2WA1A 3QV1A 1D1QA 1CJMA 4JI8B 2LV8A 1I8TA 4O5OA 1AF4A 1P1JA 4HAXA 2WABA 1JA0A 2FPXA 4RCVA 1KIMA 1OT5A 1U3VA 2PKCA 4J4HA 3SSAA 5IU6A 2XGJA 3LX5A 3VJRA 3LT0A 2FE1A 4YP7A 2JGMA 3BH0A 2ZRPA 4FS8A 4Q3AA 2IU4A 4OGFA 3N1UA 5KVAA 3LYHA 1ML4A 2VDPB 4BGEA 2NYVA 2ZJ4A 1AC5A 1BA2A 1E2LA 3OUZA 2RHDA 5C8ZA 1KGDA 5ITZB 1GPYA 3ZHCA 1YB7A 5LU9A 4FLFA 5T67A 1W96A 2IDJA 2HF9A 3HNOA 4E6EA 2DLDA 2E6KA 3OFNA 4MRPA 1NDUA 5TT0A 1K6MA 5EJFA 2OUKA 2I87A 3LRTA 3DF9A 4L8VA 1Q84A 5CB4B 1WULS 2RAUA 1GR0A 5DYGA 4OXNA 2DMRA 2OC4A 3EZ7A 1J1ZA 3IAXA 2WJ6A 4LRXA 5AM1A 5F1KA 3STYA 4BTLA 2H2AA 4MA0A 5E6SB 5JDCC 3DMGA 2PJRA 3V97A 1M0SA 4IHJA 3C3EA 4ESHA 1ODKA 4YRBA 1ZHOA 2PD3A 1GUZA 3SDZA 1YTLA 1KJYA 4H60A 1AKMA 3C3CA 3EPRA 1YB2A 4TV8B 5DP2A 3UGQA 3WNBA 1CS0B 4CCAA 4ZJUA 5K99A 4JJ4A 2FR8A 2WM3A 5IKOA 3VU9A 4GI1A 4CR6A 4YI3A 3U9LA 5DM60 2J7KA 4PAQA 1W581 3I4FA 4CGYA 1EU1A 3WRXC 2X3FA 3DULA 5AVXA 3VU0A 5KWVA 3JYNA 2D2IA 4Q3EA 2PMFA 2BGGA 3KOZA 3ASYA 4IRXA 3W3AH 2W6OA 3M6MD 2ZYTX 1JDPA 2C5GA 3E2IA 3PIRA 2M1XA 4U4AA 5A2QA 4IEFB 1C3OA 2PO7A 4M8NE 2O2DA 2O2SA 3EVDA 2BFEA 5LLSA 9LDTA 2ZB2A 5GZ6A 2ZITA 4JU8A 4KXLA 4B87A 1FIUA 3HDJA 4HQ6A 2IYTA 3CWCA 2YXDA 2IKSA 3QUTA 4L16A 3AVXA 5DZSA 3DHVA 2IIBA 1Y48E 4KYIB 3IR5A 4TMXA 2Y1XA 5DMXA 3GUVA 4QUKA 4P0QB 3JQ8B 3QYAA 4MP3A 5CW1A 5GONB 4NBUA 1E9CA 1SXJA 2BKUA 5FLYA 2D54A 2OILA 1LB1B 3JQAB 2VR1A 3LIPA 2QE7A 5FFMA 3QU4A 4FWTA 4ZHSA 4JYCA 2IVZA 5BOVA 3UH0A 3B78A 3B70A 4BX8A 1IBRA 5AM5A 3R6TA 2VZ8A 1ZKDA 2DWCA 3IIJA 3QRWA 2X5OA 3BXEA 3C4QA 3C3BA 3M33A 2CKMA 3QVSA 1XAJA 5T4HA 4EG4A 3D9QX 5KKAA 3BL8A 1SQSA 1Y7HA 2FN4A 1GJRA 3IUEA 1PHRA 3D0RA 3T34A 3TIXB 1U4OA 4IUCS 2O7QA 3V3TA 3Q9SA 4D4GA 2VUUA 1U5BB 1T6ZA 1CFZA 1VECA 3B48A 2PMKA 3GFRA 4LYAA 1GRRA 4AJIA 2WU4A 2C7OA 2YFHA 2AXQA 1ETHA 2JPDA 5DI3A 3FWPA 1EFRA 4FDUA 1XTZA 4KX3A 3SSMA 1Y8RB 4B8WA 5FP0A 5JSHA 1SK9A 1WXQA 1ZI8A 2ZJYA 2I6TA 2BKLA 4BMXA 3WS7A 3GLHB 2HHHB 4S12A 4AP6A 1UBSB 3PPIA 3WTBA 4PIVA 1I4TD 1JU4A 2FW1A 1ESNA 1KVTA 1RE0A 4HZGA 1EDBA 1YQEA 4GGOA 5K3DA 1FQKA 1V41E 4G1CA 5TIIA 4K9MA 2ORWA 2HNAA 3LQKA 3LKDA 3W5JA 1U2GA 4EAQA 5A0VA 3ZWDA 4JP2A 3A1UA 4ITVA 1PG5A 4D9HA 3QFSA 4L22A 1H6AA 4YS6A 1I94B 3M3PA 4MW9A 4DXHA 4S05A 3UFXA 1R5OA 4AF7A 2A8YA 1LS6A 3AEYA 1FPMA 1KJJA 1Q6YA 1EYZA 4YECA 4CMAA 4HNUA 5EJ8A 4XIJA 1L8XA 2K7ZA 4G9BA 4BLRA 4INOA 3TRFA 2N46A 4EO4A 4C76A 2ZJ7A 3PFCA 3PJGA 3GLRA 1IHDA 5D8DA 4EATA 1DAPA 3G3EA 2A0FA 1YS2X 1MC5A 4HQNA 4F91B 3IVRA 3TG2A 2AE2A 4TMVA 2ROQA 2I8CA 4YJHA 1OWNA 4AZTA 5C7IO 2XUDA 4CV2A 4DGQA 4QRHA 4EUKA 221PA 2GBLC 2ZWIA 3GUHA 3MLBA 4CL2A 5M29A 3D7KA 1AQNA 2UYOA 1XPUA 1HE1C 4FZRA 1H4QA 1SG0A 1D2MA 1TVEA 5K6RA 1FP6A 4MVJP 2FSHA 1S3GA 2ZWVA 3MT7A 3OTOB 1W1WA 3PEEA 2JGKA 3D02A 2Y0DA 4WPGA 3QLEA 1QOPB 1IXSB 5FI0B 4F1JA 2V6MA 5B7QA 3EPJA 3TW8A 3QXXA 3FUWA 2VHWA 3EWIA 3L6UA 3GCWA 3ONFA 4NZOA 3I0MA 3KZOA 4XYGA 3H5RA 4WMLA 1CUAA 2O8NA 1G98A 1ZMOA 4I7EA 2ZS8A 3JQPA 5FBKA 1YR6A 4IIFA 1S2LA 2ODEA 1A4XA 3V8EA 4FKZA 1V1RB 3ZI4A 2XW6A 2QQGA 3RFFA 3SZOA 5JSQA 4DJFC 3I1YA 1CEEA 2BR5A 1NIPA 5I9MA 4FBMA 2HPVA 1QO0D 4XOUA 5L4LA 4A8JA 2X0EA 1U5CA 4BMNA 1LTKA 3IAAA 2VTKA 3N39C 1Y3BE 1W4BA 2XMQA 3OVMA 2SBTA 5C8YA 5GZ1A 2G0AA 2EC5A 5LR6A 5DBFA 3OA2A 1OREA 3DT6A 1H65A 2YWFA 1G3RA 1TMKA 3TLGA 3TGWA 1YH3A 2DQ4A 2R8PA 3IPLA 3E9QA 1JLHA 1M9NA 2H9IA 5CMLA 4LN1A 4I9UA 5JC8A 1N1GA 2BBWA 3SZ3A 2W58A 2OHGA 4ZWNA 3E9YA 3PQ6A 3TPZA 3LTEA 3T4XA 3ZWWA 3TDMA 1E58A 1KRXA 4L8GA 4B1FA 3EXEB 4LZJA 4DCOA 2QTAA 3MAGA 4OBBA 3LT5A 1U0HC 4HDNA 4UU7A 1WQ1R 1KORA 4L0CA 1RAAA 1O97D 1TMGE 1D1SA 3I2FA 3PQCA 4HN4B 4XDZA 3T12A 3UWPA 3QU7A 5FWDA 4DMUB 4KOEC 3INYA 2QRHA 1NYQA 1ZBQA 2FPPB 5EIBC 2FSSA 2QQEA 2VBFA 4BJ5A 4ERXA 3DDCA 3B20A 5TT1A 5IT9A 2V6BA 4ITRC 4BLSA 3TZKA 2JAQA 2Y0PA 1IZ0A 1G1MA 1T4DA 2AI3A 1A8UA 4BCDA 3MJHA 1NVBA 4QYTA 1RE1A 3M8KA 3O8NA 4P54A 4DDKA 1NT4A 3WB9A 3WL5A 2MIIA 2GTPA 4MV8A 3EW9A 4ZQEA 3VHLB 5K0ZA 2O3JA 2PFGA 3AF4A 4LZPA 4QQKA 5E1BA 3JALA 4ALLA 4D6XA 4REQA 1HQKA 2WJYA 3QEJA 1BGVA 4IFIA 2JIZA 2RGDA 4ND7A 4GO1A 2IL1A 4RSHA 4YN3A 5BPFA 3N2GB 4PBSA 2AG1A 1UPCA 2JK1A 4AJJA 4DBLE 2ZPTX 4QQFA 3GZNA 4BGDA 5KTYA 3A9VA 4GEKA 2ORVA 3UAZA 5HWSA 3ODGA 3BCRA 3K05A 2FLVA 4MUIA 4MB0A 1KO1A 3Q2IA 4G2TA 5HPYB 4ZK6A 1VJGA 3H2IA 1UDAA 3S6JA 1JFLA 3HCCA 2I3BA 3W2EA 4B40A 5D86A 2VF7A 3I05A 2X5KO 4BFWA 2Z09A 4U5QA 4DG9A 4ZKEA 2WPDA 4PO9A 1A8PA 3JY6A 3T3OA 4DMKA 3OU7A 3FMOB 4GXTA 1BMQA 2B4KA 2MSNA 3DBHA 4B83A 2BDTA 3JZFA 5LN1A 1AK1A 3I28A 3PIIA 1TPZA 2VUTA 2A9FA 2PGAA 1HRDA 3GGOA 3RIXA 2JD1A 3HKCA 3VXKA 3ZI0A 2OCXA 1GGMA 4A0SA 3RC1A 4B2PA 3TECE 2P2LA 4KLZA 3VR6A 2JLYA 3NAMA 2HU5A 4HRXA 2GB4A 