3DTDA

Crystal structure of invasion associated protein b from bartonella henselae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
145
structure length
142
Chain Sequence
SLTETYGLWSINCGIQKVCFMHRQEVNDQNRVVVAMSVVLNADGVVSGNLTVPFGILVSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIALQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasion-associated protein B
publication title Crystal Structure of Invasion Associated Protein B from Bartonella Henselae.
rcsb
source organism Bartonella henselae
molecule tags Structural genomics, unknown function
total genus 31
structure length 142
sequence length 145
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06776 IalB Invasion associated locus B (IalB) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3dtdA00
3DTDA
chains in the Genus database with same CATH superfamily
3ARBA 4ZO9A 4NNXB 3NABL 4X4KA 1ZS8A 5CIPA 5DVLA 1LK2B 2OI9C 3BP5B 3EBHA 3P0VH 4Q74A 3RJOA 3PLYA 3JWNE 3KE0A 4NHUA 4J4PD 1AP2B 2H26A 1ROCA 4MCNA 2HUHA 4MBRA 2Y22A 2VRAA 3L6FB 3KGUA 4AQ8A 1NKGA 1VAHA 5F7LB 2JV6A 4OJCA 4UILH 3V6FA 4WW2F 3HB3D 3AM8C 3CDGB 1BD2A 2EXYC 3SDDA 3DUUA 1BG9A 5DGRA 7PAZA 1TTUA 4XI5C 3FN0L 4PQXA 1OXYA 1QW8A 3F5WA 3HZYB 4O2FA 4TUKH 3U2IA 5KVEH 1QWUA 3LQAH 3OL2A 4LVNB 4MJJA 5EUOF 2EILB 3U6XA 1ZD6A 5C8JA 4ILDA 3A4EA 1BMGA 2IJ0C 2GCYA 2PP8A 1A2YA 4FLHA 3GJFH 1EAPA 2W0PA 4U1JB 3US0A 3ZR6A 3NJJA 3QC5X 3V2AR 1IQDA 4XN2A 3UACA 5CEYB 4PG9B 5IF0B 3RNQA 4OKVB 1QFWM 1ZIAA 5K59F 4JFZH 2O5YL 5DVPA 3IVKB 1CFVL 2R2HA 2NX5E 4GG6E 2F9BT 5KSUA 1J9RA 3OPZH 5F9DC 3TIEB 4ODSL 4BZYA 4RGND 4GKOA 4K8RD 4XH2A 1BVNP 1BZ7B 1XWVA 3CSYA 2ADJB 4ZT1A 1UH4A 3AWFA 4AQOA 2PABA 2BY2A 5I6XC 4JCMA 1EEYB 4PRID 1U36A 3QPKA 2Q6WA 4YSPA 3FRUA 1JFHA 5D1QD 3GF8A 3HZVA 4IIQA 2PETA 5ADPL 5TH2A 5BO0D 3VXRB 4E68A 4K9EH 1XMWA 4PRAA 4XR8C 2X4TB 4YE0A 4F58L 5LGKA 5I6OA 3N5AA 4NOFA 5AUMB 4OZGA 5JUEL 2EXTA 2OL3H 3QWQB 1A25A 1SYVA 3MO1A 5JO5B 3MR9A 4OI7A 1VZHA 3ILQD 3P4MB 5LCVA 2V2WA 3P3YA 5D7JD 1T1ZB 2WO4A 3MRCB 1KB5A 4LO9A 5TQ2H 3EH5B 2WYZA 3TH4T 2F58L 3QG6A 1E4XI 5GQBA 3EGSA 2JLPA 3NZ8B 2BP0B 5B8CB 4YLQT 1E27A 4LGRB 1FNSL 4XXWC 3RTQB 3AXHA 1WSST 2X9ZA 1USZA 1AIFA 5B38A 4N5ED 5MERA 5F9OL 5J1AB 3W56A 4L3CA 4JAMB 1F5WA 3L5JA 5E1IA 3HG1E 3MGTB 3UPRA 3RFZC 2YMXL 2VDPH 4KJYA 4C4KT 4UQ3B 2NNCA 3WIHA 1LE5A 5F9WB 1OARH 1NC2D 3Q01A 5FM4A 4Y4FB 1SOSA 2R4SL 3WEMA 1YEDA 1IEAA 3ULUD 4LNRB 5I74B 4MZRA 2MNWA 1AGFB 3ARFB 1FPTL 2VC2L 1OY3B 1T4WA 3WBDA 3K6SB 2Z6FA 3GIVA 3BVTA 1JZ6A 1KIPB 1J48A 5GS2D 2ADIA 1GJIA 2IBZX 4DCQA 4LCWB 5LCVL 1TQBB 3NJVA 4NKQB 2FUQA 4ZXBA 2Z8RA 2NUPB 3AABA 4TLUA 3F7VB 3W2DH 1EEQA 3T4AB 1F90L 4JPIA 4BZ1A 3WMQA 3O0RH 3NN8B 3V4LA 5AVVB 5CN2A 1FGNH 2OBGA 5ALBL 2N7AA 2WB1A 2FWOA 3AMKA 3BH8A 5FK9A 3V0DA 4CMMA 4XBPA 1IUZA 3ARBC 3HG5A 3MA7A 1DEEA 1KCLA 4N6RA 5AOJA 1IAIL 1OAUH 2QHLA 1NL0L 1DQJA 4LOUD 1TKWA 4Z7UB 4H1LB 3WIHL 3DYPA 2YAHA 4K3DL 2BNRA 4Z6AT 3ABLB 5DWUH 1TVHB 5HDBF 3MUJA 3QSKB 5ERWA 4B41A 5BMFH 2IANB 1OCWL 1TXKA 1FC2D 1OGPA 3P9LA 5K9JL 1WQVT 3MODH 3VWJD 4EI6A 2VXSL 2ZG1A 3QDMB 1RIHH 4G6AD 3K2IA 5EOQH 3K6DA 5FV1L 1TQCC 2Z93A 3CFDB 5ECJE 4G43A 1ZXKA 3CPLA 2DRUA 3KH4A 5HYEA 1S78D 5E08L 4U4BA 4WEBH 5JIKA 4NZRH 4FA8A 1EHLH 1ASPA 1TNMA 3ARTA 2Q76A 4LLMA 2WHVA 3G5YA 4JDZA 1ND0A 1ZRUA 4HWNA 1QWHA 5JMOC 4IKKA 3BN9C 4HU2A 3DDFA 2ODIA 3UEQA 3TN0B 3LMJL 1SN5A 1BBDH 2ZX5A 3GI9L 3MREB 4HCFA 2BVYA 3TEZA 3KPQB 3D2UD 5AB0A 4KJWC 5I24A 2R4RH 3M07A 1QTSA 1FLRH 1P6WA 4PVNA 4R4BA 3BAEH 3V6ZB 1NDGA 4L1SA 4YGAB 2V5RA 2DQHH 1LMIA 5HVHC 2YXWA 4U6XB 1UT1A 3HC4H 1W0WA 4E9QA 5C7XH 2Y06H 2J1XA 3B2UD 3EFDH 4PWHA 1JWUA 3RWHA 2Z31A 1E4JA 4ZO6A 1HINL 4LGSB 3AB0B 5I75B 1BQRA 3GKWL 4RRPA 5E9DB 1NCGA 2L3BA 4FG4A 1TTGA 1K85A 1INQA 4BUQA 3KHQA 3RWDB 3EDDA 4ZMOA 1KY6A 2R2BA 4IU2B 5F6HI 2ZUQC 4N20A 1S7QB 2YGNA 1T7XA 4ATWA 5ES4B 1H3WM 1MCDA 3MLXH 2QQLL 4LOEA 2NX5B 4IRZA 5BS0A 2IG2L 5DI8B 4XZ4A 2JELH 4J7RA 1KY7A 2AJYL 3HS9A 2N59A 1FDLH 5T8IA 4JLRB 5T3XH 1OZTG 1N0LB 1RUQH 3WI9A 4BE6A 2WINA 4PJ5D 1V05A 1E7UA 4QXTB 5C0RL 3MBEC 4M4RA 2IPTL 3EGXB 4Y5XC 3O3AB 3ISRA 4N25A 4OD2A 3RVUC 4G42A 1X6LA 1A6VH 3KPSE 5LGJA 2VDLB 3FQRA 1EGJH 4KTDH 3PHQB 1PLCA 1CVRA 1FQ9C 4RMBA 3WTWA 3TYGL 1VCBC 4QDGA 4LOFA 2E9IA 3UZEA 4DKAA 2APTA 4MCZA 5BV7C 3DMMA 4HPYL 3VACA 2YGOA 4ZO7A 3ESVF 3WHE1 5JW4Q 1E7VA 3UTOA 2KT6A 5DRZB 1XTMA 2P8PB 4LSTH 5IEHB 1A6TB 2AQ3A 5CFHA 1W72L 1T4KB 1KCUL 4YDJA 2O5ZH 2YD7A 1CLOH 1CTOA 5CGTA 2BCMA 3J27A 4OQTA 3UYOD 4XNQA 4ANUA 2GT9A 2APFA 3BUYB 1XL4A 5LN4A 1KELL 4TQ8A 3MRIA 5KJ4A 1DANU 1DQVA 3IFLH 3KR3H 4EBQH 3N42B 3OAZH 2NDFA 3K46A 1CICC 4P5RA 1NIEA 4BJLA 3HG1B 3KD4A 4KI5F 3H85A 4AEFA 5IVXA 4JHZA 4WGVB 1JE6A 3H1ZA 1GOGA 4N8VA 4YFLI 4UANA 4QO1A 5C0BE 2CUIA 5DC2A 1T04A 4XOAA 1D5MA 4Z1PA 3T77A 3L3GB 2WXFA 4CU7A 3SDXF 1IJ9A 3I3EA 1EEUA 3VI4F 1MFEH 2NY3B 5BQ7A 5GSRB 2PCFA 1G6RA 4K9JA 4GINA 2OSLA 4GJTB 1T66D 2OMZA 3D9AL 4YVUA 3QR1A 2Y69B 3EDFA 2RCSL 2X89D 2F7PA 2JIXB 2KUTA 4GLRI 4IKJA 5KS9F 2ZUWA 4OQTL 1E50A 4HIJA 2ZWSA 4QXWA 2J2ZB 1RVFH 4WHTB 5JOPD 3KGTA 3TBCA 3ZR5A 2FX7H 3Q1SL 4JHAH 5J56B 4QKTA 1Y0LA 3FPXA 