3DTDA

Crystal structure of invasion associated protein b from bartonella henselae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
145
structure length
142
Chain Sequence
b'SLTETYGLWSINCGIQKVCFMHRQEVNDQNRVVVAMSVVLNADGVVSGNLTVPFGILVSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIALQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasion-associated protein B
molecule tags Structural genomics, unknown function
source organism Bartonella henselae
publication title Crystal Structure of Invasion Associated Protein B from Bartonella Henselae.
rcsb
total genus 31
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06776 IalB Invasion associated locus B (IalB) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dtdA00
3DTDA
chains in the Genus database with same CATH superfamily
3B6SB 1UD2A 5INDA 3OLEA 1WUZA 3VXUE 2FUQA 1MJUL 4QTIL 2AK4E 4D3CL 4E9SA 2ALAA 4UIKL 4ZTEA 2X9ZA 4BK5C 1KTCA 2XICA 2VZSA 2GHZA 2IEPA 2OZNA 5BS0A 4KJWD 1E5UI 3SZKC 4ZODA 1AY1H 1EO5A 3B7RL 1MCCA 4HIIA 3C8KA 1OM3L 5A6IA 1BQLH 1JCKA 2R4SL 1DBBL 2EDLA 3L5JA 5F72S 5C0EA 2IAMC 1PLBA 1VGEL 1NGZA 1P4IH 3LRHA 3SKJL 1EEUA 1U4EA 3DIFA 2KT6A 3EYUL 5TE4H 3FN9A 4IRZH 4PJ6A 4OUUB 4AGNA 1IB5A 3FQXB 3HG3A 3JV6B 4YSQA 2EEBA 4GPVA 2Z34A 2NNAA 3T6WA 1QABA 5DJYB 3D7PA 4XN8A 1AVAA 1TVBB 2G75B 4JVWA 5H4YA 3SYQA 4K73A 5A16B 1JF6A 5AL8A 5IHUH 5C0DA 3V0VA 3B3IB 4KJQD 3OQ3B 4X4YB 2OMZA 2IBBA 3QJZA 3CFMA 1QPXA 4MXVE 2HB0A 1KV7A 3BXNA 1PJWA 2NT0A 5FLVA 4FYSA 5EF1A 3BVNA 3I6KB 4L5FL 5C0AE 4KXDA 4FABL 1B9KA 2MNJB 3DHJA 1MUJB 1S7RB 2QQNL 3RWJB 4JZNA 4YIQA 3WNKA 4QXTB 3NPSB 2IH3A 4QKTA 2H9GA 4AL8L 3OMZA 3E9TA 3F58H 5E1AB 1YPZF 4P2CG 3FQ4A 1A6AA 4HIJB 4Z7UE 3C2AH 3K8KA 3COOA 4D9LL 4IMLB 1GZPB 4NRXA 5D4HA 1KBPA 4NBXB 4HIEA 4ANVA 2DLGA 4YSOA 3X11B 4H1LA 4YHZL 1AI1L 4PJDE 2VW7A 2QGDA 4P5MA 1U3HA 2VLJD 3QJUB 1FN4B 1P9MA 3L95A 1GCFA 3O6ML 5BRZE 1A5FL 4QPEA 3C6LC 3HA0A 4U6XA 3Q13A 4MA1C 4S1SL 2D7PA 1U8CA 4G1MA 3AQYA 2BNRD 4M6AA 5A2IH 5FYLL 1I8UA 2G60L 2XRAH 4PJXA 4UT9L 1EAJA 3SQOL 2X89A 4HUWB 2H2SC 3OHXC 1FVEB 3SODB 1P7QD 2Y25A 4QO1B 4R2GD 5EF3A 4NQQA 2GABA 4X9GA 4DZBB 2AJVH 1QASA 3T1FA 5GGVH 1PD6A 4JHZA 3W9DA 1AD9A 3VFSA 2GPZA 4S11A 2BY3A 3UCRA 2BSED 1LDSA 3P4OA 2ITFA 3W5NA 2XFXB 1BF2A 5CJXC 3UTSE 5KSVB 4O5LL 3TYGH 3JZ7A 4IBVA 3TOPA 4DCQB 2YBGA 5CIPB 3IFLL 3G04A 4HUXB 5D7SL 1E6JL 5KYUA 1BXXA 1Q1JL 3ULVC 2BVOB 5E00B 1K4CA 3SD5A 5CR1A 4UQ9A 5I6MA 5AW8B 4KY1H 3CVHA 3MRCA 1HXYA 2ARJQ 3QHZH 2AZAA 4OZFB 2L4OA 5EUOB 3VI3A 5JHLH 5DI8A 1TNMA 4FQLH 4XN7A 5LQBL 3CVIH 3TJHC 4I18B 2V9RA 4D9LH 2A74C 4G9FA 1JWUB 4LLMB 2BK8A 5C07E 5DYOB 3VXRA 4Y16C 5TH2B 1XBDA 3GMPA 5DJXB 2EVIA 3INOA 1R6VA 2HKAA 1F5WA 3HRZB 4N4YB 4Z7VA 4JAMB 3ETBJ 3SE9H 3OXRA 2EEXA 1TT6A 4K3GA 3ARUA 4KXZH 3NP3A 4RGMB 1YNTA 1L4IA 3AREA 5T5FH 3L1EA 4GSQA 2CKBL 1ZHBA 3WY4A 4E5XA 1U95A 2W9DH 4FXGB 5CP3H 3AQZA 4DPAX 2ITCB 3KLAB 5SWQA 3WAJA 2AJUL 2Q87A 3F65A 3EH2A 3P4NA 1N67A 3KJ4C 1OAKL 3CAFA 3NQKA 5I82A 2MQCA 2P24A 1UFUA 1ORQB 3QJHB 1QSZA 4BSWB 4PJHA 2DLFL 2WQWA 3G5XA 2X53A 3PABA 1JUFB 4P2RB 4Q9BA 4V33A 6PAZA 2NCMA 2C26A 3QULB 5IBUB 3D3VD 3EDFA 5KANI 2CXKA 5I1IL 1RUPL 3WMSA 2YD9A 3VD0A 4ZUSB 1A7PH 3EYFB 4NT6B 4NYLB 5BRQA 3S2AA 5INCB 4PJHB 2IBGA 1TO5A 4WSKA 4JDVB 2EZ0D 3P0GB 3KDMA 3MC0A 5BZZA 3QH3A 1YQVL 2WMPB 3JWDC 1N5YH 3EJTA 3U30C 1PZBA 3FU7A 1FSKB 3JBG7 3A67H 2NSQA 1KLGB 3QHZL 3RYMA 2X7LA 2Z64C 3BZFA 1GVIA 2KQMA 3MNZA 3ET9F 2XZAL 5DQJB 4WFED 3QUZC 1QYGL 4AYMC 2F53D 3VXSE 4ISVB 3FCSB 3HPJA 4PJGB 4ANUA 2ERJB 4IRJB 4LCUB 4ZUTB 2WTPA 3GRWA 4GRLA 1MQ8A 2DOCA 4XTRC 1M1XA 1Y6KR 2WBJC 1SHXA 1U91B 3PAUA 2DMGA 4PTUB 3ILEA 5H35B 5K39B 3NJLA 4W9FC 4ZO8A 3VFMB 1NFKA 3QWQB 3SKOB 2OX5B 3U25A 5KYXB 4OLEA 3EAKA 3IRZA 4QTHB 5C08A 1FL6B 4KAQL 1NBVH 3HZKA 3K72A 2AJSL 3O4LA 1FO0H 4OVUA 1EZUA 3EHBD 4LOFA 4OV5A 4JX0A 4L8DB 3KYNA 3W2DH 3N0PB 4OGAD 4PJCF 2I5YH 4FZEL 2OW6A 2R1YA 3E8UH 4PRPE 4X6CA 3UERA 4ZZKA 3F6LA 4GW4B 4NAMA 4TPRL 4WFEE 1PCXA 3GYRA 1QWNA 4JJ5B 1ZIAA 1R3LA 3OVUB 4ONHB 4J3BA 4Y5XC 4PLKC 4QOKD 1KYOJ 2VN6A 5E8NA 3S36X 3ZX1A 5KUKA 5FO7B 1SVCP 1T1WB 3VI3F 1O7DE 2BVOA 5GGQH 1UEMA 3KJ6H 5ACMA 5JHLA 4ZPTB 2CBMA 2VISA 2Y1AA 4DCQA 1TJHL 1JHTB 5DGRA 3AXLB 2MNUA 1C5BL 4MMZB 4Y0GA 4ZTOH 4ZMAT 1I85A 1HEJC 1NBYB 3IJSB 2A73B 5HYFA 2DYPD 2HT3D 2YAMA 4H8VA 1ADQH 4HS3B 3KPRB 1T1YB 3OR7B 4H2CA 1J1XL 5IROD 2N1KA 2X1PA 1TTAA 5CINL 4MAUH 1CZ8L 4LPCA 1B4RA 3FC8A 4AQOA 3HVNA 2E7MA 2K6WA 3K6DA 4NAJA 5BQ7A 4QTIH 5DGQA 3UABA 4G1MB 5L8LB 1FFRA 1G7IB 3R06B 3IDIA 1T1ZB 2XX1A 1EXUB 1EVUA 3B34A 5CKGA 5MP6L 2Q3XA 5CZXD 5GRJL 4O02A 1SN2A 2RBLA 4H1LB 3LTVA 3X11A 3UCQA 4JKWA 3UOAB 2P1YA 3HHMA 2W81C 4KGJA 4M1DH 3FB6B 3HFML 5HYSB 3MRFA 1EBAA 2ICWB 4HH9B 1INDL 4H1LH 4D9QD 1EEYB 3I3EA 5KOMC 1J0KA 4V1DE 1QATA 1T03L 3QZLA 1KTRL 1NUDA 2IH3B 1E4XL 1XVSA 4N9OB 2AQ3A 4HISA 5IMLA 3BWZA 2IANA 4G7VH 2VDKB 4UT6H 3O2VL 4J8RA 4PN6A 4F37K 3T8XA 4HV8A 3SY0B 4YSRA 3FF8A 2EDTA 2AEQH 2VW4A 1QSFD 2IFGA 2WLMA 2NY6D 4LL9A 1CLVA 1N9PA 3CGTA 4AZ8A 4XI5D 2PPAA 5IM7B 3PDOA 3VM5A 2X2JA 2OLDA 2EXWD 1C5BH 4AYDC 1U41A 2Q86B 1MCKA 2C7UA 