1QCCA 1XL0A 1L0BA 2D8AA 4DCSA 5JZBA 2OD2A 5IAJA 3PCXA 2D62A 1PQYA 1G5QA 2X6QA 5TSDA 4R81A 2O23A 3B1WA 3THOA 3DV0A 4BNNA 3S27A 1R4MB 1R1DA 4N01A 3CGWA 4YQYA 3OURA 4NWIA 3QYJA 3LJKA 4DLKA 2OQIA 1H1LB 1MABB 1PQWA 4KDCA 4KDFA 4PLYA 2JCGA 2AVNA 5TF0A 2EG5A 3ZEIA 1UH5A 3MS2A 2C7VA 2YN2A 1DKNA 5EE3A 3P9YA 3RYFB 4S2UA 5IC5A 5COQA 5KNBA 3IJ5A 4L9AA 2ODBA 3EFOA 2G7ZA 1NNEA 2Q3BA 2PZJA 1C1YA 1W48A 2OB2A 3FSGA 1NMQA 3CPJB 3I53A 5GVRA 1E6WA 4M46A 2WYUA 1EWYA 2XMPA 1QX4A 3B9RA 4WEQA 3Q2OA 1MU0A 2C03A 1NG9A 2AI1A 4ZN6A 2PKQO 1UJNA 4AJ9A 3HMKA 5K0GA 1Q0TA 2NTNA 2B7CA 5A9SB 2FY8A 2VYFA 3QMMA 1JFFB 1QH1A 3F78A 4LTMA 5G1OA 3WA6A 1Q0UA 1V7CA 3TQIA 5DHPA 5HDQA 2IXEA 3P0RA 4XYEA 4N3NA 4Z3OA 1EINA 3A70A 1P2FA 2PV7A 1CJBA 4ZAYA 1LSOA 4ZVSA 5T8KA 1II8B 3TL3A 2NIPA 3DKIA 4BZZA 4EARA 2VCEA 1J5EB 3HYCA 5CT8A 4MCJA 3Q7EA 5K0TA 4C7VA 4U8GA 4HV4A 1AQLA 1BTOA 1JH8A 4MQ5A 4Y2QA 3UOGA 4O0MA 1QIIA 3EXG1 2BFOA 1HSZA 4A03A 3RFUA 1NC1A 3OQVA 4TYMA 1KZ4A 4BO9A 1J99A 2PM8A 1DQRA 3JYQA 4AYWA 4DW8A 1N36B 4EHHA 4YJ2B 2VP4A 5EJ9A 4FYWA 2IOQA 3DLBA 1ND6A 3S2GA 4KMOA 4PWYA 4FR0A 4ZP1A 4Z9XA 4AYTA 4QOJA 2VIIA 2O8FB 4EG0A 2WQ6A 3UKOA 3K0CC 1TM4E 5LQKA 4DEYA 2OOSA 3PD7A 1VPTA 3UAVA 1WZCA 1YIDA 2QQ5A 1WAMA 2EQ5A 1XT6A 2IYSA 3W5DA 1XL1A 4M0KA 3DMFA 5CVDA 1WETA 2A5GA 3FVTA 1OE0A 1P75A 1ESZA 2Y67A 2AW3A 2YTZA 2F43B 4MRVA 4EO9A 1JE0A 4RL6A 1MG0A 3WGMA 4AICA 4H59A 5JS7A 3TJRA 2Q45A 4RD1A 4WADA 1GZ3A 2AHOA 4QL3A 5BN4A 4JI4B 1FVHA 1AURA 4NULA 2V7PA 4KIGA 2GZMA 3E3MA 4NVRA 1THZA 1UBMS 1JPUA 2C7QA 3TX6A 1IXRC 1L8AA 1VP9A 3D3JA 4JC0A 1OXKB 4RJKA 5HM6A 2TRSB 4IHAA 5GIOE 4YV7A 4OGWA 3FWHA 2WG1A 2LVBA 2AFVA 2JCBA 4RK1A 4E5VA 2ZVQX 4RFLA 2PS0A 2WHRA 1PR6A 4R84A 5CIWA 2OCLA 3W4IA 3WNQA 4WOJA 4ZJPA 1NF9A 5JAMA 1NJ6A 2P9CA 3A1TA 3OJOA 3ZU3A 3GLGA 3G0DA 2Z6QA 4DABA 1MVLA 3QX9A 2JLRA 3RJ5A 3SQOA 5AKKA 5H70A 4KLNA 3LX4A 4GBED 2PZMA 2ZJFA 3H19A 4B33A 2V6GA 2Z30A 4B4WA 2YN4A 1H1LA 4XWKA 3OX3A 1W2GA 2A9VA 2X2FA 3I73A 1KYWA 1JJIA 3SEAA 1H4SA 4B3DA 3DVQX 2IZ6A 2NPOA 4DLXA 1VMEA 4WNCA 1CEYA 1QF9A 4JLNA 2PZAA 1DEKA 3H2HA 2JJQA 3ZY3A 4W8HA 2CNWD 1GG5A 1ZM7A 3KDPA 4GC9A 5B4VA 3IGFA 2DEUA 1OWOA 1A72A 1X9IA 5TDHA 1OX5A 1VGVA 3IMEA 1YZQA 2J9FB 3LG2A 4D9GA 8OHMA 2G09A 1NBAA 1JT2A 1ULZA 4J1QA 5HNKA 2ZBFA 2FEAA 4ZQFA 3USZA 2Q4RA 2H7CA 4RF5A 3AJ9A 5IABA 3EEOA 2C2YA 4NFSA 1CVIA 1FEZA 3DOFA 4C3UA 3RS4A 4HFRA 2Q3DA 3W2GA 4E11A 2NTVA 5HGJA 4C87A 3K6SA 4MULA 4MMYB 2ZRAA 3PV0A 4KXWA 5GV8A 4B4UA 3NFYA 1OKKA 2X8BA 5CR9A 4Y98A 3WKDA 1II8A 1QGYA 2UVQA 5HYVA 5JR3A 2BBTA 2P2DA 2DQSA 5ECYA 3SR4A 1YVDA 1D6MA 2OFWA 4R5HA 2BZGA 5BSRA 3NBYC 1DC8A 4L4UA 4EA9A 1XTSA 4X8MA 1X1CA 5TMBA 1M5TA 1ZD3A 4XM0A 3GJRA 3JRXA 2NV6A 3T4EA 3AWIA 3T9DA 2FMHA 5EXTA 4EHDA 3HVIA 3QE4A 2I8AA 1HG0A 2RGAA 4WLNA 1M33A 1JJAA 3Q0TA 2NU7B 4HTFA 4XUDA 3P9CA 1XLTA 1EP3B 1V8BA 2XRMA 4EJ6A 2F3SA 1VLJA 5EJIA 1BZYA 3EIWA 3F97A 1W25A 2NAPA 3LKVA 4NZMA 3LHIA 4WFIA 4PM4A 3UWKA 1V95A 2WE7A 2YVLA 3OAAA 5ALXA 4B85A 4F72A 1LBIA 5D5PA 1Y1KE 3DV0B 4HAUA 2A0WA 1D2HA 1J9GA 1YVRA 2CHGA 3IJPA 4OHBA 5JC1A 4PZPA 1GAEO 1XTPA 2DLCX 4MP6A 5EE5B 3ZI7A 1W34A 2I4TA 3VI4B 3TGPA 4OQEA 2YHUA 1QCDA 4IJQA 4QNRA 3V7NA 4I1SA 4JBHA 2QTTA 4NG4A 1R0RE 4W4TA 3X2SA 4JL6A 2DRIA 4C6HA 3TEMA 2XRZA 2A9KA 1S2MA 4EHKA 3WGIA 1VRWA 2IY8A 1PZHA 2ZBVA 5T4BA 4N40A 2GK3A 4KH1A 4AWXA 1K6JA 4GE0A 4QDUA 4F2DA 2PQ2A 1WPXA 3FR8A 3QV2A 3P9SA 1ORWA 1IB6A 1P5HA 1Z8DA 3N5KA 6ABPA 4U7TB 3H1PA 1P91A 3H2GA 1FNBA 1VLHA 1YQQA 4L8WB 4UBJA 2OOKA 3ZDAA 4TUYA 5ADWA 2HQBA 3N76A 1KKUA 2J9ZB 2D2XA 3QHPA 2RC5A 1OBFO 5AESA 3THWA 5EINA 4BVAA 4BYMA 1YE3A 1OH8A 2Q07A 4D3XA 3WAGA 1ES9A 2RBGA 3DMTA 3UATA 3MBOA 2A3RA 3F5FA 3PC4A 4JKIA 1IY1A 1BCSA 2PH7A 3IEKA 2Q4DA 3OIGA 5AHKA 3UK7A 4AO6A 2GT1A 2E85A 5MN6A 3LQRA 1HDIA 2VT2A 4E5PA 3R0VA 5E2IA 2NAFA 1KFCB 4F4DA 4E22A 4GUDA 2R00A 4D2IA 3SYLA 1CR0A 4E31A 3ZKAA 1U81A 4LNHA 3E1GA 2ZE7A 3PQ8A 4GPEA 1NI5A 1YDGA 1FSZA 2VF5X 1TCAA 5TY0A 1UKZA 4COKA 4OHMA 4BP9A 4DIUA 3PLAE 3EYWA 4FNAA 5IAAA 4BHTA 1UK9A 5SYMA 1HPLA 3AI3A 4HGQA 3JAKB 3KTAB 3S7TA 1XZLA 4MR8B 1BQ4A 3PPWA 4E30A 2Q62A 4G5HA 4Z53A 4Y6RA 1CY8A 3D7MA 2BGTA 3QG5A 4NE9A 2C1EA 2VQSA 3EJWA 4LC1A 5JMPA 2GXAA 3CNOA 4WN9B 2D3TA 4C0HA 1D09A 5B6PA 4BAGA 1HDZA 4IPTA 4I55F 1ZL2A 1AQ6A 2OR3A 3Q3IA 5LIRA 4DV3B 5KO2A 2WWHA 2XDQA 3F5SA 2EWWA 3PF9A 4RIGA 2FH5B 2QTGA 4H7PA 1N8NA 3HDYA 3MJVA 3OZDA 4OJQA 4EB3A 1ADGA 3W5SA 3KYCB 2WUDA 1P7VA 1LZKA 1UBFA 3MT9A 2EERA 3OWOA 2GN0A 1JF8A 3T8YA 1FVFA 3T5GA 3MS4A 1KJ9A 1T36B 3FNHA 2IOHA 2XD4A 3E6AA 1UPFA 3HVJA 4EDFA 2JFHA 1XK6A 1M5RA 3O8OA 1HO3A 1QH8A 4ZOEA 3LYUA 3QBEA 4KWIA 4TS3A 1ARZA 2FWMX 3IKVA 1YFJA 