1RZ7L 4KKAD 2AXFB 3VNZA 3VFMB 3RGVD 4F92B 1MWAL 5GRWA 3LKQA 2YAQA 1OK8A 4YSRA 2XICA 3PWUB 3Q9PA 1AHWB 2E74C 5LNEA 5M94B 5C0IB 1EHKB 3UROR 5CGMA 3SBPA 5C0JA 1WICA 1HHHA 3DSFL 4R8WH 3T3PF 2BCKA 3D3VD 4C8XA 5BRPA 3MMEB 5EC1B 1IM9A 2DQCH 1AOZA 4HAGA 1NAMA 1JZ2A 1CL7L 2I5YL 3O0LA 3PWPA 2PO6C 3ARQA 3CFCH 1UXWB 5D7LA 2F8OA 4XCYA 1JPTH 1WG3A 3ZN6A 2I25N 3QXDB 5HHQA 3OB8A 1J8RA 4PRDA 3KYMB 4Q58C 3LVEA 4X9BA 2NW3B 4JVUA 4M48L 5F3FA 3KPNA 4HJJH 4K15A 5SWSE 5I8OH 1G6RL 2WW8A 4L37A 1GC1L 4QKXB 5E8PB 5EU6A 1IAKB 2OJEA 2CK2A 2MJWA 4GPVA 2YD5A 4YUEL 3RPIB 5H35A 2GQHA 5CR1A 2AQNA 1JTOA 2ZXBA 1J5HA 2HLFC 4UQ2B 1JV2B 3D12B 1BFOB 5HPMA 1UOKA 4TSCL 3UAJA 3FAWA 2Z3FA 3T1FB 3PQYE 3ZHKA 3QG7L 4I85A 1L6ZA 4WO4A 1P7QD 4C47A 1ONQA 1DSFL 4ZOAA 4MDJA 1DJHA 5JYMA 2QQQA 5EN2B 1E6JH 3GHEH 3JV6A 1NMBH 9CGTA 3LH2L 4IYKA 1B3IA 1NAML 3GB7A 3Q44A 5F6HJ 3TONA 3FRPB 2BP5M 3F58L 4Z76B 3BRGC 2UY7A 4PMEA 2OX5A 1J05A 4Y4KD 1D5ZB 1FWXA 2CPCA 3AS2A 3LRLA 4GT7A 3QHFH 3HHRB 4WV1A 5FHBL 2GUOB 3PP3H 1WYJA 4JRYE 2EIEA 4Q52A 3UGUA 4FFZA 5IOPA 4WWKA 1GPOL 3FBQA 3IJ8A 4ODXA 2OA9A 3CFNA 1HL8A 2VDML 4FFYH 3RL1A 3IRCA 4N2CA 1EJFA 3KJ4C 2BVEA 4P5SA 5AWNL 2WLLB 4DP9X 4BXVA 1CGXA 4TTDC 2LU3A 5L0QC 1S7TB 2CIIA 3NABH 3UABA 4GXFA 1XB6A 4HJUA 4HGMA 2B15A 2JXMA 4FNQA 1BFVH 1OGAA 3OKYA 2AERT 5L7XL 1N10A 5KVFE 3UIYA 3KPSB 2DS4A 2FR4B 1D7DA 2AQ1A 3VFWA 1ZTXE 2C9PA 3B56A 3OSKA 4HH9B 5TTRA 3UBHA 3FT4A 5F7KC 3ASNB 1O6SA 3W39A 2IAMC 4F3FB 2FVNA 1UH3A 4Z7WF 2XWDA 3E38A 2UZYA 3FN0H 4LP5A 1ADQA 5EU5A 2VL4A 3WEXB 5CUSH 4GKZA 4JO8A 4DVBB 4Z3EA 4KDTA 1YPZA 5F93C 3VXUB 4BQBA 2CUMA 3GNML 1PZAA 4R7NA 1E9OB 1EFXD 3GEWB 3O2DL 4P59L 1SNRA 4ZUVA 3RZCD 5IR1B 4KUZH 3P3RA 2JCCF 4LQ1A 1BFTA 4LGPB 4WHDA 3MCKB 1CFVH 2XA8L 3NK4A 4BWUA 2WZ0A 1H8NA 3UYPA 1FVDA 4NN7B 4M5SA 4ODSH 5JTWA 1G7LA 4AJ0A 1CGUA 2X2IA 2XY2A 3N40P 1QRND 2BOBB 1R5WA 3HI1B 4Q0XH 1KMGA 3BX7C 5C0BB 3BHBB 1ZDSA 2ZOTA 5C08E 2OI9B 2ALWA 3V5DB 5CEZL 4B27A 4QHUA 2H0JA 2LGNA 3K6OA 3ATAA 1TTCA 4YPGA 1R24A 4EZJA 3ZL1A 3RBSA 3HW7A 1XAUA 3ROOA 2VZTA 5ADPH 2VXTL 1YYML 5B1BB 1ADQL 4L23A 2HXAA 5IB5B 4GSXA 3W9DB 3WNNA 4F58H 2OMUB 5KVMC 5A6IA 2JTDA 2P43B 1URIA 3ZDYB 5F7DB 5JUEH 2CE6A 4K7FA 5HYSG 4TMPA 1JXKA 3DJ9A 3F7KA 3QZWA 1M3JA 3N0PB 4Z23A 3E9TA 4BFFA 5A7EA 3RWCB 4DP8X 1VIWA 4CC1A 2RAMA 4JO4L 2DMCA 5FYKE 2F58H 1NWOA 3MTRA 4TVPE 5BUGA 2OZNA 1AG0A 3LKSB 1FNSH 4HFUL 3VSVA 1M53A 2WMPA 4NIKB 2V9RA 4OZGE 1HZHL 4M8QA 5D6CB 5F9OH 3PFUA 1KN4L 4L1DA 5ANME 5EDSA 1V55B 1RJZA 1OAXL 4KO6A 1RZGB 3DBXA 3LNEA 4QHLB 3WJMA 1HEHC 3WO3B 4JKWA 4GFTB 4NFBA 5EZJB 2ESVA 1SFDA 3DO4A 4YO0A 2Z1KA 1UH2A 3MCLL 2R4SH 1S9YB 3NCYS 5D1ZI 3R4DA 5K69A 4CU8A 5KYUB 5I6XB 2DTSA 5SWSB 3VFSB 3LV3B 3EJPA 3A6CL 2VC2H 3D0LA 3PUUA 3HS0A 1E2VA 1I8KB 3QA3A 1AAJA 3A0OA 2BZ7A 5CGYD 3I6GA 4I1RA 5K1JA 4BCXA 3BVWA 3L9EA 4WV1C 4YDVA 2DEYX 2VDOH 2EE9A 1DSWA 4FKKA 3TOPA 4F8LA 1ZT7A 5T1JA 4JG1H 2G5RA 2AJUL 4YSCA 1TDQA 3GS4A 4RQQB 2EIBA 3Q5TA 4NBYB 3PQYB 2E7BA 1F90H 2WM0A 5IMLB 2BDNL 2WBJD 2YQ2A 3MRQA 1XT5A 2JI3A 3SBRA 5F7UA 1DZ0A 4BFJA 2LU4A 2GSIB 1AXSB 2F53D 2YWYA 3BWUC 1NL0H 2R23A 3LH9A 4K5MA 1A1OB 3PJSB 4FQXB 3WIHH 3PE9A 4XP1L 4M5YL 3ILDA 4K3DH 3F7LA 4GBXC 3M45A 4OTXL 3X1GA 4JN2A 1SDDA 1K3ZA 1LP9F 3QUMA 4WVRA 3RFZB 1OCWH 1T0NA 3AREB 4JRYB 2YGPA 4I77L 2L7UA 2LLNA 4PJIA 2DEXX 2VAAB 1W6WA 4Q6YA 4RRPM 4XCEB 1O9ZA 5K9JH 1ZY9A 2J55A 1ZT1B 5I8EA 1OQOA 3REWA 3VMNA 3EGDA 5C3IA 5AD0B 3EOBB 1WFIA 3BESR 3ETBF 3NSJA 3PL6C 3QJTB 5F1SA 5GRJL 1K6QL 4O2EB 2XWTA 4P2OA 4L0ZA 5E08H 2ZKMX 2EE3A 5T1LA 2BVPA 2WXRA 4PLOB 3ZT5A 3QO0B 1KJMA 3SKOA 2FSDA 3OV6A 4PP1C 2OMBA 1IL1B 4FC3E 2Q10A 6FABL 1ACYL 1OVZA 5DHVH 5TPWL 1EO5A 1B9KA 4UIKL 1RZJC 2UYLB 2OJZH 1F11A 2A38A 3MRPB 5C7ZA 4H8HA 3LMJH 1FZKA 1TTAA 2QGCA 3GI9H 4PJXF 3SOBL 1IJNA 4PBXA 4KWUA 3GXFA 5F1NB 5LKNA 4JJHA 5CBAB 4NO0A 4M5ZL 2MQ0A 5C0EB 4LL1A 5ACZA 4QTHA 5F88B 3ARBB 3WEAA 3ARXA 4AG4L 5CIPB 3FK3A 3ZIMA 3TXAA 5AZEL 2LFGA 3TLRA 2FQFA 2LHAA 4IOSA 4J8QA 2PXYC 4N85A 4I5BA 4YHKL 5MEQA 2QV2A 4LAJH 2KPWA 3KLKA 3F7RA 1Y6NR 1DJWA 1F1AA 2H26B 3GXIA 3JBG7 2PP7A 1HINH 4X6BA 4EAEA 4APQD 3GKWH 4Z5RA 2IC2A 2ED9A 4FNRA 1QFWI 4M6OH 1RERA 5ETUB 3V6FB 1A22B 4ZMPA 1BD2B 4GW4A 3DUUB 3OVUB 1MHEA 2WANA 4W9CC 2ZCKL 2IQ9L 5HGDB 2YK1L 2QQLH 3K8MA 4W9KC 3F5WB 1NCOA 2IG2H 4O2FB 4DESA 4JKPL 1QSED 3IRPX 5E4IA 1TQCB 1QFUL 2AJYH 5E6UB 1FHNA 1I1RA 4NJAL 2WZ6A 2DEWX 1QBAA 2GCYB 3KS0H 1AKJB 2Q9OA 3GZKA 1A2YB 2DQIH 1EAPB 5DS1A 3FT2A 5C08B 1NUDA 2YO3A 4MNQD 2IPTH 3H3PL 5IHUL 3C8KA 1PW3A 1S9XB 1IQDB 4N2EA 5J6SA 3B7SA 3RNQB 2KYIA 2EVHA 2VLME 4ZNEA 3O4LD 32C2A 1THAA 1HOCA 2YUVA 2ICWA 5BS0E 5DFVC 5KSUB 3TYGH 3DARA 3IK2A 3HMXL 4ZTPL 3SYOA 3T0ED 2O1AA 3HNVL 4HPYH 4XH2B 3C5XA 3CSYB 2DJ4A 2ZAHA 1VZGA 1KBPA 2D7OA 2VW6A 2WIIA 2VJXA 2ZT9C 5F0PB 5GGQL 4JFSA 5AAPA 1PF3A 2CMRL 1LMKA 1W72H 4P9HL 2NSMA 2AJZA 3FRUB 1GVIA 3TFKC 1KCUH 4KBPA 3EJYD 3HZVB 3L16A 1A1NA 4ZW5A 1KCKA 1IT9H 2CHWA 4IS6B 3GLDA 4QOKE 4IIQB 5E5UB 2BWIA 5FOJA 5K39A 5TH2B 3V6OC 1J9CT 3RIFF 5DO2C 4YSQA 2WVTA 2UZPA 1KELH 5EEXA 4U05A 4PRAB 3L45A 3NGBC 4AKOA 4UDUA 3VW3H 1NFIA 3BI9X 2G0LA 2M8XA 4OZGB 3VXMD 