3I75B 1HEHC 2VSCA 3IXAB 5PCYA 5DQDL 1T5KA 2DWDB 2JELH 4AGLA 5C7ZA 1A7NL 3TM6A 2NNAB 4QXWA 3HE7C 3ZK0A 2DMCA 4K2UL 1WCBB 3NGBB 5CIPH 3FZUD 4RH4A 3K6FA 3JWNE 2D2OA 3BDXA 3VXNA 4E9TA 4ZFOL 3IVKB 1O5DT 4PP1D 4QHPA 4UU9A 4GAFB 5IQNA 2XTJB 1YEJH 4LSRL 5JOPE 1LEIA 5HHPB 1EFXD 4FQHB 1S9VA 4IRZA 4LPWA 4PEEA 1ZV2A 3V7AE 4NQTA 3X1FA 1R3JA 1KYDA 5F93C 4DVBA 2OTWB 1PX4A 2DQEH 5EBMA 1X7QB 5IFJA 4IHOA 4IIQA 4NUQA 3L5HA 4QRPB 1FYTE 5IHUL 3FUIA 4ELDA 4C4KT 4MXWL 2P5WD 4TVSa 1Q9OA 3ZHKA 4ZMQA 4XBEH 1EZSA 3Q9QA 5DJZA 1RULH 2W60A 2Y69B 1TJMA 1XF5B 2CIIA 3GK8L 4P2QB 1PNCA 4B9PA 4IBLT 1UD4A 4JN2A 3QDJD 1FG2A 4G80A 4LPVA 2IDFA 1BOGA 2YMOA 3MMEA 4YGVB 3DECA 3KYOB 5C09E 2A2QT 4UDTA 2E6PA 3QFJB 3HG1E 4CDGC 2BLFA 3FSOA 5JTWA 4Y1AE 1IUZA 2YRZA 1W8OA 1QW8A 3MUJA 1TJXA 3VXMD 2EDOA 5DC2A 1PAZA 1CLYH 1K3ZA 2LLGA 3PGFL 2OL3A 1LP9E 2WSKA 3LNFA 4Y88A 5KZCD 3APCA 3RB7A 1I1CA 5HI4C 4DN3H 2MCPH 4HLZH 3ARTA 4WTZG 5JORA 4J7RA 5I1HL 4GAJL 1U2YA 4OU3A 5BVJA 2ZAGA 4MSWB 1XV8A 2LU4A 1BLIA 4RNRA 5DLMH 5DO2D 4OCRH 3WKMH 1RKRA 2QSTA 4MD0B 4JQVA 3AZUA 1MH5A 4ZUUB 2K4WA 1V55B 3BDYL 3MUGB 2FJGB 4IDJH 2MFNA 3FTGA 4HQQL 1U3YA 1P5UC 4DH2A 4AK1A 4KK9C 1MH5B 3RA7L 1DP0A 2JV6A 1NM9A 1I7RB 2LR4A 4YDVB 4OGXH 2FJUB 3LXUX 1T22B 1UWYA 2J7LA 1SOKA 3DOSB 4AJYV 2E75C 4LMQI 1NGYB 3GXTA 4EAEA 2BCMA 2BNQB 3VVWA 1E4WH 4YO0B 3NH7H 4G6AC 4WI5A 4JUSA 2XV3A 2VQUA 4UV4H 2ZIDA 5C08E 4LOVA 1SLUA 1TLKA 5HDLA 4V2CB 2DLHA 2BOCA 2V17L 4OZFH 3D0VA 2WCPA 2YD0A 1M9SA 5HI5D 3ZE2F 1G0YR 1W6WA 2APWA 4PRPA 2R59A 3MLUH 2C3XA 3ABKB 3VFVB 1SBSH 3ARSA 5ALCL 1ZMYA 3AS2A 1CJYA 1U8QB 5DHEA 2CBQA 4HD5A 3AAZA 1WBYA 2VO8A 4G7SB 5DLML 4X5WB 2HUEA 4JM2F 1I8LC 3QHTC 2EIMB 1N64L 1KXHA 1ZPUA 2YQGA 3H6AA 4OGYH 3ZDWA 1ACXA 1A1OA 2JKLA 4HQQH 5L6YL 1Q9OB 2MQ3A 4NKOA 4TUKH 5DDHA 4Z0XA 3MYJA 4KDVA 2Y6SD 5C6TL 2OCCB 2WWMD 1XCTA 5T1LD 5DFVC 1UOLA 3NA4A 4JFXA 3L2NA 4A2FA 1IEAB 4OQTL 4BJLA 2BZDA 2VE6B 3RWIA 3X3GL 3VACA 5GRVL 3V6OC 5FB8B 5B22A 5I0YA 3D25B 5TK4A 4YHYB 1BVZA 3HFFA 1L9NA 1RU9L 4XNXH 1GKEA 1DVFC 2ZSWB 2HVBA 4ENED 3F84A 5FDYA 4G6ML 1G94A 3CDZA 1MNNA 5EFIA 1GYVA 1A6TA 2NY6B 4NOBA 5AOIA 1IBZA 1NICA 2D03L 4TN9A 3ZTJG 1MRDL 1TYRA 5SV3A 1H3VA 3IKKA 3UTTB 4JRXE 1DEEA 3QEHA 2ATKA 4PJGF 1PYWB 3MRMB 2WB7A 4L4TA 5EBWB 4ELMF 4MHHI 2PABA 3E2HB 1O7SA 3VMOA 5TPWH 3DVFA 3VYPA 3F58L 4R4FL 3WL9B 3W1ZA 3ZDZE 4MA7L 4HIXL 2ITEA 4OLWH 4QRSA 5CUSH 2D3LA 1AFVH 2AQTA 3EBIA 1EO8H 4OF0A 3U0TA 3EBHA 3LZLA 3HNVL 3S3SA 3Q2VA 2VXUH 3H3KA 1OALA 2V3FA 5GSRA 3LQAC 5EOQL 4EZLA 3VU2A 1YDPB 2LE9A 1ZA3A 2WV3A 3BLPX 4XMLH 1CFTA 2AMUA 3WIHL 4HT1L 4IK7A 4G9FE 4GEJA 2P49B 5DMIH 1E6OL 3A23A 4ADIA 3DHMA 3P9MB 3MRMA 4JRWA 4V11A 4HJTA 4ODWB 3V0JA 1RHFA 1TZHA 2NX5B 3MRNA 1H8OA 2ZXAA 4HZ1A 1UM5H 4M8VA 1JNLL 3RL1B 1D2OA 2K3HA 3GEFA 5JA9A 3IETA 3RUGB 2BY1A 2EYSA 3CK0H 4UF7C 4PJ8B 2VXVH 1RCYA 2BVQA 1JDDA 4WW1A 4ZNEE 4JN1H 5B8CC 3RU8L 2FBJH 1IILE 4TNGA 5BRZA 4PGEA 3O41B 4U7KA 1PKQA 3HHRB 1MHPH 2OL3L 4XR8C 2PKDA 1RY7B 4P3DA 2FE0A 1IGCL 5I19H 3F7PC 5E24E 5K9OB 1PKOA 1KELL 4DGUA 3U1QA 4XNYH 1AD0B 1UZ8B 4ONHA 2AC0A 3ATDA 4FQIH 4FXKA 4N85A 2Y22A 5DFVD 4YL4A 4IW4C 4LLAA 3V4VB 3GSXA 4TULL 5D7IE 3TZVA 1N6UA 5F3BB 4PCYA 4Q74A 3L3OA 4H26A 2E76C 2OKMA 1YYML 4P23D 4PW9A 1MREL 3VE0A 2QFPA 2O30A 4JG1H 5ICYA 1GZHC 3BQUB 4C56E 3GPSA 3GSNL 4WW2C 3T6VA 1WIUA 4WFGE 4RZKA 3D0AA 4IU2A 5AZ2H 4HPYL 3INUL 3VI4B 4EQ2A 3QWRA 2DPKA 1URIA 5D1QB 1LO0L 1BX2A 4L4VB 1AGBB 1G6RH 2ZP9A 4ALAL 1UJTA 4K3JH 5IKCB 4RX4A 3W11D 2CHZA 4N2GA 4AIZB 4NCDA 1Z66A 3QH3B 4KI5D 1IE4A 2GIMA 3N42B 4WY7H 1JPSH 1RJLB 1WG3A 3HBPA 2PR9A 2ZCHL 3EZ8A 3V0DA 5DZVA 2QGCA 4GINA 1H9VA 5GGRB 4X9FA 3BSZH 1VLXA 4X6BB 3WJLA 5I15L 4ZUUA 1QUNA 4OJFH 4PSRA 1NFIA 3G5XB 4P2RA 5F7DA 3S35H 3ETTA 3HZMB 2COVD 1QOKA 5ADOL 5BVJB 1EO7A 5DO2C 4GSDL 4NHCH 4Z7WB 2VDMH 1HKFA 1NUFA 1DUZA 4ABQA 2F8IA 1NMCC 4OQTA 1SHWA 3STZA 4TRPL 3RVXC 5F9AC 1OD9A 2FWOB 2J4WL 5AALA 2AS5M 3TYFA 4ZFFB 3VG9B 2C1PB 3RX7A 2LAGB 3D1MC 3O45A 4YVNA 3QFJA 4AW4A 3HEIB 3F83A 4FDWA 4PJFB 4MXWH 2GTZA 3ESMA 5IF0B 1KIQB 4F80A 1J10A 4P48A 2DLFH 5GIRB 5CN2A 2G5UA 3DUUA 2O5XL 3AT9A 5CBAA 1MAML 3MRGB 5GSVA 3SDXA 1I4FA 4XCEB 1S8DA 4J3OD 1XGRA 2VDLB 4WVRA 2G30A 4XVOA 3VW3H 4ES8A 2VDPH 2OAAA 4JZJB 2AV7B 4NX0A 3PUUA 1JXDA 2AGJL 1R3KA 1X7QA 5IFJB 1VACB 3KPOA 3H2WA 4H8WH 2BVPB 3DUHA 4M5YH 1XB3A 5T5NG 4B9KC 4HUVA 4K2UH 5KYUB 4NQED 2PXYD 3L81A 4FQHA 2VN7A 1E65A 4ERSH 3OSVA 1IAIH 3ZO0A 1KXVA 3HLKA 1P4IL 3X12B 3G6AB 2VZOA 2LAAA 4X42A 4DN3L 1M7IA 3VXNB 1EBPA 2APXA 2BRQA 2J8HA 1VENA 2BNUB 4J3UA 4Y2DA 5CZKA 3T2QA 4WQOA 2VRQA 3WIFA 4TVPH 1IKFL 5I1JL 2DTSA 3GO1H 3LSOA 3BVTA 1GS7A 3QUXB 5F1SA 1H3PL 4L8BA 5F1NB 4AC2A 2V9TA 4I48A 3GUFA 4R0LA 1OPGL 2EIZB 3DTUB 4I7ZC 3MQIA 3UH8A 1TLMA 4HDIB 4GKNA 1AKJD 2AITA 4R9HA 3KPQA 4XI5C 5DRWB 3CVIL 3FTXA 3VG0L 3T3PB 5CCKL 4NXKA 3O9WB 3QQ9D 1MEXL 4DWHA 2E27L 2J6WA 4I2XA 3Q6FB 3V4PL 1DQQA 2DQFA 2CDGB 4L3EE 2Y07H 4IKIA 2V3EA 1FLRL 1DN0B 1MFEL 2OR9L 3FT3A 3ULUD 3VFNB 4PWEA 1S7XA 5KBMA 5FUCE 4QGTA 4FYRA 4B9GA 4PRHA 3TA3A 2F58H 5GGUB 3U6RB 3KNBB 1S5HB 1XZWA 4JZNB 1FZOA 2VL4A 4RFOH 1JYVA 1VADA 4WI0B 4O02B 5TFSL 