2PJZA 3B6JA 4XW2A 4ZU1X 5KNBH 1OV4A 1YWGO 3FTEA 4ZCIA 3BGOS 3H9CA 1H4TA 1E92A 1N6HA 3CT4A 4REQB 1ZUHA 1GQOA 3P19A 4D97A 4D4IA 1KJNA 3WMXA 5DW0A 5E6UB 5EUQB 1TM5E 1KO7A 4TSFA 1J39A 3UYLA 3B1FA 4IIXA 3TNLA 4J0GA 3W6OA 5DGCA 2G88A 4XM1A 3NDBB 1VSTA 3GJ3A 5G0UA 4JOSA 1K2VN 2UYGA 3L7AA 4J0CA 4OXKA 4G8DA 4WVLA 3UNXA 1ESMA 2EJWA 2G17A 3AEKB 4TYWA 1EGHA 7ADHA 4RS4A 1XALA 4M1TA 4DTCA 5C1DA 3MIZA 3VR6H 2NADA 4PN3A 3PNLA 3L01A 2RB5A 4ZOBA 1Z6AA 2CB9A 1SXGA 3IULA 2DC1A 4U02A 4ESEA 3X1XA 3QA3E 1SZPA 1L7VC 4QPNA 4PG8A 2E4AA 3ULKA 2JGFA 1JB1A 4NZZA 5IPFA 3KALA 4HC4A 4Y6PA 4EJSA 3V1MA 2H2DA 1AO3A 3QJ5A 5KYNA 5E7MA 5CCXA 3AERA 1J09A 1IJBA 1C9NA 1YZLA 2JATA 1FMCA 1ZD2P 2Y4OA 3KV1A 3P8ZA 2HHLA 3F90A 3FB1A 4R1NA 4OK3A 1SH7A 4JR0A 1EXWA 1OH7A 2OT3B 1H5QA 2FW8A 4LRWA 1Y5IA 2WSSD 4QJBA 4MVJI 1Q7EA 4WLOA 1N6LA 1YGYA 3JQ9A 4EYGA 5B1DA 4BLVA 1P17A 1ZH6A 1X8LA 3A31A 3FVQA 3SC3A 1OYYA 3KPVA 2JL1A 2JIPA 2XB6A 3MOSA 2WSIA 1N8SA 1PFQA 4CIXA 4FYHA 3A2KA 1VXOA 2X4IA 5TEWA 4PO1A 2EFCB 1MA0A 4IKEA 2HHJA 3UZUA 4Z4QA 4ZT4A 2FRXA 2QRUA 1PX0A 1BS9A 3QE0A 4JR2A 1M66A 5I9TA 4KLCA 3CX3A 3IHLA 2Z95A 2JFFA 5EEHA 4ON9A 1A9ZA 5CFRA 1X8JA 3H9EO 3KP1A 1WVIA 3M6AA 3VO1A 1ZGHA 1X0XA 2OHXA 3REFA 1KRHA 4P8RA 2BI8A 4F1KA 4NMXB 2IW3A 1SWVA 5F2KA 3LC7O 1BYUA 2ACVA 5B7NA 5JNWA 2QGFA 1NN0A 4RF3A 2E18A 4V3CA 4J7AA 2HCRA 1UP7A 4KYTA 1OH5A 1W0KD 4KMSA 1EFDN 3DC7A 4KIJA 3IXLA 3VHXB 2UUBB 3C14C 2WYWA 3VX3A 4B45A 3KB2A 4HLNA 2J3MA 4MQ4A 4UBKA 2R6DA 3PPVA 3E7PA 2VK4A 4AN4A 3SHTA 3L8DA 2QRVA 1FQJA 3ANYB 3HEAA 3WAKA 1MC8A 3I2HA 3GIWA 2BCJQ 1G8KA 2H5JA 3BRWA 3FWZA 3KX2A 1BH6A 3GPDG 4Q48A 4HSGA 2LPMA 3PEYA 2EEPA 1AUPA 3NC0C 4L5CA 4DMCA 1ZR2A 4B3RB 2J33A 1C7QA 3BXXA 3R3ZA 4IVRA 1W36C 1JE1A 2VJQA 3OKAA 4C2TA 2ZIXB 1W7AA 1D2GA 3A7DA 1W1UA 1AKQA 2LTAA 2GA8A 4J0DA 4B6OA 3UAGA 4IDAA 1TK2A 3UAWA 4FMCB 2JFWA 3FFWA 2BI4A 5AI6A 1XNRB 5FNVB 4N3AA 2XE8A 4K9NA 3JTEA 4M6WA 2I91A 1U5AA 3NEPX 2YZ7A 4HP8A 5EJMA 2EZTA 5KKNB 3JPYA 2NTYC 3WY9A 1IN5A 2X0IA 4WXPA 2QXYA 3AKDA 4GZ3A 4I5GA 5BV0A 1K7SN 3B2QA 2F90A 3BWDD 3WV4A 4W1QA 4TMWA 4B71A 4WFKA 4RF4A 2PY6A 2QGZA 4E5YA 3ECSA 1CJKC 2G4VA 3C48A 4G84A 2HA0A 5L7WA 2YFYA 3H4TA 3MWEA 1LK5A 1O96A 1C9JA 2A9RA 5J2UF 3EEQA 2BZ1A 3WZMA 3G0OA 2P75A 1GDHA 4H7DA 2JLVA 4JA2A 1HDCA 2WC1A 2OSBA 1DBSA 4OLFA 4EPXA 2ZJ5A 3Q85A 5DXAA 4RHEA 3CUUA 4PXYA 3UBTA 3L8EA 3WLFA 5EJAA 3KKNA 2FUKA 2F8MA 1JQ3A 3ZGVA 2BGNA 3X43A 3M1YA 1WBBA 4D5GA 3W5UA 4QPPA 2VCYA 4OHPA 2UZIR 4AN0A 1YK1A 4Y0AA 1N0HA 2H1CA 3BHNA 3PXEA 2VN8A 2VH1A 4DR6B 5ALHA 4D5EA 3U4IA 2WD7A 1ZO8A 4Q3BA 2N47A 4HAZA 3WK7A 2GEKA 2PR2A 4ZRDA 4KUEA 3ZDYB 2VOJA 2QOEA 1T0BA 2X0KA 3OWXA 3ZOZA 2OYCA 2FPRA 4KO2S 4ZYTA 4Q01A 3E9NA 5JW6A 4EVQA 2JIDA 3UCFA 1T8UA 4LG1A 2AJLI 1OC4A 1Q0RA 3Q10A 3NHSA 4HWOA 1NJSA 4GYKA 2G82A 4H4EA 3VPGA 1QIFA 3GLFB 4UC0A 1CDZA 3ID6C 4OB6A 3TL2A 2R97A 2EF0A 3IPCA 4QOFA 4OIMA 4FEAA 3ZWMA 3VBCA 3CPSA 1DAFA 3B3GA 4F6RA 2P69A 4J0IA 4N0MA 5DIZA 4EELA 3HNRA 3PEUA 4PIPA 3AINA 4NRDA 1G8AA 1G0NA 3M4NA 1E4EA 1NW8A 3H3FA 4N8EA 5LLTA 5KUTA 2N1MA 3IILA 4KNWA 5FWNA 1WF3A 1ZA2A 3DOUA 2HA4A 2X8LA 2QYSA 3L07A 3L1JA 3I72A 3AX6A 3ZD7A 3O8RA 2O1EA 2ZE5A 4LF8B 4XB2A 5JU6A 2O3RA 1H8HD 3LWZA 3AR2A 1A9OA 2QLMA 3JASB 5A7HA 3RSSA 2WILA 3LYLA 2LXNA 3I58A 1ITZA 2Q6VA 2KBEA 1ZVMA 3AJ8A 3FNFA 1CUXA 1EE9A 3HUDA 4ARSA 1SKUA 5CNKA 1QOZA 1WY7A 1EXNA 2FWAA 1PFVA 3DEYX 3G13A 4ZCTA 1ZRSA 1R0XA 1WUYA 1LSUA 3NLLA 4BVHA 5EJEA 1JSLA 1GXSA 2NLOA 1GD1O 4JKOA 3GJ0A 3QSGA 4G36A 4MLPA 2Q4TA 4PG6A 3RU9A 4V0MA 2TSYB 1WMDA 1XU9A 2CFRA 2RKBA 1E96A 1RBQA 4FYXA 4WGFA 1L5YA 3PUKA 2NUTA 3KQKA 1XD9A 4ALNA 1AO0A 3CJQA 1DWQA 1VJ0A 2JEZA 4ZXPA 4BO4A 3A6EA 4N47A 1I80A 3E1KA 3HC7A 3D6AA 1DKOA 4OMCA 1CYDA 2NO6A 3BN3A 1Y6QA 4AX8A 2IWRA 1B3BA 3H11A 3UMYA 4R2JA 5JTUA 4TZKA 3RS2A 3WQRA 2H7YA 3L05A 1TLLA 3LLMA 4KQCA 5JS8A 1M1ZA 4EKEA 1NR7A 1O9GA 1CR6A 5CVCA 5G53C 3U4QA 2CT8A 3BXHA 3BWCA 1UOQA 2BFDA 1OI2A 2ODQA 2WWRA 1P3JA 3M5WA 3NKVA 1G1AA 1V9CA 4YCJA 1QFSA 5HCUA 3T9AA 5C2JB 4WZBA 2XRYA 1WUJS 3WNVA 1H0SA 4M1EA 5IKPA 5AHOA 4AZ0B 2IHZA 3LF2A 1Q50A 3BWBA 4QTXA 4LE0A 1WU8A 2WAAA 3BIJA 4LHXA 1WZEA 1JQBA 2G83A 2JLXA 2WTMA 4KX5A 4DJTA 1XEAA 4ZZ1A 3I1IA 2VDMB 4XI9A 2VDWB 1PL8A 1U9ZA 1ZSYA 2AFHB 2IYPA 2ZYGA 4BNLA 5LDGA 1Z12A 1A4UA 2BMAA 4QBGB 2RE8A 4NQRA 1HKHA 1W35A 5EIEA 1AX9A 3FYTA 1XZJA 4YBZA 1JXOA 1VE1A 5ALOA 2P5TB 1KKMA 4P7GA 1MEJA 3DFMA 1MAVA 2VHCA 3KKPA 3FKQA 3PQ2A 4LY6A 4NR0A 1PV2A 3O4JA 5DLYA 3QLVA 4FFWA 1J42A 1VE5A 1K2WA 1EB9A 4PRYA 5L3ZA 1KU0A 1H9AA 2GFQA 1O77A 2JIQA 3JAKA 2RH8A 3KTAA 4V0ME 5EJ4A 5KNCD 2UU9B 3PT5A 1JLMA 1J9EA 5ARBA 5JJLA 2C4NA 2JHAA 3VM6A 3F3YA 4F11A 