1SYVB 3MO1B 3X17A 3RWGA 3C60C 2ZP0T 2V2WB 3CXHK 3PABA 1SOXA 1KB5B 2Z7ZA 2TAAA 2FL5B 4AC2A 4DO6A 3BP7B 2B0SL 1KTRL 3QG6B 4TVUA 2HX8A 3EGSB 4BBWA 2H5UA 3KLDA 1FCGA 3MBEB 1E27B 9PCYA 3R8BB 4WUUD 2FLBT 5MERB 1FNLA 5EB9A 1KLGA 1EERB 3NJGA 4LHUA 3W81A 2ZOKB 3D9AH 5EEYA 1KTKE 1HXMA 4KJYB 3EFFA 4EPSA 3ELAT 2RCSH 4J3UA 2BHUA 4PJAE 1LE5B 4QJ3B 2J88H 1A6AB 3U1QA 1IIKA 1YLBB 4JFEA 3AG4B 1WT5A 1YEDB 4OQTH 1W8OA 5C2BL 3PU7A 4W9EC 4PJDE 5SX5K 4RBPH 3Q1SH 3DLQR 4MB5A 1DZBA 4A2MA 3SHSA 1JF1B 2CNZA 3GIVB 1JGVL 1MWAH 2ZQKA 5FW7A 5L4FA 4KC3B 3VU1A 1U8NA 3IWUA 3CXDL 4IRSD 3SPHA 2ADIB 4PGJA 4JDVA 1QSFD 1QVOA 4W70A 2IBZY 1YN6B 5GJTL 3DSFH 4CU6A 3D5OF 3H9ZA 4KTEL 1ZHKA 1S7SA 1UT9A 5DJ2B 3ECUA 1CL7H 2I5YH 3AG2B 4MWFA 1LO5A 4JPIB 2ZCHH 4ACPA 1SLUA 4PIBA 4NLAA 3G7TA 1OQXA 2ADFL 4JMXA 3MYJB 2CIKA 2ODHA 2X4NA 2QQNL 3E9UA 1QUNA 5BRZA 3BH8B 1MOEA 4CMMB 3GT6A 4XBPB 3EJZD 3HJEA 2OMTA 4M48H 4N6RB 2CO7A 2XTJD 1G6RH 4OJEH 3VFTA 5ANHA 1YNTF 2MQCA 1DQJB 1A4CA 4XAWL 5IK3A 3ZXAC 1TKWB 3L4TA 4P46C 3ULVD 1UM6L 1MCCA 2WN2A 1Z5HA 4YUEH 2VMEA 1WCBA 3PWPE 5AB2A 3HG3A 1B2WL 2MOVA 5D7LE 5ERWB 4NPKA 1T1YB 1UJ3A 1B0GA 1D6EB 3P9LB 4DO5A 5AVRB 2YD2A 3SGEH 5DLMH 4CVUA 3TCXA 1M71A 3QG7H 1J0IA 5FYJD 3QRFM 5D8JL 4EI6B 4KROC 1J0YA 3N04A 1DSFH 3UTTE 2WCGA 3UZVA 2Z93B 5EU6E 4G43B 3VG0L 1KPRA 5HVGB 2PR9A 3LH2H 5E8OB 4QRTB 5ADOL 3BH9A 4KVPA 1KTCA 1VPOL 4AV0A 4JN1L 3EOAA 2Q76B 3V4PA 3QPXL 1QLFA 1SVZA 4LLMB 3G5YB 1O7SA 4GW5A 1NLDL 3F58H 4JDZB 2VCOA 5F72S 3DTDA 1PVHA 4ZMWA 3NP3A 2OSYA 4FQHA 1B2YA 5I71B 5D4HA 5I1AA 3EJJX 5FHBH 3BQUA 3CMOL 3ZUNC 4AE1A 3LRKA 2XLLA 8PAZA 1DHKA 1GPOH 2CDEB 3H3KA 3WFDH 1NDGB 2VDMH 3OLGA 2R59A 4PCTA 1NBZB 1M56B 1VFBA 5CCKL 1GGBL 4NOBA 1EDQA 5HDQL 2FYYA 3ZBMA 3VVVA 3D85B 3SE4A 2G60L 5D1ZC 1XCQA 3QNFA 2X1OA 2DWYA 4N1HB 3PV7A 1U92A 2CDGA 2GC7C 5HGAA 3IMBA 5L7XH 2R2BB 1V3MA 4BFEA 4S1RL 1R3IL 2XN2A 2AXWA 4NPJA 4I13B 5BS0B 2EINB 1MPAL 4JR9L 1F02I 4XB7A 2EXWD 3RYMA 1OF2B 1G5AA 1S7XA 3BZ4A 4YC2C 5DMIL 3S3JA 1KLUA 4OFIA 1WFJA 4MXQD 2WINB 4WJ5A 2QADD 4C58B 3DHJA 3V0IA 4HK3N 5L9DL 5MENA 4OD2B 4GG8A 2A1WL 1S2EA 4G42B 5DVOA 4QXUL 3CDCA 2DAVA 5ESQA 3VGAC 1UWXK 1PD6A 3FQRB 3O2DH 4P59H 2OV0A 4K9EC 5C0ND 3VI3E 3U48A 2A5UA 2JNZA 4Y5YC 3D33A 2ZG2A 4X4MA 5IHZA 1SXZA 4MCZB 2AK4D 2B9BA 5IQ9A 1N6UA 1CFSB 2XA8H 5HD8C 2PYEA 3CZSA 3DX0A 4P5KB 4NT6A 1UQSA 2XIIA 3UBXI 1JPEA 3KJ4B 5JORA 4FA7B 2BP8A 4ZUTA 2A9ML 2P5WE 1YPZE 2V4LA 2FBJL 4YDJB 3FUKA 4JKLA 1GGIH 5F0MB 4ABQA 1TSRA 1FYTE 1QA9A 5CEZH 2GT9B 1R46A 4KVCL 3MRIB 4XOEA 3ZTCC 1NOFA 4LKXA 1N3NA 2VXTH 4G3YL 3TBYA 1YYMH 1ADQH 1J0HA 3WIIL 4F15C 5IVXB 3N41F 3M8OH 4OUUA 4EUPB 1HN1A 5G4OA 2MKLC 5HI5D 5EWIL 2NY5H 4WK4B 2PUQT 4BK5A 4GP5B 4N8VB 2N7BA 5IVZA 1UZ6F 1WCQA 5DJCA 3Q0HA 2YWZA 5BUPA 3E8VA 3N0AA 4QO1B 1G9NH 2Q87A 4Y2NA 3DSNA 3OKMA 5L2KD 1D5MB 4PJDB 3T77B 4G6FB 1J8HD 1LD9B 4N2FA 5EUOA 2OYPA 4JO4H 4B97A 4U3SB 4N2BA 5BQ7B 2QGEA 2RH0A 4MDRA 3MRDA 3NSFA 2VMFA 2I7SA 2PCFB 3QO1A 3O8XD 2OSLB 2OMZB 4HFUH 5IW1B 4HUVB 4WEEA 4QRSA 3SJVD 4XMKL 1KTLA 3QUXD 3S4SG 2OKMA 1BCIA 1CLVA 3WV0A 1OAXH 4HIJB 5ACMA 4B9CA 3KYAA 2X6VA 2AQQA 5B39B 1Y0LB 4XCFL 3ZO9A 1K8DB 2F18A 3MKKA 3FUHA 3M6DA 3LKQB 1ECYA 3GTTA 5DA4A 3A6CH 2C9VA 2VLLA 3AADB 3QCUL 5C0JB 4URTB 4O4YL 4BFRA 2YJLA 2BCKB 4HGWA 3CFEA 1IM9B 3GSNH 1NAMB 3QHZL 1T21A 3PWPB 5D7LB 4XCYB 1QI4A 3D0VA 2XG4A 2PWEA 4Y1AD 2AJUH 2ESVE 4QHMA 4QXVA 5HHQB 1RI8A 3DX7B 1RZ8B 3UCQA 4Z3TA 2ICCA 3IGLA 1ID2A 1RIVH 4QD2E 5AVZB 2EDRA 1BZQK 3KPNB 1FG2B 1P6FA 2BDNH 4JO3L 3ZK0A 4FADA 4Z8FL 5EZPA 4L37B 5BZDB 4X98B 1V8HA 5GRZA 4DQOL 4NHCH 5EU6B 4JREC 3VXOA 2OJEB 3FQUA 4XB3A 3WNLA 4L1LA 3SPVA 2EE6A 4KQ0A 2O61B 5A2AA 5HPMB 1MUJA 3O45B 4XP1H 2PTTA 1C8QA 5KG9A 4M5YH 5E4OA 3UBGA 1BF8A 5FO8A 3MLWH 1ONQB 2YXMA 5I9QC 4MDJB 1VADA 1RJCA 2NRDA 4I77H 3N40F 3TVMA 4XRCB 3H7BA 3JV6B 1ZKAA 4AGPA 2Q2EB 5AL8A 3RA7L 5JQIB 2FLMA 1K6QH 5FUZH 2J6EA 1T03H 2IQAB 4Y4HA 2EDLA 4IRJA 1ZA3A 2Y36L 1S7VB 2HSIA 2Z8VC 3KWVA 3U6XS 4J3OD 4HG4K 1J05B 2WOBA 5MEOB 2Y1AA 4TS6A 1B3JA 3AW5A 4JHVA 2MTPA 4HK0A 4MD5A 1P5VA 4WV1B 1NGXA 1ACYH 2WD0A 4KZDL 5TPWH 3UTPD 4PWIA 1AE6H 1AYRA 4UIKH 5CO1A 3IE9A 2WSKA 4PJIE 3PDDA 5E6SB 5IOPB 4WWKB 2GY7B 3EADA 4YDNA 5AVSB 2FNWA 2IDTA 4GQ9L 3SOBH 1S9VA 5DFWH 1V54B 3PP4L 2D7MA 1UD8A 2OQJB 3D4YA 2RA1A 4M5ZH 2XYCA 4H25A 1MZZA 1B0RA 5TD4A 2EEDA 1TUPA 2CIIB 4AG4H 5AOIA 4K3JL 2B59A 2VYRE 1ET5A 2JXMB 4R7LA 4XXDA 3H2PA 4YHYC 4GBXB 2HFEA 3ZMEA 4ZOBA 5B3NA 4MRCA 1M4KA 4AKPA 4L8DB 5I76A 3AY2A 3VFWB 2WYIA 4NUPA 4DFIA 3UH8A 1EAQA 1IARB 2C4XA 4OH2A 5DEJA 1QFPA 3O3EA 5DEGA 4WUKL 3VI3B 5FM5M 1O6SB 1BHGA 3W39B 4JM2D 4NRXA 2X10A 1AR1D 5E56A 2IQ9H 2YK1H 2UZYB 5I1JL 1IAII 4WU5B 3PL6B 3K74B 5IFHL 3NVQA 3R06A 4JKPH 4A2HA 1YJDH 1IM3A 2B20A 4GKZB 4K71C 3ABZA 2NYZA 2QLVB 2L7QA 2MQ3A 4NJAH 1YPZB 1ROWA 4YDLC 1HT6A 3P4NA 1EDYA 5ESAA 2XG5A 4R7NB 3BKYL 1J1OL 2VQTA 3H3PH 4I3RL 4ZUVB 5IHUH 3WXWH 2H32A 1ACZA 1JRHH 2RFXA 3I9GL 5IB1A 4AI7A 4J3WA 1IFHL 3EBGA 1EQWA 4NQUA 6TAAA 4XPFL 3H54A 3KWTA 5K9QI 5GGSA 3RUGF 3LPWA 2FECL 3B83A 3UYPB 4ZTPH 1FVDB 2VRKA 3HMXH 3HNVH 4MLIA 5LB1A 1SHWA 1XGRA 3AXLA 4H4NA 4PJHA 2HFTA 