2ETWA 5KVGE 4BQ6A 5CINH 1BEYH 5FGSA 3BVNB 3QQ3B 5DRWA 1HHHB 4ZUVB 1ACYH 3OD3A 3RJOA 1A0QL 4L8CB 4B7LA 4BFGA 1HCYA 3CH1B 1E4JA 1L7TL 2Z7YA 2WOBA 2FYYA 3CN4A 4XVTH 3MGTB 3VQLA 3PE9A 4XNQA 4YQXH 4EN3D 2CHWA 2AEPH 3S3PA 4GUCA 4JY5L 1TJHH 4F8TA 5KBLA 2XTJC 1XIWC 1RJZB 2V2WB 3SKMA 1BVLB 3H6JA 3V6OE 3RDTB 3SDCC 5AZ2L 3BPCB 4HW6A 1A1MA 4N8PA 5AOZA 3TCLA 3HG2A 4BFRA 4OIAA 1RZJL 4NC1C 3ZQXA 2JKRM 1NCUA 4UZSA 3QAQA 3WTXA 2HVJB 3KPOB 1AC6A 4QHKI 2E7CA 2YGPA 2ZSVA 2DQTL 3WHE1 5FYKU 4FULA 2BVEA 3EYQD 5CP7B 1QFWL 2P42B 3G5YB 5A2JH 4OV5B 2NPLX 2E27H 3EJUA 2OR9H 4LCCA 4NN6B 3MRGA 4JFDE 4NN7C 5GSVB 3SDXB 3OHXB 4EUPB 4HCRL 3RZCD 1XH3A 5DVKA 2OX5A 3EJYD 4P9HH 2F54E 5IEHB 3BUYA 3BEVA 1QLFB 5I9QB 5JPNA 3QQDA 5I76A 2YEVB 2R2CA 4JFHD 3SKNA 5L0QC 3MAWA 1XIWD 4ZZFA 4B9YA 4EKXA 4K23L 1NC4B 5ICZA 4YHKL 1R19A 1XSOA 1BECA 4OLZL 4HD9A 3L7EB 4L0ZA 1RZKC 4PCSA 3JUZA 3MROA 2BS9A 2AXHA 2X7LB 3WKNA 3BAEL 2UY7A 1P5UB 4ORGA 4CSPA 2GITB 2V4LA 1X9RA 2VZ1A 4ERSL 4PTTA 4HT1H 4PJ5A 2JI2A 5C92A 4FKKA 3WNIA 1PZCA 5KSBF 1GSKA 3TO4D 4BGDA 5HJ3A 1A1NA 2YA1A 5SWZD 3EUDA 5GPRA 3ZGIA 5I8CB 4ODSH 1IGTB 1JWSA 4G8AC 5C3LD 1OGAD 4B96A 4EEEA 4A1RA 4CAGA 4Y16B 2P45B 3BGAA 4M1GL 4WFFE 3L5WB 2N0MA 1MJJA 1J5CA 1ONQB 4WIQA 1E0OB 4NQEB 3GSNA 5IW6A 4YNYB 1GGIH 5D2LF 1JK8A 1KTLB 2LHAA 1AO7D 5CJXA 4QHMA 1N26A 4P59H 3HG0A 4XBGB 3H9SB 3S4SB 4BWTA 3MJGX 1XWVA 3RZCA 1JVKA 2OPCA 5D72H 2E9BA 2V17H 4FG0A 1JTPA 1AHWA 4ODBD 2DQHL 1BD2E 1QPPA 2Z0BA 1KEGL 2KLTA 1KXTB 1PLCA 5D1ZA 3VSUA 4JRYD 3VWKB 1A6ZB 1ZLVH 4LVOB 3HRZA 4QRAA 4MS8D 2NY4B 4P5SA 1DBJH 5K1VA 1NFDB 3NP4A 4NO5B 3MR9B 1MF2H 2BIMA 3MLTA 2F1AA 4BUGA 2AQ1A 4R2GB 3OPZH 3V4UL 5TGBA 3MNMA 3ISYA 1SHMA 2MKWA 4U1KA 1YMME 3T0DA 4NO2A 3S35L 1TFPA 2A9NH 5HXMA 1G1YA 2HG5B 4Z6AT 1U8NA 1EZLA 1F90H 1TTBA 3FQYA 2HLFD 1YNKH 4XB8A 4OCRL 1D5IH 1AD0A 1XEDA 1SLWA 5K9OA 2F68X 5HP5A 1ED3B 2WO2B 5CJQL 3QUZB 1EHKB 4R8WL 2Q20A 2EQDA 2XZQL 3C2SA 5HHME 4LB8A 5SX5K 1G43A 4G8EB 3LKOA 5DJDB 1SJEB 4X8GA 4X99A 1QO3B 1ETZA 1WRFA 3T0XA 4PJ8A 1TQBB 2FYVA 3PAVA 2EYSB 4DGIL 1F18A 3B9EA 4HFWB 1AP2B 4OSUL 4TQIA 7FABH 1VGKB 4M48H 4U1LA 3FMGL 3DXAA 3WEOA 4J3XA 5D1ZD 1UENA 3BAKA 3UBHA 2EE2A 1OLZA 3VNYA 1FNGB 2EIDA 3OV6A 3PJLA 5E99L 4U6XB 2A9DA 3LX9A 2DQHH 5K33A 4ELKA 2ZAHA 1ZIBA 1JTTA 2BS8A 4OF6A 4ZXBC 4MNQD 4IOFC 4FCHA 3EHBC 4MCMA 4XBEL 2BW4A 3DI2B 4WK0B 1WWAX 4M93B 5DUBB 1U3HB 1TVHA 3GS0A 5ECGA 3RDTD 1O9VA 5EDSA 4PY8I 1MIEH 4AT6A 1FL5B 3EYVA 3LN4A 5KW9H 4AKQA 4NLHA 4C55A 2VMEA 1ID2A 5DHVH 4H25A 3U79A 2WANA 2YD2A 3PQYA 5E6SB 5J12C 5CD5D 5LWYH 3U9UB 3OKLA 4OFDA 3X13A 5A1AA 1GGCL 4I0KA 4XWGL 2GJZB 3MV7A 4KJPD 3B5TA 1FNFA 3MV8D 2B59A 4MX7B 1TJIH 4JE4B 2JQAA 5I73B 1P69B 4O4YH 2ARWA 1TJGL 1ANUA 4WNQA 3ARGB 2VKWA 5DTFA 4JFED 5KYYA 3VW3L 4PB0L 1RHHB 3LPGA 5A16A 1OCWL 1P4LA 2VDKL 5GJTH 1RZPA 1QVOB 5SWSB 4Y2OA 4KJQC 4OCYL 2ESVA 4GRMB 2HX8A 3T8VA 4HJJH 5HGGS 1NCWH 3MUHL 1G6RB 3MNVA 4WU5B 2XV0A 4DUVA 3OAUL 3FTVA 4KOCA 1MRFL 2WO3B 4JPIA 3UG3A 3N04A 4F93B 1LO4H 4ZMYA 4JK0D 3RVWD 2WKOF 4U7SA 2OV0A 3BSHA 4WU7B 4K5NA 3ZDXF 3LPOA 1QSEB 4HCRH 4AV5A 5MENA 5AAMC 3VD2A 2ZG2A 1PZ5A 2YS4A 2ZOLA 7PCYA 1D7DA 4AL8C 5DEFB 4JDEB 2QHRH 3QEQE 3FFCD 4K4KA 5J5EA 1U21A 4Z7IA 1HSAA 5BV7B 1LMIA 2MQGA 1BPVA 1QRND 1AIFB 5IMKA 1ZSHA 1B6DA 2BSRA 4LSDA 3FBKA 1R9FA 3J8F7 5E9DB 5GS1A 4XCYB 1O75A 3R1GH 5E4IA 5EO0B 5FGCB 4AMKH 3E38A 5C8JA 1CYXA 3RX5A 1BGXH 2Q7AA 2E59A 3PWNB 4NEHB 4XHJC 4JANB 1QWUA 3JT2A 3A4EA 4NOFA 2ZUSA 4ZSOB 5I1CL 4J6RH 3TT3L 1GKOA 3QUMA 3MRKA 1JRHI 4L3ED 2AQQA 3SKUD 3BFOA 5JIIA 2FX8L 3ARPA 1Q0YL 4M5ZL 4W6XB 1CD1A 1Y7VA 3KPRD 4HMDA 43CAB 1L9MA 3KGUA 5LUMA 4W4NA 5ID0B 4GT0A 1AJ7L 5EA0L 3O4LD 1MLCB 1ZT1B 3TNMA 1E5ZA 4LVHC 3VTMA 4OGZA 4NKDB 3SDYH 2FZ3B 2X1XR 3D87B 3GI9L 2W07A 1KTDB 1KFGA 3OB0K 4RX4D 1BG1A 2BVYA 2DLEA 2VDNH 3B7TA 2CHDA 3L3JB 2C9UA 3WNMA 3MRDB 2YKLL 5CGYD 1DVQA 4JFPB 4NP4H 1U8MB 1N0LA 4MD0A 4NIKB 4PJBB 1DCLA 1RZ7L 3FO2A 4KQ4H 1HXKA 1KJ2B 1PFCA 1CLCA 3D69B 3FH8A 4N0YL 5BUPA 3IE4A 3FBQA 5D7JA 2Y72A 2XG5B 4GMSL 4RETB 2VM4A 3PJSB 3X3FH 2K9UA 3D05A 3MLUL 4U1IB 2B9BA 2UZIH 5GS1C 4C47A 2HH0L 1DVTA 4LSTH 2JLPA 3GKWH 4L4TE 2RALA 3P3UA 3FONA 5BZXA 3UFIA 4AYEC 2G3XA 5DHMC 1IAKA 5FYJL 1DQML 4Z1PA 5IT2L 2WVTA 3KPPA 4KDWA 1D3CA 1PF3A 2NW2B 3NK3A 4Q9CA 4YDNA 1I3RB 1JWMA 1MCSA 2BMKA 4GO9A 5DJ8A 4PVBA 4PRIA 2ZWYA 3CNKA 2OMXA 2R7EB 2R8SH 4KRPD 4MCNA 5J6SA 3UBXA 3WNNA 4OB5L 1JHKH 3OTTA 4WI7A 1NANH 3MLRH 2F53B 1WA2X 3UJTH 5C0IA 3K74B 3NN8B 4L1DA 1HTYA 3LMJL 2OTWA 3HZYB 4KKLD 4UQAA 1HINL 2I32A 3MNWA 2WINA 4J39A 5DJ2B 2AXWA 5SX4H 2PLTA 3JYCA 3WDHA 5JA8B 1LEIB 4PJFF 1ECZA 3KGRA 3VJ6A 5BVPL 5IB2A 2HXAA 4FTVA 4FTVE 1CGYA 4LLDA 1M6OB 4A37A 3S3BB 5I28A 3KHQA 2ARJA 1NDGB 4S0SD 2NLJB 2C34A 3WN5A 5DD3H 1OAZH 3BHBA 3OLDA 4GRWE 2YGVA 5KBPA 4JDZB 1G7QA 3D48R 4OCNC 2L7EA 1C5DB 5FUZL 1X4YA 2AJYL 4LHUB 5JYMA 4K7FA 5ES4B 2QKSA 4LHQB 5IG7B 1JXFA 4JFEE 4KX7A 1IAOA 1JGVL 3LEXB 2R2HA 4OY9A 5I1DB 4KTGA 5I2IA 3DXAD 3X17A 5CLXA 3VXMB 4DK3A 5I6LA 5JXAL 3IDNB 2ZKHL 3A67L 3OGCA 1YECH 3MV7B 3O3UN 1UACH 2GTQA 3FSWA 4ZX6A 3POHA 5HYJA 1IFRA 1XH1A 4NFDA 4M8UA 2ICWA 4HH9A 