4ENPA 1SD1A 1AHHA 1G18A 1DBVO 4I1UA 4ILEA 4RH0A 4W7SA 3HSKA 3O73A 5LMUB 4MW1A 2O0JA 5EIFA 2LWIA 3HDVA 1KEUA 3HBMA 5DI9A 4IZ6A 4KPFC 3KOWA 2X8JB 2QKYA 2B2XA 4AB1A 1PKXA 3H8WA 4G1MB 4PFJA 4WSOA 1ZQ9A 3OY2A 4XPZA 5IC6A 3H13A 1OF1A 4D57A 1SD2A 3LOQA 3FFXA 3PUHA 3VQTA 3ER8A 3FHLA 3OE1A 4J49A 3CXRA 4KUGA 3MEQA 3IAFA 3GYBA 3U09A 4X71A 1KA9H 2Q8NA 2VJNA 3LK7A 3E5NA 3QHAA 4WOCA 1XFDA 4L02A 1ONPA 4LJ4A 5F3WB 2NXJA 1G63A 1OIXA 5EIBD 1ZXXA 2JBAA 1XCBA 2ATCA 1M2OB 2HF2A 1CF9A 2CF5A 3S2YA 2EGGA 2MCFA 5KJ6A 3NH6A 1R6BX 2XECA 1JKIA 4Q4JB 3FCYA 4NFHA 2BHTA 3LQ4A 4XWAA 2DCMA 1XE3A 1QANA 3C3JA 5HE8A 3IERA 1CNMA 4N7JA 2HX1A 4AK9A 1L1QA 3OP4A 5AUOB 3B89A 4MS4B 2DFPA 4R1OA 3A1CA 1JIIA 1O9HA 3FSJX 4W1PA 4DNQA 1UZUA 3TZEA 1YJBA 3LQFA 3B53X 3ESBA 3H1BA 2JLUA 2XEXA 4IDBA 2PCLA 2PD4A 3AF1A 3TQRA 1HE4A 1SHUX 2VTVA 5H59A 5FBVB 2RKWA 5EJ6A 1P9LA 1WZUA 3HJRA 4B3XA 3T7DA 3VUEA 3G49A 4F4FA 3V1TC 2RH5A 5B3KA 4LWQA 4J2TA 1L6IA 1A96A 4EJMA 2EFHB 3QMPA 4MK4A 5FKJA 1XA4A 2I3AA 3ZX4A 1JI3A 2VC2B 1CULC 3I9NA 1FSSA 9ATCA 5DWVA 2YRXA 3U44B 3OBBA 2E0IA 2GD1O 1F8XA 1OZAA 2RHBA 4FX2A 4G0YA 3ND6A 1X7WA 3M70A 4NBSA 5F9HA 5K8JB 1V4VA 5CTAA 2NV2B 1X1SA 1CVLA 4RWEA 2GJKA 3OHSX 4HQFA 2XMCA 4B48A 3BERA 3NWJA 1TAGA 1AA6A 4B7XA 2NQ8A 4QARA 1L1EA 2PZEA 2VJOA 5KJFA 1SZJG 2YFQA 1PR4A 4AY4A 5NLLA 4C1BA 4BU0A 4MUEA 1I3CA 2EKBA 2WF7A 2OCBA 4H6PA 1PJSA 1PEDA 4EGAA 3LL4A 4ED9A 4QM7A 5CD1A 4X60A 1Z25A 3WDKA 4ZDJA 1HT0A 4BV8A 2W8BA 3OX4A 4O29A 3BXOA 2YUTA 3KLBA 3IDZA 2H0QA 3P2JA 2CJFA 4JXJA 4TQ9A 5CPFA 4TQAA 1R4NA 1WMSA 3TQQA 2HCTA 2N0SA 2AX4A 1N0WA 5AYVA 3C7AA 1G60A 3E9RA 3FMIA 4RZ2A 3GAFA 1IULA 1Z2NX 4IMPA 3SX2A 5JCOC 4WT7A 1ADBA 2V3VA 4Q1BA 2Q0HA 3KUUA 2X8JA 3R3SA 4ZVRA 5H0IA 4QBFA 2RARA 2LDBA 3KVVA 4KQMA 4XJSA 3WGTA 4IRMA 2ZJZA 2NO1A 4UBOA 1LLUA 5EL0A 3OZIA 3V1KA 1APBA 3K70D 3HCBA 3ORRA 1S2NA 3KJQA 2WTEA 3NTQA 4IHQA 4XQ9A 1MC4A 3D6JA 3AOEA 1XQ9A 3AR7A 3L0OA 3OPMA 5IVIA 4YRKA 1CE8B 1T2DA 2AZDA 2R751 5FUWA 4Y6LA 5ADUS 1OXVA 1ZIXA 3LT2A 4RJTA 4ZO7A 2X8AA 1I6LA 4I1RA 4C88A 2W9XA 4FYJA 4L8FA 3AVYA 2QN2A 4XYMA 3N6RA 1Z35A 2HBYA 2YNMD 4V0SA 5CGQB 3WGZA 3DL4A 1GRCA 3UJPA 4NK4A 5FA5A 1CBUA 4BFYA 3MJEA 4MCAA 5IRCD 4KPEC 2ZM5A 1ZVVA 1G5RA 3PQ5A 1D0SA 1Z2EA 2A9OA 2COEA 1IRXA 3WKBA 3MAAC 3U16A 3RRFA 3TPCA 1YB4A 3D1LA 1BE6A 1LPAB 3AIKA 3P0HA 3QVJA 3R0IA 5DE3A 5I4CA 3WBJA 1H93A 2O07A 1GTZA 4K03A 5D3QA 4DSTA 3TPFA 5LU8A 3PYMA 2PCJA 4B4OA 3O84A 3RADC 2WIGA 5K6TA 2FPPA 1X7GA 4BGIA 4EG6A 2EKLA 3FZYA 5CIYA 1YRWA 4WTOA 4P58A 2H9AA 3VGPA 2HMAA 1NI4B 1M8KA 2XUOA 4QGGA 4L78A 5JS2A 3ZLVA 5CXSA 4BKPA 1KWGA 5FNVA 2VDRB 1FDIA 1OLXA 1PJ8A 4QBKA 1X2BA 2B0CA 1OKKD 1AUVA 3C4VA 5IJ0B 3L7OA 1DG1G 3EA0A 1NASA 2Q3CA 4GFDA 1ZGBA 3P9PA 5BQ3A 4HBGA 4J0FA 1RC0A 4Y2RA 4CKYA 3VMFA 2B20A 1EG7A 3GHYA 4C7XA 2HN9A 3E23A 3H6KA 1FUIA 3QOWA 3TOSA 1EIWA 3U3DA 4ATNA 1N0UA 4GZ6A 1B00A 1J06A 2FEWB 2BFFA 2QP3A 4UU8A 2OFFA 3WK9A 4Z7OB 2GCGA 2P77A 4UEQA 2HPAA 1NC3A 2EJUA 3AJAA 1UAGA 3N2IA 4G09A 4JLDA 4L8LA 4BE4A 4DY4A 1Y34E 1N5IA 3D4PA 2EIXA 3CV3A 1EAYA 3UPDA 5GGYA 3D4BA 2W6JD 4ZEMA 2DUNA 2QMHA 4HFJA 3G7SA 5DHAA 4JJZA 4EG7A 3D5EA 3IIKA 5JFGA 4XJXA 2ZBGA 5CJJA 2VP9A 5EZYB 2ZP1A 1ZGJA 5CDSA 1SMKA 4L9SA 5FR2A 3X1JA 2I8LA 3NC4A 3HCEA 2IYLD 3PKJA 3VKUA 4I55A 3U37A 3UFBA 3UO8B 4G6ZA 4BJHB 4MUXA 3NETA 5B2FA 3GBSA 3CVYA 3GLGB 3PF8A 4M1ZA 1YS7A 1T3HA 1NHWA 3W4KA 2DPMA 3DQQA 4MYTA 2P9ZA 2X4LA 3LYAA 5HQ3A 1DWUA 4U7HA 4FI3C 5L8VA 3PQ3A 2OXEA 3OIYA 4OU5A 2D0OB 3F1KA 3KB1A 1SCUA 1CUSA 1Y5NA 5C8VA 2FLKA 1OX4A 5IANA 1D7AA 1FTNA 3F1LA 4RKYA 4OQYA 1SKMA 4AW9A 4RTQA 2OQRA 4TKVA 1JDUA 1M2VB 3QW4B 2XA2A 4WH0A 1YCDA 3FETA 2F67A 3ZYCA 2IZ5A 4CJXA 2CV2A 4L4YA 1FFGA 1FX0A 1VPLA 4U7DA 2W0SA 4BUJA 4LNUB 1RQPA 2NZJA 3RUDA 1DKLA 1JG6A 3JVIA 5DO9A 3V6LA 1XRQA 3P0FA 1VDMA 4HLUA 4KC0A 3EXAA 3TBHA 2QTFA 2QT9A 1O0CA 3OPQA 4MP8A 5B4UA 3G89A 4CR8A 2J6BA 2H85A 4MW6A 4CMEA 3THYA 2PKEA 3GLUA 4FMDB 5CAEB 1RHQA 3H84A 2R44A 4YCLA 1W5AA 4LRTB 1ZH0A 1T34A 2B35A 1OXUA 4YDSA 1EK0A 1L5VA 2H31A 1PK9A 4HWTA 5FYQA 2QUKA 2O0KA 3L1VA 3PZBA 4E1AA 1Q1ZA 4JI6B 4UCQA 5ESXA 2IXGA 3W6UA 1KETA 2QL7A 3KZKA 3I8SA 2I54A 4KODA 3D6UA 3WQBA 1XRLA 3TRKA 2H00A 2ILVA 2MR5A 1Z4PX 1PG0A 1EFVB 1GNLA 2HLPA 4P2BA 1SR8A 4DRYA 5E7IA 4E4TA 5FV4A 4OB7A 3OZRA 3NYRA 4MJ3A 1X7XA 4R54A 3REGA 4AY3A 4ISCA 2IKQA 2P91A 4FCVA 4RSMA 3PDIB 4U00A 3AKZA 1J2TA 1TQ2A 3RTGA 1XLWA 1DWOA 4DCTA 2IXAA 4ZZ0A 3M9WA 4HRVA 5I4IA 3HL4A 2IE8A 2HQOA 5HIJA 4J3NA 1SBCA 2X19A 1U1EA 1EIZA 3DLCA 1ISGA 1WPGA 3PLRA 2FSPA 4ZYLA 3B36A 1ZOOA 3P9XA 4CQLA 4BQQA 5D7NA 1OXSC 2PU5A 5J5VA 2PH3A 2ZK7A 1V6CA 1JDJA 1YZHA 3N7UA 1CY7A 2DHDA 1E6EA 1DMSA 