4TL4A 5SV4A 1R5WB 4D9RE 2QR0A 4APXA 5GGQH 3SD2A 2CMRH 4QHUB 4XVJL 2GEEA 4K5NA 1MCSA 2PXYB 4LCCC 1OCOB 1R24B 4PP2A 3F6IA 1YZZA 3ROOB 5C97A 2HFGL 3FCGA 4AUUA 5F1IA 2XKSA 5IROD 4TLTA 4YZWA 1WFMA 4I88A 3GDBA 4U3XA 4AWJC 5C0AE 3JZYA 1PDKA 3BRDA 5LGYA 1JZIA 4PWKA 1QNZL 4I3SL 1GMIA 4D0BB 4FE9A 4PREA 4K7FB 5I2IB 2YKLL 4IHOA 2IDUA 5E94A 3ZHDA 1NDMA 3O4OB 5C0FA 1KG0A 4PHXA 1CBVH 2N0KA 3DX6A 4BFKA 2IH8A 2B0SH 3O2WL 1MHPL 1Y18A 4QNPE 1S7UB 4JW3A 3ERXA 2XI9A 5FYJU 4XMVA 2GBAA 2XIBA 3WNIA 5HYJD 4PGDA 1HL4A 2WMPB 3C8DA 5L88L 1BJ1H 4OF3A 3GMOA 4M8QB 5KSVA 4HQQH 1RJZB 1WBYB 3DBXB 3WJMB 1TZAA 1R3HA 1VERA 3NJLA 2ESVB 4HHGA 1U8CA 5I66A 1JUFB 2BIOA 2HJKA 5DURB 2HRHA 5C2BH 4UTBA 2NY0C 5F7MC 4IEFB 3D39A 1IGTB 5DZOA 3D0LB 5DMJB 1LL1A 3K0WA 1JGVH 3QA3B 1GGUA 3K4DA 4XP4L 1J1PL 2H0EA 3LHAA 3I6GB 3QDJE 3CXDH 5EBMB 4L18A 3QW9A 2X42A 4JY5L 1WA2X 4YDVB 5GJTH 3EDJA 2V7NA 4DK6A 1PD0A 3NGBB 2ADGA 4I89A 4KTEH 4FDWA 1UUNA 2G75A 2IPUG 3RI5F 4U1SB 3HCVA 2ADFH 3DKHA 1CC3A 2A83A 4V11A 2QQNH 3OXSA 2OPCA 4XBEH 5ENWB 1HXYA 5HI4C 1GA2A 4R90L 3FCBA 2WUCL 2HT3D 4PLKD 1Q0EA 2R23B 4XAWH 3AG3B 2X2HA 3MBXL 4Y19D 1AS7A 4PV8A 2EQDA 3DX3A 2DI7A 4DN4L 3SDXA 4JN2B 1SDDB 1B2WH 2D31A 3HC0A 3QUMB 4PRIA 4WFGD 3VI4A 3W57A 3ZZLA 1FZJA 1T0NB 2XBZA 4HKBB 3FT3B 3US9A 5BRZE 5CHNB 1U4FA 4PJIB 2AK1L 1A9VA 3EF7A 4ZK8A 4PWEA 1P2CA 2Z0BA 5D8JH 3ZOAA 3EGDB 2HJFA 3IPEA 2E56A 3Q8AA 4KXAA 1ZGLM 2XWTB 3FQ2A 2G2NA 4P2OB 5KS9A 4RAVA 2DWEA 1E5YA 1CDHA 4BM7A 3VG0H 1PNCA 1NCNA 4EDWL 1U42A 4X7FC 3G9VA 3PCYA 5T1LB 5ADOH 5IWLA 2XOTA 5I1LA 3IPFA 1BZ9A 1KIRA 2CJ3A 1KJMB 2EYTA 2PTVA 1WGOA 3OR6A 2P49B 3PGFH 4JN1H 4ODVH 3SKOB 1NLDH 2XX0A 3P30L 1R4XA 3OMNB 1J8SA 1RUML 3S98A 2GJ6D 4N2LA 4AL8C 2EDYA 2AXJA 1FZKB 3KLLA 3CMOH 3SYPA 1TEYA 1ZV5A 3HE7D 4L8CA 2ARWA 3FB5A 1EAJA 4NO0B 3ZQWA 4YDIL 1HX0A 1VJSA 1K4DA 4OFDA 4QTHB 4DP1X 2G3ZA 4YR6B 5T5FA 3PDOA 7TAAA 1BVOA 2YRLA 1YMMA 2NY2D 1JDDA 4JZOB 2ADYA 3LY6A 1I1CA 3UBXG 5FEBA 5CCKH 1LXMA 5HDQH 1OTSD 2K6ZA 4I5BB 5MEQB 1WISA 1ZJBA 3L1EA 3RWIB 4EN3D 2G60H 2EIJB 3N06B 4Y2OA 2B14A 1NOLA 3NEOA 3PPEA 4X6BB 2ICEC 3HE6C 4G7SB 4JKKA 4UOJA 4XMUA 1CI3M 3VXQA 1X7TA 1XBDA 3CXFA 4FQCL 4EIBA 4Z5RB 4JFXA 1U30A 1VGKA 1RK0A 4S1RH 1R3IH 1UB5A 1X3DA 1E8XA 4F9PA 2VLJE 4GXUN 3FOLA 3S35X 1PFOA 2I07B 4AUJA 3VRLF 4AY0A 1MPAH 5FYJH 2GFBB 3TESA 2OCJA 4JFQB 4KQ4L 3K3QA 5DMIH 1ZPLA 4OFYD 3WU1A 4ANKA 5F0LB 2HCZX 2KZBA 3FT2B 4OZHE 4YZFE 3ILPB 5L9DH 3ISWA 3C8KB 2IBBA 4QXUH 4FZEH 4Y8AA 3SGKA 3SQOH 1E9PA 32C2B 4EI5A 1E8ZA 1HOCB 5H37H 2ICWB 2DLHA 4X5LA 5C0AB 4IKLA 1CIUA 4ELKA 1NEZB 4IBZA 5HDWA 4J4PC 4NCC1 4P99A 2DWSA 3ALWA 5D2LE 1NPJA 4CBZA 4ZFFB 4U31A 4OVUA 4DJMA 2WIIB 1WAAF 3HB3C 5EBLB 3PAZA 4JZJA 3CBKB 2AJZB 2ITEA 3QUKA 2FBJH 2Z91A 2A6JA 3U9UA 3E2HC 1A1NB 4TM9A 2VQ1B 2EJ1A 1P5UA 5K39B 3IDNB 4FL4B 4L29B 5I73C 4KVCH 2UWEA 2I9TA 4X4ME 3B1UA 3MV9D 4WNQB 4UDUB 4PVMA 3M46A 3NP4A 2FNBA 1NIDA 3S6CA 3Q9QA 4G3YH 4RMTA 2DDQH 1AD9A 2PYEE 5JA9A 3WIIH 3COOA 4RDQF 4FKHA 3DOSA 4NP9A 3RWGB 1A3RL 4NUMA 4ZMAT 1NINA 3T4YA 2J73A 1G7QB 5GGTA 5EWIH 3UJJL 1IX2A 1RFDL 3LKRA 3CZFB 4PJ6A 5ISZD 5DRWA 3A5VA 3D2UA 4EQ3A 1MELA 1HCFX 4K8RC 2KC0A 3FU6A 4V1DA 5TE7L 2EDEA 1GZPA 2FIKA 4WNSA 3NRPA 4ZUUA 5JPMC 3LB6D 4EO5A 4I7ZC 4LB8A 1BAWA 2HTLD 4XB8A 3VGAB 1KLGB 1SJHA 1P7KB 2PW2A 3QDJB 2V17L 4LHUB 4LCIL 2Q1EA 4XCCL 1HXMB 3A6BL 5D1QC 4Y5YB 2X3AA 3D48R 4XMKH 2E9WA 3OKKA 1GAFH 4HJSA 1O7DC 1P69B 2FQDA 2XN9E 3QRGL 4KK9D 4NAJA 2BIHA 2NZIA 3OKLA 4ZX5A 3KMDA 3U7WL 2HUEA 3GBNL 4YS4A 2UUDK 1KYUA 2F68X 3BUIA 1GZHA 4XCFH 2DIAA 1I7TB 5D7SL 3FF8A 4AH2A 5EEWA 4MMXC 2BC4A 3ILQC 1U8NB 1KGJA 4OU3A 5D7JC 3RIFK 1QVOB 3ZT7A 1H15A 3WNPA 4M62L 4O4YH 2XPYA 5GGTL 1SN2A 3IGUA 1T20A 2LT9A 3CC1A 5KVGE 4RSVA 1S7SB 3EZJB 3DO7A 4PJ5A 4PM1A 5D9SA 5C07A 3GEFA 3MJ8A 4MWFB 1LO5B 4DZBA 4F15B 1N8OE 1X5XA 4ANWA 5F9AC 4NNYA 2TSBA 3RKPA 2GK0A 3KNBA 2CIKB 2X4NB 2XETA 3RX7A 4XTRD 1QUNB 2DQTL 2IMMA 5BRZB 5JDSB 2YD8A 4NQVA 4HS6A 4JCWA 3WENA 2EUWA 2VR8A 2CO7B 2YA1A 4JO3H 4Z8FH 2AC0A 3VFTB 4OIAA 4UM8A 5GRUL 1TCRA 2IXQA 5IK3B 4QMEA 2WXHA 2VITB 3MLVH 2ZOUA 2DN7A 1L9RA 1KFGA 4O58L 1KTDA 1XIWD 1DJXA 2EYRA 4ZFZA 3ULUC 1WCBB 1HNGA 5IB3A 5CCHE 3QIBA 3TBTA 3WN5A 5GGUA 1B0GB 3FOMA 3RP1A 1WAEA 2QMJA 4PAZA 3BMVA 5ID0A 2W0FA 3S8WA 1UG9A 4F9PC 3DOIA 4KDVA 4HUNB 5D7IA 4CA4A 2P8MA 3GK8L 4ONHB 3Q2LA 4PRPE 3IGFA 4NC0B 1J18A 3UZVB 2NR6D 1GXEA 2F54E 3OLIA 4DEUA 2H3NA 1R3KA 1SXSA 5B38G 3ZGIA 1XEUA 3OKOB 3BH9B 4N1EA 3RA7H 4OVVA 3C6LD 3V4PB 3JTSB 2ZPKL 3BPLB 3T3ME 4CJ0A 1GYAA 1YYLL 1DCEA 2Y36H 4JG5A 3O6LH 4MAYD 4J2QA 4WTWA 1AYOA 5I1AB 1KACB 2MOQA 3SGKC 1AO7E 3BQUB 4KZDH 4LRIA 4CN1A 2K1MA 2XPGA 1L7IL 2YD6A 1NICA 1CD0A 1TOXA 4GQ9H 4C4BA 5K9QG 2HAZA 1YUHB 2VLJB 5CINL 4OFVA 2AFNA 4P2YA 3CVIL 1VFBB 3PP4H 4Z9KB 3S3CB 2CKBA 3FSWA 2FYYB 3VWJC 4U0QB 4MBOA 5F9JB 1ZE3H 3MA9H 4G6AC 4K3JH 4M1GL 1XCQB 4Q7DA 4OZHB 1U92B 5KAQG 2B08A 4RAUA 1M9WA 5HGAB 1S78C 4UV4L 1ZEAL 4O51A 4MXVF 1BZOA 5SWZD 5GZOA 1G1KA 1IB5A 2X2YA 1ZGLB 2ZUSA 5EIIG 5FC9A 1NCHA 1LWRA 3IDGB 1LP9A 2VM4A 4WUKH 2FBRA 3D3VA 2VDRB 4GAFB 4B9YA 4EIZC 4GUOA 4Z7UF 3D4GA 3R0NA 4ENED 3BZ4B 2FBOJ 2P42B 