3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
molecule keywords IRRE PROTEIN
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTIA 3DTKA 3DTEA
chains in the Genus database with same CATH superfamily
2M45A 3P1VA 2V7FA 1BI1A 1TT0A 1G5UA 1W5DA 2Q2EA 3BYDA 5CVJA 1XJ4A 3L9KA 3NHQA 4X0GA 1USSA 5I2ZA 2DDAA 2BGCA 1K6OA 4IHSA 1V55H 3RH8B 1ZG1A 3HYGA 3OPRA 1K83J 3DWLE 4K2EA 3A3FA 2CLTA 3BTCA 1MGTA 2WADA 2KOIA 4Y17A 4KG2A 5L3CA 1OTAA 4XLEA 2FNPA 5LHHA 2B9SA 2DW0A 3H35A 3K4LA 1A85A 2VEAA 2MLSA 4R3VA 3HOWJ 1F1ZA 1OJ5A 3FPVA 2H28A 4HG2A 1MC0A 2YIGA 4LLGF 1W5CC 2W00A 2D01A 3NCKA 4ZAMA 1TC3C 3H5AA 1SCWA 2LG4A 1G3SA 1KE4A 2FNAA 1BQQM 4WZVA 1SFKA 3KZYA 2A49A 1WPKA 2W3HA 3A3IA 3NIAA 1ROSA 2LY1A 3S93A 1CJFA 1G3TA 5FD6A 2OAZA 4CCMA 3QAHA 3TKYA 1XJ6A 4G9YA 1JK3A 2DW4A 3G35A 1BI3A 4DXCA 2VC0A 2OCCH 3FKVA 4DN0A 1CGFA 1SVMA 1GO8P 2YR2A 2X85A 1GA0A 3PR6A 3U1DA 4WZ5C 1S9HA 1U0JA 2XF7A 3G71I 3CKIA 4OP5A 2P5VA 1OQYA 1JGSA 4HF2A 1ONVA 3HREA 1HKSA 3WTUC 4KUOA 1TW3A 3CF2A 4M3BA 3SXYA 4AWXB 1Z6TA 2PR5A 3F17A 4XXRA 3CC4I 3FXKA 1UG0A 5J4YA 1UMSA 4A0YA 2HQNA 4GD6A 4LMYA 1V9YA 5EVIA 3F8MA 1YIJI 4FUWA 3VV4A 4H82A 4IUWA 1LKXA 1WJBA 4IOCF 2P9VB 1FILA 2QGUA 1F9IA 3NARA 3WS2A 4A0ZA 4S0HB 2R7WA 4N9LA 4RGSA 4LGWA 1ETXA 3KEOA 4PSWA 5LD2C 2GIZA 3HPGA 3MKWB 1DUXC 4X56A 1YW8A 4ZJ1A 3O2XA 2KJBA 3U1RA 1LQ1A 1HC8A 5E79C 2R7XA 3PTEA 3KZZA 4Q0HA 4CGZA 1T33A 2R7OA 5H2FC 4BACA 2ZM2A 4OOYA 1HDDC 3UMEA 5J40A 4CCNA 4BE2A 5BOXA 2DNSA 3Q0UA 2YX4A 1SD5A 4XL9A 3I4NJ 2VX8A 2WWYA 1ZKJA 5F04A 3SYTA 2ZBKA 5LGUA 2R9WA 2WKIA 2VI6A 2NVQJ 1VEUB 1MD0A 2BG1A 2E2DA 3E5UA 5EGOB 2O9LA 3BFCA 2KFDA 4C2MJ 4ZRRA 1MZBA 1ITYA 3RJPA 3ZHHA 3BTJA 1YP1A 3DPFA 4GLQA 3TS4A 3HM5A 1CF7A 3LGPA 1XC5A 4DYCA 4MMNA 4D9JA 4BDZA 3EYYA 2Z5UA 5CPRB 3GTLJ 1MBLA 2PBDP 1RGZA 4KT5C 1VB6A 3VOYA 4M9ZA 1MNCA 1VQQA 1FOXA 2JWTA 5L79A 4MN7A 4G7HF 4B1RA 4AUXA 1ODVA 2QSFX 1KUKA 3P7NA 2VQHA 3K6GA 3DFGA 4A5MA 3QP5A 1ETVA 3S1YA 4M6YA 5H20A 2JIHA 1IAEA 4F7ZA 3HLFA 3ML6A 1MIJA 4QB8A 2IA2A 2M1CA 3LMMA 2DCFA 1HTDA 1H9TA 4WF6A 3KYEA 3AG4H 2BY1A 2Q2EB 4HNTA 2K31A 4U7BA 1ZLJA 5IOZA 2Y2LA 1RESA 3HOUJ 3I4PA 1RP5A 3S32A 1K54C 2H0TA 1Z0XA 3FC7A 3NECA 3WTVC 5F68A 1GDTA 4I09A 2J9PA 4BBRJ 2K7LA 4KT6A 1K4EA 4C30A 2L7KA 4R38A 4G3KA 2R7UA 1ACIA 3EDPA 2JHEA 5G18A 1HW5A 1WJFA 2ZL1B 2JA2A 3BQYA 1KVLA 4RA7A 3WRTA 4ME4A 3A0RA 1GE5A 4M73A 4YIIA 2IA1A 2WAEA 3A0HC 1VNDA 2E7WA 3Q07A 3O2PE 3V42A 3RXXA 1QVUA 1O3SA 3M4OJ 3J81K 4A3LJ 1LJ9A 3HCYA 1ZELA 2XF5A 3E3VA 1H8ZA 3MFDA 4LLOB 5FQ9A 4ITVA 4WXHA 4HDUA 3ZNTA 1K7IA 1KQ0A 4KJZA 1N9OA 5H8XA 5DJUA 3K0LA 1R00A 5FKLA 1YCMA 2Y0SA 1BZSA 4OIQF 1VQ6I 1C3BA 1S7AA 2QSHX 4J01A 1GSXA 3KLNA 2OW0A 3TRCA 3COAC 3DWBA 2P81A 3MKZA 3OL4A 2VGKA 2LTPA 1U8BA 2KRJA 2VBYA 1QQIA 2XGEA 2XR0A 2XB5A 2ZNYA 1SATA 2VASA 2DMQA 1XS9A 2YKHA 4KG6A 5HARA 3SOIA 1FM1A 3OYDA 3FXMA 3E0YA 4X6TA 3RZOJ 2Z1DA 3TBIA 4F3LA 4O3MA 4PM5A 4XRMA 1T95A 2FA5A 4Y5FA 1Y0VA 3CI6A 3SFZA 3IHUA 5B66C 5FJ8J 2V8CA 2DMWA 1EF4A 2W1RA 3S3NA 1N9NA 2PU2A 4DE0A 1UFMA 3LSPA 2P5LC 3S4XA 4XM6A 5CRFA 3UB6A 2WZZA 5A2QZ 3OSFA 2HGCA 5FKMA 1VQ7I 1Q2QA 1QIBA 3QOPA 1R49A 2OVXA 4UXNA 4PKVA 5HL1A 1OT6A 2Y2ZA 1U8RA 2Y91A 4FASD 3MCZA 2NVXJ 3E8RA 3JW4A 3ZVTA 3BQZA 1RCJA 3E4PA 1OYWA 1ZHFA 3RPUD 1D0YA 2PG4A 3LILA 1B6AA 3KX2A 4PKUA 1Y1VJ 2EZIA 3GWZA 2EFWA 1LEBA 5IU1A 3HTSB 4GUYA 2BVLA 4CTHA 3K2NA 1XGOA 2VZWA 3OIQA 2Y0SN 4P9FA 4BNCA 3HHHA 4Q4ZF 1XFZA 1QMEA 2E35A 1EAKA 2V26A 4WCGA 3G42A 3UE1A 2UXXA 2Q9NA 4BXUA 2AQFA 2X6YA 4JQGA 4GOGA 4RGRA 2KLIA 1G6OA 1XFNA 4HJ4A 2F5EA 2JN6A 3A02A 4P6BA 2HVRA 4KQDA 4CHUA 4RX2A 2FXAA 4E4HA 2XASA 1YPRA 1LEAA 2WB1A 1NYMA 2G2UA 3EEAA 5F83A 3P24A 1K78B 4BL0B 4EGZA 1XTAA 1IYOA 3SH8A 3UN7A 2DBBA 4E3MA 3CJTB 4RB1A 3IHBA 5EYRA 3ZQFA 2L01A 4OPYA 5E2GA 3ZMZA 3I54A 3PNYA 2VOOA 3L1PA 2CG4A 5IP7J 4GDFA 3IWQA 1OM6A 3CLQA 4KISA 1ACFA 4QY6A 1XGIA 1EUBA 3O5YA 4HPQA 1W63M 3HYIA 2X4HA 5FLXZ 1XFVA 5AVEA 4GR8A 2LY9A 4DYQA 1ZG6A 3K70D 2J8YA 3A0VA 4ESBA 5D4RA 5HODA 1D7XA 3CUOA 3OWTA 1PNEA 3BA0A 1OTIA 2KLOA 3CG5A 2W85A 1YLFA 4AU7A 4BAYA 3OSGA 1OCRH 1G68A 4YNRA 4OIRF 4M3KA 2O6GE 3K4BA 5J47A 2EJRA 4H76A 5M5XJ 4F3LB 3OOPA 3BG3A 4XSZF 1OMJA 4AIDA 1FR1A 4OQIA 2LKSA 1LHYA 2WKPA 4BXXJ 3OCNA 5BPIA 3ZMDA 1UWNX 3FPWA 1X58A 2J5PA 2BW3B 3HKZA 2PJRB 4Q1LA 3N05A 3BTIA 4P1WA 4OLDA 2YX7A 3C4PA 3JVVA 1FIAA 1WGXA 3ZN0A 2VKSA 1YLTA 3L7HA 2H6BA 2KHMA 5K7ZA 4RA2A 3FDYA 3JR9A 3HJIA 4S2MA 1OCOH 2K2GA 3O64A 4GW9A 2K40A 4XM7A 5GPCA 4LFUA 2C6YA 2VC1A 1FYMA 3WRZA 1DJCA 2RGVA 4DZJA 3W8KA 5HSQA 2QQ9A 5K5BA 2VOPA 4YFNF 3S1QJ 3C8CA 2QYOA 5JFRA 4MIMA 2CV1A 2MD0A 4I98B 1FOYA 5D3CA 2P08A 3J80K 1PP8F 3G6OA 1PZPA 2XA7S 5DS9A 4HESA 1KQ8A 2O61A 4IVNA 1W36D 3MZDA 2WKQA 5EVIC 3ECHA 4CICA 4G12A 2GM4A 2O36A 3BG6A 3QP1A 2ICWG 2WTEA 3PNVA 5DFYA 3ZQ7A 3JTHA 3CP8A 2LFBA 3UB8A 3GDIA 1I5QA 2ZB9A 3LR4A 4XRSG 1VQ5I 2E5NA 2V1BA 1NLYA 3IWOA 3KYDB 1KAPP 4B88A 3T0YA 1MY8A 2QQAA 2R92J 1IXSB 5IP9J 4B3AA 5LLQA 3GV9A 4I3IA 4E3LA 2QM3A 3P9CA 2HJ9C 5E20A 5IPAA 2B02A 3VE3A 3ZCZA 4RGXA 1Q3AA 1LVAA 3V8KA 1ODDA 3CO6C 3NC8A 4HX3A 2ZMVA 2EK5A 2ACGA 1K57C 1MW7A 1LDJA 2WV0A 5FGMA 2Y2HA 5M18A 3HG9A 3BCAA 2FU4A 3G6EI 3KLOA 4BBUA 2LH9A 3LIBA 1JWVA 3QPSA 4PUSA 1KA8A 5E3NA 3LEAA 3FXLA 2OZUA 3HUNA 4Y15A 3N4IA 5F5YA 2Q8KA 2V9VA 1IEMA 1YLPA 4PFOA 1FCOA 1P2FA 4B43A 3OCLA 4WF2A 3B3XA 4FXYP 1L0DA 3UKGA 1W5SA 4XKCA 2KT0A 2M0CA 5HDCA 5L2FA 4DQ2A 3E4QA 3AIGA 5E1ZB 1C8TA 2E8IA 4DMZA 3U9GA 5EG0A 1LE8A 1NXYA 3LIAA 1TDGA 1UELB 5D2BA 5FAOA 2AQEA 3TQNA 2QLZA 3FKIJ 5KIZA 2LBFA 2PMZN 2WY8Q 3RKXA 3ROUA 5HD5A 4IF4A 1U5TB 3SZGA 3W6VA 4HSRA 3I7IA 4EM2A 3BR5A 1QMFA 2RQQA 4CYDA 2W1TA 1W7PB 1NLZA 1QHHD 1RC9A 3LSHA 5J4VA 4IHWA 4PM7A 4Q47A 2LVSA 1E3HA 1NG7A 2B63J 2DOEA 4OOIA 2LR8A 2P4WA 4HF1A 5FDHA 2P7VB 4WM9A 1C7KA 2OOLA 4WLAA 4ETXA 1R9TJ 2PJRA 3CHWP 1RUOA 4WZ5A 1FY7A 3S17J 2R9XA 4FX0A 5L07A 5L3FA 1H8AC 3JRDA 3BLYA 4MEYF 5CERA 3Q7VB 2VE8A 2OQGA 3G34A 3KFWX 3HLBA 2WY7Q 4F55A 1VFCA 2XD1A 2IWDA 3S7NA 3OOUA 1DJBA 2F5VA 2CW0F 1FBUA 1Y8QB 1ONGA 3ASNH 3NDGA 1CGPA 1Y4OA 2XQZA 2KPMA 2PAVP 1EW0A 1IRFA 1K56A 3MKFA 5DF9A 3UB5P 3M7GA 3ZXSA 3JRFA 3ZFZA 1XDSA 5HS9A 1YE9A 2L7FP 3HGYA 3RYRA 3SFIA 2MZEA 4KZ5A 2ZLYA 3PBOA 1BQOA 2PDRA 4CCOA 1RR8C 2D1OA 1ES3A 1EWZA 1V9ZA 2ESNA 4RM2A 3QODA 3H9JA 2OLUA 2JKRI 2W0DA 4NQWB 5GADJ 2WYXA 2K7SA 1JI8A 3NWTA 2SRTA 4JGOA 1GT0C 3GQZA 3OYJA 4OQGA 2M7UA 2UWMA 4P6ZS 3NOTC 1RZ4A 3AG1H 5EVEA 2DRWA 3TSKA 3HRMA 4XLFA 1K7AA 1T98A 2DA7A 2PEXA 4D2OA 2Y6DA 3EUHA 5C3EJ 2HV1A 1YW7A 4PJJA 4IX7A 2W3DA 2FJ1A 4MLOA 1YJNI 3HVFA 3E0JB 4YEJA 4ESJA 2DPUA 4HJ3A 2VPLA 1Y28A 2K4BA 3WHBA 2KKOA 3EQLF 1JTGA 3A1YA 2QKMB 1QPMA 2F4MB 1STZA 3RCOA 2VT3A 1A0KA 2FH5A 1CI8A 2JBFA 4KQOA 2HPIA 2CQ7A 2XFTA 2VKEA 2Y8HA 5F69A 1B8YA 1K55C 5L7FA 4BKXA 2A69F 1T56A 1IAGA 3KSIA 2BY0A 4OVDA 1KGGA 2IGKA 2OTJI 3BZKA 2QBYB 3CUQC 3GTGJ 4EBLA 2WO8A 2K3FA 2V6CA 4HBUA 1AXBA 1IABA 4Q5SF 4OPQA 3D5LA 2RDPA 2P9VA 2FV9A 2Z2LB 3ICYA 3OL3A 2JT6A 4UUSB 2EV6A 3KMEA 3RJUA 1BIWA 2VBZA 2E2HJ 4I3JA 4L63A 3TDZC 3P5JA 4LK1F 3IT9A 4LCMA 5A90A 4CLCE 4N9KA 2GWRA 1X1AA 3DPLC 1Z6FA 5K5OA 1GXPA 5AQ9A 2IA0A 4MTEA 4ZDLA 1JAQA 3HOVJ 4R1GA 1OR7C 1X1PA 3ITBA 4ZJ3A 2AHQA 4BY7J 2QHKA 4HY8A 3N2VA 2JNPA 4I76A 3GYHX 1ZR2A 1S4RA 4AIJA 2LF7A 1H0MA 3E6DA 3BEBA 2Y2JA 3HSFA 1FTZA 3IHAA 3HKZN 4Y4RA 2HFHA 5DUKA 2OCEA 5B5EC 4HQEA 1FOKA 2Y2IA 4NBQA 1VEUA 2KZVA 5D5UB 1VHMA 1ATLA 1LFUP 5F6FA 1SMTA 3HL2A 3K7AJ 1R36A 3EUHC 1B4AA 4L9JA 1BL0A 1ESIA 3PBTA 2PBIA 4MCWA 4AFIA 3N2UA 4IJOA 3SZPA 2XFSA 1QNTA 1Z7UA 1JKQC 1D8JA 1T8IA 3F1OA 3Q1FA 4WEJA 2EX2A 4K91A 4P85A 1IW7F 3RPQA 1NK2P 2A6HF 1YIOA 5M3FJ 3SS5A 3WV1A 3TJZC 1WYCA 1A04A 3L09A 2Y0MA 4E7SA 2J83A 4R3AA 2W3EA 3IH3A 4A93J 3EDIA 1FMVA 2BYVE 1MH4A 5E2EA 4WEKA 1NJ4A 2DA2A 4AIGA 3J7AY 3WG7H 5DD4A 1LI9A 3CAXA 4K0XA 2OD5A 5EECA 1FCNA 1I27A 1YITI 3G32A 3HRUA 2EZKA 1J7NA 3H82B 2DU9A 1IDZA 4GZBA 5EFWA 3HBUP 3F0CA 3K9TA 3VB2A 4C3JJ 3OYLA 2Y55A 4BQMA 4ZDOA 2X0LA 2HTSA 4B4ZA 3LSMA 5FKOA 3MA2A 2XF6A 2IXSA 4JX5A 2P0WA 4WWCA 2M4GA 3C30A 2OJED 1XP4A 3DW0A 1X4OA 3PUBA 2QA4I 1K38A 2Z6DA 4MHGA 2EIKH 2V1ZA 2VBWA 1LSVA 4S2NA 5M3MJ 4E3OA 2QBYA 2ME0A 5FLMJ 3VYUB 3JRGA 4KZ7A 1O3TA 4JLFA 1D7EA 4FTHA 1NY0A 4LPZA 2NNNA 2ZC7A 2W25A 5C44J 2HU9A 3SHIA 3GZ5A 3K4JA 1L0FA 3S3OA 1XUCA 2XS3A 3BJAA 5CHJA 2K27A 2KZGA 4NQWA 3A3DA 