2EDNA 4KQ0A 1P7QA 3GRBA 1JBJA 1F02I 4IGBC 2EH7H 3LRSB 4F92B 1FVDA 4J2QA 2IDUA 1KIUB 2NY7H 3RGVA 3NFSL 2A4EA 1CURA 1AGCA 1J86A 1VHPA 2WXIA 3EYVB 3LN4B 3L3KB 2X4PA 4GAGH 4GUPA 4J6IA 5C0BD 3CSBA 5FCUL 1NANI 4RIRA 2EECA 4E42A 3RNQA 1R34A 4YFDB 1XSJA 2UWEF 5EDXA 3SE3C 4NQCD 2MNWA 4OZHE 4OD1L 3D2UA 5HYIA 3IMUA 5IY5B 1T7YA 4DIXA 5TDNB 4UOW1 2IH8A 5B38B 3BGFC 2H3NB 3CIQA 1J0HA 4FHJA 4U6YB 2AHIA 1G7PB 1UB5A 4ODSL 3IAQA 3FH7A 5DUJA 3RY5A 1QLRB 5F89B 1VGKA 4U1LB 3KLLA 5FGBC 3PGDB 4CVXA 4ILDA 4WEBH 3U6XA 1TZ8A 3D51A 5C6WH 4JGMA 1J8RA 4HBCH 1BXVA 3QPQD 3PYCA 1O9WA 2Z6FA 3GXIA 3HG1A 2DBLH 3GIVA 3LJ3A 4PS4H 2VQ4A 3LHPL 4XE0A 2X4SA 4GXFA 4LAJH 4WSGA 3G08B 3F7YA 2VISB 3Q3GA 4JB9L 2WP3T 1JGDB 1TKWB 4HZLB 2V33A 4TULH 3U0PB 4KKZA 4NO3A 1NL0L 1XO8A 2DQGH 2JJWA 5CJOH 3RB5A 3VFOB 3HFMH 4Z23A 2WKLA 4JO1H 1LWJA 4DNLA 2NZ1A 3G6JF 3VGAC 1FNHA 3D06A 1L3NA 4J23A 1AGDB 3FMGH 3N55A 3NIFE 2HMID 2OI9B 1PZSA 4G43A 2A9BA 3L2MA 1D6VH 3AU1A 2HJKA 3ECWA 1IGCH 1WHOA 4ACTA 3RVTC 1AQMA 3RZCC 1D7FA 3JV4A 3V4PB 3O6FB 2Y1VA 2AI0H 3MO1B 3VFMA 3BEWB 4QLWA 4F57H 2IGFL 3WIIH 1QR1B 1EEZA 2X09A 5T3XE 2XI9A 3ZHFA 4CMHB 4M9PA 1FPTL 1N3NA 4Z7UA 5JIPA 5IB4A 4KK6D 1LXMA 5DD6B 1ZT4B 5BJTB 1ACZA 1LNUA 5KANG 2OR8A 1OTTD 2W9EH 1DBBH 3NCXA 1Z5HA 2JIXD 2YN3A 4PJAF 3R0NA 4Z18A 2X6MA 5E94A 2YRPA 2X4TA 3STBA 5KSAB 3KDMB 4JMNA 2IOIA 4ONFL 2MCAA 4MNGB 4KTEL 2XWJB 1MHCB 3AS1A 1LK2B 2JCCA 2DI9A 1BVNP 3V8OA 2PP9A 1YY8B 3D4YA 3O6FD 2DMBA 1FNLA 1T2QL 4IBYA 1RZ8B 4BFIB 4PAZA 3ZR6A 4NP9A 1WGVA 3US0A 1CFSB 2HTLC 3CDCA 1FO0L 1WSST 2C3HA 5JPNC 2P24B 2OCJA 5K9KA 3DX0A 1BOYA 3FCTB 3KBPA 4P2YA 1L9RA 3PPSA 2CO4A 4TPRH 5T5FA 1TF4A 2Z93A 1EJ6A 3W11C 2F7OA 3L5XL 1AE6L 4CGTA 1A2YB 5DRXB 4P5TA 1UM4L 1IC7L 3A5VA 3BLBA 5HJGA 2J55A 1KY7A 4LFHG 4MMXA 4W9EC 3D3VE 3QUYB 4OAWA 5E5RB 3WJLC 5IOPA 3FTSA 3TH4T 2XV6B 5ICXA 3QW9A 2XBZA 2XG4A 2PWGA 3BEVB 4OBSA 2D0GA 3HRZC 2E3VA 3O3BA 3HBGA 1S2EA 1XH3B 4BFBD 2XTLA 3Q5TA 4ZMWA 5FWRA 1ZANL 3TPUA 3UTZA 3DOIA 4LRIC 5DMGC 2H2PC 5CZRA 1CTMA 3KZ8A 5C9JA 5IJCC 3T77B 4E41B 3VXTA 2CRZA 2AXFB 3N85L 1KMGA 3DYOA 5AENA 5DJCA 2ZAIA 1WFIA 3D50A 3VD5A 4DP6X 2W59A 1X5YA 35C8L 4AYBA 1U93A 3FSVA 2B1OA 3QRLA 2VGLM 3MFFA 4MCZA 2DWTA 2BHZA 3B9DA 3EGXA 4JBSA 1V7NH 4DP1X 3LXCA 1NCWL 1GR7A 2HX7A 1QBML 2NUPA 1CGUA 3A4DA 3G04B 2GT9A 4HUXA 4UTBA 3UROR 2WJ5A 3WIIL 5J3HC 4D3CH 2XWZA 1B4LA 5I5RA 2E8YA 1CBVH 5KSVA 3BP4B 2DIJA 1U3NA 3GLEA 2FL5A 2X1WL 3QDJA 3MV9A 3UEQA 2C9QA 1WAPA 1JNHB 3DGGA 3HRPA 4DETA 2P28B 3TBSA 1TJGH 4ZMXA 2Z31C 3R19A 5DFAA 1S7TA 5ALCH 1YA5A 4DZBA 5ISZD 4HEME 2HFFA 5JNYA 1EHLH 5EZLA 2Z8SA 2X87A 4F2ME 3MGTA 5LNEA 4GRWF 1KYUA 5EU4A 3MTXA 1FFQA 2EXYC 5KZCB 1X5LA 2WYTA 3MUZ1 4ADGA 3QQ3A 3DIDA 2EIJB 5BRZD 4WI0A 3WN6A 2YXFA 3ASOB 3L4VA 4FKHA 3S6CA 1GZPA 1UT1A 3MU3A 3GXMA 4IMLA 3QIBA 4NM8L 5LHDA 4X9IA 2NSMA 1QZ1A 4K3EH 4LCCC 5JLZB 4P2AA 3ASNB 1UD5A 1SDAB 3GMOA 1OE1A 1S9XA 1TQTA 5FYKE 3IDYB 4L29B 1DQQB 4XVTL 1RIVL 4HVBA 1IAMA 1PSKL 3P2BA 4KK5C 1UHVA 4LSPH 5E8EB 2B14A 4I2XB 5E2JA 3NEXA 3KLKA 1VEMA 4Q7DA 2QLVB 1S78C 3HC4L 3M1BA 5LBGA 3IGLA 1QHPA 1MHPL 1J05A 2OL3H 4FLOA 4R0LB 2E9IA 3AC0A 3CX2A 3B2XA 2ADJA 5I1GL 3QXTA 1TVBA 2G75A 2HWZL 2XXFA 4S1RH 3WMQA 2XZQH 2QVMA 4Z7NB 1FDLH 4PREB 1A5FH 1KBGL 4M1CC 1WIOA 1JZ6A 1JMZA 4GXUM 2DQCH 3MRBB 3GEWB 1T4WA 3QYMA 1S9WA 2VAAA 2VMCA 2P8LA 5EOCL 3S36H 1NEUA 1NMBL 4UQCA 1DVFD 1JS4A 4K8RH 4A7SA 4UQ2B 3PXLA 5AVVB 1YYLH 3APFA 2NW3B 1H9DA 4QJ3B 4N2EA 1YMHB 3ESNA 2FNWA 4RAHA 4QRQB 2BVPA 3A6BL 2B1AL 3GSNH 1BQHB 3D85D 1HWHB 3L1OH 1Z9MA 2BZCA 2ZKHH 2HP4A 5SX4I 3FQTB 4YXLH 1BWMA 1OK0A 3A4FA 1IKFH 1PGRB 5I1JH 2YIHA 2XTJD 1BGXL 1XGRB 3KH3A 2RFXA 2DD8H 4XBMA 5CBAB 3B56A 3IF1B 3QORA 4WWKA 1YEKH 3VGAB 2H8PB 3MRRB 3P54A 3STLB 3QDGD 4JQIH 3IXTB 4LSSL 1CCZA 1IO4C 1PDKB 5MEPB 1UADC 4XXDB 3T0EE 1MWOA 3B1UA 4XCNB 3UTTD 4K55A 3VGEA 3ZTCC 2JWYA 2CLRB 2VR3A 4KU1A 4AQ1A 3TEZA 3TBCA 5BVPH 3FAWA 5D7KE 4NZUL 2C9XA 5DZNA 1XTMA 3WFEH 5F70A 3WKPA 1RUQL 4JN1L 2W65A 1KZQA 4KKBC 4Z7WA 1LDPL 3KYMA 2GAZA 1QTYT 3FW6A 3H85A 2W0KA 3I9PA 3CLEL 1M42A 1XR9B 4G7VL 3D52A 5HHNA 2FB4H 2A9CA 3DMMD 1JMXA 3LKNB 3MLRL 4RESB 5FEBA 2KHAA 4L9DA 1NUGA 3T4YB 2VLMD 1EANA 4U2ZA 3T2PA 2NR6A 4PS3A 5AKTA 5TF0A 3ROLB 5FUCC 2V8MA 1A4JB 1XXDC 5D1QD 3U7WH 2BNRE 2Q76A 5A6LA 1RZIB 3DIVA 3KXFD 5MEQA 4WWPA 3FRPG 3SBPA 2A1WH 1FZKA 3EJZC 2K3TA 1AGBA 4MNHB 4F8QA 4CMMB 1N6VA 1XGQB 5AOLA 2VJ0A 1Z9SB 5HPMA 2Q8BL 3CMOH 4KZCA 5AFAA 3TF7C 2VL5A 1MNUL 4EZJA 4JO4L 5IFHL 1HNFA 5I30L 3OKKB 1SHSA 3TXAA 3QDMD 3ARDB 3FDWA 4FG2A 1QR1A 2AK4B 4MVBD 1QFWH 1M7DA 3GM0A 2WQAA 5D5MF 4BK8A 1KFAL 2C3GA 4M1CD 4L23A 1F6AB 1AS8A 2ZNWA 2FBOJ 1D5MB 2WXKA 4ABUA 2I9TA 4Q9QH 4A6YA 1ZTXE 2YPLD 1G1CA 4O2EB 2Y06H 5EA0H 4LDOB 3V0HA 2L3BA 4MMYB 4CGUB 4GG6B 4KFMA 3KPSA 5JW4M 1G6RL 3NZHL 4ALAH 4GG6A 5ID1B 5LXVA 1SQ2N 2Y1YA 1CQYA 1M56B 4O2EA 1DVSA 3SD2A 1PU0A 3FFOA 1DJZA 1F4HA 2NTFA 1BDYA 2F8OA 2FWSA 4LSUH 4TLKA 5IVXF 4YSDA 2YPKA 1L3WA 1OAJA 1PKQB 4BH8A 5C0CD 2DIBA 5E08L 4Z3GA 1E5AA 3B5HA 2Q1EA 3ZYZA 1A7RH 3QRGL 3OKKA 4GFXA 3EDJA 1Y18A 5AOMA 4LVOC 4POZD 4F58L 2Z35B 3RVXD 3GMQB 4ZMTA 1AQ8A 5I5JA 