2RMNA 5D2LB 3RNKA 5I1JH 4P06A 4H44C 2RQ8A 3ELQA 3MGAA 4A67A 4BUHA 1KYDA 4GG8B 2O6CA 1FP5A 1D5XA 5ESQB 4Q9RH 1TJGL 1WP6A 3BKYH 3D08A 4I3RH 3QORD 4J3OH 2HRPL 3I9GH 5IHZB 2KHAA 1RK7A 4HJ0D 3B2UC 5F97E 4E2OA 1IFHH 4ZFOA 3T1WA 2YC1A 2A9DA 5IQ9B 3W38A 3CFTA 3NMEA 3OHXA 4XPFH 3NRFA 5JHDE 1IEHA 1FNFA 2PYEB 4MJIA 4GRWH 3K5RA 1OGSA 1UQSB 1W16A 3EBAA 3GYRA 4PJXA 3RU8L 3VGFA 5JORB 2BP8B 4QYOB 4KI1A 4YEFA 4S10A 5EHFA 1RJYB 4A6YL 4N2KA 1V7NL 4XVJH 3ES6A 1A21A 4OLEA 4X9IA 3KCPB 1KV3A 1Q1PA 4YHYB 5FYLL 2JJTA 2HFGH 1U6AL 3MRKB 2ZXEB 4LKXB 1N3NB 3TBYB 2EDFA 1OF0A 3V4VL 1S9WB 2BSCA 4PPTA 4OUUB 2O6DA 4L4TD 1QNZH 4I3SH 3O2VL 4PJHE 1NGYA 4QRRD 3DVGB 3VWKD 5AW3B 5IVZB 4GI6A 5DJCB 2XN9B 4R26L 2YKLH 1OTUD 3OJDB 2Q7YA 4N2DA 2QJDA 1SBSL 1GKOA 3DSNB 3OKMB 2IH1A 1RZIB 4ZFOL 2P28B 1T89C 3RDJA 3DURA 4H8QA 3O2WH 5I1GL 1MHPH 2NXYC 3MRDB 5DF0A 2ZUUA 3QO1B 2YGVA 5TF1L 3WN5C 1JERA 4H40A 4GG6F 3O9WD 4YPJA 5L88H 1LK3L 1JI2A 4JO2H 1KTLB 3FQWA 2UXVA 3RLSA 3L3HB 3ZHFA 2P24A 5LWYH 4FXGA 1GTFA 4FG0A 4GUPA 4L4VD 3O3UN 2K7QA 3QDHA 1NUGA 2CHZA 3T2NL 4MMYA 5E51A 2EDWA 1DR9A 5C1MB 5DQ9A 4U1MA 1DUZB 3HFFA 3UAEA 2X7LA 1R5IB 4Y5VA 1W0YT 5C9JB 2V33A 2VLLB 3QJUB 4LCCB 4KTGA 4EVNA 4HGWB 3CFEB 4XP4H 1J1PH 2QMKA 1WIOA 3DVNA 1T21B 4JY5H 3WL9A 1MI5A 1LEKA 3N85L 2XG4B 4CSTA 4QIRA 2Q5BA 1PX4A 5H4YA 2Y25A 1MRDL 2E7LA 1J10A 1AJ7L 2SEBB 1F56A 3HBQA 4N90D 4AYSA 4PRPB 5CP3A 5MI0C 5DFAA 1IKNA 1WA0X 5J13C 5MP6L 1J8KA 1QQDB 1EO8L 3FQUB 3L3IA 2C3WA 1T83C 3SPVB 2WUCH 3MJ9A 3N42F 4GSRA 2JE8A 3AU1A 5EOCL 1CDJA 2R56L 1U8QA 3MBXH 4NO2A 2IWKA 3T3MB 4GRMA 5I0ZA 1QRNA 1T1XB 2PTTB 2R9HD 5KG9B 5EIVA 3RGVC 4DN4H 4CILA 2WAQA 4N8VG 5I0WA 1T7WA 2AQ2A 1LEGA 3LXBA 1MCWM 1W0VA 3HPLA 3KBPA 1FRGL 1WBZB 2ED7A 2X53A 1R19A 3HN5A 3R7RA 4E42A 2ZF8A 5LQBL 5BW7A 1PIGA 3DHPA 2FH6A 3TVMB 4LSPL 2VR3A 3L3DA 1QSZA 4F57L 2CBPA 2NY0B 4RGNE 4Y4HB 1YMHA 4IRJB 3E3QE 3AQXA 4ZW3A 4XPBL 4BKTC 3KVPA 43CAA 3SDXE 3OC8A 2DPKA 2C3XA 4KZ0A 3ME0B 4C54A 4PRIE 3VI4E 1P5VB 1PAMA 2F08A 1NGXB 3P30H 5D1QE 2HX9A 4X5RA 1RUMH 5IV2B 4W81A 4I4WA 1PU0A 2I69A 3VYNA 1O7DE 1BYOA 3HI5H 5KEZA 4LEEA 4WGWB 4GKNA 3MJ9L 4KXCA 3ZQXA 2DYPA 1L3NA 3NRQA 1S9VB 5J11C 5KYXA 1T0PB 1ESOA 2CBMA 1DBKL 4JPSA 5GS0L 3TBVA 4H25B 3FQNB 1O5DT 5D4IA 5DUPL 3L9YA 4MCMA 2B59B 3ARGD 3KPOA 1WFTA 5KN5A 3TA3A 4GOSA 5ITBL 1YNTA 4XXDB 4WI0A 4FD0A 5EEUA 2HFEB 5AAMC 1NCDL 5IESL 3AS3A 4FQCH 1F00I 3O3EB 4X42A 5HDBB 3CX5K 4Y4KC 4R0LA 2R0KL 4LMQI 5EO9A 2OW7A 3DUSB 3T6WA 3ESUF 5IMOA 5KTEL 1YMME 4HIXL 5JHDB 2JB5L 3BPCA 1GZQB 3R06B 4N0CC 1IM3B 2O4EA 4CVWA 4KQ4H 1TTRA 1F41A 3ULUE 4ZMXA 2WQWA 4MA7L 4TSAL 3P4NB 2HG0A 3I50H 1HNFA 2BWQA 2XG5B 4Y9FA 2VAJA 1ZXQA 4YDKL 2ZZUT 4HP5A 2O93L 2H32B 2RFXB 2P3YA 5IB1B 2H2SD 2VN7A 4G7VL 1EXUB 2JKIS 3S36X 3U0PB 5E0FA 3LZLA 2WSPA 3F62A 2AQSA 2V3FA 5DMKB 3W37A 4XNXL 5C71A 3BKCL 5A40E 3LZFL 3QNXA 2NPLX 2NY5C 3KPPA 5E1HB 1XGRB 3AXLB 4PJHB 5AW2B 4EE2A 3GWJA 2QR0B 2X4OB 1G9NC 1A7QL 3CN0A 3I6KA 4APXB 3S97C 4AJWA 4M9PA 4OBSA 4X7DC 1T5KA 4H20L 3SQBA 4PP2B 2CA3A 3MTXA 5E2TL 5EO1A 5F1IB 3WYRA 4HSAC 3IJ9A 2ICEB 5AW7B 4WSGA 5AVUB 1IVLA 3HLKA 1BQSA 1HQRA 4HC1A 3VSUA 5CBEA 2H6UA 3AC0A 3FFCD 3IDIA 4PREB 1RMFL 2WLYA 4G7YL 5AZ2L 3RZCC 2E7LC 3WFEL 5T33H 5E94B 3B5GA 3NJXA 5C0FB 1RFDH 2E0PA 5C6PB 4X5QA 5TDOA 3E7JA 5J4MA 2EDJA 1RHHB 2AKRA 4JFYA 1CWVA 2EVIA 1DQML 1Y18B 1HC1A 3VD9A 3U30C 2UWEE 4HALA 5TE7H 4NERA 4PGDB 4PTTA 4XP6L 2R0LL 3DC0A 3P0GB 2JQMA 3VTMA 1SXBA 2V17H 3JV0A 4PIRF 4LCIH 1IFRA 4XVSL 3A22A 4XCCH 1YVLA 3A6BH 4R3SA 1JHLL 3LVTA 5DK2A 1R3HB 3S37L 3UAAA 1XF2A 5GSVA 5I66B 2ZJSL 3MOQA 1NC4D 1VKXA 2ZCZA 3GBDA 1Y7VA 1GCFA 2ATPA 3U7WH 3GBNH 5I1HL 4HC1L 3PWJA 5D7SH 4Z3JA 3E2HB 3UFIA 4PJBE 4XN4A 2IAAC 5I73B 1TSHA 3CFJA 2B2XL 1H6TA 3CDYA 4M62H 2ADGB 2P45B 4M93C 5CSGA 4RLDA 5GGTH 3TO4D 3VQ2C 1UACL 2XU9A 1MIEL 2G75B 2ICWJ 3P3SA 3GSQA 3NDYE 2BM3A 3IF1B 4MNQA 4B9PA 3MNWA 4G5ZL 3ZE1F 1CD8A 4GI8A 5IW3A 4LSRL 1BJ1J 2A83B 3KPRA 2A6IB 1LNUB 2IBGA 2DQTH 3OXSB 1EFQA 4NJ9L 1GIGL 2IALA 1HXYB 1PCXA 2YD0A 3BZFA 3UOAB 3S96A 2APWA 1WFOA 5GRUH 3U9WA 4RGNB 3T0EA 3F12A 4N2OA 2QVKA 2EVJA 4N24A 2D2CC 4PV8B 1SOQA 3B5TA 4O58H 4UBDD 1DLHA 3SDXB 4PJ5E 1BIIA 4KXDA 4OCSH 2EE2A 2D31B 3HC0B 3X3GL 4PRIB 3VI4B 4LVEA 1PZ5A 3QZWG 5D1QB 4X6FB 4R0LC 2V2XB 2P5ED 5CGYC 1F3JB 3L3JA 1P2CB 2HJFB 2Y1VA 2GAZA 2Y5EA 3F84A 1PEWA 3QEHA 3B4NA 1WZMA 2DWEB 1AMXA 5EORH 3TC9A 5GGRY 4JE0A 3VXMA 1CICD 5E7BA 4MMXB 3VH8G 3IFNL 2WBJC 4OLXL 1L9NA 1QX1A 4U2YA 1BZ9B 2EYTB 5I1LB 3OR6B 4RMUA 3MLPA 2ZPKH 1NBYA 5D7JB 2ZXCA 3AVEA 1I8AA 1YYLH 3WTUA 5AEAA 4G6ML 3ZIYA 4X4XA 4GXVL 8FABA 3RIAF 2C9AA 4LCVA 3O41B 4FHKA 5D7IE 2F61A 1FAIL 1SY6L 1USQA 1P1ZA 3L5HA 1L7IH 4K2UH 4FJ6A 5ABDE 4LSVL 3PDOB 1YMMB 3SPIA 1IGFH 5CINH 1BM3L 4Q14A 3CVIH 1YJDC 3BGFC 2F2HA 4MRBA 1NC2B 3T0DA 1WHOA 4A7TA 4QRQA 4ERSL 4QCIA 2NT1A 4P9ML 4Y2OB 1OP5K 4M1GH 4YSAA 3VFPA 2HLEB 3MFGB 4OFKA 5CXPA 2BHYA 1YUKB 3VXQB 4UV4H 4JFXB 4XGZB 1ZEAH 2YS4A 3PAVA 5ESVA 1VGKB 2X28A 1U3HD 1II4E 4BSWA 3MAWA 3PV6B 4L0PB 2IH9A 3BYYA 1QSFA 3FOLB 3DDGA 1KLFA 4GSQA 1TMCB 2LR4A 3ZX1A 2VLRA 1IKOP 4P4KD 1A6UH 1RY7B 1QPPA 4QTIL 2PO6D 2C9UA 4P2RD 