1MMPA 2DT6A 4O7DA 2E1MB 4X69A 5EVLA 3AL0B 3BROA 2RJQA 3KWVC 5M5WJ 5KK1A 4XM3A 4HQMA 3K7LA 3KP7A 4FCFA 5EOOA 3NOPC 1JVJA 5BS6A 3CCUI 3F1NA 1UMQA 2PU4A 2QMIA 4WBGA 5FSRA 4L9EA 3MWMA 4HZFA 2EB7A 1WJCA 2DJNA 5GTHC 1MJAA 2HI3A 5L3DA 4YRVA 1R1UA 2H8RA 3CUEA 3EYIA 1NRJA 3CMZA 2CYYA 2LDUA 4NK3A 2OV7A 3BZCA 5BOHA 2BY3A 1NG6A 3O87A 2FQ4A 3FXQA 5F0FA 3BRMA 4A3JJ 1T18A 1XUDA 4H3XA 1FIPA 1PIOA 2OY4A 4DF9A 1KU3A 5AIPA 1JIWP 1IN5A 2HWVA 5IOYA 1UGUA 1LDKB 3M1CA 1ZTRA 3H3VK 3DQVC 3UE6A 4QIWN 3G1MA 3QYFA 1LUJB 2WAQA 4JGQA 3OOVA 5E3MA 1CGEA 3CPTB 1XGNA 4NETA 4HLXA 5EDNA 2DODA 2ZXJA 3CCSI 1Z9CA 4C2TA 1UJ8A 1T2KA 1VQ4I 3ZDJA 5BPAA 3F15A 3LO7A 1V5EA 3CMYA 1K6SA 2HDUA 1MBJA 3SZTA 4I03A 1Y6IA 4B47A 4X53A 2JSDA 5AQBA 4JX4A 1YM1A 1MMAA 1S6RA 3K7NA 2ZC3B 3BC8A 1FBSA 3OYIA 1MXOA 3R7WA 1NTCA 4BMWA 2W14A 3QRFF 1FTTA 4EJWA 3V96B 4UUSA 1AA7A 2OUMA 1PRQA 1J3WA 2DT7B 5ICEA 1QU3A 2R3SA 1G28A 4JF6A 3LUNA 4BQOA 1PI4A 1I6XA 1MNEA 3KP4A 2CW8A 2XGCA 5D5XB 1IV8A 1PZOA 3DBAA 1ORKA 5HX9A 2ERPA 2V4BA 5TRDA 1Q2PA 2HYGD 2MLKA 4Z1WA 1LL9A 3DU5A 2Y2OA 3H9GA 4P6ZM 3VEPA 3O8HA 3NULA 2IS6A 2A61A 3CWFA 1FP1D 3MSHA 3NBLA 4JGPA 2W13A 1F36A 3A01B 1H88C 1WA9A 3LEQA 4LCLA 4MBKA 5DUIA 3OC2A 2EINH 1R1IA 3LSIA 2NVTJ 3VTGA 2E1MC 3CZDA 4C6YA 3IWIA 4KZ8A 5HDDA 1BLSA 2DQLA 3IS2A 1OR7A 1RIOH 5IHVA 3T1SA 2P7CB 5HNHA 4EM0B 1FPQA 3W2ZA 3HRSA 5HW3A 2MH2A 2IPQX 2GLOA 5DEQA 3M8EA 3B2ZA 2CV0A 3K10A 4ENJA 1F5TA 3SDBA 3E4OA 2GAUA 4KZBA 4Y0UA 4EGYA 2NOGA 2XHKA 3ZGKA 3G73A 1YHQI 4JGRA 1S3JA 2A5YB 1P92A 5F6AA 4N0BA 1BLHA 5JI6A 2I10A 5IYDJ 2F5CA 3C5AA 2HZTA 1WZ2A 3LUQA 1PUFB 3W6JB 1W63Q 4L9GA 3ABMH 4AVPA 4H0EA 4ZTKA 3QPTA 2XGXA 3UR3C 2JQ7A 2GQQA 5E2FA 2X6OA 4CA0A 3VOEA 4R79A 2E2JJ 1JT6A 2H8WA 5KAFC 2UUZA 1K55A 1XX2A 2GDNA 3IKVA 4PMAA 1GV2A 1OZ9A 3IBJA 5CVUA 3TEDA 4EJUA 3K4CA 3SDGA 3WS0A 5TJJA 2X6WA 3BPVA 2XPUA 3Q0VA 2YU3A 1W0TA 3DU6A 2IJLA 5BOYA 2H10A 4GYGA 2EA9A 1WH5A 4FTXA 2OY2A 3EPZA 4KIGA 4JBFA 3M8FA 1YRNB 2MZHA 4JOMA 1ONHA 1IDYA 5I12A 3KSGA 5CLSA 3IXGA 4EQIA 1W5TA 2CSOA 3FM3A 4EU0A 3LA3A 4O01A 3MVPA 4E7HA 1AWIA 3PBSA 4ZYAA 3UPOA 3K2ZA 2V9KA 2Z6CA 3DSLA 1EKEA 2MD5A 4UA7A 1PJRA 3UDIA 5HWVA 2W1TB 1Z77A 1KE0A 1HTZA 1R1VA 2L0WA 3SHFA 2IS2A 3T4OA 1XCVA 2FOKA 3UB7A 1ZRFA 5D8LB 1YLJA 3F1OB 3H36A 4CJNA 5KVRA 1Z3JA 3HBVP 3T4LA 3ZGAB 3CUEC 2X1DA 1TW2A 1BR4A 4BL3A 5EPHA 4C3QA 4A2UA 3CMMA 3OMYA 2Y2QA 2R7FA 3G30A 5I94A 3QP4A 1O0QA 2VV7A 4IEDA 2ZFWA 3BY8A 1Y0UA 1QIAA 3F16A 3DTIA 3G31A 1EJ9A 2YKFA 1XB4A 1LB2A 3N7WA 1TBXA 4OP8A 1W8QA 3LR5A 2ETHA 3CUQA 3LIKA 3CJNA 2QF7A 2H1LA 3S8PA 4D7NA 4LITA 3ZN1A 1MDMB 2W3GA 2XAUA 2I72A 1MBFA 3BR6A 3F18A 4OH0A 3MMYB 3WU2C 3UE0A 3CD6I 3T1RA 3B6AA 3C2BA 4XN3A 4L9VA 3OS2A 1T0FA 1HW2A 3IF5A 3Q7ZA 3I0TA 4NXGA 2FBIA 1DU6A 1ZTUA 4KIBA 2PT7A 3HBRA 1Y0NA 2VV6A 4Y0TA 5KMWA 1G6NA 1FNNA 4JXSA 3IH8A 4EUVA 4B4XA 2EFPA 5BNGA 2VKHA 3I7JA 2L02A 4LIUA 3CC7I 1YX5A 1JT0A 1WKMA 4XK4A 3ULQB 1REPC 2OV5A 3LNQA 4M9SA 1LL8A 3T4SA 5CTNA 4WKEA 1B72B 1HD8A 2JA8J 1QO0D 3VP3A 1KYZA 2RREA 2J9OA 3K69A 3MJQA 4HEA2 4BHBA 1H9GA 4K08A 2HDWA 2DTZA 1JTDA 1R1JA 5D7WA 2GOXB 4XKWA 2FFYA 1TVIA 1XJ2A 1J59A 3RQ4A 1IXCA 3MMHA 4EUZA 2ZC4B 1WQ2A 3DKYA 3F72A 1AKHB 1ZH5A 3GX4X 4GDBA 1JWPA 2UV1A 1GHPA 4KDPA 4II3A 2B95A 4N1HA 5I3MA 3FXJA 3RYPA 3ZRGA 3CCLI 1SEUA 4NKPA 3CCVI 3LCEA 5A91A 4CCLA 2M0MA 2QKPA 2L7ZA 1V4RA 4OLGA 5ILSA 1OCTC 5FD5A 1YRNA 3ELMA 2H5SA 3K3DA 2Y59A 3RPUA 3JCUC 4BJ5C 3RTSA 4GJ4A 1IN7A 1D1JA 3ZUKA 3LSJA 2PX9A 3V7CA 2PFBA 1Y1WJ 2PI0A 3OPPA 4GB7A 4IUHA 4KZ9A 1DU0A 3VOZA 5D1UA 3BJ6A 3TO6A 4DNCA 2R5ZB 4IBRA 4S2NC 4A3WA 2LSOA 5KSHA 2TDXA 4V2GA 3IWFA 2N8GA 1RRJA 4M4XA 4L6TA 3C3WA 2L7MP 1TZLA 2ZJ2A 1Z7LA 2WGIA 2BBYA 3KCCA 1NWZA 4GF1A 2LKXA 1G8XA 1DMTA 5DF7A 3VP4A 2X3AA 4RX3A 2ZSIB 2EZHA 3IV5A 2Z16A 1TT5B 3VSLA 1BA5A 2WK0A 3K4KA 3RSNA 3ZG0A 3K4MA 1KUGA 3KZIC 2K5CA 3LA7A 1JGGA 1I1GA 1TWCJ 2K85A 3ASOH 4P96A 3RIRA 4I0AA 3FZVA 3V7RA 2VUMJ 1BZAA 3HSEA 4UQIM 3DPEA 2HQRA 4WMCA 1CQTA 3KETA 2E71A 1I39A 2JE5A 2CUJA 5LRRA 1U60A 3ZQHA 4CZZA 5KHDA 2YUFA 4CYCB 4I6ZA 4UVAA 1YFHA 2GZAA 4KIFA 1VQNI 1U5TC 3ELKA 3ECOA 4Y13A 2XRNA 4BHPA 3AKZA 1K61A 1FX7A 1P4AA 2GA2A 2HEOA 1XSVA 4FH4A 4A0XA 3EOIA 4B09A 2FUG2 3PO2J 2GNXA 4YINA 3N8LA 1B3DA 2Y2NA 3IC7A 2L9VA 4UV9A 2IVMA 2MABA 4LB6B 1OFCX 4FE4A 2GXBA 2QWWA 4EETB 2KRCA 1SVOA 1ZAOA 1NZUA 4DV8A 5M19A 4ZR5A 5EOEA 5B5PA 2FMLA 4HV5A 2HOAA 5HS8A 1FEXA 1R22A 4IJAA 1ZRDA 1KBCA 2DMPA 2QCOA 4XLCA 4V2FA 3EUKL 4UQIS 3VFHA 1G4KA 1XKZA 1ND1A 3BR1A 1J0RA 1JTYA 4ZYEA 2MG4A 1OKRA 3BG7A 5BOTA 1SFEA 3HB2P 1LFBA 3BM6A 2IWBA 2LLKA 1UG2A 3T12B 2F4IA 3EGXC 1PDNC 2DMUA 4A5RA 2B0LA 1WJEA 2V0WA 2NRAC 4QSHA 2LMDA 4JIJA 5GL9A 4PM8A 1WJAA 1TD5A 2PHYA 4XT2A 2DDFA 5BQTA 1A36A 3ZMSA 5D1SA 4JP0A 456CA 4YIRX 1BYWA 4R3JA 3MKYB 2AIGP 1ASTA 3C2HA 3H92A 5F0CA 2LY2A 4CCJA 2CFXA 1ZTQA 2DW1A 3PM1A 2HNHA 1MWTA 2L4RA 4E7JA 3BW6A 5DVAA 1MMQA 3VFZA 5J1YA 5K5QA 3O6BB 3OS0A 3MXQA 3O3VA 3EETA 3ZCOA 3ISGA 5EVIB 3GUDA 1WSUA 5J6XA 3GLXA 3SW1A 1IOUA 3B42A 4C9YA 3OS1A 3VP1A 3D1NI 4N9IA 1BKCA 2DW2A 1U5TA 4IHVA 1BC8C 2VQGA 5CKTA 3LSGA 4JXWA 5EM1A 1Y93A 2Y69H 4PPRA 1ZR4A 1ZYRF 4KUKA 1GHIA 4BENA 3OHLA 4QKZA 3HOSA 2HR3A 3HUOA 3Q81A 2QZ8A 3ZMVA 1CGLA 1H8MA 3MKEA 1TQIA 1SMYF 3MQ0A 5LGTA 3L2CA 2OW2A 3G4SI 4DD8A 3CMEI 5J3LA 2EIJH 2PQ8A 2JA7J 1D1BA 3UNWA 4GGGA 5JYOA 1OM7A 4B9OA 4PFPA 1Y39A 2XS4A 3WODF 2L54A 5AIQA 1IRGA 1OO9A 3LK8A 1Y56A 1ES4A 1VQLI 2VK3A 3CCEI 4XUXA 3PIPF 4C75A 1GCEA 3HY9A 2DI3A 4KICA 3P9KA 4NB5A 5FL3A 5I43A 3A0BC 5GTIC 3O8GA 1MWRA 3F19A 3GEZA 3H5RA 3MAJA 3TDUC 2HP5A 2HDQA 1LVKA 4G0DA 1ON1A 4H6JA 5D1TA 2VE9A 1TTYA 4NXFA 2WGVA 1J9MA 1XMXA 2JUGA 3LA2A 4CLCB 3DBRB 4IHTA 2HDRA 4WYYA 3H0DA 5I0LA 2V1UA 4X55A 4B8XA 5CTMA 1Z21A 4LG3A 4RAZA 1F98A 4XCTA 1UEAA 3I7GA 4DW6A 2XA7M 5E3OA 3H3ZA 2ZO4A 2H0YA 3OLOA 2POJA 1QZEA 3N6IA 1UHSA 1YW9A 2Y79A 1JH1A 2H94A 3F3XA 3O86A 2W1OA 3A2KA 1GVJA 1GE6A 4QWOA 5DFXA 3ZG5A 1RGYA 1XFUA 3VOLA 1SFXA 3FF5A 5DV5A 1J5YA 2EBIA 1JUMA 2XKOA 3GMEA 3WE2A 3J7YJ 1G59A 1DJAA 3FISA 4XQFA 2XD5A 5E8GA 4CYCA 3AG2H 2ESHA 2FRHA 4Y0OA 4Z9QA 3TSGA 4I2OA 1ETYA 2K9LA 1AHDP 1MJ9A 3F8FA 3UE3A 3FM5A 4CUGA 1CQRA 3OYMA 3OYAA 5DCMB 4LENA 3HJKA 1HSTA 1BOAA 2UZKA 1BTLA 4GHIB 4XRFA 4EV0A 2MA3A 2ZMEA 1Q1VA 3S2WA 2MGQA 1VETA 4QJGA 2BV6A 1IC8A 3NY4A 3WS5A 2KISA 3C7VA 4S2IA 2ZQCA 4XT2B 2FF4A 1XURA 3G1OA 2A2LA 4RB3C 1TS0A 1F2KA 3K70C 3HOZJ 3EDGA 2VQLA 3C2WA 4C2UA 1ZXCA 3BQAA 3FBIB 2B5RA 2LK2A 5DTSA 1OJGA 4HI4A 3HUGB 3CITA 2G7UA 2FQ3A 1HKQA 2KL4A 3ZMTA 2XSSA 1B9NA 4I0BA 1E3UD 2PBYA 3OIPA 5FLVA 1XFQA 1DP6A 2CQNA 3PQJA 1X1DA 1IO2A 1WHUA 3R0JA 3WGGA 3P9IA 3DLAA 1MH3A 4IRIA 4ZJ2A 3UY6A 2NVUB 4D5CA 3D9YA 1G9KA 1U3EM 2PMZA 4MQ9F 1JTXA 3WTTC 1ERMA 1QZZA 1OCZH 4ENKA 3IRRA 3GFJA 3J80Z 3CCRI 5FAQA 1YT4A 2FX0A 1XGSA 1JKRC 1HOVA 3W4QA 2ZC6B 2V1XA 3GTKJ 3GTOJ 1ENHA 2R7QA 4U0YA 1BKCI 1BIBA 3Q9VA 3N97A 4PSXA 1I1SA 3HRTA 2EX6A 4PKQA 3C18A 3C38A 5M1AA 3WG9A 2PR6A 1T0FC 4N9HA 2CMNA 3FXOA 2OLVA 2ID6A 1EH6A 2YPRA 3FKJA 5I4OA 4HMAA 1BOBA 2HYFA 4FU4A 4HV6A 1ZG3A 3L7WA 1SHVA 1TEMA 1V3FA 5ERIA 3L2RA 4ETZA 1JKYA 4XNFA 3USNA 3LFUA 1GVDA 2DFIA 2V6EA 2ELJA 3S22A 3W4OA 3EHXA 2IS4A 2Z2SB 1M6KA 2VB6A 1JNUA 3K4NA 2FFFB 2L0RA 1L0EA 1TNSA 2DN0A 1SC7A 4LRYC 1QPIA 4DDSA 1S7EA 2CQKA 1UWPX 2X9DA 2OI0A 1E0EA 2UXNA 2L9NA 2WGWB 2JVGA 3AG3H 3FBNB 2BE5F 5LHIA 2A07F 1MZUA 3P98A 4YG2F 3NOUC 5MC7A 3WTWC 4HP9A 3R6SA 4LV3A 2PJTA 3AGDA 3E6MA 3GW2A 2XSDC 1BULA 3T1XA 3G3ZA 1Z1DA 2XPVA 4HW0A 1XDUA 3U1KA 1NRFA 1J2XA 3A3EA 2VXDA 2PN6A 2DYSH 1HOMA 3I4MJ 2Q1ZB 4W1UA 2ECCA 2DTRA 4WL9A 3T5XA 2NNYA 4F94A 1BSGA 1SKOB 2DJIA 3M07A 1YLYA 3FMQA 2CUZA 3H9QA 1WRJA 4G7ZF 4M6XA 5GLBA 3SS4A 3U4LP 1U9OA 2D2WA 2CH0A 1G3YA 4BE1A 4GD8A 2IT0A 4OONA 1VQOI 1LI0A 4E3JA 5FRNA 1K57A 4OIOF 3MZEA 1X3ZB 2FD5A 5KZHA 4BQAA 3DF8A 1D06A 4OWRB 2A3UA 1K25A 4KITB 2EV5A 2DDBA 3S1MJ 4CDGA 1W7PD 3DCFA 4EM1A 2ZM0A 2VLAA 4GKUA 2EWNA 4WXDA 2K9NA 3KHIA 1K0KA 4N1XA 4GHIA 4E3NA 3CP2A 5LFAA 4I02A 4M3GA 3LQ0A 5TBMB 3HLWA 5E8IA 4EXOA 5EUAA 4OKPA 1T6SA 4FQGA 2IW5A 4XONA 3AL0C 5CYVA 1SLNA 3V67A 4PJMA 2R4GA 1WYBA 2ZBBA 1FR6A 2KDKA 2BW3A 3LIDA 2F4OB 2RKHA 4AYBA 1Z09A 2ZXHA 3N4MA 1L0GA 1XPXA 2L1MA 5GLDA 1IN6A 3EEHA 3T4JA 1QUAA 1S7OA 2VL8A 4PJ0C 2JK3A 4EEPA 5IYCJ 5LGNA 4BQNA 1AF0A 1X3UA 3NRVA 2DK8A 4ANJA 2ADUA 2DMNA 2ZJRF 1BT5A 1DP8A 5F1RA 