1RKXA 2X6TA 4PYOA 4UMDA 5HRAA 3ZCVA 3WGYA 1MX1A 4KITB 4IDCA 3NS7A 2OBMA 2F8TA 2LR0A 1FY2A 4L0MA 4RCZA 2P9QA 3EOBI 4Z0HO 1DELA 3R5HA 2OFPA 2YW2A 1IATA 4YR7A 3GJ5A 4JROA 3R3XA 2DKFA 2Y1KA 1RWPA 4FHGA 4F8EA 3RS7A 1D2CA 3ESYA 2P35A 4OFZA 4IGFA 2BBSA 3WFJA 1I14A 1GR1A 2XNDA 4D8TA 2PA3A 4NOKA 1H2BA 4NSNA 3AEUB 4OI2A 1OWPA 1PT9A 2EX0A 4CZ2A 3O26A 4IUDS 2A59A 2FZ4A 2OD9A 3B6ZA 1OFUX 1Y1SA 2AG0A 4LIPD 2V9CA 3NP7A 4FYVA 4PBRA 2MYPA 1G2OA 3KO8A 5GM1A 3R75A 1MV8A 2DTXA 2IZ0A 3LA8A 3A4IA 2GM9A 4LJ6A 3KTOA 3E5RA 2I99A 1D9XA 4N82A 2X0JA 3KVNA 1PGPA 2VH2A 3JQ8A 1TE2A 1ZUWA 1QF6A 5E1MA 3FGOA 2UYYA 4D6PA 5JVDA 1B4DA 3A27A 4I3HA 4KUHA 4YUZA 5I8PA 5BR7A 3FYUA 2XZDA 4JOBA 5DYWA 2JFVA 1A88A 1UT6A 4LXXA 2XF2A 3H2KA 5DI3B 1TYCA 3TI9A 5JYEA 4LYJA 5F4ZA 2X5NA 2J09A 5FBQB 5B58T 4YP6A 2Z0MA 3B6IA 5HRUA 1MMFB 3WK5A 5BURA 3LCUA 4KRFA 1VHDA 4BMDA 1SN7A 2C2BA 1X1RA 5DCWA 4IDEA 4MUNA 3BSFA 5A0TA 5FORA 3ADOA 3WL3A 3LW8A 1XZ8A 4OFXA 5J58A 3QOYA 1U5BA 1TJ3A 2I1QA 4JB0A 4BZWA 4B4DA 4ZXFA 2FZWA 3A4MA 3ZUGA 4ZEOA 3KLOA 2Q49A 3C3KA 3O4VA 4A2CA 3EXG2 4WDRA 1C80A 3VR2D 2XY4A 3DJFA 4XQ0A 1IYZA 4AUEA 3RFCA 3EGXA 3ZCRA 2C07A 1ZDMA 3IT3A 4HEJA 4UDYX 4DDWA 3HDTA 3MLAA 3TG8A 2QX8A 1O0SA 2ECOA 4JD5A 1V3UA 1TM3E 2COUA 4KN6A 2F6RA 2NUPB 2VNHA 2SHKA 4J07A 4UD2A 1UBGA 1KI6A 3T0GA 3JVVA 4ETIA 1AUOA 2YH2A 4YMSA 4X3CA 4YALA 1N9ZA 3PG5A 4HYEA 4POOA 2XVYA 3R0QA 2JAXA 4EKNB 4J4TA 4C4SA 4K6FA 5DM1A 4EYQA 5L6LB 2WKRA 6YASA 3GWGA 2RB4A 4DRXA 3AKEA 4XB1A 2D1QA 3P9NA 3BGDA 1GLVA 3AMVA 4FB5A 3PWKA 5FPQA 1Z0ZA 3FW1A 1CUHA 5EMNA 2HH9A 4IEIA 5G40A 3S2FA 3LUAA 2H2IA 4E4RA 3OQHA 3D2CA 3H17A 3KYDB 2OP1A 3BEOA 3MTAA 2VXOA 4ZQGA 3S55A 4F9EA 4DQUA 1BMFD 1GTL1 4WZAB 4KB5A 3GFGA 1N2CB 1V8ZA 2X0RA 3MOIA 5A5FA 2JH9A 4YVFA 3LDUA 1E9RA 4LNUA 1ZK4A 2GPNA 3NONA 4RE5A 4UM5A 3EWSA 4JEIA 2UZ0A 4EB6A 4JI2B 1CR1A 3JX9A 1QG6A 1NUHA 2AOWA 2XYPA 5EYPA 5JARA 3ZU4A 4UREA 1F9AA 1TK9A 3NCTA 5FPTA 4HAOA 5AK0A 2GGSA 4GZLA 4P34A 3OLCX 5DPMA 1RFGE 4BL5A 3L46A 1AZWA 2HIGA 3I9MA 1S4MA 5EXEA 1FYFA 1SKYB 1GZUA 3LLSA 2FMTA 2AKEA 3NH9A 5JS1A 4NC9A 3G6KA 4H18A 2AN3A 1K8RA 1Z22A 3GT0A 2QTLA 4XIYA 3H2YA 4R9RA 2H5IA 3NNSA 1U1DA 2R7AA 4YRCA 1C7EA 2V9PA 3FKJA 3EQ8A 2W8BB 4IXMA 4JUBA 1FE8A 4Y6SA 4K9LA 5J2UA 1F12A 4FN4A 3OOEA 2XNDD 5JVDB 4BOYA 4BDTA 4OM8A 1PJZA 3CR8A 3LI2A 3GH1A 5IBRA 4YIHA 4I4TA 3HGQA 1ZWLA 4I5IA 4YRRA 1ZOSA 1PK7A 1QG4A 1XSEA 3S2ZA 3OM9A 3TLEA 4MPJA 3TOZA 1A5ZA 2OCYC 4LTNA 4DLSA 4LXIA 1UF9A 2EJVA 1TJYA 4RY2A 4M54A 5KYXB 3G68A 3ZDCA 4YP5A 2GLXA 5I7VA 3OZAA 2C4HA 3WRXA 4D3FA 4DZTA 3V00A 1XZHA 4BCBA 1E32A 1QUFA 3AHEA 3OTGA 1F1JA 4MR8A 1AH2A 2YV4A 3CNLA 3O8DA 4IHKA 2W2VA 4KV7A 4ZEXA 3I0ZA 3TS1A 3OIFA 4OP3A 1R3UA 2OECA 3H4MA 3I5XA 1BMFA 1PJQA 3PWZA 1TC1A 2QN8A 3DBIA 1FF9A 5K0JA 1OV6A 2CFSA 4PF1A 3K5WA 4IINA 4OGKA 1L5GB 1VFPA 3Q87B 4FQ8A 2AFRA 1QF7A 1C7ZA 5LQNA 5JY6A 1KMMA 1OZFA 2WG2A 2H2WA 4TV9F 4CMIA 2H18A 1U8XX 1BWSA 4HR7A 4ZEWA 3QPWA 2GCPA 3NTXA 4IIJA 3RU2A 1J2UA 2XE7A 7MDHA 1EWTA 6Q21A 4X1KA 5LP6A 3AR4A 1HFWA 5LA6A 3ZN2A 4AF6A 3IPRA 1FUEA 1M74A 5ALRA 1EHIA 2ZXUA 2OORC 4RY8A 2CXHA 4TOIA 1QH8B 2IVFA 4S1TA 1GTMA 4EGJA 3M3DA 3GVIA 3MBIA 4R98A 1OT3A 1C0PA 2ISSD 1I9GA 1TF5A 2QIOA 2ZTUA 2JCVA 1ZONA 1XJ5A 3NRJA 5FO1A 3F96A 2RHRA 1EAMA 2A5LA 3PQ7A 4C20A 2JLAA 2QZZA 5IP5A 1Y3AA 3E18A 3AHDA 4X6UA 3E9DA 3BULA 1P0PA 4Q9IA 4MQBA 2FPIB 1E1RD 2Y9PB 3EZ6A 4XSHA 3C5WP 3FZGA 4EGCB 1RXVA 2IBSA 2PK3A 1D4OA 2C83A 4M1QA 1MFZA 4ZOLB 1M72A 4DV4B 1IN1A 4LQDA 3ZV3A 2FW0A 1H8ED 1G4HA 5EWMA 1O58A 2R6ZA 2SICE 1JGTA 1GYQA 4ZU6X 5HSGA 3WL8A 1UAAA 4L5YA 5H5JA 4IILA 1KXJA 3QW2A 4PZUA 2AMJA 3X1WA 1GQYA 4OSEA 3SFTA 2Q2VA 4OBWA 5I9LA 1LQTA 1DC4A 1O94C 2Y1DA 3STWA 2G06A 3D64A 4KBGA 3R8FA 3O1IC 3TTSA 4I6JA 5IJWA 1HQCA 1BJTA 2PMWB 5K8TA 1HLPA 3CONA 2VPXA 4FM9A 1MJGM 2C8KA 3KB6A 3FCSB 2G9NA 4RDHA 3T7RA 3N0TA 4H3KB 1V39A 3WYNA 1MW8X 4NABA 2XSZD 3M5CA 3MMNA 2GYUA 3VYTB 2XUZA 4F9TA 4LXQA 1UKBA 1R00A 4G1VA 1ILEA 1P1HA 2PZGA 3SLRA 5K3CA 1NN1A 3OFJA 3AM1A 4ZVOA 4A5OA 2GD2A 3C70A 1E9VA 1WG8A 2JGLA 2QX6A 3GEDA 4D0GA 4DLLA 4Z99A 1UOOA 4RIIA 5TQ0B 1L4YA 2O3TA 3FOAA 3FVWA 2QXTA 5DMHA 4QFMA 1ZCZA 2QN7A 2IOFK 1N2CE 3B1YA 3OTHA 3BTUA 4U2DA 1AZLA 3BCSA 3PEWA 2O06A 2IIPA 2XMDA 4UASA 2D5CA 3IQGX 1JB9A 4PC3A 5CXXA 5DBGA 2AFHE 2QLJA 3QF4B 1X9HA 4R1MA 3IDOA 4L5AA 4FN5A 1QAQA 1TLFA 2C3PA 4AKIA 2QMQA 1SHTX 3C7KA 3GAMA 3SKVA 4UUOA 5FDFA 1LW6E 1JDZA 3L5OA 1SWWA 4LXGA 4WNAA 4KI7A 4KNVA 3WADA 5DBIA 2D5LA 4LYFA 4IS3A 4P92A 4BO8A 4QGHA 4UMFA 1KP9A 2IEGA 1EFAA 2A2ZA 3IRUA 4O4HA 2X0FA 4WY2A 5LP6F 2CMDA 3F6BX 3FMFA 4DZRA 4JKYA 1U99A 3CRMA 4TVBA 2MJLA 3VHXA 4XFJA 2HCJB 1Q1BA 4PZZA 