3ARBD 2Z8RA 1LE9A 3CZEA 1QLEL 3LD8B 5F9WC 5BV7H 1EJOH 4GAJH 4YR6A 1MKFA 3D09A 3K2MC 3THMH 1FFPB 2IANE 1Z3GL 4PJXF 4PJ7B 1ROWA 5C0GB 2AJZB 2W5PA 4UINL 3ZZSA 4ZS6C 1OP5H 1N4XL 3FRPB 1KC5H 2CA4A 2OMWB 3ZZLA 3C08L 4L3CA 2Q8BH 3UX9B 5E2UH 3NRPA 3VH8A 3N41B 2FIRT 4PLJC 4Z7VE 5E95B 5CEXA 2Y7NA 3PL6D 1USZA 4LCVA 2COQA 3QORC 4WWKC 3TIEA 2VZTA 2IJ0C 3C60D 3TGXA 1DBJL 1W2KT 4PWIA 5F3HA 4ZUWB 3IRPX 5GRUL 2GVYA 2J43A 3CFQA 4G9DA 4LLUB 2LU7A 4WKZA 4I0PD 1KEML 2X05A 3U7WL 3RWDA 3LRSA 4MXQC 4J5VA 3ZKND 3UO1H 1IZKA 5E5LA 2IGLA 1KTJA 4PGJA 1B4JH 3HMXA 3MA7B 3CWGA 3VI3E 2APTA 1QQDB 3ZKMC 1KULA 3DROB 1JDAA 4HIHB 5HYJB 4F5CE 3ARBB 1MRFH 2X70A 3CQFA 5IQ7L 3OKEA 2QPUA 1H3XA 3REWB 3WSQH 3QZWB 3S48A 2CLRA 4AQ1B 2WZPA 3VXMA 3RX8A 4GT7A 3CVHL 2J5WA 4UIMA 2ZXQA 3UTSA 1E4XI 1LEKA 2GJ6B 3IXTA 4LHUA 3VXUD 1KXQA 4WEBL 4DN4H 1L0PA 5A2BA 5F44A 4JREB 4OJDH 1PLGL 3ZU8A 5KSUA 2IPTL 2IBZY 2CGYA 1FZMA 4Z0BL 3C5JB 4M7JL 5DMKA 5IROC 4ZFQA 1FH2A 4C56A 2P4AB 2QHLA 4FLQA 4R0LC 1HIML 2RJMA 4L1LA 4AG4H 4F3FA 3H9HA 1OAQH 2YXMA 4WZ9A 1UGNA 2Z7ZA 4DP4X 3B1TA 3ESUF 3MCKB 2G2RB 5GISL 2JKJA 5EO9B 5DEJA 2W91A 1FE8H 4N2NA 2I07A 1YMHA 3GBEA 3I9AA 2WCGA 3WI9A 2PW1B 3L48A 4FTVD 3DRTB 5LQBH 4KKCC 3ZY7A 5IQ9B 4NDMB 4FNPA 1GL4B 5E1GA 1V10A 5EMYA 3HKFA 4NQCA 1SLVA 1SXSA 4AVKA 3RIAF 1RAMA 3QIWC 1J87A 1JPGB 2YRBA 4JFUA 1W72L 4UQIM 2CLZB 4JPQA 4UT9A 1YEEL 3GK8H 1BD2A 3FYIB 1D9KB 3BP6B 4CVUA 2Z4QA 4Y4HB 2VM9A 1QHOA 2IH1A 3B9KA 4TTGA 4RISL 4N90D 2QSCH 1D5BB 3HBZA 1RPKA 1U8KA 4I5BA 3CQPA 3LV3A 2FNBA 3VFUB 2XHNA 1FNAA 5C1MB 2NY1B 3CUPA 3APMA 3SE4C 3FONB 1SF3A 5IQOA 1WFMA 4E36A 3OKNA 1PTZA 3MRHA 4JM4L 1OTTC 5E8EA 4CJ0A 1FFTB 3TJEH 1AHWC 2OXHA 1AKJB 4YHOL 1CBVL 1HHJA 1S9XB 2H6PA 5I15H 5IB3A 2HFGL 2XXGA 4DQOL 1TZGL 1V7MH 4L0PB 4H8WC 4MAYC 4MZRA 1S4IA 3PXHA 3SO5A 1KJMB 4PJHE 1SBBA 5E23A 3BVVA 3RPIA 3FZUC 3GI9H 2VT0A 4G8FB 1NPNA 3V8CA 1F11A 3V6FB 2OJ1A 5CSBA 4EI5C 3H3BC 3JTTB 5GGTA 1X44A 2C5DC 3ECQA 2P7TB 4GAYA 2VJXA 5EU5B 3VXSB 4OIBA 4GNKB 3TP4A 5BS0E 4FADA 1KBBA 1MLBA 4LNRB 3HAEG 4ZX4A 2XPZA 2FZ3A 2PWHA 4H5SA 3TNMB 2YGOA 4OZHA 2FEEI 2QADD 3GSWB 3TT3H 4TOYL 4C4UA 4FLSA 3O0RH 1DQMH 2ZUYA 5E8DL 4RWHA 4UQ3A 2Y06L 3L1GA 3SBQA 4LLQB 5C0CE 4EN3A 3K4ZA 3Q6GH 4Y9GA 4PYGA 5DMJB 4LDEB 4DP2X 3CFBA 4M7LL 3ULUL 1ZLUH 4GBXB 3SYOA 5FA4A 3BP4A 5JO5A 3H0TB 3C75A 3CPUA 5HHOD 4PJAE 2O6PA 2J44A 1F1GA 3TVMD 1BFVL 4MJIB 2FT6A 2ZE0A 3LIZL 4AJ0A 5AW4B 4G2AA 5L4JA 1Z5YD 1JFHA 1TQCC 4FFWD 3SGKA 5C0RL 4XCYA 2EYRB 2CE6A 3RKPA 3R18A 1G9HA 3T6XA 1FCCA 3VQ1C 1ZLSL 1C12B 3F04A 3CD4A 5HTSA 3NIDB 2R69A 5C9JB 4KVPA 4I77L 4TVPL 1XX9C 1H5BB 1WZAA 4PD4J 2VOTA 4UANA 2NOYA 3CLEH 4WKXA 2OMTA 2PCPB 2YD6A 4FI7A 4PM1A 5HHOE 4APQB 1F6LL 3AQDA 3CXFA 1YPZE 1QSEA 4Y2LA 1JF1B 3M45A 4PJXE 4MNQA 3WFEL 3ELQA 3IJ9A 5EB9A 1TITA 4FNRA 2L7JA 2AXGA 1UB6A 4U6HA 5D96B 4FFVC 3WELA 4PRAB 5EZOL 5F7WC 1KCSL 3A21A 4DFHA 4XXWC 4EO5A 4OIIL 4PR5B 3WLBA 4JL1A 3MJ8A 4D8OA 1WFOA 1P7KB 3H7BB 1EQWA 5KJRH 4W6WB 4XWOC 4GS7C 1N8ZA 2FX9H 1WT5C 1HOEA 5A2LH 3VSQA 3V5KA 3CZLA 4P4KA 5F7KC 1MIML 3JWOC 2VXSL 4LARH 4W68A 1IGFH 2BWQA 3VUAA 1MFNA 3CFEA 3IEAA 4HIXH 4OLWL 5CUSL 1MHCA 2P80A 2XWJA 1E5CA 5FW7A 2V2TA 3V0EA 5T1KD 1OSPL 2Y36H 5D2LA 5JHAA 2DQJH 4GMTH 2E47A 4H25B 3X1GA 1DJSA 2BERA 2Q2EB 3O9WD 4YSSA 1K5NB 1FL5A 2DBLL 5AZEH 5C08D 3RTLA 3BAIA 5D96C 1OGPA 1S46A 4GSDH 4JZJC 3LPFA 5E8OB 1OTSC 1KXQE 1I82A 1AYRA 1AR1D 5CMAB 4NQSB 3JTBA 4RFEA 2Y1ZA 1OW0A 4N9GA 3VRJA 5IOPB 1OSZA 2IAMB 3VDCA 2BOLA 1KLFB 3CX5J 4U1MA 2ZCHH 4RMTA 2WBWB 1R5VB 3BKJL 3OKYA 4ABVA 5D55A 1OOAA 4GKLA 1HH6A 4O2FB 5TDOA 4M03A 4EZKA 5JPMA 3GS7A 3IJ7A 4F9PC 4Z3JA 1AQKH 3QHFH 1BYOA 3DX8A 2H1PH 3ARQA 4QRPE 3PL6C 4HX1A 1OF2A 3LQAH 2KZ1B 2CO7A 2X10A 5DD0L 1JHTA 1HFUA 2ZOWA 3HZVB 1GGCH 3OXSB 1MEXH 1KXVC 5IIEB 3KCPA 2SEBA 1RI8A 3K8MA 1JGDA 2YARA 1T1WA 3K2UL 4XCCH 5DWPA 5FX3A 3PWJB 4N6RB 2C1OB 3M88A 2LABA 5GJSL 1YECL 4PJ9A 3MX0A 2E46A 3VVVA 3T71A 4PJEE 3HG1B 2GEEA 5TQ2H 2P3YA 1MFAL 3C5ZC 2OA9A 5KVEL 8FABA 5JPMB 2JB6A 4FQLL 3RWCB 4DFIA 1U2CA 4W9HC 4PJ8C 5E6IA 3IJ8A 3OJMB 3B2UC 5AUMB 5KVMC 4DGVH 1BVNT 2RHEA 4HK0A 4NQSA 5AB0A 1KNOA 3PL6A 2DL2A 2VQ1B 1PLGH 1ZDSA 1ZK5A 4G7YL 3U0WH 4IHBA 3C6LB 5J1AB 3MBWA 3TT1H 2HLAA 4GUPB 3JVGA 3QJFA 5DEGB 3BZFB 3MNZB 3S4SA 1WE5A 2UZXA 4Y4KA 3FU7B 5F2FA 1E8XA 5ILTL 5D2LB 3NCJL 2OSYA 4NQEA 1HDMA 2MRYA 2XTSA 2OI9C 3HE6B 4HC1A 1RZFL 3Q8AA 4LBEB 1EMTH 4IKKA 3CFKB 3VSVA 3IDNA 4X7CC 4KUCD 4NB7A 1QG3A 5J4MA 1OZTG 2P26A 5CO1A 1W0VA 3RTQA 4I8DA 4K94L 1WPCA 4XC1L 4PTTB 3L17A 3TN0C 1WS7A 2XWBB 4YXLL 5LGKA 1JAEA 2J8UA 2XVBA 1P5UA 3P4NB 2EE6A 4B27A 2XSKA 3NYKA 2ZXGA 3REVB 4J12A 2A74A 3EFDL 2QZ5A 2HRLA 2QPEB 3KWWB 4WUUB 1F3DJ 2CBTA 3NCYP 4HS8L 1W8NA 3DPBB 4N2OA 3WNPA 1UWGH 1AOHA 1WEJH 1YNTB 4JFYA 4NNXA 4TUOA 3VRJB 2FLRT 4P99A 3FU5A 3FQ1A 4MNQB 4AVJA 4LEEA 5ACZA 4Y5YB 1KYFA 1I9JL 1J1PL 3BUYB 3UZQB 1ZY9A 1Y1UA 1F4YH 2WBJA 2DQTH 2IDCA 4YWGL 4DP9X 5KS9A 4HKZB 2VIRB 3G6JB 1JWUA 4FLRA 1Q94A 4LLMA 4U1HB 5ANHA 3V2AR 2L04A 5CEYA 4PRHD 3NN8A 3G5YA 3LEYL 3NQIA 4YHLL 4BE6A 1HI6B 1KYOK 3QDJE 3DYMA 1E8WA 2F53A 5J3HD 1NOLA 4KDTA 2J3SA 4X6EB 2F5AL 1HXYB 