3GR2A 1S5LC 1X3WB 2AXLA 3LOCA 3E97A 1YSQA 2ZMAA 1XFXA 2H6CA 2A8HA 4Z2YA 2DFHA 4KA4A 3I56I 4A6EA 3S2HJ 2ZMFA 3IX8A 5TGFA 4U0WA 3MKLA 5AVFA 2EV0A 2OZ6A 1D8MA 4JQFA 4HNVA 3HUGA 3OYKA 1J9IA 1TVFA 1SD6A 3CJRB 3W3CA 1WI9A 3MN2A 3HEFA 2XKPA 3QPHA 4UV8A 4NUBA 3OYGA 3GO5A 4ESFA 3JSPA 2IBDA 3ZPLA 2P7JA 4S04A 2R0QC 1TWGJ 1D5JA 2CJJA 2MH9A 3KP2A 3S7QA 4MFEA 5GAHJ 3V3SA 1JKOC 2I5UA 1L6JA 4OOLA 2R5YA 4R8HA 4Q8IA 2DK5A 3WTZA 5GHXA 2CMPA 4GFBA 3ERED 1W4MA 4EVIA 1U2WA 2JUCA 5JHFA 1ZC2A 3RI4A 1MMGA 4O6JA 4LRXC 4ZYDA 4IRGA 4OAYA 2CV2A 2JKGA 1PWUA 4D60A 3GFIA 1G49A 2A6TA 4E7ZA 1RUNA 2TCTA 1IGNA 2ZQ8A 5EZHA 4UUTA 3D5SC 1N25A 3IAM2 2BTFP 4HBLA 2CW7A 5AJGA 4ZZDA 3LKAA 4Z6YA 5GLCA 3D72A 2I47A 3LQBA 3MZHA 4WXCA 3LIFA 1EB6A 1FT9A 1JXSA 4X1LA 2W57A 3ZQ5A 2QENA 1ZKGA 2W48A 3BTLA 1GA9A 4IHQA 5DCMA 1WI3A 1HCRA 4XBHA 1Z67A 3LFKA 3BJNA 3I3LA 4JXGA 1VQ9I 4R6LA 4BU2A 1ZGWA 2FMYA 4B3XA 3HSRA 4Y7NJ 2CRGA 2CQXA 1KE3A 2D02A 2Y2GA 2ZM8A 3RFBA 2VJWA 3WWXA 2CS3A 3I53A 1ZP5A 2TCLA 3WGHA 1IUFA 1G3WA 2D1HA 1FLIA 4ZBEA 5FI7A 4ILWD 1ZHHB 3WU1B 2WAQN 5G4ZA 4A69C 1E2XA 1PP7U 1K4SA 3NJAA 5GP9A 2QPJA 4FETA 3DWZA 4GYIA 1YQSA 1R71A 2F48A 5FQIA 5FKKA 4AUOA 2E2IJ 2K9QA 4L18B 4OIPF 3IBRA 3OR1C 3CUQB 4ASNA 4LG0B 4RBOA 3G2ZA 3WGIA 5CX7A 5TFQA 3V3RA 1ZVXA 4PZJA 2VGJA 3GVAA 2R7RA 2XGNA 3PJRA 2RAEA 1QRYA 2K2NA 3WTXC 4MNRA 5FQKA 5IY5H 2RNJA 4QWQA 5EM0A 9ANTA 4QPOA 3BWGA 1MMRA 2X1CA 4B4CA 3IKTA 4LRZE 3WV3A 1OYYA 2M30A 1NHAA 2LP0A 4EMSA 3CDHA 3R0AA 1MMBA 2OAQ1 3PSIA 2B7EA 2LC2A 1SKOA 2IP2A 1A6QA 5HLTA 2JCHA 1RNLA 2ZMEB 1D1AA 4UB8C 2Z99A 4X1MA 3DNGA 2VLGA 5EF6A 3HDDA 2OW9A 2GIVA 2VIXA 3B73A 5EEHA 3RDIA 2KIFA 3SH9A 2J5OA 4Y3OA 5DTDA 4IEJA 3RKQA 3KYLA 4P87A 5EGOA 1JHFA 3JRIA 3T1QB 1YI2I 3CCJI 4HIAA 3FWEA 2DA1A 4PCQA 2DFEA 5DYMA 2HOTA 4R1HA 3AGFA 2EPFA 2V1NA 2N8RA 4X68A 1AOYA 2M5WA 4FH2A 2CWEA 3E7LA 4NG2A 1CK3A 3HY7A 3H7WB 4C3IJ 3CF5F 1YO5C 5J3WA 2M4KA 2UWXA 2HKOA 3V5MA 1JJ9A 1BR1A 3KYCB 1FQGA 4H8RA 1HV5A 3KEJA 1K78A 1KUFA 2OBPA 5HDKA 1T08B 5BPDA 4KMFA 4BEHA 2KRFA 5DJTA 2DPDA 3OYCA 3GLLA 1KU9A 4ABZA 3M2KA 2IWCA 3UDFA 3OPLA 2EILH 5ILUA 1OTDA 4JBAA 4ETSA 4E7IA 4WF0A 3FHNA 4Q0JA 1N77A 1W0UA 2WGWA 3RTYA 4CPKA 2K9MA 3VWBA 2WOAA 5CVVA 1ZLKA 1KDWA 3QU6A 3KECA 4QD4A 3FKWA 2VN2A 5HOOA 4E6WA 4II2A 1CEFA 4H6JB 2EFNA 4IRHA 4IO9F 3ITAA 4GQLA 1PWWA 1LDDA 1OS9A 2EFQA 2PD7A 3UMDA 1G12A 5IS1A 1Y54A 3LUMA 4AYKA 1XN7A 3ABUA 4BWIA 2E3XA 4JPAA 1ZGAA 4M71A 5L3GA 1S66L 3U21A 3MZ8A 4CH7A 5ED4A 4LV2A 2G9WA 2NAZA 2R7TA 4UA6A 2ZXWH 1ZS0A 2COMA 1GSVA 4Q0IA 1D1CA 3S1NJ 2DAOA 2V79A 4XKVA 2L9RA 4JYKA 3OHOA 4F92B 4BUPA 2Y31A 2Y2PA 4ON1A 3EUAA 5CQGA 1DGWY 3BZ6A 1KU2A 1K6RA 3GCMA 4HQAA 3S2DJ 1GXDA 5E2HA 4BY1J 3LJGA 1ZGJA 1IYQA 1LFPA 5HDNA 2OAP1 3LI8A 3TGNA 2YS9A 3BFGA 2DA4A 2V4JC 3R61A 2QQ8A 4AIHA 1BI2A 3KP3A 1WJDA 5D4SA 2LOOA 3RZDJ 4LV1A 4KN7X 2QQBA 4IHYA 3LSKA 1YMXA 3N8SA 2NS8A 2P6TA 2XF3A 1JAPA 3TE8A 4A5NA 1X2MA 2BVMA 2BXZA 4I7HA 1E17A 3I5UA 1GHCA 1K54A 3FXRA 1KDSA 2DA6A 4JX6A 4MNUA 1QGPA 2NS0A 1L3LA 4I3AA 5CECA 2JKFA 4PK4A 1T1CA 4DKIA 3OYHA 3IF6C 1I3QJ 3TW8A 2MZIA 1B8IB 1TS8A 2IAIA 2VJ5A 5JVGF 4R70A 1POGA 2ZOHA 1QICA 1RKTA 3F22A 3MXSA 1S72I 1SRPA 1R5ID 2W0NA 2EFUA 3IRQA 3Q0WA 2QPNA 1OCCH 1EROA 2WA0A 1VQMI 5DM7F 4ZTFA 4CLCC 2Y6CA 2LB9A 4AD9A 1ETKA 2J7VA 4UEYA 3GTJJ 1FSEA 4BHCA 4EV4A 3V7SA 2OXWA 3HDAP 4HOIA 1SAUA 1W7FA 2HP6A 4EBNA 3IP4B 4V19K 3FV7A 3BCBA 4NXEA 2XEPA 1W79A 1SKFA 2MYSA 2HDCA 3DEWA 2PRFA 3EHYA 2HDSA 3GVBA 1G4DA 1FCMA 4FXQA 2MLRA 2M87A 3N8RA 3BG5A 1VTNC 1O0TA 1XM5A 1OPCA 3BECA 2LB5A 5E1XA 4A12A 1NH3A 5FLXK 2HS5A 2O7OA 1E4DA 1YSPA 5G4YA 3GTQJ 1IXRC 2QVOA 4D7MA 4PAUA 4EJOA 5BMZA 1K6YA 1KGEA 2STWA 3JYIA 2A5WA 4RAYA 2LBFB 1A5JA 1ESUA 4A3IJ 5D6FA 1R54A 4PKTA 4L0YB 2J0TA 3IUOA 2UV0E 3J7ZI 1YLWA 5L10A 2OPTA 3V8LA 3OYFA 1UHWA 1RMZA 3DPTA 1HW1A 4S2LA 4LJZF 3X2QH 2ZNZA 3TO7A 3VP0A 4MGRA 5J8XA 1HQCA 3ZQGA 1FSWA 2AVXA 4KMUX 2O3FA 5CGSA 4BJTA 5AONA 3F8CA 1XD7A 1UHMA 3MEXA 3RTRA 1KYWA 1O7EA 1YAXA 2P04A 1MKIA 3VE4A 3RTTA 4H1QA 5HPIA 2X3CA 4HAMA 4L9FA 2PMUA 3JAMZ 2JPBA 3DAVA 3MQOA 1CXVA 4G9LA 1IAWA 2XIGA 1T39A 3QQAA 5HVQC 3B8ZA 2K3PA 3UNGC 1SDEA 4P5OA 2HZ5A 2DOFA 4S2PA 1HFCA 2L2OA 4OQ0A 4F3QA 3KYZA 4MDZA 4ZYGA 3B47A 4ZDPA 3VPRA 1R4MB 5FKNA 2F5DA 2XAFA 4QTRA 3KO6A 1NZOA 2MC4A 3FHZA 2KIQA 2L9SA 1GV5A 4G6TB 3PIOF 4MN5A 1X19A 4KENB 2E36A 3M2JA 1R1TA 4XICA 2WKEA 2ME6A 3AYKA 3H5NA 4BBSJ 3U2RA 1U9NA 3ZQCA 4UVCA 1OPXA 3E2LA 3LL7A 5L8MA 2K9SA 4ZJZA 1KQ9A 2R7ZJ 1CF7B 4DXBA 3D0SA 1X0OA 3LJZA 1ZG5A 1GLNA 1M1EB 4EJVA 2V1DA 3A4CA 2ZQDA 3DL1A 3BDDA 3BR3A 3C4OA 2KMUA 1YS7A 4DPEA 2DT5A 5GAGJ 1ES2A 3L2WA 2EA2A 3OIOA 5LEKA 3F1NB 2R7DA 2WC2A 4I01A 4EQQA 5GAEJ 4HRIA 3EDZA 1SVLA 2LRDA 3KEYA 4BL2A 1OS2A 3R7WB 1FP2A 4KZ3A 4GR3A 4A6DA 2E5ZA 3FIWA 1YQAA 4A3GJ 2FBHA 3MZFA 3MQQA 3KP5A 1P0ZA 4E3KA 3A0SA 1Q1HA 2KIMA 2XC7A 1CI9A 1XA7A 2ISYA 2A24A 4II7A 5EVID 1KVMA 2AYKA 4KZ4A 2ZC2A 1R4NB 1TWAJ 2NVYJ 2Y9YA 3AAFA 2IGNA 2CGPA 2WUQA 4JP4A 5FB2A 1USTA 1VI0A 2ZCWA 3H1CA 3R4KA 3FXUA 2KQRA 4LK0F 4PJLA 4D1QA 3TW7A 1XSDA 3DWKA 1BJAA 1O57A 2VODA 1BR2A 5CHUA 1OT9A 4A3MJ 1IACA 3Q5FA 3KE2A 3JAMK 3ZP5A 1ETQA 4XOTA 4LOCA 3JVUA 3O88A 5JMYA 3Q9SA 2J3WA 2JMWA 1LPQA 4A3BJ 4GRIA 4PJNA 1KZHA 4MTDA 4IZZA 3NAUA 3HOTA 3K1PA 4AIKA 3W2AA 3LIEA 3LYXA 4R3BA 4BD1A 5FEFA 2R5ZA 1R1HA 1UTTA 5HWTA 4CO8A 1PWGA 2K02A 3GECA 5JR3A 3CCYA 4W97A 4GN2A 1MBHA 2QKLB 4DJ3A 2O3EA 2V20A 5K1YA 5HZHA 1BIAA 4OOMA 2E19A 4FE7A 5KSCA 1B9MA 2H09A 1FZPB 1FLSA 4IN9A 2ELHA 3M3YJ 3UPPA 3TOAA 2Y2KA 2DFFA 5FROA 5ICGA 1S8NA 1J75A 1X2NA 4L7AA 1TWFJ 4A3CJ 4DGWB 1KGFA 2Z2MB 1N9BA 3ONQA 3LAPA 2CFOA 3OYBA 5FFZA 1VETB 3G2YA 1BUEA 5GHZA 4DBQA 3F1AA 4G7OF 4R23A 2EWVA 4U0TA 3T1BA 2XGDA 4DRTA 4BYYA 4YFXF 3VFFA 4XR6A 2Y9ZA 1S67L 5CEBA 2DXIA 1K4TA 4GNUA 1Y8RB 2E1NA 1YTYA 3RXWA 3DV8A 5D8KB 1IN8A 3L2UA 3HL9A 4G94A 3HLCA 4JF5A 4KG5A 1WFXA 1JJ6C 2G0EA 2HXIA 1CEGA 5FA7A 5KCMA 2ZSHB 2TRTA 2R7SA 1KGSA 2R93J 2LKPA 4L5IA 2FZ0A 1E25A 4WMCD 3LJTA 1TWHJ 3H3UA 3VDXA 5TBMA 2EQRA 4WK7A 5IT3A 4FX4A 3VODA 2ZKZA 2OF7A 1CF0A 3AYUA 4XORA 1JHHA 2O8XA 4OPZA 1J09A 1S0WA 2A3SA 4IUKA 4EFSA 3V8JA 3CZ6A 4WN5A 4PKRA 2W84A 2DDYA 1PW8A 2K4JA 4HHDA 5F82A 2A68F 5FATA 1S1YA 4UHUA 2WBMA 1HA8A 1QZYA 5F64A 5CXWA 2IEKA 3PNTA 4PHTA 2P8TA 1D5VA 1ERDA 2ECBA 3ABLH 3UB9A 3FMRA 2STTA 3M6HA 1WNIA 1R55A 2RQPA 2X1EA 1FYLA 3FK6A 1Z05A 4GCVA 4LG0A 2JA5J 4A3KJ 1ZREA 1XXMA 3A3JA 4U3TA 4PDKA 2V1AA 1OMIA 2GZWA 3Q7VA 4M74A 1KUHA 2ELKA 2ZJQF 3QOEA 1IRXA 2PYPA 5B1BH 3T8TA 3BLMA 3H82A 3P01A 4EERA 2WKRA 3KSFA 1YKDA 4EQ1A 4WZ4A 5J4EA 1J7KA 3F23A 4J4MA 1JKPC 5HAQA 2LF8A 3H9WA 1T1AA 2M8GX 830CA 3TVCA 4NNJA 4U88A 4KQRA 4DOZA 1QBJA 2LD5A 5F1FA 3GZ6A 2HYJA 1SANA 1O7FA 2RN7A 5FO5A 4ENNA 1O07A 4NXBA 4R4SA 3JREA 1AWCA 2EZLA 4FSFA 1XFYA 2E34A 1SAXA 3WS4A 3OR2C 2O03A 1LSXA 1A35A 5GLAA 4BD0A 2MW8A 5HAPA 2AS5F 2EIMH 1R5HA 3WHCA 4L0ZB 4B93A 2JTVA 2EH3A 4G6QA 5J1RA 1WH7A 4PKWA 3TMOA 3FYZA 2W24A 1DY6A 5DTKA 4HNUA 1XMKA 2ISZA 2YU9J 1XFWA 4YOFA 5J8CA 4HEFA 1L2SA 2ZFUA 3K2AA 2MC3A 4MO7A 3IF6A 3VP2A 4UA9A 1I1IP 4GXOA 4OU0A 2PYRA 3AGEA 3HC7A 1HF0A 4M3DA 3JRAA 3HB9A 1D8KA 2D1VA 4U0VA 1XGMA 1GHMA 2EX9A 3HLGA 4HP4A 4JXVA 1KUIA 2ZQ7A 4B48A 2PD8A 4PKYG 1BN5A 3OV8A 4BEHB 3LEZA 2Q0OA 4YELA 1H3QA 1K7QA 1QJJA 3OPHA 1TDLA 3SEZA 2F2EA 3HTUA 1XJ3A 5AQ7A 5ILVA 4Q48A 1MNMC 3F8BA 1ZXVA 1CAQA 5K7HA 5B5OA 3TO9A 1H5XA 1RI7A 3F6OA 4JK1X 4TV7A 5D3OA 2ZC5B 2XH9A 3DTMA 1GE7A 1X1BA 1USNA 1OTEA 3NX7A 1N78A 4L9TA 4ENMA 3G2BA 1BC7C 3DPUA 2L0KA 2K86A 2COBA 3E6BA 3E5XA 4UVBA 2EA4A 2VXZA 5HLHA 1HLUP 2XDVA 1PWDA 2Z9OA 2C6WB 3HUMA 3TT4A 4XUZA 1ON2A 3L0TA 3Q2HA 1OCPA 3BFDA 1FOWA 4M9XA 4ZYHA 1IF1A 2PLYA 4PKYA 1V54H 5ICFA 3ZQQA 5A2QK 2EXAA 3J81Z 4OQHA 2OVZA 3T8RA 2O9CA 4HSTA 2Z33A 1HLVA 1IFQA 5FASA 1IYSA 1VZ0A 1N4OA 3NI9A 2HGVA 3BT9A 3HOYJ 4KZ6A 3ABTA 3IXBA 1PWQA 3KP6A 4FOFA 4B44A 3S7OA 1IADA 3M9AA 3S15J 1R23A 4DZPA 3LSRA 1RKWA 2BLSA 1ZN2A 3K1NA 4I39A 4D5FA 4IVKA 5HS7A 1O4XA 3RKWA 5CJ9A 1T1BA 4NC8A 2FBKA 4I35A 1VM1A 2GBYA 1IELA 3S16J 2VV8A 4YWZA 4KNYA 2H27A 2ACJA 4DF6A 4WK8F 1R58A 3HJEA 3BQ8A 4N92A 2HVQA 4E7LA 4JPMA 3FZCA 4HA8A 1C3IA 4C3HJ 2E60A 2RVCA 3PBNA 4AM3A 1MWUA 4JF4A 4EW7A 5F0HA 3W2WA 5FQQA 1P4WA 3IH2A 4UHTA 4NHJA 4OMYA 5LBQA 2P74A 3CJMA 2NUPC 4XOPA 2XAHA 1D0XA 1JWZA 1BW6A 3JRCA 1LT0A 1BM9A 3BR2A 1YYVA 1SZVA 2BHZA 