3E2PA 4RU1A 3L7YA 2Q2NA 4UFPA 5DSZA 3INRA 2YHIA 3RVMA 4RANA 3EXHB 2BFBB 1PJTA 1KQ3A 2FWRA 1U0JA 3BAFA 4M9XA 1L5HA 3RVDA 3TOVA 2PLNA 3VJKA 2ZJ8A 2FEOA 4FK8A 4UARA 3OG9A 4FT2A 2G77B 3QEOA 1OXBB 2WD9A 1NE7A 5U4QA 1BH2A 3FLEA 2DYKA 4FFSA 2FHSA 2P2SA 3LY5A 4MA4A 1BN7A 3ZV6A 2YYYA 1BDHA 4MWSA 2HWKA 4E3WA 1Z4KA 2I6XA 421PA 2W6NA 1GTVA 1LQUA 4E4YA 1TAQA 1FK8A 3OOWA 1LW7A 1LNSA 3UC5A 1X87A 3TBFA 1JXMA 3F6CA 4K9DA 1D5CA 1XP8A 4ANFA 3AF3A 1PJRA 5AI5A 5KTSA 1W52X 3CZPA 4CG2A 4GPBA 4H4DA 5IWAB 1SCJA 1FDUA 4ARCA 5D6OA 2C5HA 5JAZA 3OZXA 1A82A 2HAEA 2V3WA 2ZCUA 3QWIA 1DT3A 2FN3A 4UFOA 4Z1MA 3IBGA 2BM8A 3GZ4A 2E1RA 1AQUA 3UAYA 1IXZA 3CRZA 4AZWA 3R6WA 4DM4A 2ST1A 1C8VB 4TL8A 3GN1A 2GPAA 1Q1EA 4RULA 1DKMA 2I33A 3GPCA 2VPPA 1DARA 1SUIA 3JCZA 4QYXA 1J21A 2Y0BA 1ZNYA 3A3PA 2P8SA 2OYRA 1BS2A 1FQOA 1S2GA 2XMGA 3FFBA 1P8AA 3RTCA 3U4CA 1MABA 4U7GA 1Y7TA 2OHJA 2Q9CA 2UDPA 4TV8F 3WZLA 3WWEA 4I2NA 2FA9A 2NUAA 2BVNA 2ZG6A 4HUQB 1B2RA 2X4GA 2ZDQA 3D7SA 4TT8A 3FNIA 5DLPA 4DCGA 4K9KA 4TLBA 5LA6B 3JZMA 5JQGA 2SKDA 4PYJA 5C4GB 4AS3A 2V4UA 3S70A 1DV1A 1RLIA 2BEVA 4IDOA 3R23A 1QGED 2FFHA 5BQOA 4NBRA 4IIBA 3DXXA 3ILSA 4TVKA 4L1KA 1KE1A 1OSNA 1U6JA 4ND8A 4YCAA 2R8XA 3CF4G 2Q7XA 5HIIA 5ENVA 4DR1B 3OU2A 5L3RA 1C7RA 3NO4A 1A8QA 1Z18A 1BRTA 5KEIA 4XDGA 5JT1A 1Q57A 1GG2A 1CY6A 5TQVA 4LI0A 3GMSA 3HZOA 2QAJA 1DIGA 4K6KA 3DEJA 5CK4A 1FTYA 4V1CI 4B3TB 4O4LB 3UA4A 1I1QB 3TYXA 1T2AA 2V7EA 3CH4B 4P3XA 4ZRNA 2D1SA 3RBAA 3ZHRA 3SE0A 1PWXA 3RRYA 1GTSA 1NF3A 4GDFA 4JI1B 5BP7A 4DV7B 2FVYA 4LJYA 4IUBS 1FDOA 5BMVF 5KTMA 4TTTS 5L3QB 5E2AA 1DTEA 3EAFA 1JA1A 1ECJA 3EQ2A 4W63A 3U9SA 4YAUA 2FZEA 1QS0A 2WE8A 3G8YA 2V4MA 3NT5A 1W8IA 5J4VA 1F6WA 3A2MA 5LYJF 3LZCA 2QLTA 3I52A 2ES4A 1HNXB 5EUMA 1I4WA 1ECCA 2JAOA 3EC1A 3S8EA 3ER9A 2BEKA 1KOLA 2REBA 3NVKI 2IS4A 3P9ZA 3EK2A 4EZEA 1V6SA 1A7UA 1KI3A 3Q5DA 4NZNA 2O8CB 1N0VC 4QPJC 4MEJA 1H3EA 3W8EA 4MWDA 3C6QA 4KQ2A 4JODA 2EQBA 2I2FA 2WAMA 3NJ4A 3LL7A 3BKXA 4BYGA 1BXRB 1G20B 1ENZA 1RJFA 1XKLA 1AS0A 2VYVA 1D6SA 3BPSA 2FX3A 2XWBF 3FCCA 3MWLA 3AGQA 4WKNA 5HJEA 2I7VA 3JWGA 4OXYA 3I04M 5FI5A 3VDNB 1C1XB 5CFQA 4G0MA 4MIOA 2VSXA 3LUCA 4BUZA 3UKJA 1SXQA 1SUPA 5H02A 1FQWA 1WDMA 3B1JA 4HPXB 5DTEA 2YCBA 2C5LA 2O2EA 4E3ZA 3AC0A 3N8KA 3NYQA 4ITUA 6LDHA 4N03A 1VGQA 5AHXA 1USUA 2HUPA 1NI3A 1FPQA 1XD8A 3FF4A 1JDNA 3ZKWB 3DTVA 3H4IA 4HAIA 5DHFA 1JYSA 1IN7A 1Y7IA 4NCNA 4CN8A 1H2HA 4B9AA 3FOFC 2KX7A 1QBGA 4IH9A 5ERGB 4DIMA 4TS1A 1M6EX 2R9VA 5EWJA 5BUCA 4PHTA 3GLGE 3O90A 4IJVA 1UWCA 4IXTA 1Y6GA 4PLGA 1P6QA 1H4VB 1ZCJA 4RJ2A 1VI6A 2FPLA 5EIHA 3DUFA 1T4BA 1P44A 4WUTA 1I6WA 3ZXSA 3B6EA 3FRHA 4IIYA 4G1UC 2NZWA 5JQGF 2OKCA 2HIHA 5IKXA 1OYWA 3KQOA 1SHKA 3OPXA 4ZI2A 3PX2A 4G24A 1AXGA 1OBHA 2VYNA 2YY7A 4K8RB 4ZYWA 1G8HA 3O9ZA 3U9TA 4YP0A 3UMRA 1S01A 1ISIA 3G79A 4C08A 1V0JA 4IZIA 3L92A 3VHQA 1NM5C 1T5OA 5F3DA 3DR5A 2X40A 1JECA 2EV9A 2Z2KA 3Q9NA 5AKXA 3PNOA 1IWBB 3G5MA 5CA1F 2RBKA 1P1KA 2H07A 1VBNA 3PSAA 1R0SA 4J03A 4X24A 1ZMRA 5E9QA 3EC2A 1VJ5A 1Y37A 2F59A 3DBOB 5K3BA 3K0HA 1JHQA 4JLSA 4K1XA 1JIUA 1T3LA 5JXGA 3R8CA 4OMUA 1E0DA 1UFQA 1DCTA 2Q9AA 1N32B 4KZKA 4OH7A 1ODIA 3RLFA 3ZHZA 3QWAA 1N7IA 2GCIA 5HK9A 2V0GA 4ZT2A 4DCUA 4LZNA 3RYCA 1E9AA 2D0DA 5LNK6 1ZR4A 4IG4A 4YASA 4R1SA 1U1GA 1J70A 2BJHA 3PA6A 3QKUA 2BF7A 4MYHA 1ZH8A 4U9HS 1PR2A 4EFNA 2GUGA 2O7RA 4S3MA 1N33B 2AFIA 2YYSA 5ICFA 1A9PA 2IPLA 1UBOS 2IRWA 3OJEA 5FEMA 4JR1A 5LSAA 2QTVB 2H4WA 1RM0A 1JEJA 2VF2A 4JYMA 3S1SA 3TNFA 2PTGA 1XDDA 4MJ7A 1G19A 3M89A 3WLOA 4CKWB 3QMWA 3C8HA 5KU7A 1I3NA 1Y3HA 2B7BA 3BAZA 3CZMA 4JYAB 1DVRA 3GELA 4Q7EA 4DM3A 2WJGA 4EI8A 2HQRA 4XXHA 1XQXA 2DBVO 1AT1A 3QPCA 2IPOA 4U39A 4ZCLA 5A04A 5E3JA 3QUSA 2VJLA 3V4VB 4QU5A 2H2GA 1UJ5A 3B5IA 1U3DA 3WWZA 4DUGD 3GVXA 1E99A 1VL5A 1AKEA 1NFRA 3EIHA 3T5BA 3ZV4A 4JXKA 3AU8A 1QV7A 1NOIA 2YWJA 3IOCA 3KQYA 4URUR 5FOTA 2AR0A 2PWZA 3WHPA 3R5SA 2FG5A 1LNQA 3P5SA 1YULA 2C5EA 4UVHA 3IBTA 1Q16A 4MO2A 4X6LA 1KEEA 3HVHA 2A1UA 3UOWA 3NKFA 2VTBA 1KR2A 1K63A 2VA8A 3ZWBA 4UCXA 3M9LA 1RRCA 1Q3TA 2K5UA 2NUBA 3DAPA 4JUIA 1HG1A 2OK7A 3LXMA 2NU8A 3N28A 4QE3A 3ZQUA 3WGLA 1P80A 3GAAA 3SWWA 1JLLA 3WGQA 3ZW7A 3INTA 1RKVA 2OLKA 1KBOA 3OCUA 4ZVQA 2C92A 1XDSA 3T4PA 5HJ7A 3CZCA 1M6WA 1DO0A 2BH2A 3NDJA 1EWQA 2C78A 2O2ZA 3UANA 4E6PA 3R9XB 3B3QA 3FDJA 3ONVA 2PL1A 3WGVA 5HMLA 1C2YA 3ILXA 2FUEA 3IBFA 1SEVA 3ZK8A 3QPVA 3SC4A 1YOBA 4ETMA 4H0CA 4DWVA 2FMIA 2E6UX 3EZFA 3HVUA 1Z17A 4GYJA 4MW2A 5K3FB 1PBNA 5L53A 3HWSA 2IDKA 2WWVD 2YWEA 2CL0X 4Z4EA 3IEVA 2HMVA 2QY9A 4IOLA 1K66A 1G8JA 2E4UA 2IEYA 2ZUSA 3ODPA 4I4LA 4L0QA 2WMYA 4FC7A 2P9TA 3WISA 4Q4DA 5IN5A 5IUNC 4B6SA 4UTZA 5EFOA 5GINE 3IKMB 3OJLA 