5EUOA 2CBOA 2ED9A 5C70A 3ZTDC 1UZGA 1R5WA 2XT1B 5KVGL 4I9WE 1SXAA 1FFOB 5I74B 4X98B 4MB3A 1K4CB 2YSSA 2VDQB 4NUGH 4R7DA 4RA3A 5J13C 1HHIA 3N41F 2VAJA 1XL4A 4N8CH 1HH9A 4K3JL 3QXVA 3KPPB 3ZL4L 1J9TA 4JRXB 1A1MB 2UZYA 3TCLB 4ZAKA 2VR6A 1E30A 3EGDB 4D0CA 2OMNA 1I1YA 3CBJB 4PWGA 2FHFA 4WWOA 3PIQA 5I24A 1UQSB 3I9IA 2ID5A 1BVLA 1AD9B 2RMNA 3MLVH 2NY3C 3LNDA 5AVTB 1E4HA 1ZEAL 5LN8A 3ZT7A 3LIZA 2E7LA 4HFUL 3BKMH 4C54A 4KITB 1UA6L 3ARXA 4DJMA 5AAPA 1QFUH 4I9WD 2YUVA 3ZE0F 5HSFA 2DJSA 3CH1A 1TXKA 4XN9A 4XPGH 5DJ0B 4ZAKD 1BXUA 1MFEH 3MOAL 1FLRH 2WZ5A 3MLYL 2P7TA 4GAYB 4YX2L 3NTCH 5TJWK 3KVDD 4M4RB 1QSFA 4OTXL 2AW2A 3V6FA 1K5WA 4LGPB 4OZGF 2VXVL 1S7XB 3V0WL 3QFDA 2UUDH 3QBTB 4RGOH 1DN0A 1WQVT 5CCKH 1S3RA 3HOGA 3LNHA 2FAUA 3WEAA 1JD7A 2WOYA 4PJIE 2OK0H 2F19L 2OYMA 1IVTA 5FYLH 4YIQB 1XIWA 4BH7B 3GS4A 3HG1D 3NACH 3PQYD 4PJ9C 4F33A 1NAMA 2ATPB 3GMLB 3OKNB 5D4JA 3VMPA 3MRQB 1NC2A 4I77H 1ZEAH 4OGXL 1ICTA 3KWXA 4GKNB 4G8GD 5HGHB 1OWRM 2QR0B 3CFJA 4N3TA 3WENA 2XPGA 4MAYA 1HX0A 3VFWA 1OAXH 1SQMA 2F08A 3RGHA 2LTQB 4PLOB 5L2KD 4MKMA 5DVPA 5KVFE 4F9PA 5E2TL 4BK5A 1A0QH 4RMSA 5D8JH 5C0BB 3EYSL 4ZW7A 4NJ9H 2GB2A 2A77L 2YLKA 3ALXA 1AIFA 5KVGH 3G6AA 5IZ7A 2FLBT 3OZ9L 1YSOA 4NQCB 1HL9A 1IU1A 4HKBA 5C07A 3QRFM 4WHYH 1QHQA 3MNDA 5FO9A 2BHYA 3C8KB 1A6UH 1JGEB 4EJ1C 3BO8B 4XNZB 5D9SB 4OD1H 5JIMA 2AK1H 3PNRB 4KAQH 4OFIA 2JJTA 4KY2A 3H54A 4JZJA 1EUTA 4TOYH 3VCLA 4DOHB 4JPIB 4BFNA 2P5EA 1NH6A 4C56B 3FQWB 4Q6IC 3SB3A 3MNVB 4YC2B 1LK3L 4K7PH 2VR4A 3WFCL 2UUDK 1JV5B 1MN4A 2AAAA 1XGYL 4H88L 4NWTL 4WHTB 4KC3B 5J6HB 3QARA 3NJJA 3EUUA 3QR0A 2YLHA 2VJ8A 3BFWA 4KO7A 5IESH 3BQVA 1MHHA 5CXPA 3WXWL 4KTEH 4UWQB 2XWCA 5EUKB 1OM3H 4JG0H 4MS6A 1VESA 4EI0A 3Q2LA 2ZJSL 2DMHA 2JJUA 3UP6A 4KJYA 4YXKL 5KN5A 1OCWH 4PJEF 1PG7H 4Q8BA 2X4UB 1QPKA 3P02A 1KB5L 1CXHA 4XPHH 3RGVC 5MEOA 2B7DT 4D9QE 4AH2B 3BGMA 1CTOA 5G5DA 3OKLB 4I3RH 5DT1H 1SRDA 2IOMA 3T0EA 2Y23A 4TSAH 2RD0A 4BZ2A 3RWHB 4GI9A 4O58H 1RIVH 1OIOA 4PP2B 3KBHE 3BZ4B 3FPXA 2NMSA 1A9BA 4UOW0 3DETC 4XX5A 2DW5A 1A7QL 1H3TA 1LP9A 3IWUA 2VDRL 3I2CH 5K5YA 1M6UA 1F13A 3LKQA 3N42F 3CXHJ 2WWNA 3T2OA 4HGWA 2Z8WC 3O0RL 4Z7OE 2ODHA 4DEPC 2YGNA 3TH3T 1I7ZA 3CPLA 4X6DB 1U8JA 3Q2CA 1KPRB 1X5HA 3SPJA 3RY6A 5D7LB 1HSBB 3CCHA 3R8QA 1GPOH 2OP4L 3MJ9A 1GYCA 2FECI 4KRPC 3E3QE 1XEUA 4OLVL 1ETZB 4Z3IA 2UWEE 5K9JH 3UAFA 2NR6C 3AUVA 2F9BT 3PWPD 2J4WH 4QHNB 4X99B 1SJEA 5HD8C 1AANA 1RQ5A 4UT6A 2WXOA 5FM4A 3MA9L 2UY6A 2VC2L 1EFXB 3VXOA 5I5MA 1C08A 4L8SB 3TL5A 3GXPA 1EAPB 2X2UA 4K7PY 4HF5H 2FK9A 2CCWA 1PNDA 2YC1B 2CUHA 4MLSA 3IN2A 1TZGH 4YOKA 4A66A 1GH7A 5K59F 3S88L 5AAWA 1M2VB 1YN7B 4NO0A 3S37X 1U8NB 4R8WH 5DD1H 1IGMH 4RMUA 3UG5A 3RU8H 3H42H 4WTQA 2EINB 5HDQH 3WO4C 1ZT7A 3DX7B 4YAQB 1YVLA 4BXVA 2CK0H 5IWLC 3MHZA 3PGCB 1BFOA 1DJXA 4CU7A 2NY2D 1GJWA 2WP3O 4WWNA 4KRPB 5E2WH 4CU6A 2BSSB 3FO9B 3D18A 4G6FD 5CN1A 4NJAL 1CLYL 4QHNA 4F9LA 4MA3A 3RY4A 5GZOA 5DSCB 4AK2A 3PJNA 2OBGA 1GMIA 3IMTA 2FR4B 2BY0A 5I0XA 3ARRA 4ANKA 3HE7A 4G8GB 5FDWA 3AW5A 1KPRA 1MZZA 2CPUA 2WBJD 3N1MC 4W9ZA 4XP4H 5EEWA 4PJAA 4NRYA 3C9NA 5D2NE 5JHDB 3BSZA 1T0OA 3CFDB 5DMYA 1U42A 1X9LA 2Y7OA 3DO3A 4LPXA 3FF7A 1A4JA 4OV6F 1I1RA 1NCDL 5IBLD 4Z3TA 4IDLA 4AUYA 3K6SA 4FXTA 1WAEA 5F7HA 6FABL 4FNTA 2EC9U 1VPOL 3W0WD 1INEH 5F7AA 1O5PA 5ADPH 5J6GB 2CD0A 4JHUA 4NPJA 3SOBH 1J8HA 5TPWL 4JM2C 3UGUA 1IL1A 1NGPL 5D7HA 4XO4A 4D0DB 1UWGL 3QDMA 1A7NH 2GITA 2IADA 3FT2A 3UZVB 2FVNA 2RB8A 2H3KA 4AZUA 3BUDA 1UKSA 1CE1H 1K6QH 4QY8A 5KG9A 1E28A 2BFGA 4X5XA 1UUSA 3QT2A 5T1KA 2HG0A 2FBRA 2CJSA 4X50A 2VH5L 2B1AH 4KRMB 3QZOA 1JZ4A 3LB6C 4NWUL 1NBZA 2AEPL 5EBWA 1FL3B 5LAXB 1ZXKA 3BH8B 2YKKA 1T1XB 4YHYC 3O11A 3EHBB 1N10A 2CDFB 3UTTA 5J6HA 1R75A 2ZUQC 2WB1A 3IF1A 3QORB 4WWKB 2VXTH 2RFXB 2O1AA 3CFCH 1GIGH 4KNQA 4EDXB 4FJ6A 1AXIB 1KGWA 5CKAA 1OB1B 4EIBA 1K2DA 2AJXH 4NNPL 3RVVD 3NTCL 2EIKB 2OK0L 1AGEA 5J12B 4O2CB 3EW3B 4KO6A 2VABB 4I1PA 3UTPE 1JIBA 4KMTL 4U2YA 5AAMA 3I02A 4LIQE 5EG6C 2HH0H 2D9CA 3S35X 3T2NH 3EJZD 1BG9A 3L9BA 2VAAB 4Y19B 1UA6H 4LPYA 1GGUA 4PY8J 3RDTA 1CG9A 3LN5A 1SOXA 1RUAL 2AXJA 1QLEH 1JNNH 3IFPA 4XPGL 4X7TA 1NGWA 1BIIB 4AEIH 1EGJL 3KWUA 3IMVA 1UZ6F 5I8EA 3OKOB 4FXLA 3MLSH 5MENE 4URTB 3O2DL 5GGSA 1EJFA 2QVFB 1BZ9B 2XPGB 4PWHA 1AGFB 3VFWB 5C0NC 1JZDC 5H4ZA 5ENWB 4PGDB 4K3DH 4W9KC 3WS6C 3MUUA 3HIZA 3MLZH 1NLBH 5C97A 2XWTB 4OLUL 4S2SA 4TL4A 3U48A 3SDDD 2R2EA 1FWXA 2UYLB 2AERT 1ZKAA 3WFBH 5I16B 3GMLA 3TN0D 1P6WA 3OSKA 4YHPB 2ICWI 1WWCA 4UUJA 4ODTH 1MI5B 4XWOD 4Q56A 1T83C 1G7LA 5DD5H 4PG2C 1IX2A 4E41D 3AJ7A 3ARYA 4NRZA 2FGZA 1B3IA 1GAFH 2EDRA 2XACC 4NUGL 3BYTA 2ROXA 1LGVA 3DOSA 4M5YL 1L0YA 4LDCA 4YBLC 3DC0A 3VDBA 1G1OA 2QT6A 4OM1L 1U8PA 4JFQB 1MCPL 1HKLL 1VA9A 4LASH 4B5EA 3Q6FA 1CICA 5TTRA 4DQOH 3KCWA 4HCRA 3K46A 5EU6D 1X9UA 2JIXB 2N3JA 3QJSB 4EUPG 4I0PB 4MA1B 4AXWB 1RVFL 3PP3K 5F1IB 1JZ8A 3AM8A 3GNMH 4XVJH 4F20A 2OR7A 2EIZA 3EFDH 1FJ1A 1MF2L 4AYID 3GSVB 4PJIF 5B1KA 3HN3A 4I48B 2XWRA 1FI8C 1YJDH 32C2B 3O3EB 4JFOA 1DLHA 2IWKA 5F9OL 3I6SA 3H9ZA 5HGDB 2FX7L 3KGSA 4WI4A 4QF1B 1QYGH 1W0WB 2BNUA 3WFCH 4R4BA 3BCFA 2WNGA 5FM5O 4W70A 5B1JA 2X4RA 5FHBL 