3OY9A 4FCYA 2YB9A 1BM6A 3ERMA 3IXDA 3ZR8X 5IT5A 4N4NB 5DD8A 2J80A 3WU0A 2JT5A 2OXZA 2MBFA 5JLXA 2XUBA 4E6KG 1TP4A 2HOEA 3O3KA 5JYPA 2WAFA 5DCFA 5FRMA 4KQQA 2H1KA 3UPNA 3ABKH 5HDGA 3CDIA 4G3WA 2JRTA 3QP6A 1CIZA 5CVRA 3W6KB 1P7IA 1MMSA 3GTMJ 1YMSA 2INWA 3I71A 1DPRA 2MFZA 2L3DA 2CQQA 4DE3A 2XRLA 4BS9A 4RS8A 3OBFA 1UMTA 2CU7A 1YJ9I 4RLQA 4M72A 3KX0X 4MEXF 2RC4A 4DBRA 5TISC 2JKTI 1X4PA 3I58A 4IBXA 1DGRM 4HDVA 3WV2A 5KAIC 3U2AA 2PMHA 5HL6A 1GO7P 1UCRA 2CO5A 4IL6C 4BJ6C 2V0UA 3GTCA 1I73A 4BBVA 3GBOA 4DE1A 4DYRA 3EDHA 4QU3A 4LIVA 1D8FA 2M7BA 4XLNF 3JTGA 2RCXA 4P9UA 4X6AJ 2QSGX 4PKSA 1SD7A 2VKVA 1TS6A 4IKFA 1SLMA 2M34A 4ZDXA 4QY5A 5J1UA 3GZNB 2JC7A 3PBQA 1ETWA 4HLYA 5HAIA 3B92A 2XAGA 1A31A 3GSGA 4HF0A 3V50A 4UNOA 3ISPA 5K7FA 3B02A 4E7KA 4Y3IA 2X48A 1MSEC 1TQMA 3DEUA 2AXTC 3TL4X 5EE8A 2KDZA 1H8YA 4P55A 5GHYA 1VQPI 1PUFA 5FAPA 1MWSA 1P9RA 2EX8A 2QZ6A 3LE9A 2M8EA 5LBRA 1O3RA 2G7HA 6PAXA 2HQ5A 4ARZA 1S4BP 4RB0A 2I8DA 4HX8A 4NDLA 1LNWA 1H71P 2LNBA 1BLPA 4HX4A 3S14J 3PL8A 4I38A 5CGXA 4JA1A 3ZNYA 5HFOA 2MJ6A 3PO3J 1FBQA 3R60A 3LFVA 4KFCA 1MPLA 1Y8JA 1N75A 4J00A 1MBEA 2HTJA 4MEZA 4OAZA 2JA6J 2VGLM 3NEUA 2M7AA 1P4XA 3JRBA 3PAEA 4Y52J 1YQYA 3CJQB 4Y33A 3I55I 2A6EF 1P6RA 4RGUA 4X1EA 2GJ3A 3VYSB 2VA0A 4HBTA 2GXAA 3TOBA 4IJGA 2XLNA 4G8XA 2D1NA 3D5RC 4UY8I 1HZOA 1TL8A 1K79A 1XX5A 3HOXJ 5DDGA 3F6VA 1WJ5A 2JPCA 4U7DA 1G2HA 3MD2A 2LYCA 3CQZJ 2X02A 4KUMA 1PVEA 3IXHA 3F21A 2M3AA 5GPAA 3ZQLA 2RL3A 4HJ6A 3GXOA 2O0YA 3I59A 3WTSC 2ZJ9A 3IS2B 1P7JA 1R6RA 4RDUA 1MMNA 1F5MA 3CO7C 2B18A 2YSRA 2E1OA 2QJ5A 3KSHA 3UO9A 1JANA 1VQKI 1N9LA 3IH9A 2RJPA 5TGTA 3T4KA 1YS6A 3CMAI 3S1RJ 1PWCA 3LR0A 3DBLB 1U78A 1I5ZA 4EATA 3ZMUA 3A01A 1FYKA 4E04A 3IX4A 1ALQA 3BP8A 4S2KA 5C5KA 1I76A 1K7GA 4OMZA 4RQ9A 3FK7A 3LR3A 1Z3YA 3T50A 1B8IA 2GXGA 4RYEA 4AYBN 2JVHA 2KP6A 3KMCA 5F1JA 4NEED 2BOLA 2HDDA 4A3FJ 2XSJC 4D0PA 3JPUA 3MR0A 1UTZA 1SFUA 5EEAA 4QLCU 5TR7A 5FDSA 3LY4A 2VQCA 2M7VA 2JSPA 2YUSA 2HOSA 5LABA 3LQRA 1IUYA 4OINF 2Y48A 4MBFA 4BLMA 3I9V2 1MSFC 3HLDA 3KEQA 3EWJA 1YG2A 1AKHA 1FWZA 2XK1A 4RAGA 2XAQA 5EZGA 4K0WA 5CUHA 2OU2A 4LLLA 4GS9A 4JKTA 5CGWA 1Z6RA 3QPLA 2OTLI 3CC2I 1PYVA 4U0XA 3EWKA 4G6DA 1DPUA 1SFOJ 2NYXA 1I50J 2BY2A 2HU6A 1SMPA 4EESA 4LD5A 1ZRCA 1S29A 4BGDA 4KYWA 1BUVM 3SQNA 2OQRA 1XSXA 1KU7A 4CQHA 4NC7A 3MF0A 3TW6A 3ZVWA 3AFHA 3CESA 1H89C 5IYBJ 4GDNA 1PI5A 2JJ7A 1I6HJ 3QP8A 3TG9A 4A3EJ 4I99C 5KNLA 3C2GA 3T4QA 3L2QA 3VMAA 3NQOA 1DDNA 3RQIA 1DQUA 4RM3A 1DP7P 4U87A 1IG7A 1SDNA 2VJJA 5A8BA 2J3TD 1DP3A 4KN4X 1PWPA 5HLGA 4WX9A 2X71A 4H49A 2V8FA 1UB9A 2KIUA 1B72A 3SH7A 4GWMA 1BBYA 2O9AA 2BZTA 1EH7A 1HBXG 1AKLA 1MMDA 3D3OA 3E6CC 2W4SA 4IQ4A 4HYEA 3KPHA 4R4RA 1B59A 3CCQI 1IAAA 4XM8A 4F93B 5L3EA 5K5RA 1FOFA 2EFXA 1G05A 4M3FA 1FJLA 3KRYA 2E7XA 3E98A 5CXAA 2W3FA 3HLEA 3ZQIA 2EXBA 4P0MA 4GS9B 1K56D 1JAOA 1IRZA 1DP9A 4EWFA 4FISA 1WWXA 2Y75A 3DP7A 2NS7A 2K9CA 2EWWA 2OW1A 1A6IA 5HDSA 1DTHA 1B1BA 1YOVB 1IKIA 3SS3A 5DKKA 4ARZB 3ZXHA 1ETOA 4FT8A 3RKYA 3QU3A 3C1DA 5HPFA 4XSXF 3HIFA 2HP9A 3VSKA 3QNBA 1ZK8A 4AC0A 3ZYTA 4EEUA 2FSWA 3E1SA 1YOUA 3K3CA 3CPTA 3T4TA 3FX3A 5CHMA 1GKDA 1E3PA 3L2VA 2M9HA 1EV7A 1P9QC 1BI0A 4IPAA 3K1MA 1PUEE 1BLCA 1OLTA 3I59B 2XROA 3QHYA 4MLLA 1IYPA 4IVIA 4BXFA 1O3QA 5H6RA 1ES5A 3DKXA 1PW1A 3LICA 4LLNA 2EFOA 2C5WB 2NUTC 4IQJA 4HH2A 1HDPA 2NOJB 2MLGA 3LQQA 4XMYA 5FI2A 1T19A 2USNA 4S2OA 2HKXA 4M6VA 4M3EA 4BBTA 3L0VA 1G6AA 4L5JA 5FFXA 2BASA 3F1PB 3PAGA 1XGJA 5H6QA 1PWVA 5FEGA 1ZG4A 1S1ZA 2FE3A 3PUFA 1XA1A 3F8NA 4XN0A 3PQKA 4EJTA 3WTYC 3LMCA 4MFDA 2OC6A 3HHGA 3ZOBA 2ZD8A 1XG1A 1UAAA 2M2EA 4DJAA 3G1LA 4A3DJ 4YFKF 3S3MA 5E43A 4BDYA 2DCEA 2X51A 3UDXA 5D5VB 4PGGA 2DYRH 2O99A 1X1CA 1XPBA 2QUFA 2FOWA 4PM6A 4BJPA 1D5YA 1W8YA 1LL5A 4XLAA 1RPWA 5J8FA 3CCMI 2QYBA 3D4FA 1JE8A 3PFIA 3LGOA 3ZG9B 3DEEA 5L09A 1GKCA 1QVTA 3FMSA 4X25A 3M8JA 3WE3A 5C4XJ 2WV1A 1P97A 4PGHA 1APLC 4FVLA 3TP0A 1XMAA 5IP6A 4CLCA 2ZXIA 2CUEA 4RMNA 4O0PA 1SD4A 3IL2A 1A86A 966CA 1XAXA 4A7BA 3QNCA 3GMWA 3GRJA 4WELA 4R0QA 2IRFG 5E17F 3EQUA 5F1GA 5A93A 2IGOA 3Q3SA 2OSUA 1ZQ3P 3W4PA 4NC6A 1VF9A 4GO1A 4YFMA 4F91B 5HD3A 3WS1A 4O5VA 1VQ8I 1IN4A 2AO9A 2VPRA 2JKTM 3MFXA 4FHTA 1IV6A 3HPHA 5IT9K 2ERQA 4ZZLA 5DM6F 1MBKA 2QEXI 3TOIA 1FBLA 3PXPA 1OTBA 2WO9A 1W1WE 4N4OB 1ZARA 1S4SA 4ESPA 1HFSA 1AYKA 5EV0A 1OYIA 1HSJA 5ICCA 3FG8A 1TS7A 4LV0A 4Y7PA 1OMEA 5CQEA 3IAS2 2R5YB 1PYYA 3CTAA 2A24B 3BY6A 2J3TC 1RR7A 5E3LA 4WUJA 1P9WA 2OXUA 5IT9Z 3S7PA 2HQAA 5B1AH 3DLLF 3SJMA 1OISA 3H7WA 4XRSA 4S2JA 3JRHA 1JUSA 3H0GJ 1TNTA 3MBZA 3ZG8B 2W12A 3QYEA 5HLIA 1TF1A 2KRHA 1MNDA 3VYRB 1FSHA 5CVIA 1K4FA 4PM9A 3M6BA 1RETA 1I2SA 2Q9MA 2DA3A 3HZJA 1UZCA 3MS6A 4L5EA 1TQPA 2V9PA 2DA5A 3BFEA 1BKCE 1GXQA 3IWZA 2NXNB 4H4KC 1BJZA 1V5GA 3NWSA 3V4GA 4UUVA 2QJ7A 1OM8A 1JUPA 4CZCA 2GX5A 3IQAA 1F43A 2G2WA 5J7EA 5A92A 3BY9A 2X3BA 3EGDC 3OYEA 1BSWA 3W2VA 2DOAA 2W15A 4H84A 2CKIA 3BG9A 3LI9A 1WE4A 2RV8A 4ZH4F 2D45A 2P5KA 5EJCA 3JSOA 1TLHB 3B6CA 2X01A 3G5CA 1R5GA 2KX6A 3HGGA 5DF8A 5U47A 5L3BA 1FC3A 2DMTA 4MN6A 3DKWA 3BFFA 4IHXA 3KYQA 2JT1A 1D0ZA 1LLBA 3E5QA 1FMWA 3PBRA 3IF6B 2Y4AA 4Y2FA 4GR0A 2DLLA 3TP3A 3KEKA 4XLHA 1KONA 3LSTA 2X6XA 5M5YJ 3NDEA 3Q82A 4DIQA 3ULFA 2DQRA 4YIFA 2BEOA 2EROA 4HOBA 2LREA 4L9NA 2XB0X 2MSYA 1OJLA 2OZRA 3Q2GA 2FV5A 4H2EA 1HXDA 5EEGA 3MZYA 5B3SH 3MXRA 3PYPA 1SU3A 2XDMA 2GOMA 5F08A 3SEQA 2GA1A 3DBHB 4S05A 2V2FF 4LB5A 4QPRA 2Z2DA 5C4JJ 2W7NA 4WKIA 4H30A 3VYTB 1QA6A 3M1EA 5CZMA 2M1BA 4HNBA 3L00A 1I2WA 2ZOIA 4I5SA 3CDLA 3PHYA 4AXQA 4E6XA 1NYYA 2P6SA 2L4MA 4RB2C 2KDOA 3BJOA 1HKTA 3BWLA 2O8KA 2OA4A 5FQMA 1IZ1A 2W82A 3F1PA 3LY3A 3V39A 1W7PA 3QYBA 5F27A 1WCMJ 3PFYA 1F4KA 1D3YA 1C0WA 2HJEA 4HH3A 1AU7A 5JLWA 3FWLA 3G4PA 1JIZA 3ZVSA 2O9BA 2F5FA 1Z3XA 2HXOA 4G3VA 1GUUA 4L0LA 4UAAA 5DKLA 1RM8A 4XBFA 4CCKA 2L4AA 3B33A 3C7UA 2A05A 1EI5A 2XVCA 1MDMA 1IKGA 1MJBA 1I3AA 3GFMA 3IH4A 4O8GA 2O5RA 4RAFA 4XLPF 2HPBA 3HBLA 4ID4A 3BR0A 1XCBA 4BH9A 2VBXA 1YJWI 3C7JA 2HPMA 2OWJA 2E1CA 1GSWA 1ERQA 1R7JA 2ZQ9A 4DE2A 2VGLS 1JJ8C 1FIKA 1KOUA 5JHUA 1BUDA 5D6EA 3DTEA 3BOQA 4CLCD 3GBGA 3QWLA 1IJWC 3KIOA 2L5QA 4IOAF 2D5VA 1BW5A 1PFLA 1HVBA 1O7LA 2Y2MA 3BLSA 1EA3A 1MBGA 1F9NA 2BHYA 2KJCA 3LAJA 5CEDA 1T38A 1S6LA 2HZDA 1MKMA 3GF2A 4UB6C 4FD8A 2F6CA 3MFKA 4DDYA 2IS1A 3EQVA 2OWHA 5EG0B 1LE8B 2HF6A 4GWNA 2VJ4A 2Z3YA 3P09A 5LEJA 5LRSA 2WB1N 2V9AA 2PJPA 3IX3A 5FQJA 1QJIA 2I9VA 2JRMA 5E18F 2QWSA 4OPRA 1LSWA 4DJ2A 2X7MA 3F9KA 2XPWA 1ULYA 1E3OC 1M40A 4E70A 2XV4S 5I5LA 1CQAA 1FSYA 5AQAA 1L0OC 3PSFA 2JSCA 2JKRM 3DTKA 4E3IA 1V5FA 4MQVA 4ZC3A 3I64A 1YLZA 2W27A 3QP2A 3ESWB 4CXFA 5DTTA 3BPXA 2WZXA 4IXAA 4QHCA 4BQQA 3L9FA 1YX3A 4XIDA 3J7AO 3DXJF 2CC1A 2R78A 1W36C 4EBPA 1Z91A 3E2KA 4XKBA 3OZHA 5FI6A 3HXLA 2RNGA 3UVCA 1U6GA 2VT2A 3OYNA 4QPQA 3GTPJ 5HWWA 4RLFA 3REOA 1NK3P 2XAJA 4J19A 3LWFA 4ZTJA 2JZYA 1CK7A 2ID3A 4CSWA 2ZMEC 2R7VA 5E1WA 4F52A 2E8JA 4KZAA 3ZG7B 4MBHA 2IGMA 2Y30A 4BE0A 1QHGA 2BXYA 2ZL1A 1DRMA 4L19A 5D5WB 4GCZA 3VI1A 2JN7A 2VONA 3LIRA 5JVTA 2FEZA 2VKDA 5LHGA 3HDBA 2DO7A 4AVZA 2CUFA 1WVRA 3A03A 2WKHA 4HX7A 2ZJPF 2ZQAA 4EEFG 5HNFA 2HVSA 3CLOA 1E3UA 2VJIA 1HY7A 4RVAA 3GFLA 4ON0A 1EH8A
chains in the Genus database with same CATH topology