1GW0A 5JOPE 5JW5B 2CK0L 2XQYA 3S3BB 1ZVNA 4ZW7A 5IFJA 2Z7YA 2YBRB 1OAYL 4K5PA 5FPIA 3L1FA 1X5ZA 3SCMD 5ID1A 1J0JA 1T7ZA 4GRLA 4AMKL 1E9PB 4EI5B 1T1WA 1I9JH 5EF0A 2A9AA 3D3VE 4Y9BA 2RACA 1ASQA 4Y9CA 1TFHA 4XC1L 3MUUA 1JPSL 3LOWA 2WXQA 4GAJL 4S1DD 3VG9B 3JV5A 4APQC 3RU8H 2QV4A 4RGMC 4BKLA 5JHLL 1LM8V 4JZJB 4R83A 1F42A 4LIQE 4UAHA 3VWJB 2Z91B 2A6JB 3U9UB 2WV3A 1JTPA 3EYOA 1NA8A 2PNDA 5BQDA 1P5UB 4A6YH 2YQ3A 1NGWA 3HAEA 1V7NH 3GIZL 4X9FA 4YNYA 5KJRL 2UWEB 2I9TB 1I7ZA 1N4XL 1WVZA 5FYLH 5ID0B 1U6AH 1JGDA 3GS7A 5IW6A 3KCWA 1AD9B 2X4SB 3V4VH 3KLAA 3QXVA 5KZCD 2I32A 3DOSB 3K8LA 1TQWA 1BVNT 2C3VA 3GMPA 4XN9A 2XQBL 3OKDA 3FCTB 1N64H 1NCCL 3LKRB 4NDMA 3TA4D 4DOHE 1Z66A 5FGRA 2CCVA 3SE6A 3PYCA 3D2UB 1SBSH 1KXTB 1JWSA 2I60L 4HKZA 4OLVL 3MZGB 5IQ7H 1JF5A 3T0EC 2R8SL 3RVXD 5T3ZL 1LE9A 1HZLA 2C34A 2VR6A 1GZPB 2FIKB 3H9HB 3LXAA 3QI9D 4ZUUB 1EHXA 3OQRA 5I1GH 3PXJA 1I4FA 2HVKB 3GMQA 4GMTL 1A66A 1SJHB 3T5WA 1RUKH 3WS6C 2B1OA 3EH2A 2FQGA 4JGUA 4ZO8A 3OWEA 4TTDD 4Y1TA 3EJYC 5CLTA 1KJVA 1LK3H 1XXDC 2AAVA 3OKKB 4LSDA 1HYSD 3QULA 4MNGA 1KUMA 1R1CA 1RZQA 1LJMA 3D2TA 4IHBA 3RB7A 2EICA 2R1YB 1LILA 5AFAA 4HDIA 5AB1A 3SDAD 2B1AH 3KLQA 4KVNL 3RUGA 3T2NH 4FQIL 2OTPA 3WTXA 2IDCA 4OD3L 5IG7A 1XBRA 4AH2B 1FSKC 4BCZA 2YA0A 4NRZB 3O6KL 2BIQA 2BC4B 4UI2A 3GBEA 3PWLA 5EZIL 5BUAA 2IAMD 3HBGA 4FNUA 2W94A 3OB0H 3REVA 5GGVL 1IC1A 1QPXA 3TYFA 4ZMYA 4GB9A 4XNUL 4ZX6A 1T20B 1H9DA 3T6ZA 3DO7B 4HJTA 4PJ5B 5D9SB 5C07B 3MJ8B 2FECI 1EK3A 1K5NB 1P84K 4HXAL 1UOWA 5EO0B 3LAFA 3N85H 3KNBB 4NQVB 3HA0A 1UFGA 3FB6A 1QHPA 2UVFA 3D34A 4HS6B 1MRDH 4RAHA 1S3KL 4X0KA 1AJ7H 1HE7A 4UM8B 1TCRB 2IXQB 5AKTA 2BY3A 4JPVL 4ES8A 1E4XL 3WJLC 3LNIA 4HIPA 5MP6H 2F5BL 4W9LC 1EO8H 5EBGA 2YUWA 4ZFZB 2EYRB 2PWHA 4OZGF 5JDJA 1UVQA 5IB3B 5EOCH 1NMAL 1MI5E 2R56H 2VABA 1H3TA 2ZP8A 3KM1A 3KWWA 4WK2B 4NN5C 1FNEA 3TO2A 5GGUB 4PD4K 3WN5B 4V2CB 3FCUB 4A63A 1BVZA 3FOMB 3MRMA 1U3ZA 4OJFL 2KH2B 3RPBA 3LRHA 5CU9A 1HQ4A 2Y2YA 2E27L 3MC0A 4IRSC 2K4AA 2W0FB 4YSDA 4ADGA 5CN3A 1PZUB 1VGEL 1FRGH 5D7IB 2QKSA 2WP3T 4ZFGL 5IM7A 2QDVA 4BFIA 1K72A 2A9BA 2NY1B 5FFGA 5IFAL 1R3KB 1A3ZA 4X8JA 5I6LA 4LSPH 3EO0A 3VDBA 4M6NL 5T1KD 2WLJA 4F57H 1UWFA 1MRFH 4P2QD 2BRRL 3CXHJ 4X6DA 1AQHA 4NKOB 1JPFA 1UKTA 5LBSL 4FTVD 4PBDA 1HEJC 3PDGA 1QRNE 4JRFA 4XPBH 1DBJH 3Q5OA 2KPNA 4X4YB 5GGVY 3FU0A 2DQMA 1URLA 4IM8A 4JGMA 5L2KA 3F83A 1IBGH 3UXFA 3ULVC 3NG5A 1J8HA 2E9BA 1CB4A 3LKNA 1TVBB 2XPGB 5I1KL 1SOKA 3WY4A 1RPKA 1IBBA 2EH8L 1K3IA 4DWHA 3O8XA 2C4FU 1PL3A 1BEYL 2E3VA 4A55A 1UKQA 3IMWA 4JJ5B 1T0MA 1DBKH 5GS0H 4B9GA 2CKBB 3P9MA 5MI0B 5F2FA 3VD3A 5J13B 1JMXA 2APVA 1OP4A 3HR5A 1NM9A 1KIQB 4ALAL 2H45A 12E8L 1Q72L 3FPYA 5ITBH 4OJYA 4FHBD 4O51B 5MHSE 3RGVB 4Z95H 5G5DA 1NCDH 5IESH 3LKOA 5I15L 5AG9A 3QJZA 1FH2A 1NCJA 1HJCA 1N70A 1QR1A 1OWWA 3BCFA 1YC8A 1LP9B 43C9A 3D3VB 1QO3A 3O3BA 4CKQA 3FT0A 2R0KH 4PB0L 2W9EL 3ABMB 5IUCA 3G9AB 5KTEH 1DCLA 4DGWC 4HIXH 3RNKB 2JB5H 4D0DB 2UZIL 3CTTA 1FO0B 1VEMA 3G08A 4Y1AA 1NAKL 5HHOD 3FTGA 1IRAY 5C09D 5SX4H 3QUZA 4LZKA 1M7IB 1QD0A 4MA7H 1JPGA 1D5XB 3C5ZD 4NN6B 1M42A 5F3BB 4JGNA 1U8OA 1E5AA 3PWVA 4NZFA 5ICXB 1QZ1A 5E5RB 1CJYA 1MWOA 3CHPA 4HHAA 1KCRH 1A0QL 3NZSA 1J1XL 2CRYA 1G7PA 3HTLX 4HHWA 4L8SA 1XF3A 3CK0L 1E40A 4MJIB 4EXKA 3H4FA 4YSOA 5J11B 2AHIA 1BWMA 3K71A 1HH6A 4L5FL 1ZWIB 2F0CA 2QZ5A 2AV1A 3BKCH 3C09C 4G7QB 2HKHL 3V5HA 1JD9A 1AGCA 1T5XA 4QYAA 4DOHB 5LGHL 1A7QH 3RWFA 2XIDA 4HJEA 2VQUA 2EIMB 5CS7A 2EXWC 4RGOH 2CJSA 4H20H 4K73A 3QUYC 1AS8A 3L95B 2F53E 4X50A 4MXQC 5HI3C 2G5BB 3QEGH 1NMCC 5DJZA 1XEDA 2QADC 3U2SA 3FFOA 4PJ8C 2IDFA 3SGDH 3Q2VA 2AP2A 4PWFA 2VMCA 4Y4KB 1LO0L 3U1SL 1CE1H 4M8RA 1NGYB 1KZYA 2EVFA 4KAQL 4JS7A 3U6RA 5AZ2H 1RMFH 4G7YH 1CGWA 4LK4A 4OZFH 1JHKL 2Q7YB 2DQGL 3T8XA 5C0NC 1FNHA 3WFEH 1L9TA 1XH1A 2IH1B 3ET9F 4KKQA 4B9JA 4YHZL 3CSBA 1OIOA 4XMPL 2H1XA 3A47A 5JZ7D 3DURB 4W4NA 3FB7A 2F5AL 1DQMH 2FZ3A 3GZOA 1TJXA 4WWID 4JQXC 1T22A 4LDLB 3VRIB 2F1AA 4WHYH 5I28A 3OZKA 4RWHA 2R0LH 2JKWA 2A74C 3FQWB 4JFPA 5KWYC 2P24B 3CH8A 2W5PA 4WSKA 1DQIA 4FXGB 2M2DA 1D7BA 2BOCB 2EDHA 4GUPB 1XD1A 3W9EA 1SUJA 1JHLH 4MMYB 1A6PA 2IO5A 3MV7D 3NEEA 1UYWL 2CH8A 5DQ9B 2ZJSH 3TWCH 2X7LB 4L1BA 4PRBB 4O02A 4HF5L 4MJ6A 1XF1A 5HI5C 1XVSA 5I1HH 4JM2A 3P4OA 3O3DA 1OOAA 1WAAA 1E4WL 3BEVB 4LLDA 3FB8A 2H2PD 4BH8A 5LHDA 3WL9B 1ORQA 1MI5B 1LEKB 2B2XH 4F7CA 4D7BA 3TX4A 4NQTA 1MREL 3WOVA 4PEEA 1U0QA 1UACH 1SGKA 1MIEH 3BXNA 3G5XA 1X9UA 3O8XC 4YIQA 5D4JA 1EFXB 5L8LB 3RZCB 4G5ZH 1QBML 5DD1L 4ELME 3HHSB 4M61A 3MRBA 4LSRH 4UMGA 1QLEB 3OGOE 2VJ8A 4MB4A 2G9HB 3QUXC 2OMNA 5CJXA 3BP5A 4NJ9H 1GIGH 1CN4A 3L3IB 3F01A 5DFVD 1NIBA 5IUSA 2ZNXA 3DX2A 4ZS6D 3U30B 1U8QB 4NO2B 4KNUA 1AI1H 4GRMB 1SRDA 1JVLA 1QRNB 3L6FA 3SE3A 3B2DC 4PJAF 1DVFD 2YR3A 3N9GL 1LEGB 4MNQE 1W0VB 3HPLB 5F1OB 3X3GH 2XZAH 3WDIA 1X9RA 3Q6FB 1B6DA 4P5TD 2CO6B 4O02L 3T8MA 2C1PA 4JFDD 4E42B 2ZX6A 4B9FA 2DLEA 4PJDF 5FOBB 3HZYA 4TUUA 1G94A 2D0HA 3O4LE 1J5DA 2GJRA 3FQXB 3S35H 3L3DB 3WHXA 5F71A 3T0EE 1AC6A 3RJQB 1YMHB 3DPDA 4U1JA 5GRVL 3B5HA 1FL3A 2ORBH 3PG2A 4HH8A 1F4XL 4FI7A 2Y2WA 4H8PA 4WJKB 43CAB 3OX8B 3IFNH 4OLXH 3C60D 4N2MA 4OKVA 