3ZKQD 3OL2A 4LVHB 2EC9T 3CZSA 1NC2D 5BO1L 4M6OH 1A7BA 1DZ0A 2AZUA 4N0UE 2P44B 3ZUNC 2H45A 2IALB 4NS0A 2DQDH 2NUPB 2VLLB 2WJ7A 3PWPA 5DJ6A 3KXFB 5EU6B 2W60B 1PX8A 4X7SH 2VDRH 4Z76A 1GYUA 4XB3A 2VDKH 5TE6H 4LGRB 5IFAH 1T21B 3JTSB 1T21A 3P0YL 2NY0D 3D33A 5GS2H 4ZX5A 4Z76B 1KBWA 4GQPH 4C4KO 5GZNA 1DEDA 2PNDA 2WVUA 4WUKL 3ULSB 4AOFA 4MQ7B 2CUIA 3MKGA 2KPWA 1OAKH 3QFJD 4IKNA 3TPUB 3UTZB 3W0WE 4DGVL 4TSAL 5FM5M 3FFDB 4A2MA 4F15B 2FO1A 1MCJA 4MD5B 4OZIE 2WLJA 5ICXB 4NZRL 4ZMNA 1PLAA 4P23A 2AQRA 4BV1A 3N50A 4HPYH 4OCWH 2R23A 4FQ2L 4X9BA 4ZFFA 4JRLA 4ELMB 3TS8A 2AQ2A 3HI5H 4P5TB 3DPBA 4QHUB 1DQKA 1S9YA 2JMRA 4NGHH 3WYRA 5FO8B 3KWWA 1UH2A 4WUUA 5IMMB 4JFOB 4ZYKA 4B3VA 1IBHA 2AF2A 3E6HB 1I1FA 1DJYA 5H8DA 3FCTA 3PDOB 1GGBH 4FF9A 5L8JB 3HZMA 1HE7A 3QWOB 5CNHA 5BXFB 5JIQA 1P2CB 4IRSD 4K23H 5HVHB 1ZGLM 5GZNC 2VDPB 3IGFA 1YJDL 43C9A 2WKOA 3UYPA 4HK3J 3ZL2A 4KY1L 2KUTA 1VFBA 1C5CL 4YJZL 1UM6H 4A2EA 2VZ3A 5LCVL 4W4OC 1LK2A 2AI0L 4NENB 1GCYA 4LBEA 3P30L 2XYBA 4TTDC 4X0NA 5D6CB 5EU3B 3MRIA 3TONA 4BZ1L 2EIBA 1F2XK 2JKTM 2BNQD 2EDDA 1D5ZB 3MRFB 4JY6A 4UM8A 2NXZC 4U33A 1RK0B 1ZWIB 5FGBA 2J88L 4LLWB 1SMDA 2G5BA 2UZXB 4NKIH 5KJ4A 5B39B 2C4FT 4FNUA 2HLAB 4YDKL 2Q3ZA 5BJTA 4JFHE 3Q05A 3IU4L 2CO6B 4FL4C 4EMZA 3HC4H 4QYAA 3S8GB 1OTSD 4HFUH 1MDTA 1WAAE 2R2EB 2QV2A 2UYLA 2WWKO 4PJ5E 4HK0B 1DJWA 4YZFF 1IKNC 3G3LA 4S2SB 5HHXH 3HS0B 5E6IB 5I1AA 1MRCL 2A5UA 3DVGA 2Y7SA 3ENEA 5GGSB 2OM5A 1KDIA 3AFLA 4IGBA 3RHWF 5BZDA 5HVWA 3LIUA 4H26B 2YMXH 4PBXA 1L7TH 4ANXA 5D93B 4HPOH 8FABB 2XQBL 3AABA 3UZEA 4K9EH 5HYJD 3QEQB 4J6RL 2O5NA 4F1SA 3TESA 1BAFL 1IGFL 3PWUB 1H8NA 3BAYA 1MREH 4V2BA 5KSBE 3PWJA 3TVMB 3B9KD 4JM4H 3EDKA 2B8OT 4MJID 1K8DA 1JP5A 4H40A 4YC2C 4HU2A 5C0JB 5GS0H 1F00I 1XR8A 1BM3H 1CPUA 3HZVA 5ETUA 4AM0A 5AW3B 2V9UA 3V0WH 2PO6B 3DYPA 4FQIL 4P59L 4XZ4A 5CSGA 4PVMA 2KMWA 2ICCA 1WBXA 4S1DC 4UTBH 4L48A 2BVQB 4WW1B 2EO1A 4KNSA 3GF8A 1JK9A 1WA1X 1E2ZA 5T1MB 4WK4B 1IBFA 4DZ8B 4I1RA 1MFCH 1MW1A 1IAIM 3VB8A 5BZDB 3LS5L 3RL1A 3QUXD 3GSQB 4HS6A 4QTHA 3F7RA 4WEEA 4YZWA 4CVXB 1LMKA 2VRKA 1BYPA 5CJBA 1TZHB 3EGSB 1FRGL 3HS0A 5B38A 1U92B 2DRUA 1O6TA 4GO6B 1M1XB 3MOBH 3DSNA 1OT4A 3ULVH 5C0FA 1H3PH 5DC4B 4KKPA 1VZGA 5IK3A 4XAWL 2R9HD 4BYHA 1RIUL 2F5BL 4ZUTA 1M57B 1XGTB 5JXED 1OKEA 4M9OA 4ZD3L 1AOZA 1DBMH 1ZA6B 2A9ML 4YFEA 2JKXA 3P4MB 5EV7A 2G5BB 2A83A 2E9GA 4ZS6D 2G0LA 3TASA 1IGJB 2XOTA 4FFYH 3BJ91 3UZVA 2BFVL 1ZVHA 5GSRB 3N3EA 5IW3A 1EAQA 3QPQC 4PJCA 6CGTA 2I27N 3SCMA 3CFEB 3CFTA 5FYLD 1EHAA 3MV9D 1FH5L 1IEHA 1A8ZA 1VFBB 4L9LB 2OQJB 3L08A 1LD9A 4DEPB 3QULA 4H8PA 5C0RH 3O2DA 1A14H 2DS4A 2NX5D 2OJZH 2VXUL 3RVTD 1PFOA 4GSUA 5A7EA 4N68A 5ESQB 3WDJA 3QWOA 1KYAA 4L4TB 4C83A 2XZZA 1HAWA 2P8PB 2ATKB 1I1FB 5DC9B 4R7NA 3UJTL 4N2AA 4E9WA 2GEQA 4KI5F 2CGRH 2CNZA 4IRSC 5FDWB 1A22B 2NLJA 5K9JL 4E5XB 1NL0H 4QAWA 4Z95H 4AJVA 4FI6A 3WY3A 3NZ8B 3W81A 1MAMH 4RMRA 1RJYB 1SXBA 1RZJH 2JTYA 3OXRB 2K4AA 3V95A 1OSEA 2E7LC 3B9VA 3ME0A 4H8QA 4AUUA 3UADA 3GBML 4P2OC 4HEMA 4YHIB 3OKMA 4P57A 2DF3A 1YQVH 3T04D 1ZD6A 2ZYRA 4X7EC 4YAQA 4F91B 1GSMA 4PRNB 4RFNC 4ORZC 1XB6A 4JY5H 2WLNA 1YQ2A 3IU3B 2OMYA 5ESAB 4M4PA 3M6DA 4U3HA 3CDGA 4L4TD 4N0CC 4UINH 3MRCB 3IMWA 1AR2A 1T66C 2JJVA 5DZAA 3FH5A 1UKTA 1I53A 1TQCB 3CC5A 3KJ4B 4PRIB 2YUXA 3KXFA 1UWXK 4GRWH 4N0FB 5C0AB 5E00A 2QDVA 3VFRA 2CJTA 3SQRA 1FDLL 2UY6B 1T89C 1FAIH 4KDTC 3WTTA 1KCRH 4IRSA 4GRWB 1F4AA 3BC9A 4LASL 2J88H 2QV4A 2EH7L 5JOPD 2DM4A 2F54A 2W9DL 4GP8B 4YSTA 3VFSB 4NQXB 3GJFA 3GMRA 1OP4A 3INUH 2WVVA 2ZCLL 1KB3A 5EORH 3ZQWA 3F8UB 3L3GB 4U31A 5J9PA 1AKPA 4HU8A 4U4IA 2VR7A 3DX6B 3BKYH 3Q5OA 1A6VL 1CLZH 5I1EH 2R1WA 4QRRE 5ITFA 4B9JA 2H1XA 4NO0D 1UCBH 5DA0B 2J1XA 1NINA 3MREA 1TYJA 2CRYA 3IJEA 4LO9A 4UV4L 1OGAE 4YDVA 3ZKMD 1Q0YH 4GW5B 4JO5A 5D7JD 1A4KB 3IFNH 5IQMA 2F7RA 5I0VA 1MQKL 4L4JA 2O5ZH 3JTTA 1XH2A 1SY6A 2F1BA 4R5TA 3APNA 3T3MB 4OGQC 4PIBA 2RIKA 4PP2A 5DR5L 1G9MH 3V52H 1YYMH 2BH0A 3GHBL 4OM0H 1OB0A 2O6FA 5E6UB 3VFTB 4NKDA 3WNJA 3NCEB 3LVTA 4Y4FD 1ZE3H 4U1JB 4LBAA 3V0IA 1LHZA 2PN5A 1PVHA 4IDJL 2A77H 3EOAB 1YEHL 4BGLA 4IK6A 3BD5A 2OS7A 1MI5A 2ALWA 1CD1B 1KCSH 3AY4A 3VB9A 1E7UA 3Q8CA 4AI7A 2H1PL 1G87A 5DEZA 1YNLH 4WW2A 4NQDB 3N9GH 3DX3A 3JUYA 3RVUD 2YXWA 2MOGA 1BBJB 3D6GA 4QCIB 1R5IA 4FQXC 4Z5RA 1CYGA 5CD3B 3ERXA 4HXAL 2RCSH 4E9VA 3F7VB 5DUPL 3W38A 4JKLA 4LIQL 4IMKA 1FG2B 4G80B 1CF1A 5HDWA 1OARL 3FCGA 4IOIB 1J0JA 1WFNA 1QFWM 2BP0B 2CIIB 4P2QA 5C8JB 5CZVH 5I66B 4IJTA 5E6IC 3KR3H 2F7PA 5B3SB 3WIHH 2IG2H 1V3KA 3RWEB 3N06B 4PBDA 3SDAD 5ISZA 2D9QB 1DUYA 2HX9A 4IIQB 5JXAH 4JHAL 4G1EB 5D9SA 1RZGA 3SIKA 2JJSA 4PG2A 3QXWA 1F0LA 1V3JA 2MPAH 4FMFA 1Z9OA 2CNYA 5I1CH 4TYUA 3HI1B 1MJ8L 3DV4A 3H9HB 4XPBL 3K2KA 2JLLA 4YZFE 3QFGA 6FABH 4GIAA 4AYFA 1G6RA 2X6AA 4WU5A 2WN3A 3GNML 1D6EA 1Q9WB 3O4OC 4LAQL 3VI4F 4KBPA 2FX9L 2YJQA 1FHNA 2Z4TA 4D2NA 1I3UA 4JM2D 1ZS2A 1A7OH 2W92A 4GI6A 3EZJB 5AW2B 1M3IA 1FO0A 4ODUB 1MWAL 5HGHA 2B15A 1PCSA 4A2LA 5JPMC 3EH5B 2BP5M 2BVTA 3IFNL 1QI5A 3PDGA 3HZ3A 4PJ7F 4WV1A 4ZOCA 1ORSB 3DSFH 5LNGA 2DWYA 3DJTA 3QZWA 1E28B 2GJZA 3ARGC 2PP7A 1SNRA 4OKVA 3W39B 5IMMA 3P9LA 4WTWA 2JJTC 