3P1VA 1N78A 2V7FA 1TT0A 1X4OA 2CH0A 3PUBA 3G2BA 4BE1A 3DPUA 5HOOA 5LD2C 2DDFA 2VXZA 2XDVA 4X0GA 5FRNA 3TT4A 3L0TA 3Q2HA 3VYUB 5I2ZA 4OWRB 3HYGA 4KITB 3DWLE 3ZQQA 2HU9A 3SHIA 2WADA 2VLAA 3K4JA 1XUCA 3S3OA 2XS3A 5I4OA 2OVZA 3KHIA 4XLEA 4HSTA 1MMPA 2DT6A 3CP2A 1VZ0A 3H35A 3K4LA 2E1MB 5LFAA 1A85A 3AL0B 2DW0A 2MLSA 2RJQA 2YIGA 4HG2A 3KWVC 4XM3A 4B44A 3K7LA 2W00A 4XONA 3AL0C 1IADA 1SLNA 3H5AA 2LG4A 4PJMA 1BQQM 2R4GA 1SFKA 4WZVA 2BW3A 4AYBA 4NC8A 2ZXHA 1ROSA 1WJCA 2LY1A 3S93A 4I35A 4YRVA 4CCMA 1GE7A 1QUAA 2VL8A 2OV7A 1NG6A 2HVQA 4E7LA 1C3IA 4BQNA 1JK3A 1CGFA 1AF0A 4ANJA 1GO8P 1XUDA 2E60A 2OY4A 4H3XA 1JIWP 4DF9A 2X85A 3W2WA 1S9HA 1LDKB 1U0JA 2XF7A 3M1CA 3CKIA 4XOPA 1XFXA 1KAPP 3DQVC 3LE9A 4AUOA 5BPAA 3CF2A 1D0XA 2A8HA 3QYFA 3F17A 1UMSA 1UG0A 2WAQA 3OY9A 2W0DA 4H82A 1BM6A 1CGEA 4IUWA 1LKXA 1WJBA 3ZR8X 4C2TA 4N4NB 4JQFA 1D8MA 3OYKA 2JT5A 2OXZA 3CJRB 3W3CA 3OYGA 2R7WA 4E6KG 3F15A 4PSWA 4NUBA 2WAFA 1V5EA 3HPGA 3MKWB 5FRMA 3O2XA 4I03A 1D5JA 3U1RA 1CIZA 1Y6IA 4B47A 2R7XA 2JSDA 4XCTA 2MFZA 4BACA 2R7OA 4BS9A 1MMAA 1L6JA 1UMTA 4BE2A 4CCNA 3BC8A 3K7NA 3OYIA 2W14A 4RLQA 4XL9A 3V96B 2CMPA 3SYTA 1AA7A 2OUMA 4DBRA 2DT7B 1QU3A 1X4PA 5JHFA 3LUNA 1DGRM 3WV2A 1MMGA 4BQOA 1MNEA 1PWUA 2CW8A 4OAYA 2CV2A 2E2DA 2V4BA 2ERPA 1GO7P 1G49A 1YP1A 2A6TA 4E7ZA 4BJ6C 3DPFA 3TS4A 1I73A 3D5SC 3IAM2 3GBOA 3EDHA 3LGPA 2CW7A 3DU5A 4LIVA 4D9JA 2M7BA 3H9GA 5CPRB 4BDZA 1D8FA 2I47A 2IS6A 2W13A 1MNCA 1EB6A 4PKSA 1KUKA 2VQHA 3K6GA 4IKFA 1SLMA 1R1IA 4XBHA 3LSIA 3VTGA 3I3LA 2E1MC 1IAEA 2JIHA 4BU2A 4B3XA 3LMMA 1HTDA 4WF6A 4E7KA 5HNHA 2CS3A 2TCLA 4HNTA 2Q2EB 3B2ZA 4U7BA 3TL4X 2CV0A 5L79A 3K10A 4ILWD 3SDBA 2QPJA 4FETA 3S32A 3ZGKA 1S4BP 2I8DA 1H71P 4JA1A 3PL8A 3OR1C 4KT6A 1ZVXA 4C30A 2L7KA 2R7UA 1Y8JA 2R7RA 1WJFA 1N75A 4J00A 3PJRA 2JA2A 3UR3C 4OAZA 4CA0A 4R79A 1GE5A 2M7AA 1YQYA 2WAEA 4QPOA 1MMRA 2X1CA 3CJQB 2UUZA 4Y33A 3WV3A 3V42A 3VYSB 1MMBA 3PSIA 1ZELA 2LC2A 2XF5A 3K4CA 1K7IA 3D5RC 2X6WA 4ITVA 5HLTA 2D1NA 3DNGA 1D1AA 4KJZA 5H8XA 3DU6A 2OW9A 1YCMA 2VIXA 1WJ5A 5BOYA 2Y0SA 1BZSA 3MD2A 3HB2P 2LYCA 4J01A 1ZP5A 4Y3OA 2OW0A 2OY2A 3EPZA 2M3AA 3DWBA 3MKZA 3OL4A 2MZHA 4JOMA 5I12A 3KYLA 2KRJA 1R6RA 1SATA 2VASA 4E7HA 1MMNA 1FM1A 4ZYAA 2V9KA 2V1NA 1JANA 3OYDA 2N8RA 3DSLA 1PJRA 2RJPA 5TGTA 2Z1DA 3TBIA 3HY7A 1T95A 1Y0VA 2IS2A 4EATA 2M4KA 1JJ9A 1HV5A 1BR1A 3KEJA 1I76A 1K7GA 1KUFA 1Z3YA 3HBVP 966CA 3S3NA 4BEHA 2X1DA 4XM6A 3OYCA 1BR4A 2JVHA 2KP6A 3KMCA 3CMMA 3OMYA 2BOLA 1O0QA 2XSJC 1QIBA 4E7IA 1UTZA 2OVXA 3FHNA 2WOAA 1N77A 1QIAA 3F16A 4PKVA 2K9MA 2VQCA 2JSPA 3DTIA 3VWBA 5LABA 4FASD 3KECA 3I9V2 3E8RA 3EWJA 4II2A 3LIKA 3S8PA 4GQLA 4LITA 1PWWA 3RPUD 1D0YA 2XAUA 1OS9A 3F18A 3LILA 4PKUA 3KX2A 3MMYB 1G12A 5CUHA 4AYKA 3LUMA 4XN3A 3OS2A 2E3XA 2BVLA 4GUYA 4JPAA 1PYVA 4CTHA 3OIQA 3U21A 2HU6A 4CH7A 1SMPA 1XFZA 1BUVM 4BGDA 2R7TA 1EAKA 2V26A 1ZS0A 3G42A 1D1CA 4NC7A 2VKHA 4XKVA 4LIUA 3OHOA 1YX5A 2AQFA 2X6YA 3AFHA 3CESA 4BUPA 4F92B 4JQGA 4ON1A 3EUAA 5CQGA 1DGWY 4WKEA 2HVRA 5KNLA 3C2GA 1GXDA 2RREA 3LJGA 3L2QA 1LFPA 4HEA2 4E4HA 3P24A 2WB1A 1DQUA 2HDWA 4RM3A 4U87A 1R1JA 4BL0B 5D7WA 2GOXB 4XKWA 2VJJA 1PWPA 2V4JC 3RQ4A 1DP3A 4H49A 3DKYA 1WJDA 4GWMA 2LOOA 2UV1A 3PNYA 4II3A 1AKLA 1MMDA 3LSKA 1OM6A 5I3MA 4KISA 3ZRGA 1JAPA 2W4SA 1EUBA 4IQ4A 2BVMA 4HPQA 1IAAA 1XFVA 4XM8A 4CCLA 4F93B 4GR8A 2M0MA 3K70D 4PK4A 3ELMA 1G05A 3KRYA 5CXAA 3OYHA 1D7XA 3BA0A 3OWTA 2MZIA 2VJ5A 2KLOA 4AU7A 4BJ5C 1JAOA 1QICA 3RTSA 3ZUKA 2K9CA 2OXWA 2OW1A 3K4BA 1DTHA 1SRPA 5D1UA 4H76A 3ZXHA 4A3WA 2WA0A 2Y6CA 4ZTFA 1OMJA 3VSKA 1KUGA 4GWNA 3HDAP 1YOUA 3E1SA 4L6TA 1SAUA 1TZLA 1Z7LA 2BW3B 3IP4B 3HKZA 2PJRB 1GKDA 3BCBA 3N05A 3L2VA 4GF1A 4Q1LA 1P9QC 1G8XA 2MYSA 4P1WA 1OLTA 1DMTA 2X3AA 3EHYA 4FXQA 2ZSIB 4BXFA 2Z16A 2MLRA 3VSLA 3DKXA 3K4KA 2KHMA 3RSNA 3K4MA 2K5CA 4IQJA 2NOJB 3FDYA 3DPEA 4XMYA 2K2GA 2USNA 3O64A 3L0VA 1K6YA 4XM7A 2A5WA 2LBFB 2CUJA 1PWVA 1R54A 4PKTA 5KHDA 2J0TA 3IUOA 2YUFA 4XN0A 3OYFA 1RMZA 1Z3JA 3DPTA 3AKZA 2CV1A 2MD0A 2YB9A 2OC6A 3LMCA 5D3CA 2FUG2 1UAAA 4DJAA 1B3DA 3S3MA 1USNA 4BDYA 2DCEA 2MABA 4BJTA 2X51A 2KRCA 1W36D 3RTRA 1X1CA 4DV8A 4ZR5A 3RTTA 5B5PA 4H1QA 2O36A 2X3CA 3BG6A 4XLAA 1CXVA 4G9LA 1KBCA 3PNVA 3LKAA 1GKCA 5HVQC 3CP8A 3DEEA 4XLCA 3EUKL 3B8ZA 2K3PA 3UNGC 3M8JA 4P5OA 1G4KA 1ND1A 1HFCA 2L2OA 4F3QA 2E5NA 4FVLA 3BG7A 5BOTA 4ZDPA 2ZXIA 4RMNA 2F4IA 2MC4A 1A86A 2L9SA 1WJEA 4G6TB 4A7BA 1Q3AA 1X19A 4JIJA 3AYKA 1WJAA 3H5NA 4HX3A 2IGOA 1MW7A 3LQ0A 5D1SA 3HG9A 3BCAA 4F91B 456CA 3LL7A 2LH9A 3LJZA 4ZJZA 3MKYB 4PUSA 2ERQA 3HPHA 3C2HA 1ASTA 3LEAA 1GLNA 1FBLA 2LY2A 4CCJA 1ZTQA 3A4CA 2DW1A 2HNHA 3DL1A 2WO9A 4PFOA 4E7JA 4B43A 1MMQA 2KMUA 4N4OB 4DPEA 4FXYP 1AYKA 1HFSA 3OS0A 3L2WA 3ZCOA 4XKCA 4HRIA 3EDZA 2LRDA 4C9YA 3KEYA 3OS1A 1C8TA 5CQEA 3IAS2 1OS2A 3AIGA 5D2BA 1BKCA 1UELB 2DW2A 4GR3A 2E5ZA 2AQEA 2VQGA 5CKTA 3LSGA 1Y93A 2LBFA 2WY8Q 2OXUA 3OHLA 2XC7A 2CLTA 3SZGA 3HOSA 4HSRA 2HQAA 2AYKA 3I7IA 4QKZA 2RQQA 1QHHD 3LSHA 1CGLA 2IGNA 4JP4A 2OW2A 4D1QA 2W12A 3QYEA 2KQRA 1NG7A 4PJLA 2KRHA 1BSWA 1MNDA 3VYRB 1IACA 1D1BA 1C7KA 1BR2A 4PFPA 2XS4A 4XOTA 1OO9A 2PJRA 3LK8A 4DD8A 5JMYA 1Y56A 1BKCE 4H4KC 1V5GA 3NWSA 5I43A 3HY9A 4GRIA 4PJNA 4CZCA 4IZZA 1OM8A 3HOTA 3W2AA 4G0DA 3F19A 1R1HA 3BLYA 3H5RA 1UTTA 2X3BA 3OYEA 2W15A 3W2VA 2DOAA 4H84A 2WY7Q 1LVKA 4F55A 2CKIA 2QKLB 5D1TA 2O3EA 3OOUA 2F5VA 2JUGA 1FLSA 4IN9A 2KPMA 3G5CA 3H0DA 5I0LA 3ZXSA 1YE9A 2MZEA 1Z21A 4LG3A 5FROA 1BQOA 1D0ZA 4CCOA 1UEAA 2D1OA 3I7GA 4L7AA 1FMWA 3B92A 4DGWB 2POJA 4GR0A 4RM2A 3ONQA 3QODA 2CFOA 3H9JA 1KONA 4XLHA 2X6XA 3OYBA 4NQWB 1JH1A 4DIQA 3KEKA 4DBQA 2EROA 3F1AA 1JI8A 3NWTA 2LREA 2SRTA 2OZRA 2W1OA 4H2EA 3A2KA 2FV5A 3OYJA 1GE6A 3Q2GA 2UWMA 4XR6A 1SU3A 2GOMA 2DXIA 1XFUA 3SEQA 3TSKA 2Z2DA 4XLFA 4WKIA 3L2UA 2W7NA 4H30A 3VYTB 2Y6DA 5CZMA 1G59A 1WFXA 4PJJA 4IX7A 4XQFA 4MLOA 5KCMA 4AXQA 2ZSHB 3E0JB 4YEJA 2R7SA 2KDOA 2VPLA 1CQRA 2K9LA 3LJTA 4CUGA 3VDXA 3OYMA 3OYAA 4WK7A 2W82A 3A1YA 3NX7A 3QYBA 2QKMB 3PFYA 3RCOA 3AYUA 4XORA 2HPIA 1B8YA 1J09A 1JIZA 3ZVSA 3USNA 5L7FA 1Z3XA 4EFSA 3CZ6A 4PKRA 1IAGA 1RM8A 2DDYA 4CCKA 1XURA 3EDGA 3LQBA 2IGKA 3K70C 2VQLA 4C2UA 1ZXCA 2WO8A 2WBMA 2O5RA 3FBIB 1HA8A 3PNTA 1IABA 3HUGB 2HPMA 1ERDA 3D5LA 2KL4A 1PWQA 2FV9A 3OL3A 1WNIA 2JT6A 3OIPA 1R55A 2X1EA 3KMEA 1X1DA 1BIWA 1BUDA 3DTEA 3DLAA 4L63A 3GBGA 1G9KA 2L5QA 1KUHA 2PMZA 1EA3A 1X1AA 3DPLC 3QOEA 1IRXA 1JAQA 4ZDLA 2HZDA 2F6CA 1HOVA 1OR7C 3N2VA 4J4MA 2IS1A 2JNPA 2VJ4A 2R7QA 1BKCI 1QJIA 4PSXA 830CA 4Y4RA 4PKQA 3TVCA 4NNJA 2X7MA 4DOZA 2KZVA 3F9KA 1T0FC 1ATLA 1OM7A 3H9QA 3FKJA 3PSFA 3DTKA 1XFYA 1V5FA 3HL2A 1BOBA 3OR2C 4ZC3A 4FU4A 3EUHC 4HMAA 4IJOA 3N2UA 3L2RA 1JKYA 4XNFA 3LFUA 2V6EA 4PKWA 4BQQA 1YX3A 2ELJA 3EHXA 3TMOA 1W36C 2IS4A 2Z2SB 2VB6A 4XKBA 3K4NA 4HNUA 3HXLA 2RNGA 1XFWA 2L0RA 3UVCA 3WV1A 3OYNA 4QPQA 2ZFUA 1I1IP 4RLFA 2OI0A 1E0EA 2L9NA 3HC7A 4ZTJA 2JVGA 3FBNB 4E7SA 1CK7A 2J83A 1O0TA 1KUIA 4CSWA 2R7VA 1FMVA 3EDIA 4F52A 2IGMA 4B48A 4BE0A 1QHGA 4AIGA 2PJTA 4L19A 3J7AY 2AIGP 3VI1A 4BEHB 4YELA 3LIRA 1J7NA 4R3VA 2VKDA 1K7QA 1QJJA 3HDBA 4AVZA 3HBUP 2VXDA 3SEZA 3OYLA 5B5OA 2Q1ZB 4ZDOA 1ZXVA 5HNFA 1CAQA 2HVSA 1HY7A 2VJIA 3LSMA 3MA2A 2DJIA 2IXSA 2XF6A 2P0WA 2CUZA 2M4GA 1X1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTI A;  3DTK A;  3DTE A; 
#chains in the Genus database with same CATH topology
 2M45 A;  3P1V A;  2V7F A;  1BI1 A;  1TT0 A;  1G5U A;  1W5D A;  2Q2E A;  3BYD A;  5CVJ A;  1XJ4 A;  3L9K A;  3NHQ A;  4X0G A;  1USS A;  5I2Z A;  2DDA A;  2BGC A;  1K6O A;  4IHS A;  1V55 H;  3RH8 B;  1ZG1 A;  3HYG A;  3OPR A;  1K83 J;  3DWL E;  4K2E A;  3A3F A;  2CLT A;  3BTC A;  1MGT A;  2WAD A;  2KOI A;  4Y17 A;  4KG2 A;  5L3C A;  1OTA A;  4XLE A;  2FNP A;  5LHH A;  2B9S A;  2DW0 A;  3H35 A;  3K4L A;  1A85 A;  2VEA A;  2MLS A;  4R3V A;  3HOW J;  1F1Z A;  1OJ5 A;  3FPV A;  2H28 A;  4HG2 A;  1MC0 A;  2YIG A;  4LLG F;  1W5C C;  2W00 A;  2D01 A;  3NCK A;  4ZAM A;  1TC3 C;  3H5A A;  1SCW A;  2LG4 A;  1G3S A;  1KE4 A;  2FNA A;  1BQQ M;  4WZV A;  1SFK A;  3KZY A;  2A49 A;  1WPK A;  2W3H A;  3A3I A;  3NIA A;  1ROS A;  2LY1 A;  3S93 A;  1CJF A;  1G3T A;  5FD6 A;  2OAZ A;  4CCM A;  3QAH A;  3TKY A;  1XJ6 A;  4G9Y A;  1JK3 A;  2DW4 A;  3G35 A;  1BI3 A;  4DXC A;  2VC0 A;  2OCC H;  3FKV A;  4DN0 A;  1CGF A;  1SVM A;  1GO8 P;  2YR2 A;  2X85 A;  1GA0 A;  3PR6 A;  3U1D A;  4WZ5 C;  1S9H A;  1U0J A;  2XF7 A;  3G71 I;  3CKI A;  4OP5 A;  2P5V A;  1OQY A;  1JGS A;  4HF2 A;  1ONV A;  3HRE A;  1HKS A;  3WTU C;  4KUO A;  1TW3 A;  3CF2 A;  4M3B A;  3SXY A;  4AWX B;  1Z6T A;  2PR5 A;  3F17 A;  4XXR A;  3CC4 I;  3FXK A;  1UG0 A;  5J4Y A;  1UMS A;  4A0Y A;  2HQN A;  4GD6 A;  4LMY A;  1V9Y A;  5EVI A;  3F8M A;  1YIJ I;  4FUW A;  3VV4 A;  4H82 A;  4IUW A;  1LKX A;  1WJB A;  4IOC F;  2P9V B;  1FIL A;  2QGU A;  1F9I A;  3NAR A;  3WS2 A;  4A0Z A;  4S0H B;  2R7W A;  4N9L A;  4RGS A;  4LGW A;  1ETX A;  3KEO A;  4PSW A;  5LD2 C;  2GIZ A;  3HPG A;  3MKW B;  1DUX C;  4X56 A;  1YW8 A;  4ZJ1 A;  3O2X A;  2KJB A;  3U1R A;  1LQ1 A;  1HC8 A;  5E79 C;  2R7X A;  3PTE A;  3KZZ A;  4Q0H A;  4CGZ A;  1T33 A;  2R7O A;  5H2F C;  4BAC A;  2ZM2 A;  4OOY A;  1HDD C;  3UME A;  5J40 A;  4CCN A;  4BE2 A;  5BOX A;  2DNS A;  3Q0U A;  2YX4 A;  1SD5 A;  4XL9 A;  3I4N J;  2VX8 A;  2WWY A;  1ZKJ A;  5F04 A;  3SYT A;  2ZBK A;  5LGU A;  2R9W A;  2WKI A;  2VI6 A;  2NVQ J;  1VEU B;  1MD0 A;  2BG1 A;  2E2D A;  3E5U A;  5EGO B;  2O9L A;  