1RM5A 3RHFA 3QLJA 2W2KA 1Q91A 2VEOA 2AN1A 1Z4NA 1EJBA 4LRUA 4LSZA 3L7JA 1M54A 1NMEA 4NFLA 5C1OA 4QVKA 4DKJA 1MOQA 4Y2HA 5PGMA 5KNDD 2V7BA 1U0EA 2GILA 1GP2A 1SOAA 3R44A 5CA1A 4US1R 5J47A 3UBMA 3AR5A 3PJEA 1TQDA 5BOSA 4ZTZB 4HH4A 1OI3A 2VRWA 4WCVA 3SC2A 2B8JA 3C8DA 3MLEA 4YK7A 4KBYA 3N7TA 4HGZA 5F7OA 5KYYB 3X1YA 3HHEA 4PQYA 2Y1OA 3L4BC 1K8ZB 5G0TA 4MI3A 4BFLA 4FI3F 4DLYA 4LK3A 3U7HB 2YKGA 2JKZA 3DD1A 3Q2KA 3FOZA 3CMCO 4R41A 2CWDA 4QJ4A 4GKJB 3DVAB 2XCSB 3RRXA 1PGJA 5M5BA 3F8TA 4V0NA 3KBBA 1V8OA 4YV1A 1JKMA 5DNEA 4H1HA 4QC2A 1VB3A 3FPAA 2ATEA 3OEWA 3RYIA 4A6XA 3NU1A 1M1NB 4BQSA 5B5SA 3R20A 3UW3A 2XJ9A 4BLWA 2B4AA 1NV8A 1QIEA 5KDLA 4UOZA 1BSVA 4FSDA 4KJXA 1Y3DE 4KWHA 4Z3KA 1VJDA 3CEPB 4A0HA 3WGJA 1ABBA 1I2CA 3GPBA 4K0RA 1RRPA 4MW4A 1CQXA 2FUG6 2R2AA 3BICA 3GG9A 4FQ5A 1NBMD 4P4SB 1YR1A 3T9FA 2ZB8A 4LSWA 1CP3A 5CNIA 4DBLC 4E09A 2DTEA 2P5SA 4OCZA 1MENA 4EW2A 1F17A 1YJ5A 1U3GA 3O31A 4EJ2A 1BX1A 2QRVB 3LVRE 3MB8A 4NJMB 4JP3A 1DS6A 3SIXA 4L57A 4HVLA 5E9WA 3KAPA 1L5LA 1QRTA 5TQJA 2XUFA 5TV2A 1ISPA 1V7PC 4DJEC 4UM9D 4A5SA 1FXUA 4MWCA 2BEUA 3K94A 1GFZA 4HAVA 2F62A 4JBIA 3SBXA 4PVDA 3RVOA 5LL6P 5DGIA 2RAPA 2H0RA 1INLA 1CETA 1N2JA 1OPXA 2VHXA 1KHHA 1KPIA 4MB6A 2XLCA 3MFQA 1BHO1 3HCPA 3QNWA 5EMMA 3N74A 3MJDA 1GKKA 5AVYA 1EX9A 2JHGA 3KZCA 2C3YA 4Z4HA 4UXJA 4DUGA 3WHIA 3K9CA 2QJRA 2POQX 1EFKA 3V2UA 2QU8A 3L4JA 4L4RA 1NULA 1RRMA 1V1MB 4EJSB 1CQZA 1J56A 4PYMA 4JLKA 3RK1A 5T5QA 2RD2A 2B4QA 5M34A 1MEEA 2P4SA 3USES 3BWEA 2BCEA 2B1RA 1GZVA 1QLWA 1FTWA 4RPJA 4UATA 3R74A 4H1UA 4ECEA 1JEDA 5KTNA 2C88A 3LHKA 5MGBA 2ZDHA 2J9GA 1Z9BA 2OESA 3OKFA 4DSUA 4RTMA 1K5PA 2GSWA 5CX1A 2VP6A 4Q6BA 1II9A 1SXHA 1W29A 2UZ1B 2XUPA 2JIZD 2NYAA 4HUQA 1QHXA 1XDUA 1QO0A 3NEYA 5I8WA 1T4CA 2OAGA 3VV2A 4NXNB 5DBOA 1ILWA 2H1FA 4DR2B 4NU8X 4W5HA 4AKSA 4K8OA 2DE0X 3G8DA 2X1HA 2XH8A 1OTHA 2VBGA 2CXUA 2WIBA 1W47A 4TV9A 4BQEA 4P4GA 1FFSA 1ZCAA 4H9GA 3VKWA 4P83A 3IPYA 4ND8B 4MVJA 1E1CA 5FNZA 1B2LA 1Z3CA 2GEJA 4BMVA 3QXGA 4D98A 5CX4A 4EPTA 4YDQA 5C53B 1GQRA 1G38A 1KDTA 1W4AA 3H9QA 4GOLD 1IBLB 2BSXA 1LZLA 1M67A 4FNMA 2AE1A 1AF7A 4I5FA 4C3OB 4RKQA 1N8TA 2YV2A 2ZYVX 1FW8A 2JLQA 621PA 5IEJA 4TROA 3RVSA 1E59A 2D5BA 4MB2A 1F4LA 2QVLA 1CQWA 4NBTA 2GPTA 5EERA 5EHXA 1Z2CA 1BAPA 3G6WA 1ZW6A 5FEUA 3UG7A 1KZGB 4ND3A 5AOAA 1K6EA 5DXJA 3ITNA 1EEXB 1DLJA 2B8TA 2Q4BA 3RKSA 1MX9A 2J0UB 2QUBA 4HX5A 3G1TA 3K8OE 2XKBA 2XZOA 1NZJA 2WM2A 5IVPA 3LQ2A 2IV2X 1T9ZA 3O4RA 4NJEB 1O54A 2ATXA 2NW6A 1KGSA 3I5MA 1Z0DA 3K9BA 1DXQA 4TLDA 1JG7A 4WAUA 3IHKA 4ND5A 4HY3A 3RTDA 1FDWA 4F60A 1H2AS 3Q98A 2ZJ0A 1UKEA 2HIMA 4DB4A 1ISFA 2JW5A 3EZYA 3KKMA 4D99A 5AVVA 4F3TA 4RJJA 5ALSA 2GJSA 3HB1A 5GOTA 4DSZA 4E13A 5LXTB 3KJHA 5ANRB 1T6BY 1NBWB 3F73A 2FPMA 5KVSA 1MP0A 4YFYA 1RJEA 2R62A 4OLBA 1I4LD 3GRFA 4K87A 1KI1A 1D2EA 1MD9A 4RORA 2H11A 5FTKA 1AGRA 4H6WA 2C31A 4PG4A 2IXBA 5CDGA 4DLZA 2B2CA 3E0QA 1RFLA 1C9EA 3DL7A 4JDPA 4MAMA 1KVRA 1OX6A 2PUCA 4L85A 4MZXA 3CPHA 3SG0A 4BNUA 2ONZA 3LUDA 1SC3A 1X3SA 4RA6B 1EZZA 2QUJA 2X2EA 3D3NA 1AVTA 2YV3A 4PGFA 5CB4F 1UJMA 2FOLA 2V4ZA 4WLUA 1VKZA 4TWZA 2OZKA 5AD1A 4KRYA 1NLFA 2Q4EA 1SVLA 4TGLA 1XFAA 4QLAA 2G40A 2G6TA 2TECE 3DE7X 4EHIA 1JKXA 3VZDA 4ZFNA 1QIHA 1I2AA 4WZBB 3JD0A 3OT4A 4WVFA 3WMGA 1WE2A 1HY3A 3B3JA 1CDOA 2KMLA 3M4JA 2YWHA 1E0JA 4X1IA 3KEMA 4J91A 3V8VA 4PW0A 3R0ZA 4PYNA 5REQB 4IOMA 5DGXA 4TSFD 5DB4A 3PS9A 1FL9A 4KPUB 5EHZA 4DV5B 2O59A 1J07A 3DAHA 5CH5A 4GWKA 1M0EA 4MVJH 2JC3A 4I9GA 3WLKX 2CXOA 3GT7A 1YS9A 3BHJA 3H5VA 4B17A 1LFDB 1M6VA 4QGSA 3H65A 1H2ZA 4TYYA 4L5IA 5F2EA 2NVUA 2CBXA 1L7DA 1RHJA 3QWFA 4WXEA 1YBVA 5IC4A 1L7PA 3K15A 3SXJA 1JYFA 1YZNA 2CHUA 3HSYA 2JGEA 3IUNA 3D54D 1T4MA 1ZQ1A 2AMLA 4WKOA 4YWHA 1CUUA 4PONA 2NU9B 4Q21A 2IZ1A 2XXAA 4BV2A 1K9SA 2JJ2D 2BMEA 3FAZA 1SC9A 2FSFA 3R0JA 4J4BA 5C3MA 1FDSA 1LVUA 3LFUA 2HWYA 2TMGA 2WW8A 2XNSA 3CF2A 3WYAA 3IESA 3EPHA 3GA7A 3GA5A 1OAAA 2AJ8A 1MT3A 4JBYA 4XD2A 4YP1A 2Y76A 4X7BA 5AJXA 3L0BA 1C1DB 2Q27A 4UU1A 3VPDA 2TS1A 4RVSA 1NW5A 2B2NA 5DEOA 1P0IA 4O02B 3GDOA 3LVQE 1TZMA 1MGOA 2J46A 1OJLA 1H3NA 2YXLA 3DL0A 4FYPA 1S1CA 4NBWA 2N42A 3KBOA 1XOIA 1SOWA 3MERA 3KJGA 4FFOA 4O1MA 3X0DA 5JZMA 1KI2A 1R4AA 1WNTA 2X7JA 3G85A 3WC4A 4FSHA 4HGYA 4D42A 1JHVA 3A6ZA 4DSNA 4YRQA 1XZMA 1GADO 2PRYA 2XQVA 3LUFA 4J75A 3U3JA 1G17A 2J9YB 5BVHB 1GRVA 1WB5A 4GLOA 1DJPA 2CYAA 3KQLA 5JATA 3MAJA 3RSOA 5B2ZA 3TQSA 3AHFA 1GAQA 4D7AA 4QYSA 2XYQA 4FZJA 2O4CA 2KLHA 4B0PA 3ESZA 4UMEA 5JNLA 3I9FA 2O19A 4ALIA 4YWJA 3HN7A 5IDYA 5JOQA 3HO1A 1JLRA 2NV0A 4INPA 5IDVA 1J20A 3G2NA 4D44A 4QNNA 1Q1GA 3DZCA 3ANLA 3P26A 1UKCA 4MUHA 2IELA 5K3AA 3GCZA 4LRYA 7ABPA 3NIBA 1Z5WA 2VHVA 