4MA8H 1FP5A 4BKLB 1T7XA 2R4SH 4BSJA 2VN4A 5CZVL 1F6FB 5HY9B 3BIAX 3QFDB 4JPWL 2CK2A 4HWEH 2ZX9A 5J6GA 3B7UX 1XFPA 3TWCH 4PJBF 1IV8A 3O4OB 4KI5C 4WGKA 5F3HB 3GSOB 5EC1A 1HNGA 4LEXH 5ABDE 5L2KA 5CZXC 2E4FA 4F7MB 1MCNA 1ERNA 1S5IH 3TIEB 2O61B 2WLIB 4G6JL 3KVPA 5L2JB 3NPSC 4G11A 3GZPA 2WUBL 1WZ1L 4E9RA 7PAZA 3BZEA 3C6LD 2O6EA 5L0QB 3EFFA 4NFBA 1G5AA 1CB4A 5SWZE 5G4NA 2AJZA 1MJ8H 2PPFA 3DX6A 3FOMA 3DJRA 3NBNA 2NY3D 3E0GA 4B6ZA 1JN6B 3AS0A 3QIWB 4NZTH 1T1YA 3FQUB 4JFEA 4Z7NF 1U8HB 2GJJA 5B8CB 2Y5TA 3H9SD 3KEDA 2XDHA 1BPLB 1GZQB 1I1YB 1G9ML 2HT2D 1E9PB 3FHQA 3DJZA 4FQJL 4JRXA 4NPYA 4MQTB 4N1HB 4ZPVB 2R1XB 3MFGB 4CSTA 4XOEA 3WMPA 5I1KH 4KKLC 2N4IA 3EH3B 1JF5A 2JQZA 1BHGA 3LHAA 2NTFB 1T7ZA 4YPGA 1E3XA 2KZWA 1R3LB 4X8CA 1FE8L 4JFFD 3NH7L 3KPSB 2R1YB 3Q44A 7FABL 1J8HD 3O6KL 2D4DA 2YC1A 3L3HB 3DSFL 1UXSA 2FQGA 5B1JC 2GBUA 4D8PA 1Q94B 4ES9A 3NCJH 4RFNB 3RIAK 3ZO9A 3NJGA 4NSKB 4DGIH 2ADIB 2IVFC 4NZUH 1OO2A 4O9HH 3KPNB 4HHAA 2D73A 1U8IA 2EEFA 4HUUB 1KGCD 3VXRD 4W1TA 5IVXE 1I7TB 4HLJA 2EDMA 3TJEL 4PGBB 4JFYB 4NNXB 2IAMD 2NY4C 3HUJA 3TJPA 1KN2L 3AG1B 4L3EA 4XPAL 1HSBA 1KCLA 5AYQA 2DKMA 3V52L 3JWOH 3VD7A 4D7PA 1U8LA 4I3RL 5IWLA 4XX1E 1MAJA 5D7IA 2UZPA 3BAEH 1MIEL 2BWDA 3VGHA 2EADA 2I69A 3IFOA 3LKQB 1NSNL 4PV1C 1ZLEA 2QQQA 5FECA 4TMPA 2UVFA 4LSVL 4Y16A 2AQSA 3G6DL 4FFZH 4LP5A 5ICUA 1JPTL 1IGTA 1RK1B 2CMRH 3CFKA 4GQZA 4XVSH 4R7LA 5LGYA 2ZICA 4C57C 2CR6A 4PJDB 4ZFGH 1ETB1 5TDPB 3RWHA 5CEZE 1CLOH 1HDMB 2ZP8A 4ZQTA 2J1ZA 4PPTA 3QJOA 2EXSA 1AZNA 1HZHL 4K5LA 1ML0A 4S1RL 5CAYB 5G5DB 1Z3RA 4PV9A 3UTQB 3RBSA 4P06A 2GK0A 2KDGA 3DGDA 3QJFB 5DEGA 1G4MA 1BVOA 2Y2WA 4FQPA 1H8LA 4DPBX 1N70A 1ZRUA 1WO2A 4ZMLA 3GRWL 5IJKC 2AK1L 1JGUL 1BJ1H 2DMKA 4G72B 5ABAA 2FO4B 1KN2H 3QDME 3S96A 4BFJA 4N86A 3DSNB 1ITBB 2Z31D 1JZIA 4OD2B 2DJ4A 3RIKA 5JMOC 3EGSA 2HAZA 1RURL 5TH2A 3T4AB 4DN4L 1U33A 1LO2L 1ITCA 5CEZD 2RAMA 5E2VH 4NI3A 2A7BA 3HAEB 1OXYA 1OLLA 2CPCA 5D1XA 2GC7C 3RX9A 1AI1H 4K94C 3FQWA 1N6QL 2IDQA 4MJ2A 1QBLH 5DI8B 1WBXB 5E8PB 1CD8A 4BQBA 1X5IA 3QFJE 1OV8A 3EO0A 4GOSA 4L1BA 3S0PA 5LDUA 2R4RH 2PO6A 1MQKH 2LTQC 4BA8A 1E4XH 4J3OH 2Z0UA 5C0JA 1FORL 1IM9B 2DEXX 3I3BA 1UCBL 4U3SB 5I26A 1J11A 3W9EB 2P52A 4UQ2A 3B7YA 4HKBB 5C07B 4RGOL 4AUJA 3NJHA 3IU4H 2CO7B 2IGFH 2XKSA 3BKYL 1C8QA 1UKQA 4OZGB 4WNSA 3QEQA 1IFHL 4OI7A 4PREA 1QZNA 3T1FB 1SF5A 2NYKA 1JXKA 3QUXC 1CBJA 3QI9D 3BUIA 3UP1A 3ISRA 5KJRL 5FW8A 1EDHA 3CDFA 5T3ZH 4IGBB 1R5VA 1BZ7B 1S7QB 2FBJL 4HKXB 4X8XA 4HUWA 5I8OL 2KZBA 2YPVA 3HMWL 2NY2B 3I9GH 2W0LA 2FH8A 4MDJA 4DKFH 3DX9B 1XZ0A 3S3CB 1R46A 4B9IA 3BDYH 3SE6A 5IJVA 1B0RB 4O58L 4LLVB 4EF3A 3M1BB 3WS3B 4LU5L 2PYFB 3B7SA 3H3PH 1NAMB 4HJ1A 2WYIA 1DSWA 2CXGA 1J5OL 1CI3M 1YNKL 2HN7A 2EXWC 4PRHB 2X3BA 4LLWA 1G9NH 4L9LC 2ZOUA 3BKCH 3IDGB 5F88B 5IQLA 3VFNA 2CO3A 4NWUH 3AADB 4X4XA 2HSIA 2JH2A 1V7NL 4MASA 3OX8B 4CN4A 4PVNA 5EBLA 5FYKH 2BNRB 1DQJA 4ZS7H 4NBZB 5IBTL 3NSYA 4QDGA 4JFFB 1UA7A 1IC5H 4Q2ZA 4M4RA 4MCYB 3RBGA 1D9KC 2FSDA 2QFRA 3CVDA 4N5EC 3JVFC 1JPFB 3P11L 5E6ZA 43C9B 1MCWM 4XC3H 4FLHA 4M00A 2I60H 4QHLA 5D7KD 1N8ZB 3KPQB 2BNRA 2AFNA 2B0SH 4LL4A 2DQUH 1EO8L 1BEYL 4BFEA 1NDMB 1P7KA 3UO8B 1PL3A 1SJHB 4YDMA 2A9AA 3L1FA 4KXAA 1RUML 2DWSA 1E5BA 3QJQB 1SZNA 2D3NA 3M17B 4PRAA 5IFAL 4AX3A 3UTPD 1Z5LB 3EYOA 2HTLD 4ABWA 3OF6D 1S7TB 2BRRL 3E8VA 2G9HB 4P2OB 3TFKD 1QSED 1A3ZA 3CLWA 1X7SA 4NCC1 3WIHA 1F2QA 1RMFL 3O6FC 4JRYB 4P9MH 3VWKD 1QFWI 5IV2B 2WGXA 4ZAKB 5FLUA 3LZPA 1KCUH 5TQ0L 5BO1H 5F9JB 1ZSDB 1D5XB 5D1XC 4HC1L 1HH9B 3HC3L 2FGWH 4UMGA 4UYPA 1DJGA 3QORD 4WWKD 5CSZB 2HJFB 4AEFA 3CVBA 5JHBA 1X7TA 5EN2B 1PKQE 1C12A 3VTAA 1JZ3A 1M53A 1ET8A 1JSYA 2CR3A 2PXYA 1A66A 1JTOA 3V9FA 2FJHB 1UYWH 2NTSP 1DBML 3WTSA 2X6VA 1FV1A 1AMXA 2ED6A 4ZNEA 3IDXH 4Z7AA 4PWFA 3B6SA 5INDB 3W5MA 2B08A 2EABA 1S3KL 2WXNA 1Z9PA 3BLKA 4MJ6B 3SDAA 3DUUB 4HKZA 3OGOE 1XXFC 5LGJB 4X6CF 3NSDA 1RK7A 1QLEB 4MJIA 4JNXA 3O3BB 2HFGH 3VRLE 2CAKA 2JXMA 4X6CE 4LIQH 5GS3A 1YZZA 5I1GH 4RGMC 3EO0B 5GS2D 2X4RB 4GBXA 3QI9C 3DVIA 4TUOB 2MJWA 2IMNA 4Y9FA 4ZTPL 1MHEA 3DMMA 5ITBL 3EO1B 4R3SB 1UJ3C 5DRXA 3S37L 2EKSB 1D6VL 1L9OA 1DO5A 1HHGA 4UV7H 5ILTH 4I3SL 2QJDA 4YDIH 2E4TA 2HA1A 2QADC 3FQRA 2VDPL 2NDGA 4M43H 3RPBA 4DEWA 1NMCB 2FSEA 2P5EE 2ADFH 4ACPA 2B2XL 4DP7X 3TT1L 2FDBP 3MOAH 4Q52A 1QA9A 1HAUA 3S96B 1EK3A 2BP8A 4K3EL 1TUPA 3K91A 3MRPA 4CILA 5AWNH 4Q4IA 1TTRA 5BZWA 3RL2B 1YY8A 1NLDL 4FQJH 3JQOB 4IRJD 3TA3D 5IEKA 4RWYL 3RUGE 1LEGA 1HXMA 3F12B 3LRLA 1VCAA 3P2TA 5I75C 5EBLB 1X4XA 1SYVA 1H15A 1TU2B 1MW3A 5TDPA 4B5ZA 4TRPH 5EOTB 4NRZB 4UAOC 4NZRH 3C09B 1NMBH 1MRCH 3ATBA 4H4NA 4ZQKA 2ERJC 4IRJC 3MBWB 2WAQA 1MCHA 2NYZA 2WUCH 1GYAA 2WZ6A 3EF7A 4OR1A 2MIZA 3MV8B 3CBKB 3MRHB 4D0BA 3SOTA 1J5HA 1XD1A 5I74C 1VSCA 5I16A 2DQCL 1KNOB 1KENL 1FNSH 3CHPA 3D39A 3LQMA 3N5AA 5KAQF 3ARGD 3L4YA 1CFQB 4LPUA 1W72A 2JNZA 4AIOA 5H2BA 4FKEA 3V5HB 2XTJE 2BDNH 4O02L 5TD4A 3OKOA 4LQ1A 4IIQC 3O6FA 3VXQB 4XNMA 1ZXQA 1BIIA 4HWEL 2YPVL 1UOVA 3M1CA 1EV2E 2I7SA 1C1EH 2DI8A 3CSGA 3GSXB 1AZZC 1WZMA 1VFUA 1CU4H 5ALBL 4KO9A 5GS0C 2ZUQB 4F2MA 3N6YA 3MX0B 4LCWE 1JPTH 4CRPA 3KH4A 1F90L 3UACA 1KGCE 4NDMA 1CE6B