3BFC A;  2KFD A;  4C2M J;  4ZRR A;  1MZB A;  1ITY A;  3RJP A;  3ZHH A;  3BTJ A;  1YP1 A;  3DPF A;  4GLQ A;  3TS4 A;  3HM5 A;  1CF7 A;  3LGP A;  1XC5 A;  4DYC A;  4MMN A;  4D9J A;  4BDZ A;  3EYY A;  2Z5U A;  5CPR B;  3GTL J;  1MBL A;  2PBD P;  1RGZ A;  4KT5 C;  1VB6 A;  3VOY A;  4M9Z A;  1MNC A;  1VQQ A;  1FOX A;  2JWT A;  5L79 A;  4MN7 A;  4G7H F;  4B1R A;  4AUX A;  1ODV A;  2QSF X;  1KUK A;  3P7N A;  2VQH A;  3K6G A;  3DFG A;  4A5M A;  3QP5 A;  1ETV A;  3S1Y A;  4M6Y A;  5H20 A;  2JIH A;  1IAE A;  4F7Z A;  3HLF A;  3ML6 A;  1MIJ A;  4QB8 A;  2IA2 A;  2M1C A;  3LMM A;  2DCF A;  1HTD A;  1H9T A;  4WF6 A;  3KYE A;  3AG4 H;  2BY1 A;  2Q2E B;  4HNT A;  2K31 A;  4U7B A;  1ZLJ A;  5IOZ A;  2Y2L A;  1RES A;  3HOU J;  3I4P A;  1RP5 A;  3S32 A;  1K54 C;  2H0T A;  1Z0X A;  3FC7 A;  3NEC A;  3WTV C;  5F68 A;  1GDT A;  4I09 A;  2J9P A;  4BBR J;  2K7L A;  4KT6 A;  1K4E A;  4C30 A;  2L7K A;  4R38 A;  4G3K A;  2R7U A;  1ACI A;  3EDP A;  2JHE A;  5G18 A;  1HW5 A;  1WJF A;  2ZL1 B;  2JA2 A;  3BQY A;  1KVL A;  4RA7 A;  3WRT A;  4ME4 A;  3A0R A;  1GE5 A;  4M73 A;  4YII A;  2IA1 A;  2WAE A;  3A0H C;  1VND A;  2E7W A;  3Q07 A;  3O2P E;  3V42 A;  3RXX A;  1QVU A;  1O3S A;  3M4O J;  3J81 K;  4A3L J;  1LJ9 A;  3HCY A;  1ZEL A;  2XF5 A;  3E3V A;  1H8Z A;  3MFD A;  4LLO B;  5FQ9 A;  4ITV A;  4WXH A;  4HDU A;  3ZNT A;  1K7I A;  1KQ0 A;  4KJZ A;  1N9O A;  5H8X A;  5DJU A;  3K0L A;  1R00 A;  5FKL A;  1YCM A;  2Y0S A;  1BZS A;  4OIQ F;  1VQ6 I;  1C3B A;  1S7A A;  2QSH X;  4J01 A;  1GSX A;  3KLN A;  2OW0 A;  3TRC A;  3COA C;  3DWB A;  2P81 A;  3MKZ A;  3OL4 A;  2VGK A;  2LTP A;  1U8B A;  2KRJ A;  2VBY A;  1QQI A;  2XGE A;  2XR0 A;  2XB5 A;  2ZNY A;  1SAT A;  2VAS A;  2DMQ A;  1XS9 A;  2YKH A;  4KG6 A;  5HAR A;  3SOI A;  1FM1 A;  3OYD A;  3FXM A;  3E0Y A;  4X6T A;  3RZO J;  2Z1D A;  3TBI A;  4F3L A;  4O3M A;  4PM5 A;  4XRM A;  1T95 A;  2FA5 A;  4Y5F A;  1Y0V A;  3CI6 A;  3SFZ A;  3IHU A;  5B66 C;  5FJ8 J;  2V8C A;  2DMW A;  1EF4 A;  2W1R A;  3S3N A;  1N9N A;  2PU2 A;  4DE0 A;  1UFM A;  3LSP A;  2P5L C;  3S4X A;  4XM6 A;  5CRF A;  3UB6 A;  2WZZ A;  5A2Q Z;  3OSF A;  2HGC A;  5FKM A;  1VQ7 I;  1Q2Q A;  1QIB A;  3QOP A;  1R49 A;  2OVX A;  4UXN A;  4PKV A;  5HL1 A;  1OT6 A;  2Y2Z A;  1U8R A;  2Y91 A;  4FAS D;  3MCZ A;  2NVX J;  3E8R A;  3JW4 A;  3ZVT A;  3BQZ A;  1RCJ A;  3E4P A;  1OYW A;  1ZHF A;  3RPU D;  1D0Y A;  2PG4 A;  3LIL A;  1B6A A;  3KX2 A;  4PKU A;  1Y1V J;  2EZI A;  3GWZ A;  2EFW A;  1LEB A;  5IU1 A;  3HTS B;  4GUY A;  2BVL A;  4CTH A;  3K2N A;  1XGO A;  2VZW A;  3OIQ A;  2Y0S N;  4P9F A;  4BNC A;  3HHH A;  4Q4Z F;  1XFZ A;  1QME A;  2E35 A;  1EAK A;  2V26 A;  4WCG A;  3G42 A;  3UE1 A;  2UXX A;  2Q9N A;  4BXU A;  2AQF A;  2X6Y A;  4JQG A;  4GOG A;  4RGR A;  2KLI A;  1G6O A;  1XFN A;  4HJ4 A;  2F5E A;  2JN6 A;  3A02 A;  4P6B A;  2HVR A;  4KQD A;  4CHU A;  4RX2 A;  2FXA A;  4E4H A;  2XAS A;  1YPR A;  1LEA A;  2WB1 A;  1NYM A;  2G2U A;  3EEA A;  5F83 A;  3P24 A;  1K78 B;  4BL0 B;  4EGZ A;  1XTA A;  1IYO A;  3SH8 A;  3UN7 A;  2DBB A;  4E3M A;  3CJT B;  4RB1 A;  3IHB A;  5EYR A;  3ZQF A;  2L01 A;  4OPY A;  5E2G A;  3ZMZ A;  3I54 A;  3PNY A;  2VOO A;  3L1P A;  2CG4 A;  5IP7 J;  4GDF A;  3IWQ A;  1OM6 A;  3CLQ A;  4KIS A;  1ACF A;  4QY6 A;  1XGI A;  1EUB A;  3O5Y A;  4HPQ A;  1W63 M;  3HYI A;  2X4H A;  5FLX Z;  1XFV A;  5AVE A;  4GR8 A;  2LY9 A;  4DYQ A;  1ZG6 A;  3K70 D;  2J8Y A;  3A0V A;  4ESB A;  5D4R A;  5HOD A;  1D7X A;  3CUO A;  3OWT A;  1PNE A;  3BA0 A;  1OTI A;  2KLO A;  3CG5 A;  2W85 A;  1YLF A;  4AU7 A;  4BAY A;  3OSG A;  1OCR H;  1G68 A;  4YNR A;  4OIR F;  4M3K A;  2O6G E;  3K4B A;  5J47 A;  2EJR A;  4H76 A;  5M5X J;  4F3L B;  3OOP A;  3BG3 A;  4XSZ F;  1OMJ A;  4AID A;  1FR1 A;  4OQI A;  2LKS A;  1LHY A;  2WKP A;  4BXX J;  3OCN A;  5BPI A;  3ZMD A;  1UWN X;  3FPW A;  1X58 A;  2J5P A;  2BW3 B;  3HKZ A;  2PJR B;  4Q1L A;  3N05 A;  3BTI A;  4P1W A;  4OLD A;  2YX7 A;  3C4P A;  3JVV A;  1FIA A;  1WGX A;  3ZN0 A;  2VKS A;  1YLT A;  3L7H A;  2H6B A;  2KHM A;  5K7Z A;  4RA2 A;  3FDY A;  3JR9 A;  3HJI A;  4S2M A;  1OCO H;  2K2G A;  3O64 A;  4GW9 A;  2K40 A;  4XM7 A;  5GPC A;  4LFU A;  2C6Y A;  2VC1 A;  1FYM A;  3WRZ A;  1DJC A;  2RGV A;  4DZJ A;  3W8K A;  5HSQ A;  2QQ9 A;  5K5B A;  2VOP A;  4YFN F;  3S1Q J;  3C8C A;  2QYO A;  5JFR A;  4MIM A;  2CV1 A;  2MD0 A;  4I98 B;  1FOY A;  5D3C A;  2P08 A;  3J80 K;  1PP8 F;  3G6O A;  1PZP A;  2XA7 S;  5DS9 A;  4HES A;  1KQ8 A;  2O61 A;  4IVN A;  1W36 D;  3MZD A;  2WKQ A;  5EVI C;  3ECH A;  4CIC A;  4G12 A;  2GM4 A;  2O36 A;  3BG6 A;  3QP1 A;  2ICW G;  2WTE A;  3PNV A;  5DFY A;  3ZQ7 A;  3JTH A;  3CP8 A;  2LFB A;  3UB8 A;  3GDI A;  1I5Q A;  2ZB9 A;  3LR4 A;  4XRS G;  1VQ5 I;  2E5N A;  2V1B A;  1NLY A;  3IWO A;  3KYD B;  1KAP P;  4B88 A;  3T0Y A;  1MY8 A;  2QQA A;  2R92 J;  1IXS B;  5IP9 J;  4B3A A;  5LLQ A;  3GV9 A;  4I3I A;  4E3L A;  2QM3 A;  3P9C A;  2HJ9 C;  5E20 A;  5IPA A;  2B02 A;  3VE3 A;  3ZCZ A;  4RGX A;  1Q3A A;  1LVA A;  3V8K A;  1ODD A;  3CO6 C;  3NC8 A;  4HX3 A;  2ZMV A;  2EK5 A;  2ACG A;  1K57 C;  1MW7 A;  1LDJ A;  2WV0 A;  5FGM A;  2Y2H A;  5M18 A;  3HG9 A;  3BCA A;  2FU4 A;  3G6E I;  3KLO A;  4BBU A;  2LH9 A;  3LIB A;  1JWV A;  3QPS A;  4PUS A;  1KA8 A;  5E3N A;  3LEA A;  3FXL A;  2OZU A;  3HUN A;  4Y15 A;  3N4I A;  5F5Y A;  2Q8K A;  2V9V A;  1IEM A;  1YLP A;  4PFO A;  1FCO A;  1P2F A;  4B43 A;  3OCL A;  4WF2 A;  3B3X A;  4FXY P;  1L0D A;  3UKG A;  1W5S A;  4XKC A;  2KT0 A;  2M0C A;  5HDC A;  5L2F A;  4DQ2 A;  3E4Q A;  3AIG A;  5E1Z B;  1C8T A;  2E8I A;  4DMZ A;  3U9G A;  5EG0 A;  1LE8 A;  1NXY A;  3LIA A;  1TDG A;  1UEL B;  5D2B A;  5FAO A;  2AQE A;  3TQN A;  2QLZ A;  3FKI J;  5KIZ A;  2LBF A;  2PMZ N;  2WY8 Q;  3RKX A;  3ROU A;  5HD5 A;  4IF4 A;  1U5T B;  3SZG A;  3W6V A;  4HSR A;  3I7I A;  4EM2 A;  3BR5 A;  1QMF A;  2RQQ A;  4CYD A;  2W1T A;  1W7P B;  1NLZ A;  1QHH D;  1RC9 A;  3LSH A;  5J4V A;  4IHW A;  4PM7 A;  4Q47 A;  2LVS A;  1E3H A;  1NG7 A;  2B63 J;  2DOE A;  4OOI A;  2LR8 A;  2P4W A;  4HF1 A;  5FDH A;  2P7V B;  4WM9 A;  1C7K A;  2OOL A;  4WLA A;  4ETX A;  1R9T J;  2PJR A;  3CHW P;  1RUO A;  4WZ5 A;  1FY7 A;  3S17 J;  2R9X A;  4FX0 A;  5L07 A;  5L3F A;  1H8A C;  3JRD A;  3BLY A;  4MEY F;  5CER A;  3Q7V B;  2VE8 A;  2OQG A;  3G34 A;  3KFW X;  3HLB A;  2WY7 Q;  4F55 A;  1VFC A;  2XD1 A;  2IWD A;  3S7N A;  3OOU A;  1DJB A;  2F5V A;  2CW0 F;  1FBU A;  1Y8Q B;  1ONG A;  3ASN H;  3NDG A;  1CGP A;  1Y4O A;  2XQZ A;  2KPM A;  2PAV P;  1EW0 A;  1IRF A;  1K56 A;  3MKF A;  5DF9 A;  3UB5 P;  3M7G A;  3ZXS A;  3JRF A;  3ZFZ A;  1XDS A;  5HS9 A;  1YE9 A;  2L7F P;  3HGY A;  3RYR A;  3SFI A;  2MZE A;  4KZ5 A;  2ZLY A;  3PBO A;  1BQO A;  2PDR A;  4CCO A;  1RR8 C;  2D1O A;  1ES3 A;  1EWZ A;  1V9Z A;  2ESN A;  4RM2 A;  3QOD A;  3H9J A;  2OLU A;  2JKR I;  2W0D A;  4NQW B;  5GAD J;  2WYX A;  2K7S A;  1JI8 A;  3NWT A;  2SRT A;  4JGO A;  1GT0 C;  3GQZ A;  3OYJ A;  4OQG A;  2M7U A;  2UWM A;  4P6Z S;  3NOT C;  1RZ4 A;  3AG1 H;  5EVE A;  2DRW A;  3TSK A;  3HRM A;  4XLF A;  1K7A A;  1T98 A;  2DA7 A;  2PEX A;  4D2O A;  2Y6D A;  3EUH A;  5C3E J;  2HV1 A;  1YW7 A;  4PJJ A;  4IX7 A;  2W3D A;  2FJ1 A;  4MLO A;  1YJN I;  3HVF A;  3E0J B;  4YEJ A;  4ESJ A;  2DPU A;  4HJ3 A;  2VPL A;  1Y28 A;  2K4B A;  3WHB A;  2KKO A;  3EQL F;  1JTG A;  3A1Y A;  2QKM B;  1QPM A;  2F4M B;  1STZ A;  3RCO A;  2VT3 A;  1A0K A;  2FH5 A;  1CI8 A;  2JBF A;  4KQO A;  2HPI A;  2CQ7 A;  2XFT A;  2VKE A;  2Y8H A;  5F69 A;  1B8Y A;  1K55 C;  5L7F A;  4BKX A;  2A69 F;  1T56 A;  1IAG A;  3KSI A;  2BY0 A;  4OVD A;  1KGG A;  2IGK A;  2OTJ I;  3BZK A;  2QBY B;  3CUQ C;  3GTG J;  4EBL A;  2WO8 A;  2K3F A;  2V6C A;  4HBU A;  1AXB A;  1IAB A;  4Q5S F;  4OPQ A;  3D5L A;  2RDP A;  2P9V A;  2FV9 A;  2Z2L B;  3ICY A;  3OL3 A;  2JT6 A;  4UUS B;  2EV6 A;  3KME A;  3RJU A;  1BIW A;  2VBZ A;  2E2H J;  4I3J A;  4L63 A;  3TDZ C;  3P5J A;  4LK1 F;  3IT9 A;  4LCM A;  5A90 A;  4CLC E;  4N9K A;  2GWR A;  1X1A A;  3DPL C;  1Z6F A;  5K5O A;  1GXP A;  5AQ9 A;  2IA0 A;  4MTE A;  4ZDL A;  1JAQ A;  3HOV J;  4R1G A;  1OR7 C;  1X1P A;  3ITB A;  4ZJ3 A;  2AHQ A;  