4LE2A 2WD8A 3A04A 1XKTA 3AEXA 4HRYA 4YGXB 4FFMA 4K6OA 1H6DA 1CQIA 2SCUB 1U3WA 3MZ0A 4ID9A 4ZPJA 1P7PA 4E5DA 4CKCB 5JD6A 2BV3A 1TNDA 3AY0A 3NWEA 2BGIA 3Q8XB 2O2YA 4DIEA 5EKDA 1CR4A 4FB4A 5A6VA 3E0XA 3SLGA 4YAOA 4YAEA 2VTBB 1JEYB 1XVIA 3E7FA 2ZI7A 3QXHA 4G26A 5CB0A 3IQDB 1E4VA 2FPUA 4JQCA 1ZLYA 3SEQA 3P9QA 3E48A 4IEEA 1N5LA 2HA7A 3U0VA 3U0BA 1FNNA 1E1CB 3VFDA 1L7QA 2VHQA 4AJ4A 4C6RA 4TVOA 3QUAA 4LJ8A 2W2PA 5A9SA 3L02A 4YRPA 3PR1A 3SI7A 1CUZA 1E7SA 3H3XA 3AY6A 1QVWA 3A9SA 4MYCA 2WG0A 1YBAA 4GQAA 5JZ9A 2WWFA 1ZN2A 2PGLA 3ETCA 3K0CA 4KQIA 4F2GA 1GVNB 1SUBA 1HF3A 3F98A 1E5VA 1CLEA 2PUTA 3E70C 3Q0IA 1SG9A 1T8PA 3BDAA 2OBYA 2JJYA 3GIDA 3FTDA 5EXSA 4F5WA 2QPAA 5K03A 4DKXA 1U0SY 1XG5A 5KPJA 2P79A 4FDVA 2X14A 3GW8A 1LUAA 1Y9DA 1KYVA 2Y6VA 3RIMA 2IYAA 2PVPA 4YYZA 1RZUA 2CC2A 3DE6X 1EB8A 4NJEA 3K6KA 4LBYA 4PC7A 3KL4A 4E5NA 1K75A 1VMKA 4J1SA 4ZANA 3WBBA 5L3VA 3G0CA 2M98A 3LZ6A 4G0VA 2AZMA 2DR0A 1Y1TA 2OVFA 2JVKA 4P36A 4UM7A 5JEDA 3KPJA 4RAOA 4N5IX 3KU4A 3LPAA 4FEEA 1DOZA 1NP3A 4N0QA 3RSFA 2IYNA 4R68A 3UHOA 4B3IA 1G5HA 5K0SA 1ZGCA 3A9UA 3QLTA 2M1ZA 2E4ZA 3D4NA 4OXQA 2Q7DA 3V9AA 2ZR7A 3BMCB 1FP2A 3B3FA 1U7TA 5JHGB 4BDSA 4FNGA 1ODCA 4JFRA 1BW9B 3IA2A 4QOGA 2FEMA 3KSRA 3EUWA 3OPYB 4B46A 4EG5A 5JMTA 1UQRA 4W5OA 1E2NA 2BMWA 3EW7A 3ZR4B 1O7JA 1W5FA 2VP0A 1XTUA 1L4EA 4A8PA 1QH0A 1R8XA 2QX9A 1M10A 2W2LA 3L1KA 1PS8A 5H83A 1G3MA 4O59O 1NWHA 5AW6A 4B6PA 1Y63A 3DYIA 4WOBA 2DBZA 4B44A 4G2NA 4B82A 4Q0MA 4ZVLA 4AMBA 5EUCA 4UTNA 4D9MA 2O5EA 2A5DA 2IQIA 1RLUA 3EBPA 3KHSA 4KQ9A 3DPUA 1C3JA 4NS1A 4B84A 2Q6OA 2R79A 4R1PA 4JZYA 4CODB 3NV7A 3GPIA 4GD3Q 5LZ2A 1F14A 5JALA 3P7MA 3QTLA 1V37A 5I7WA 4XLZA 5ALUA 3KNZA 1DQNA 1Z0AA 1NMSA 4LE1A 4KE8A 4BKOA 3U56A 3RKRA 5I01A 3SBDA 5HZHA 4JC5A 5AI9A 5CA0B 4DTIA 1PEAA 1TW2A 3L0IB 4KXYA 5C4MA 5K0CA 3FLMA 4AC9A 5C5EA 1TF2A 3E8XA 4MDHA 3DMDA 3OC0A 5MGNA 1WPQA 1FFYA 1M7BA 4RD6A 2ZJBA 2WZDA 3N0VA 4RVDA 3SQWA 4D26A 4GKKB 1YS6A 4A0GA 1XN1A 4LSMA 1KZYC 4PCUA 2OCDA 1LVGA 3KKZA 2RJNA 4FC6A 1R66A 2HM7A 4JT4A 1U8AA 2FB9A 4XGQA 4LKRA 4K6MA 3VH3A 3X1MA 1GFSA 4DRZA 8ATCA 3PUVA 2DUUA 3ZS8A 4PGMA 4CIAA 5MFPA 2PSFA 4LDJA 3A9WA 1P9NA 1SC6A 2WM8A 3BIOA 3SHVA 2FQXA 1ODFA 2CVHA 2IITA 2JFOA 1IC6A 4RLFA 5HTOA 5AT1A 4HNAB 2OO3A 1D0IA 1W30A 3FJYA 4YGYA 4I1PA 3P4YA 5KNCH 4AY2A 3IELA 3DE5X 2XB2A 3VH2A 1DSSG 3STHA 3SZMA 4XFKA 3WICA 1T0HB 2L2QA 2YHAA 4QVGA 1UM9A 4AP9A 3KLMX 5I6DA 5FJIA 3HHPA 2A35A 4F0JA 2J5RA 5K0FA 1SRRA 4Y9DA 3ZY5A 4GNKA 4ZVNA 3FYSA 3L7CA 2ZUEA 4G4SO 1QFZA 1I3OA 3VU8A 3ZCXA 2QG6A 2PT6A 1PBTA 1WBJB 1E3SA 2UZ1A 3JR3A 4H1VA 2YZGA 2RGCA 3PQDA 2P9GA 2W6MA 3TLAA 1KYTA 3IYLW 2XUHA 1X77A 1JHOA 1XCPA 5IHXA 2GEBA 5DK6A 4BO6A 2A94A 2DKNA 3C41J 1GA1A 2CXQA 4UTXA 4EGQA 1V48A 1VSUA 2CD7A 2I6FA 4KXNA 1VCHA 1QO7A 3PK0A 2C4TA 5K4GA 3RGGA 3LUKA 4CE6A 2ZTLA 1TVMA 4Q3OA 3QZUA 5HG0A 2VPZA 1BU8A 2R7LA 3PEFA 1IEQA 1PV1A 1YB6A 2F7SA 2JANA 2CDAA 2WF8A 2Y1GA 3G2QA 3PNQA 4IL5A 4ZV4A 4GRIA 1CX9B 3T7KA 2IU0A 2DY1A 3CX8A 3I6BA 4GLJA 5HTKA 4PSKA 4Y2UA 1SQ5A 3UMSA 5LMCA 3PFBA 2WWIA 4KDEA 4Y2GA 4HQOA 5AM4A 2CCJA 1JVBA 2YNMC 3OQIB 3ZGOA 1B8NA 2IEAA 2B1QA 2JGJA 3PFKA 4QYIB 2EFJA 2RGYA 3MBKA 2E4VA 1N7HA 2JIOA 2GBCA 3W8NA 4EY3A 4PN7A 1T0JB 1VL6A 4E33A 2QD4A 5BR4A 3U3OA 4A8JC 2YZMA 4PHCA 3I37X 4MGEA 3IAS1 2FK8A 4HDNB 5HS6A 5B37A 5GJBA 4ZJYA 4YCBA 2ZULA 1YJCA 1WV0A 1I5RA 3PPXA 4M0FA 4M60A 1UPAA 1XTKA 2JA1A 3I23A 3L6EA 4II7A 2OO5A 2P3LA 3UVEA 4ZODA 1Z62A 3WL7A 1TJ4A 5JYDA 3SC6A 3GDWA 1NMXA 2KHZA 2ODAA 3C1TA 3CUEF 3I9OA 2DSTA 1BCSB 1JT9A 2ZYDA 4LHZA 5KIAA 5K0BA 5FCDA 5LD2C 3G7NA 4CFYA 4TYPA 2ZUCA 3K16A 2FETA 5EXDA 2Q2OA 1JTVA 1YRQA 4IGAA 2JIBA 3ZCQA 4UM9B 1YA6A 1PNRA 4JBNA 1A2BA 4MKHA 4YUAA 1SC4A 3CLTD 3E5HA 1ZHHA 3R77A 1FFEA 1NV9A 4DNPA 1YE5A 1EWRA 4EKIA 1AGYA 2HC9A 2W2MA 2C57A 2FOXA 2WF6A 3C4JA 2ZCJA 3S81A 1O6ZA 4JH0A 2DPGA 3MRSA 4RO0A 4TLCA 4WLFA 3VAZA 1ECBA 3AOEC 3RUEA 3AUKA 2ZI9A 3L04A 4MWGA 3TCKA 3UK2A 3T5PA 5FR1A 3ZBTA 3OI7A 1BRMA 4BFXA 5EG5A 2R1TA 5BYJA 2WHYA 1TTTA 3EDRA 4B7UA 4Q1DA 3BTOA 1WIWA 4JP8A 4FNOA 4EF6A 1DCFA 1JHYA 3AQIA 1K8QA 2CHEA 4TRNA 1KQOA 2EXXA 3R1IA 4HG2A 1Y4DE 3THRA 3U1TA 4CM5A 3QXSA 4CDRA 1M6HA 5E4JA 4NAUA 5A4JA 5JJKA 2WIDA 3BTVA 2WJIA 1OB2A 1H94A 4PE5B 1NZFA 5IZ4A 3ADBA 3KXIA 2V9ZA 4KRXA 4Q16A 4MEBA 3EDYA 4NEQA 5AUNB 5REQA 1U8YA 2OG2A 4WA7A 2ZDGA 3ZYZA 3D6TB 1Y0BA 1FJ2A 3TLYA 4UDOA 1Z6YA 3RJMA 1I13A 3CISA 3OESA 3V1LA 1YBHA 2B37A 3WQQA 3FG9A 5HHTA 1I7LA 3ORHA 4ENTA 2BCGY 3ZH2A 1DHTA 3MWYW 2YVQA 4PXAA 5BYAA 4XDHA 1MB3A 1TIKA 4L6AA 2D5IA 3VYRB 1J22A 3ASZA 5GWXA 1GNTA 2W2QA 3NATA 2QVZX 5GGXA 2IW1A 1ABFA 1L4GA 2K6GA 3TCXB 2I4LA 1UZLA 1A1SA 1NTRA