2CJUL 3SPGA 1ZGLP 3DX8B 4JRXD 2OXGA 3C08L 4G6MH 1ML0A 3GRWA 4GXVH 1TPXB 1A8ZA 5FKPB 1I3VA 3F7YA 4LESA 1H6UA 2FO1A 2DMHA 4L8SC 4OFQA 4F2FA 4QRUB 2PTUA 1FAIH 4NQCD 1BZ7A 3HG2A 3X11B 1OB1B 1SY6H 5KYXB 1ILUA 4FQ1L 3UP6A 1CGVA 3IXAA 5D7KD 3VXME 3VFUB 1BA9A 1I8LA 1KENL 4HCRA 1BM3H 4MZIA 1V7ML 2LABA 3MBWA 4UQCA 3TA3B 1YNTB 1M05A 3VXRA 3VGGA 4JZNB 4WI0B 4LVOB 2XKNA 3U4EA 3JWOL 2PPFA 5AUMA 5F7AA 4WUUE 3H56A 3QB7C 3ARSA 2BHZA 4J3OC 4FAAB 2P8LA 1HI6B 4R0LB 3FU7A 4WFFD 4UU9A 4JFUA 3P4MA 5EO9B 2HRGA 2P46B 2YEQA 5IMOB 1T1ZA 1A4AA 2O5XL 3BPCB 2X44D 4AITA 3V55A 2DF3A 5D1XD 2QKIC 3GRWL 3NQIA 3NZ8A 4Y4FD 1CFTB 4BGLA 5B8CA 1J88A 5CILL 2Z9TA 4G59C 4A7UA 1PD1A 3RTQA 2CK0H 1PNDA 2VXQA 3SO3C 1ZLUK 1OAYH 1CF8H 3G6DL 1XGTA 4JAMA 4BK8A 4N86A 3MGTA 4EEEA 4CMHB 2F53B 4OR1A 5DZVA 4UQ3A 4AMKH 2Z8WC 3TGXA 1QSFE 4QAMB 4MMZA 1U33A 1UWYA 4BWTA 2Y5TA 1IBHA 4M7KL 2B3IA 5FAAA 2GPZA 3BDYL 4XC1H 1JPSH 2E9GA 4Y2DD 5B21A 3II3A 3KPPB 4GAJH 1CLZH 1ZSDB 2FX8L 3ARFA 5HDOA 3K6SA 5IHLB 3I6KB 4RETB 5JHLH 2XV2A 3BGFB 3I9PA 3AQDA 1JMZA 1AQDB 1AR1C 3SQBB 2XTJE 5EO1B 1J0ZA 3VXNB 3HPJB 2EDQA 3MUGA 4DKDC 3KYOB 5I19H 1TIUA 2MCMA 3BISA 3X14B 2Z64C 2MFNA 4XOCA 5H4ZA 5KJRH 3ULVE 1HQRB 4HPHA 4HG4J 1X4ZA 4U6VL 1EJ6A 5E6IA 3NN8A 4LDOB 3S5LA 3IDIB 4LXFA 3ETSA 4K5LA 5DTFB 2OAAA 2VXQL 1XSOA 4UZUA 3BWUF 4JPWH 1D9KD 2GHZA 5DK3A 5FYJE 2XQBH 2AEQL 2MEJB 1NCCH 2FT8A 2E4TA 4Z7UA 4PFEA 2AKRB 4JFYB 4WIQA 4H1LA 1ZHNA 2I60H 4OLVH 5LO7A 2R8SH 5T3ZH 1DQTA 1BM7A 2DMGA 1TVHA 1IC5L 3VI3F 1OP3K 3B37A 1C7TA 2GI7A 2IANA 3EH4B 3ECVA 2IWEA 2XZCL 1IC0A 4UF7C 2D0FA 1GYVA 2DJUA 3ARVA 1RK1B 3DX4A 1XH0A 2NLJA 2BHFA 2J5LB 4R3SB 4EN3A 5DK2B 5D1ZD 3QDMA 3ZSTA 1TZGL 4GO8A 3FMGL 1YPZF 5GSVB 5IROC 3CFDA 4APQB 1VKXB 4YFLF 4Y89A 1CYGA 1TTBA 4ELMB 4QR7A 1E28A 1FH5H 3IE4A 4G80A 4KVNH 3D07A 4Q4IA 3FC8A 3PWJB 1Q9LA 4JKMA 4NRYA 3ZL4L 4AX3A 3B6SB 3O6KH 3ZT6A 1EH9A 2XDHA 3WHE0 3QGVA 5EZIH 4MAUH 3EZ8A 3CFJB 4KRPC 5GGVH 4HEPA 1G84A 1A47A 4XNUH 1WZKA 4OFYA 4LAQL 3M7OA 4MNGE 1DN0A 5A6LA 3C75A 3GSQB 4MNQB 5E9DD 1BZ8A 2A0LD 4Z7IA 4HXAH 3KJ6L 5E2UH 3CH1B 3V6ZA 3KPRB 3MRJB 4FEIA 4POZC 1JXJA 1Q9WB 4P49A 4U6XA 2IALB 2YGQA 2NX5D 2Y1YA 3BZFB 3EYSL 1S3KH 5JIHA 3SGJA 3X1FA 3S96B 2EDDA 5I1EL 1RZKL 1S7RA 3T0EB 1X4XA 2Y0SA 3LRMA 1E4XH 4L4JA 4YHML 2F5BH 1G7MA 4HA1A 5F21B 3ARDD 1YEHL 1DLHB 1BIIB 3LEVH 5J6HB 1E30A 4IU2A 1NMAH 1PZ5B 3GS0A 4HUXB 3OAYK 4YX2L 3UCRA 4OJFH 1NOAA 4D8PB 1R6VA 1UZGA 4GG6A 3US1A 3Q8CA 4R7XA 4ZFGH 1IVTA 1BZEA 2W1NA 1M3IA 1BQLL 2FE0A 1PMYA 1MCWW 2AK4E 3DOHA 3QEHB 5CLXA 1MFAL 2NY4B 4QRPD 1DQKA 1PJWA 2VM9A 3GUFA 5IFAH 3VXMB 1FSKB 4M6NH 2HT4C 4JFOA 4CSZA 1OE1A 1MVUA 2JQZA 1LO3L 5B7MA 4Z7OE 1NBYB 5LBSH 3S0PA 3C5SA 4LU5H 4X4XB 4KUCD 1QTPA 3Q5YA 2IV8A 3S3DB 8FABB 3LIZL 4PLKC 1FZOA 1C12A 3S88L 3CFMA 3ZE0F 2R29A 4WUUB 2WAHA 3G3LA 4I2XA 4XO3A 4MGXA 2EEBA 4YHLH 5I1KH 4AVHA 5L4IA 5DRZA 3IAGC 4AMXA 4AUYA 2KDGA 3DGCR 2HJLB 4IK7A 4X6DE 4OCWL 1NCTA 1CF1A 3HLAA 2DQDL 2WSDA 3T9WA 4QCIB 5L2KE 2JQAA 5FO7B 2JI2A 2KZWA 3VFPB 12E8H 1Q72H 1BF2A 5HHXL 4H0GA 1J8HE 3W11C 2W07B 1W8NA 1XR8B 3TIDB 5FIEA 5ESVB 3HG1A 3RY4A 1MRCL 5I15H 2OCFD 5FLUA 3K72A 4XHJC 1RPUA 5DHMC 2ZTBA 1QSFB 4Z3GA 1SQ2N 1DQDL 1KLFB 4PHZA 3ZTJG 4I18A 1KXHA 1TLKA 2VDLL 5TE6L 1U8KB 3UZQA 1MW0A 3WKYA 4UQEA 2W9EH 5GS1C 3U7AA 4AIZA 1U8LA 2UZIH 3HE7C 5JXEA 1A3QA 3NACL 1NAKH 5IFJB 1KJ2B 2R29L 5HY9A 2D7QA 3H53A 1MHHA 2W81C 3U9PL 4EOWL 2UXGA 1BQKA 3Q8FA 5ID1B 4PJIF 2XTJB 5D96C 2NY2C 4N9GA 5EF2A 3NBNA 2YAFA 3RIAK 3M7FB 4PJEF 3V95A 3FU3A 1RP9A 4IOIB 1OTSC 1Q0YL 1VFAB 4BQ9A 5M7QA 4G9DB 4BQ6A 1XIWA 2B9AA 4L3ED 1MCQA 1A0QH 4TQEL 1J1XH 2CHNA 3UGXA 2X87A 1CQYA 3MJGX 3CFQA 3KM2A 2DLGA 1FL6A 5E23A 3MV8D 2AXFA 3O81A 4Y1AE 5D6DA 4YLBA 4HOXA 4L5FH 3ULAB 4BKLB 2BSED 4HD9A 2HKHH 4M7JL 4R5VA 3PWUA 4GSUA 1OHZA 4I0PC 3V0AC 3ZGHA 1HHJA 3QXAA 2R69A 3HAEB 5EC1A 1SZNA 2NR6A 3M1BA 5BOZG 4YNYB 3DGGA 4C59B 1I7ZB 2D4FA 4FFTA 1GSMA 1UXWA 3ZMNA 5DD0L 3SIKA 1WBXB 1JGDB 4XWGL 4OV5A 5IW6B 5DJ0A 4M7LL 5BRQA 3RVWD 3QXDA 1N2RA 4F7PA 4KMQA 3KYMA 2CGZA 2C3VB 3GMPB 2IDQA 1ZK5A 3VFGH 1LO0H 3U1SH 2V8LA 3HNTL 2R83A 3OKDB 1SXNA 4KAQH 1NSNL 3AXIA 3SGJC 1JHKH 2DQGH 1JWSB 4CKVX 3RPIA 1L9MA 1MFCL 4ZPVA 4YHZH 4AC4A 4PJ9D 4PR5A 4XMPH 4NZUL 5G55A 4NBZB 1I4FB 2F5AH 2EC9U 4G7RB 3T1FA 3OG4B 5KSAD 3K91A 2WK2A 5T3XD 4HVBA 2RALA 1KJVB 1DO6A 1HCZA 3EUUA 3UX9B 1Z0NA 4J6RL 4AYFA 3QULB 4MNGB 4AKQA 1CGSL 4G6KL 5EN2A 4GRWE 2G5UA 2WBKA 1WWCA 4HDIB 4S1SL 5DZAA 3BW9B 4CADA 3C09B 5SWZA 5SX4I 5CMAA 2NNRA 1I1YA 1UYWH 5IG7B 3FRPA 4Z76A 3ETBJ 3WKPA 1SUHA 1SYSA 3QIWD 2GKIA 4G8IB 2ATKB 4HF5H 3P02A 3N2JA 3TYFB 4LBEA 4B9IA 3TM6A 5J1TC 4BFNA 4DNLA 2GUOA 3HI6H 1A02N 3GMNA 1NMCB 2HX7A 2QADB 1F45A 3BGMA 3JVGC 3K4AA 1GGCL 2B16A 1Z9SB 3H9SD 1MREH 1HVXA 3LB6C 1N12A 3S5YA 2HTLC 5DQDL 3WUWA 3WO4C 1HL5A 3RY6A 2FT7A 5DD1H 4X0KB 4F27A 3DJSA 1GCYA 3UC0L 1R3JA 3MROA 1TZIA 3ARWA 4P57B 3PGDB 1I3RA 1UVQB 4HT1L 4U6TA 4DPCX 2VABB 3SGDI 3VGHA 3TO2B 2QDWA 1ZA6A 4Z7OB 2FR4A 2W9DL 1FNEB 2GHWB 1QATA 2M1KA 5AENA 3MRMB 3VXUD 4C56D 3NIFF 4GQPH 1S46A 2A74B 3RVTD 1HQ4B 1E65A 1RURL 3L4UA 3N9GH 2WNXA 4FNSA 5F44A 3DXAD 5IM7B 