4BY7 J;  2QHK A;  4HY8 A;  3N2V A;  2JNP A;  4I76 A;  3GYH X;  1ZR2 A;  1S4R A;  4AIJ A;  2LF7 A;  1H0M A;  3E6D A;  3BEB A;  2Y2J A;  3HSF A;  1FTZ A;  3IHA A;  3HKZ N;  4Y4R A;  2HFH A;  5DUK A;  2OCE A;  5B5E C;  4HQE A;  1FOK A;  2Y2I A;  4NBQ A;  1VEU A;  2KZV A;  5D5U B;  1VHM A;  1ATL A;  1LFU P;  5F6F A;  1SMT A;  3HL2 A;  3K7A J;  1R36 A;  3EUH C;  1B4A A;  4L9J A;  1BL0 A;  1ESI A;  3PBT A;  2PBI A;  4MCW A;  4AFI A;  3N2U A;  4IJO A;  3SZP A;  2XFS A;  1QNT A;  1Z7U A;  1JKQ C;  1D8J A;  1T8I A;  3F1O A;  3Q1F A;  4WEJ A;  2EX2 A;  4K91 A;  4P85 A;  1IW7 F;  3RPQ A;  1NK2 P;  2A6H F;  1YIO A;  5M3F J;  3SS5 A;  3WV1 A;  3TJZ C;  1WYC A;  1A04 A;  3L09 A;  2Y0M A;  4E7S A;  2J83 A;  4R3A A;  2W3E A;  3IH3 A;  4A93 J;  3EDI A;  1FMV A;  2BYV E;  1MH4 A;  5E2E A;  4WEK A;  1NJ4 A;  2DA2 A;  4AIG A;  3J7A Y;  3WG7 H;  5DD4 A;  1LI9 A;  3CAX A;  4K0X A;  2OD5 A;  5EEC A;  1FCN A;  1I27 A;  1YIT I;  3G32 A;  3HRU A;  2EZK A;  1J7N A;  3H82 B;  2DU9 A;  1IDZ A;  4GZB A;  5EFW A;  3HBU P;  3F0C A;  3K9T A;  3VB2 A;  4C3J J;  3OYL A;  2Y55 A;  4BQM A;  4ZDO A;  2X0L A;  2HTS A;  4B4Z A;  3LSM A;  5FKO A;  3MA2 A;  2XF6 A;  2IXS A;  4JX5 A;  2P0W A;  4WWC A;  2M4G A;  3C30 A;  2OJE D;  1XP4 A;  3DW0 A;  1X4O A;  3PUB A;  2QA4 I;  1K38 A;  2Z6D A;  4MHG A;  2EIK H;  2V1Z A;  2VBW A;  1LSV A;  4S2N A;  5M3M J;  4E3O A;  2QBY A;  2ME0 A;  5FLM J;  3VYU B;  3JRG A;  4KZ7 A;  1O3T A;  4JLF A;  1D7E A;  4FTH A;  1NY0 A;  4LPZ A;  2NNN A;  2ZC7 A;  2W25 A;  5C44 J;  2HU9 A;  3SHI A;  3GZ5 A;  3K4J A;  1L0F A;  3S3O A;  1XUC A;  2XS3 A;  3BJA A;  5CHJ A;  2K27 A;  2KZG A;  4NQW A;  3A3D A;  1MMP A;  2DT6 A;  4O7D A;  2E1M B;  4X69 A;  5EVL A;  3AL0 B;  3BRO A;  2RJQ A;  3KWV C;  5M5W J;  5KK1 A;  4XM3 A;  4HQM A;  3K7L A;  3KP7 A;  4FCF A;  5EOO A;  3NOP C;  1JVJ A;  5BS6 A;  3CCU I;  3F1N A;  1UMQ A;  2PU4 A;  2QMI A;  4WBG A;  5FSR A;  4L9E A;  3MWM A;  4HZF A;  2EB7 A;  1WJC A;  2DJN A;  5GTH C;  1MJA A;  2HI3 A;  5L3D A;  4YRV A;  1R1U A;  2H8R A;  3CUE A;  3EYI A;  1NRJ A;  3CMZ A;  2CYY A;  2LDU A;  4NK3 A;  2OV7 A;  3BZC A;  5BOH A;  2BY3 A;  1NG6 A;  3O87 A;  2FQ4 A;  3FXQ A;  5F0F A;  3BRM A;  4A3J J;  1T18 A;  1XUD A;  4H3X A;  1FIP A;  1PIO A;  2OY4 A;  4DF9 A;  1KU3 A;  5AIP A;  1JIW P;  1IN5 A;  2HWV A;  5IOY A;  1UGU A;  1LDK B;  3M1C A;  1ZTR A;  3H3V K;  3DQV C;  3UE6 A;  4QIW N;  3G1M A;  3QYF A;  1LUJ B;  2WAQ A;  4JGQ A;  3OOV A;  5E3M A;  1CGE A;  3CPT B;  1XGN A;  4NET A;  4HLX A;  5EDN A;  2DOD A;  2ZXJ A;  3CCS I;  1Z9C A;  4C2T A;  1UJ8 A;  1T2K A;  1VQ4 I;  3ZDJ A;  5BPA A;  3F15 A;  3LO7 A;  1V5E A;  3CMY A;  1K6S A;  2HDU A;  1MBJ A;  3SZT A;  4I03 A;  1Y6I A;  4B47 A;  4X53 A;  2JSD A;  5AQB A;  4JX4 A;  1YM1 A;  1MMA A;  1S6R A;  3K7N A;  2ZC3 B;  3BC8 A;  1FBS A;  3OYI A;  1MXO A;  3R7W A;  1NTC A;  4BMW A;  2W14 A;  3QRF F;  1FTT A;  4EJW A;  3V96 B;  4UUS A;  1AA7 A;  2OUM A;  1PRQ A;  1J3W A;  2DT7 B;  5ICE A;  1QU3 A;  2R3S A;  1G28 A;  4JF6 A;  3LUN A;  4BQO A;  1PI4 A;  1I6X A;  1MNE A;  3KP4 A;  2CW8 A;  2XGC A;  5D5X B;  1IV8 A;  1PZO A;  3DBA A;  1ORK A;  5HX9 A;  2ERP A;  2V4B A;  5TRD A;  1Q2P A;  2HYG D;  2MLK A;  4Z1W A;  1LL9 A;  3DU5 A;  2Y2O A;  3H9G A;  4P6Z M;  3VEP A;  3O8H A;  3NUL A;  2IS6 A;  2A61 A;  3CWF A;  1FP1 D;  3MSH A;  3NBL A;  4JGP A;  2W13 A;  1F36 A;  3A01 B;  1H88 C;  1WA9 A;  3LEQ A;  4LCL A;  4MBK A;  5DUI A;  3OC2 A;  2EIN H;  1R1I A;  3LSI A;  2NVT J;  3VTG A;  2E1M C;  3CZD A;  4C6Y A;  3IWI A;  4KZ8 A;  5HDD A;  1BLS A;  2DQL A;  3IS2 A;  1OR7 A;  1RIO H;  5IHV A;  3T1S A;  2P7C B;  5HNH A;  4EM0 B;  1FPQ A;  3W2Z A;  3HRS A;  5HW3 A;  2MH2 A;  2IPQ X;  2GLO A;  5DEQ A;  3M8E A;  3B2Z A;  2CV0 A;  3K10 A;  4ENJ A;  1F5T A;  3SDB A;  3E4O A;  2GAU A;  4KZB A;  4Y0U A;  4EGY A;  2NOG A;  2XHK A;  3ZGK A;  3G73 A;  1YHQ I;  4JGR A;  1S3J A;  2A5Y B;  1P92 A;  5F6A A;  4N0B A;  1BLH A;  5JI6 A;  2I10 A;  5IYD J;  2F5C A;  3C5A A;  2HZT A;  1WZ2 A;  3LUQ A;  1PUF B;  3W6J B;  1W63 Q;  4L9G A;  3ABM H;  4AVP A;  4H0E A;  4ZTK A;  3QPT A;  2XGX A;  3UR3 C;  2JQ7 A;  2GQQ A;  5E2F A;  2X6O A;  4CA0 A;  3VOE A;  4R79 A;  2E2J J;  1JT6 A;  2H8W A;  5KAF C;  2UUZ A;  1K55 A;  1XX2 A;  2GDN A;  3IKV A;  4PMA A;  1GV2 A;  1OZ9 A;  3IBJ A;  5CVU A;  3TED A;  4EJU A;  3K4C A;  3SDG A;  3WS0 A;  5TJJ A;  2X6W A;  3BPV A;  2XPU A;  3Q0V A;  2YU3 A;  1W0T A;  3DU6 A;  2IJL A;  5BOY A;  2H10 A;  4GYG A;  2EA9 A;  1WH5 A;  4FTX A;  2OY2 A;  3EPZ A;  4KIG A;  4JBF A;  3M8F A;  1YRN B;  2MZH A;  4JOM A;  1ONH A;  1IDY A;  5I12 A;  3KSG A;  5CLS A;  3IXG A;  4EQI A;  1W5T A;  2CSO A;  3FM3 A;  4EU0 A;  3LA3 A;  4O01 A;  3MVP A;  4E7H A;  1AWI A;  3PBS A;  4ZYA A;  3UPO A;  3K2Z A;  2V9K A;  2Z6C A;  3DSL A;  1EKE A;  2MD5 A;  4UA7 A;  1PJR A;  3UDI A;  5HWV A;  2W1T B;  1Z77 A;  1KE0 A;  1HTZ A;  1R1V A;  2L0W A;  3SHF A;  2IS2 A;  3T4O A;  1XCV A;  2FOK A;  3UB7 A;  1ZRF A;  5D8L B;  1YLJ A;  3F1O B;  3H36 A;  4CJN A;  5KVR A;  1Z3J A;  3HBV P;  3T4L A;  3ZGA B;  3CUE C;  2X1D A;  1TW2 A;  1BR4 A;  4BL3 A;  5EPH A;  4C3Q A;  4A2U A;  3CMM A;  3OMY A;  2Y2Q A;  2R7F A;  3G30 A;  5I94 A;  3QP4 A;  1O0Q A;  2VV7 A;  4IED A;  2ZFW A;  3BY8 A;  1Y0U A;  1QIA A;  3F16 A;  3DTI A;  3G31 A;  1EJ9 A;  2YKF A;  1XB4 A;  1LB2 A;  3N7W A;  1TBX A;  4OP8 A;  1W8Q A;  3LR5 A;  2ETH A;  3CUQ A;  3LIK A;  3CJN A;  2QF7 A;  2H1L A;  3S8P A;  4D7N A;  4LIT A;  3ZN1 A;  1MDM B;  2W3G A;  2XAU A;  2I72 A;  1MBF A;  3BR6 A;  3F18 A;  4OH0 A;  3MMY B;  3WU2 C;  3UE0 A;  3CD6 I;  3T1R A;  3B6A A;  3C2B A;  4XN3 A;  4L9V A;  3OS2 A;  1T0F A;  1HW2 A;  3IF5 A;  3Q7Z A;  3I0T A;  4NXG A;  2FBI A;  1DU6 A;  1ZTU A;  4KIB A;  2PT7 A;  3HBR A;  1Y0N A;  2VV6 A;  4Y0T A;  5KMW A;  1G6N A;  1FNN A;  4JXS A;  3IH8 A;  4EUV A;  4B4X A;  2EFP A;  5BNG A;  2VKH A;  3I7J A;  2L02 A;  4LIU A;  3CC7 I;  1YX5 A;  1JT0 A;  1WKM A;  4XK4 A;  3ULQ B;  1REP C;  2OV5 A;  3LNQ A;  4M9S A;  1LL8 A;  3T4S A;  5CTN A;  4WKE A;  1B72 B;  1HD8 A;  2JA8 J;  1QO0 D;  3VP3 A;  1KYZ A;  2RRE A;  2J9O A;  3K69 A;  3MJQ A;  4HEA 2;  4BHB A;  1H9G A;  4K08 A;  2HDW A;  2DTZ A;  1JTD A;  1R1J A;  5D7W A;  2GOX B;  4XKW A;  2FFY A;  1TVI A;  1XJ2 A;  1J59 A;  3RQ4 A;  1IXC A;  3MMH A;  4EUZ A;  2ZC4 B;  1WQ2 A;  3DKY A;  3F72 A;  1AKH B;  1ZH5 A;  3GX4 X;  4GDB A;  1JWP A;  2UV1 A;  1GHP A;  4KDP A;  4II3 A;  2B95 A;  4N1H A;  5I3M A;  3FXJ A;  3RYP A;  3ZRG A;  3CCL I;  1SEU A;  4NKP A;  3CCV I;  3LCE A;  5A91 A;  4CCL A;  2M0M A;  2QKP A;  2L7Z A;  1V4R A;  4OLG A;  5ILS A;  1OCT C;  5FD5 A;  1YRN A;  3ELM A;  2H5S A;  3K3D A;  2Y59 A;  3RPU A;  3JCU C;  4BJ5 C;  3RTS A;  4GJ4 A;  1IN7 A;  1D1J A;  3ZUK A;  3LSJ A;  2PX9 A;  3V7C A;  2PFB A;  1Y1W J;  2PI0 A;  3OPP A;  4GB7 A;  4IUH A;  4KZ9 A;  1DU0 A;  3VOZ A;  5D1U A;  3BJ6 A;  3TO6 A;  4DNC A;  2R5Z B;  4IBR A;  4S2N C;  4A3W A;  2LSO A;  5KSH A;  2TDX A;  4V2G A;  3IWF A;  2N8G A;  1RRJ A;  4M4X A;  4L6T A;  3C3W A;  2L7M P;  1TZL A;  2ZJ2 A;  1Z7L A;  2WGI A;  2BBY A;  3KCC A;  1NWZ A;  4GF1 A;  2LKX A;  1G8X A;  1DMT A;  5DF7 A;  3VP4 A;  2X3A A;  4RX3 A;  2ZSI B;  2EZH A;  3IV5 A;  2Z16 A;  1TT5 B;  3VSL A;  1BA5 A;  2WK0 A;  3K4K A;  3RSN A;  3ZG0 A;  3K4M A;  1KUG A;  3KZI C;  2K5C A;  3LA7 A;  1JGG A;  1I1G A;  1TWC J;  2K85 A;  3ASO H;  4P96 A;  3RIR A;  4I0A A;  3FZV A;  3V7R A;  2VUM J;  1BZA A;  3HSE A;  4UQI M;  3DPE A;  2HQR A;  4WMC A;  1CQT A;  3KET A;  2E71 A;  1I39 A;  2JE5 A;  2CUJ A;  5LRR A;  1U60 A;  3ZQH A;  4CZZ A;  5KHD A;  2YUF A;  4CYC B;  4I6Z A;  4UVA A;  1YFH A;  2GZA A;  4KIF A;  1VQN I;  1U5T C;  3ELK A;  3ECO A;  4Y13 A;  2XRN A;  4BHP A;  3AKZ A;  1K61 A;  1FX7 A;  1P4A A;  2GA2 A;  2HEO A;  1XSV A;  4FH4 A;  4A0X A;  3EOI A;  4B09 A;  2FUG 2;  3PO2 J;  2GNX A;  4YIN A;  3N8L A;  1B3D A;  2Y2N A;  3IC7 A;  2L9V A;  4UV9 A;  2IVM A;  2MAB A;  4LB6 B;  1OFC X;  4FE4 A;  2GXB A;  2QWW A;  4EET B;  2KRC A;  1SVO A;  1ZAO A;  1NZU A;  4DV8 A;  5M19 A;  4ZR5 A;  5EOE A;  5B5P A;  2FML A;  4HV5 A;  2HOA A;  5HS8 A;  1FEX A;  1R22 A;  4IJA A;  1ZRD