1D5IL 1M7XA 3IRZA 1DUYB 3CLEL 4Z7NE 1EHAA 4X8JB 4AQAB 3FXIC 3BT2H 3K2KA 4YHPA 3ORJA 2AAAA 2LTQC 1MFNA 4X6DB 3QYNA 5F7YC 3NJIA 1JPFB 4L4TA 3WJJA 3FHAA 2YQBA 4XTRC 4QRRA 4ZS7H 1J5OL 2UX7A 1O75A 1F4XH 2DH2A 1B0WA 3QCTL 4CC0A 1HL9A 4JQVA 4NX0A 5L2KB 1WGVA 2ITDB 2X4PA 2CJUH 2EABA 1M6OA 3C08H 1J8HB 2FO4B 4S0SD 4XE5B 4F7MA 4ZMZA 3LKNB 1MAML 3SZ6A 1UWGL 5EOCJ 1PG7X 3S36H 3BVXA 3O8XB 4M02A 5T1MA 4G1EA 5I8CB 3MRFA 4ZMVA 5DS8A 2BOBA 3MQIA 1T0MB 2KZ1B 3GI8L 4KV5E 3QUXB 3P9MB 5C0BA 3OAWA 1DE4A 2NCEA 1RZFL 4H0IA 3KGSA 3TASA 4TUOA 4BH7A 1V7MH 4MX7B 4UOZA 4F20A 1I1AD 2FGWL 4ABUA 1A4JB 4FQJL 3D8MA 3MOAL 5G5DB 1QEXA 3LKOB 3JWOH 3C6LC 3AM8A 5E4AA 3WKML 3FUJA 3S5ZA 5HYJE 1M1SA 1KCSL 1KBGL 1QO3B 3O3BB 4MAYC 5C6WH 3E6FB 2GSGA 4KKRA 4FABL 3FUFA 3O6FC 5AYTA 1E8WA 2O5XH 1UHVA 3RWCA 4B5ZA 5T1DL 3G08B 4Y1AB 3AITA 1F3DH 2JI1A 2QELA 3FTGB 3GRWH 4UV7L 2NXZD 5EG6C 2WUBH 1A14L 1E6OH 2J72A 1JPGB 3M17A 4N1CA 3GC3A 5D4QA 3L3KA 1MW3A 3D30A 1H9VA 1U8OB 3ARPA 2IWFA 4FQ2L 3G6DH 4HIHA 3PWVB 3HOGA 3BZDA 4JG0L 3MSPA 4AGNA 1VEPA 1G7PB 3MFFA 4L8SB 2XN0A 1XF3B 3QS3A 2ZOLA 3TJHD 1TVDA 4HWZA 4PY7A 3EF4A 3G5ZA 4X99A 2A7BA 5DHYB 3K71B 3V5HB 2CALA 3BDYH 1N0XL 2AV1B 3E1ZA 3MKGA 1G9EA 3UTQB 2VDKB 5ILTL 4S11A 1T5XB 2FX8H 2ZXAA 1WC7B 1QI3A 4HIQA 4H0LC 5C70A 3QFJD 1H5BC 2MTAA 3BP6A 3UBFA 4UT9A 1SN0A 2J44A 2EDKA 3FH5A 5IEKB 3J2PA 1RH8A 1UM5L 1XGZA 1J7VR 1E5BA 5DJZB 4Y19E 4NQDD 5E8NA 4RQQA 3U2SB 3E0GA 1YA5A 3PQYA 1HAWA 4Y7MA 4JQIA 4RMWA 1B9ZA 4QGYA 2Z4TA 4WFGE 4U1GC 3U6RB 2PPDA 3T8XB 3QORC 1DFBH 4JRYD 3L5IA 4HJ0C 2WQVA 3PY9A 4OZHF 2AEQH 1AXSA 2XY1A 4YZFF 2WWKT 2FHFA 2YIHA 4AZUA 4MB3A 1YN7A 1BX2A 4DKEL 1JK8A 3K5SA 4XXWA 3FB7B 2ZKXA 2DBJA 4GEIA 2E47A 2FZ3B 2PWGA 4AEEA 3MXVL 3SO3B 1RCYA 3KH3A 1T22B 5IB4A 5HPOA 1OT1A 1SEBB 3FO9A 1NFAA 5JXAL 4IBUA 4HMDA 1SXAA 1B6UA 1IC5H 3BUQA 3SSGA 5IY5B 5EF3A 3RFZA 4MXVE 2XZCH 4JFPB 3Q8EA 2WQ8A 3IMVA 5D2LF 5DHXB 1CK0L 1ZT1A 2NW2B 1RLWA 3W9EB 5AD0A 2GJ6E 3EOBA 4LRNL 3E80A 1TZGH 3QE5A 3MJWA 2OSXA 4UT9L 4CN4A 3FMGH 3KXFD 3S48A 1A4KA 5A2LH 2QQKL 2WZPD 3S8FB 5J0BA 3LPFA 1DVXA 4MJ6B 3WJJC 4EQ2A 3BDXA 4JM2B 3LN9A 3O3DB 3VWKC 3ZL4H 3FO1B 1IL1A 1AR1B 1OTUC 3ML9A 1QASA 3HRZC 4JQVC 4BH8B 4DEPC 1FE8L 4IBLT 1IAOA 2C7UB 1I8MA 1ORQB 4F7CB 5AKRA 3B9VA 2AW2A 4K3EL 4UINH 3BXNB 3G5XB 5F1NA 1CYXA 4H1LH 4KFMA 5TDPA 3CLWA 3KJ6H 4Q4EA 4JHUA 4M61B 3MRBB 1FNAA 4AYEC 4DP4X 3O9WC 4K4KA 3SODB 4YHIA 1BD2D 3SDDD 2HN7A 2V2TA 1TZOA 2ITFA 2COQA 4Z7NB 3DRTA 2OMWA 2DJSA 4HUUA 5G4MA 4BINA 5CSZA 5I1EH 2IFFH 1RZKH 3IJYB 1MJ7L 4J3XA 2P7TB 3K0YA 2EKJA 3KL0A 1XFPA 1HHIA 1YEHH 4UIMA 4EZKA 1H3UA 5ETUA 4FA6A 3QC6X 2WWMD 3G6AA 3P3UA 2I9LB 3QQDA 4YX2H 4L8BA 1ODAA 2C1PB 3MLUL 5HGDA 4O2CA 4U3CA 3WNKA 1L7TL 2XN1A 1JDCA 3BSZL 5HDLA 3P2BA 3AT8A 4LQFH 3WHXB 5I0XA 1BQLH 1D3CA 3JWNH 5E7FA 5KVFL 1AKJA 4WCYL 1MVFA 1FL3B 5C08A 5HJBA 1ZTXL 3L7EA 4AYID 1S9XA 1LO3H 1A7OL 3DIFA 1E4KA 4LLUB 5DVKA 2OXGB 2XBDA 3E6HA 4JDEA 3F7YB 3LIZH 4XVTL 3S88H 1H3PH 2OYLA 4E5XB 4RFEB 2JKTM 2WCSA 3MV9E 5HYJB 3BDBA 1MW1A 1YEIL 2R9HC 3BYTA 3KLSA 4FLOA 5TQ0L 3RY5A 3IXAB 1SEQL 3R1GL 1YY9D 2HKFL 2VDNH 2X6AA 3NH7L 3MBWB 4OCXL 3P73A 2Y1ZA 4YOKA 2EZ0C 4IS6A 3VRJB 3GJEA 1ZLWK 4WKZB 2XZQH 1M05B 2C9RA 1M7DA 2JKXA 3U4BH 5ISZE 4ZAKD 2XKNB 3U4EB 3LXCA 1BSIA 4DW2L 3ZU8A 5HHXH 1JGIA 2EH7L 1WE5A 4PTUA 3WMSA 4I2XE 5I1IL 5ANMA 2P8LB 3INUL 3VA2C 3WIFA 3FU7B 4UU9B 1EAOA 1MRCH 2AS5M 4UYPA 2GJZB 1EBPA 3INOA 3GMRA 2YPVA 4MA8L 3IMRA 4WU7A 5CZXD 1DQDH 1T5WA 5T5NF 4DPBX 2FL5A 2RR3A 3TO4A 3BP7A 1Z5YD 2VDLH 3VQLA 2X6CA 3T3MF 3GLAA 2W88A 3MBEA 4Y5XA 2H0FA 1KDIA 2NY6B 4NZTL 4OCRL 1EPFA 3NACH 5HGHA 2R29H 5E00A 2VXVL 4F7EA 1XGTB 2B1HH 3U9PH 2ZOKA 4EOWH 3SN6N 1INEL 2HWZL 4A7GF 2EO7A 4HCGA 1OALA 2B8OT 2D7TL 3ARGC 4NSKA 2IOIA 4MMZB 3VB9A 2EUZA 2Y5TB 1A6AA 1Q0YH 1TG8A 4ZXBD 5FYKL 4X6CA 1HK6A 1VEOA 4TVPL 4TQEH 1CDCA 4F2ME 1N5YL 4OF6A 2UZXB 4NO5A 4XX1E 1JF1A 5GZND 1F6AA 2P5EA 3SBWC 1GYCA 5KBKA 5CJ8A 1Q8MA 1YN6A 3AUWB 4XNBA 3ZSSA 1V3JA 3MUGB 3JSSA 2YPVL 1KB5L 2LAAA 1A1MA 4QRAA 5DJ2A 2Q8AL 1CICA 2ZNWA 2BNRD 1CUOA 4W68A 3BGAA 4L48A 5DD0H 5E6IB 3IPBA 2DKUA 4M7LH 4RWYL 3MYJA 1QFWH 2ISDA 3S5LB 3JZ7A 3A23A 5PAZA 4Z7AA 3TPKA 1MCBA 2YRPA 4M5TA 2PP9A 2H2SC 1XH3A 2AITA 2OR9L 4M7LT 3X13A 3HNTH 1OSZA 1F18A 3KYKL 4WWOA 2DQUL 1NSNH 4E9TA 3MNMA 5JOFA 3BFOA 1ZHNB 3HE7B 2EDMA 1V27A 3MNZA 3QT2A 5LN8A 1MFCH 3V0FA 1F6LL 3R4RA 3K6FA 4FJZA 4JFWA 1T1YA 2R0ZL 2ZCLL 2NY2B 1D6EA 2X0UA 4IKIA 4M4PA 3Q43A 1BP3B 2NLJB 4EN3B 4OGYL 4RFOL 4X5PA 1CGSH 1CGTA 3MRRA 4ODTH 4OZFG 3ZVVA 5LDSA 4F8TA 3CX5J 2K9UA 4S1SH 3ZE2E 3VAEA 5IHWA 1E28B 4G80B 5E8OA 4QRTA 3GM8A 4ABWA 1U3HA 2LVCA 3D25B 2EE0A 1AQMA 3ZZSA 4NRYB 1Q9LB 4LLAA 4BZ1L 2RQEA 5E4EC 1QAWA 3GMMA 3GSVA 3B7TA 3WTVA 1QOKA 3ALPA 3D09A 1E4KC 2ZOOA 2WIMA 4JL1A 3EXLA 4WHYG 2DBLL 3ZKMD 3G04B 2PO6A 4P2RA 3IDMB 1Z1WA 2Z31D 1IGYB 1DN0B 2XPZA 4PJHF 4QF1A 3QHTC 3T0BA 3NJHA 1GGCH 2CDEA 3CSTA 3FBKA 5SWZE 4LPWA 1N68A 2MMXA 1KSRA 1O9VA 1KYOJ 3FL7A 5DQDH 4AQ1C 1NBZA 3KBHE 2XWCA 4EKJA 1T2XA 3GXNA 3D85A 2K3HA 1S7RB 3CX2A 4GW1A 1FIGH 3UC0H 5AW6B 1WZAA 1DTUA 1JTTA 3QNZA 2BSTA 4NUGL 2PLTA 1G7MB 4HT1H 3U36B <