A;  1KBC A;  2DMP A;  2QCO A;  4XLC A;  4V2F A;  3EUK L;  4UQI S;  3VFH A;  1G4K A;  1XKZ A;  1ND1 A;  3BR1 A;  1J0R A;  1JTY A;  4ZYE A;  2MG4 A;  1OKR A;  3BG7 A;  5BOT A;  1SFE A;  3HB2 P;  1LFB A;  3BM6 A;  2IWB A;  2LLK A;  1UG2 A;  3T12 B;  2F4I A;  3EGX C;  1PDN C;  2DMU A;  4A5R A;  2B0L A;  1WJE A;  2V0W A;  2NRA C;  4QSH A;  2LMD A;  4JIJ A;  5GL9 A;  4PM8 A;  1WJA A;  1TD5 A;  2PHY A;  4XT2 A;  2DDF A;  5BQT A;  1A36 A;  3ZMS A;  5D1S A;  4JP0 A;  456C A;  4YIR X;  1BYW A;  4R3J A;  3MKY B;  2AIG P;  1AST A;  3C2H A;  3H92 A;  5F0C A;  2LY2 A;  4CCJ A;  2CFX A;  1ZTQ A;  2DW1 A;  3PM1 A;  2HNH A;  1MWT A;  2L4R A;  4E7J A;  3BW6 A;  5DVA A;  1MMQ A;  3VFZ A;  5J1Y A;  5K5Q A;  3O6B B;  3OS0 A;  3MXQ A;  3O3V A;  3EET A;  3ZCO A;  3ISG A;  5EVI B;  3GUD A;  1WSU A;  5J6X A;  3GLX A;  3SW1 A;  1IOU A;  3B42 A;  4C9Y A;  3OS1 A;  3VP1 A;  3D1N I;  4N9I A;  1BKC A;  2DW2 A;  1U5T A;  4IHV A;  1BC8 C;  2VQG A;  5CKT A;  3LSG A;  4JXW A;  5EM1 A;  1Y93 A;  2Y69 H;  4PPR A;  1ZR4 A;  1ZYR F;  4KUK A;  1GHI A;  4BEN A;  3OHL A;  4QKZ A;  3HOS A;  2HR3 A;  3HUO A;  3Q81 A;  2QZ8 A;  3ZMV A;  1CGL A;  1H8M A;  3MKE A;  1TQI A;  1SMY F;  3MQ0 A;  5LGT A;  3L2C A;  2OW2 A;  3G4S I;  4DD8 A;  3CME I;  5J3L A;  2EIJ H;  2PQ8 A;  2JA7 J;  1D1B A;  3UNW A;  4GGG A;  5JYO A;  1OM7 A;  4B9O A;  4PFP A;  1Y39 A;  2XS4 A;  3WOD F;  2L54 A;  5AIQ A;  1IRG A;  1OO9 A;  3LK8 A;  1Y56 A;  1ES4 A;  1VQL I;  2VK3 A;  3CCE I;  4XUX A;  3PIP F;  4C75 A;  1GCE A;  3HY9 A;  2DI3 A;  4KIC A;  3P9K A;  4NB5 A;  5FL3 A;  5I43 A;  3A0B C;  5GTI C;  3O8G A;  1MWR A;  3F19 A;  3GEZ A;  3H5R A;  3MAJ A;  3TDU C;  2HP5 A;  2HDQ A;  1LVK A;  4G0D A;  1ON1 A;  4H6J A;  5D1T A;  2VE9 A;  1TTY A;  4NXF A;  2WGV A;  1J9M A;  1XMX A;  2JUG A;  3LA2 A;  4CLC B;  3DBR B;  4IHT A;  2HDR A;  4WYY A;  3H0D A;  5I0L A;  2V1U A;  4X55 A;  4B8X A;  5CTM A;  1Z21 A;  4LG3 A;  4RAZ A;  1F98 A;  4XCT A;  1UEA A;  3I7G A;  4DW6 A;  2XA7 M;  5E3O A;  3H3Z A;  2ZO4 A;  2H0Y A;  3OLO A;  2POJ A;  1QZE A;  3N6I A;  1UHS A;  1YW9 A;  2Y79 A;  1JH1 A;  2H94 A;  3F3X A;  3O86 A;  2W1O A;  3A2K A;  1GVJ A;  1GE6 A;  4QWO A;  5DFX A;  3ZG5 A;  1RGY A;  1XFU A;  3VOL A;  1SFX A;  3FF5 A;  5DV5 A;  1J5Y A;  2EBI A;  1JUM A;  2XKO A;  3GME A;  3WE2 A;  3J7Y J;  1G59 A;  1DJA A;  3FIS A;  4XQF A;  2XD5 A;  5E8G A;  4CYC A;  3AG2 H;  2ESH A;  2FRH A;  4Y0O A;  4Z9Q A;  3TSG A;  4I2O A;  1ETY A;  2K9L A;  1AHD P;  1MJ9 A;  3F8F A;  3UE3 A;  3FM5 A;  4CUG A;  1CQR A;  3OYM A;  3OYA A;  5DCM B;  4LEN A;  3HJK A;  1HST A;  1BOA A;  2UZK A;  1BTL A;  4GHI B;  4XRF A;  4EV0 A;  2MA3 A;  2ZME A;  1Q1V A;  3S2W A;  2MGQ A;  1VET A;  4QJG A;  2BV6 A;  1IC8 A;  3NY4 A;  3WS5 A;  2KIS A;  3C7V A;  4S2I A;  2ZQC A;  4XT2 B;  2FF4 A;  1XUR A;  3G1O A;  2A2L A;  4RB3 C;  1TS0 A;  1F2K A;  3K70 C;  3HOZ J;  3EDG A;  2VQL A;  3C2W A;  4C2U A;  1ZXC A;  3BQA A;  3FBI B;  2B5R A;  2LK2 A;  5DTS A;  1OJG A;  4HI4 A;  3HUG B;  3CIT A;  2G7U A;  2FQ3 A;  1HKQ A;  2KL4 A;  3ZMT A;  2XSS A;  1B9N A;  4I0B A;  1E3U D;  2PBY A;  3OIP A;  5FLV A;  1XFQ A;  1DP6 A;  2CQN A;  3PQJ A;  1X1D A;  1IO2 A;  1WHU A;  3R0J A;  3WGG A;  3P9I A;  3DLA A;  1MH3 A;  4IRI A;  4ZJ2 A;  3UY6 A;  2NVU B;  4D5C A;  3D9Y A;  1G9K A;  1U3E M;  2PMZ A;  4MQ9 F;  1JTX A;  3WTT C;  1ERM A;  1QZZ A;  1OCZ H;  4ENK A;  3IRR A;  3GFJ A;  3J80 Z;  3CCR I;  5FAQ A;  1YT4 A;  2FX0 A;  1XGS A;  1JKR C;  1HOV A;  3W4Q A;  2ZC6 B;  2V1X A;  3GTK J;  3GTO J;  1ENH A;  2R7Q A;  4U0Y A;  1BKC I;  1BIB A;  3Q9V A;  3N97 A;  4PSX A;  1I1S A;  3HRT A;  2EX6 A;  4PKQ A;  3C18 A;  3C38 A;  5M1A A;  3WG9 A;  2PR6 A;  1T0F C;  4N9H A;  2CMN A;  3FXO A;  2OLV A;  2ID6 A;  1EH6 A;  2YPR A;  3FKJ A;  5I4O A;  4HMA A;  1BOB A;  2HYF A;  4FU4 A;  4HV6 A;  1ZG3 A;  3L7W A;  1SHV A;  1TEM A;  1V3F A;  5ERI A;  3L2R A;  4ETZ A;  1JKY A;  4XNF A;  3USN A;  3LFU A;  1GVD A;  2DFI A;  2V6E A;  2ELJ A;  3S22 A;  3W4O A;  3EHX A;  2IS4 A;  2Z2S B;  1M6K A;  2VB6 A;  1JNU A;  3K4N A;  2FFF B;  2L0R A;  1L0E A;  1TNS A;  2DN0 A;  1SC7 A;  4LRY C;  1QPI A;  4DDS A;  1S7E A;  2CQK A;  1UWP X;  2X9D A;  2OI0 A;  1E0E A;  2UXN A;  2L9N A;  2WGW B;  2JVG A;  3AG3 H;  3FBN B;  2BE5 F;  5LHI A;  2A07 F;  1MZU A;  3P98 A;  4YG2 F;  3NOU C;  5MC7 A;  3WTW C;  4HP9 A;  3R6S A;  4LV3 A;  2PJT A;  3AGD A;  3E6M A;  3GW2 A;  2XSD C;  1BUL A;  3T1X A;  3G3Z A;  1Z1D A;  2XPV A;  4HW0 A;  1XDU A;  3U1K A;  1NRF A;  1J2X A;  3A3E A;  2VXD A;  2PN6 A;  2DYS H;  1HOM A;  3I4M J;  2Q1Z B;  4W1U A;  2ECC A;  2DTR A;  4WL9 A;  3T5X A;  2NNY A;  4F94 A;  1BSG A;  1SKO B;  2DJI A;  3M07 A;  1YLY A;  3FMQ A;  2CUZ A;  3H9Q A;  1WRJ A;  4G7Z F;  4M6X A;  5GLB A;  3SS4 A;  3U4L P;  1U9O A;  2D2W A;  2CH0 A;  1G3Y A;  4BE1 A;  4GD8 A;  2IT0 A;  4OON A;  1VQO I;  1LI0 A;  4E3J A;  5FRN A;  1K57 A;  4OIO F;  3MZE A;  1X3Z B;  2FD5 A;  5KZH A;  4BQA A;  3DF8 A;  1D06 A;  4OWR B;  2A3U A;  1K25 A;  4KIT B;  2EV5 A;  2DDB A;  3S1M J;  4CDG A;  1W7P D;  3DCF A;  4EM1 A;  2ZM0 A;  2VLA A;  4GKU A;  2EWN A;  4WXD A;  2K9N A;  3KHI A;  1K0K A;  4N1X A;  4GHI A;  4E3N A;  3CP2 A;  5LFA A;  4I02 A;  4M3G A;  3LQ0 A;  5TBM B;  3HLW A;  5E8I A;  4EXO A;  5EUA A;  4OKP A;  1T6S A;  4FQG A;  2IW5 A;  4XON A;  3AL0 C;  5CYV A;  1SLN A;  3V67 A;  4PJM A;  2R4G A;  1WYB A;  2ZBB A;  1FR6 A;  2KDK A;  2BW3 A;  3LID A;  2F4O B;  2RKH A;  4AYB A;  1Z09 A;  2ZXH A;  3N4M A;  1L0G A;  1XPX A;  2L1M A;  5GLD A;  1IN6 A;  3EEH A;  3T4J A;  1QUA A;  1S7O A;  2VL8 A;  4PJ0 C;  2JK3 A;  4EEP A;  5IYC J;  5LGN A;  4BQN A;  1AF0 A;  1X3U A;  3NRV A;  2DK8 A;  4ANJ A;  2ADU A;  2DMN A;  2ZJR F;  1BT5 A;  1DP8 A;  5F1R A;  3GR2 A;  1S5L C;  1X3W B;  2AXL A;  3LOC A;  3E97 A;  1YSQ A;  2ZMA A;  1XFX A;  2H6C A;  2A8H A;  4Z2Y A;  2DFH A;  4KA4 A;  3I56 I;  4A6E A;  3S2H J;  2ZMF A;  3IX8 A;  5TGF A;  4U0W A;  3MKL A;  5AVF A;  2EV0 A;  2OZ6 A;  1D8M A;  4JQF A;  4HNV A;  3HUG A;  3OYK A;  1J9I A;  1TVF A;  1SD6 A;  3CJR B;  3W3C A;  1WI9 A;  3MN2 A;  3HEF A;  2XKP A;  3QPH A;  4UV8 A;  4NUB A;  3OYG A;  3GO5 A;  4ESF A;  3JSP A;  2IBD A;  3ZPL A;  2P7J A;  4S04 A;  2R0Q C;  1TWG J;  1D5J A;  2CJJ A;  2MH9 A;  3KP2 A;  3S7Q A;  4MFE A;  5GAH J;  3V3S A;  1JKO C;  2I5U A;  1L6J A;  4OOL A;  2R5Y A;  4R8H A;  4Q8I A;  2DK5 A;  3WTZ A;  5GHX A;  2CMP A;  4GFB A;  3ERE D;  1W4M A;  4EVI A;  1U2W A;  2JUC A;  5JHF A;  1ZC2 A;  3RI4 A;  1MMG A;  4O6J A;  4LRX C;  4ZYD A;  4IRG A;  4OAY A;  2CV2 A;  2JKG A;  1PWU A;  4D60 A;  3GFI A;  1G49 A;  2A6T A;  4E7Z A;  1RUN A;  2TCT A;  1IGN A;  2ZQ8 A;  5EZH A;  4UUT A;  3D5S C;  1N25 A;  3IAM 2;  2BTF P;  4HBL A;  2CW7 A;  5AJG A;  4ZZD A;  3LKA A;  4Z6Y A;  5GLC A;  3D72 A;  2I47 A;  3LQB A;  3MZH A;  4WXC A;  3LIF A;  1EB6 A;  1FT9 A;  1JXS A;  4X1L A;  2W57 A;  3ZQ5 A;  2QEN A;  1ZKG A;  2W48 A;  3BTL A;  1GA9 A;  4IHQ A;  5DCM A;  1WI3 A;  1HCR A;  4XBH A;  1Z67 A;  3LFK A;  3BJN A;  3I3L A;  4JXG A;  1VQ9 I;  4R6L A;  4BU2 A;  1ZGW A;  2FMY A;  4B3X A;  3HSR A;  4Y7N J;  2CRG A;  2CQX A;  1KE3 A;  2D02 A;  2Y2G A;  2ZM8 A;  3RFB A;  2VJW A;  3WWX A;  2CS3 A;  3I53 A;  1ZP5 A;  2TCL A;  3WGH A;  1IUF A;  1G3W A;  2D1H A;  1FLI A;  4ZBE A;  5FI7 A;  4ILW D;  1ZHH B;  3WU1 B;  2WAQ N;  5G4Z A;  4A69 C;  1E2X A;  1PP7 U;  1K4S A;  3NJA A;  5GP9 A;  2QPJ A;  4FET A;  3DWZ A;  4GYI A;  1YQS A;  1R71 A;  2F48 A;  5FQI A;  5FKK A;  4AUO A;  2E2I J;  2K9Q A;  4L18 B;  4OIP F;  3IBR A;  3OR1 C;  3CUQ B;  4ASN A;  4LG0 B;  4RBO A;  3G2Z A;  3WGI A;  5CX7 A;  5TFQ A;  3V3R A;  1ZVX A;  4PZJ A;  2VGJ A;  3GVA A;  2R7R A;  2XGN A;  3PJR A;  2RAE A;  1QRY A;  2K2N A;  3WTX C;  4MNR A;  5FQK A;  5IY5 H;  2RNJ A;  4QWQ A;  5EM0 A;  9ANT A;  4QPO A;  3BWG A;  1MMR A;  2X1C A;  4B4C A;  3IKT A;  4LRZ E;  3WV3 A;  1OYY A;  2M30 A;  1NHA A;  2LP0 A;  4EMS A;  3CDH A;  3R0A A;  1MMB A;  2OAQ 1;  3PSI A;  2B7E A;  2LC2 A;  1SKO A;  2IP2 A;  1A6Q A;  5HLT A;  2JCH A;  1RNL A;  2ZME B;  1D1A A;  4UB8 C;  2Z99 A;  4X1M A;  3DNG A;  2VLG A;  5EF6 A;  3HDD A;  2OW9 A;  2GIV A;  2VIX A;  3B73 A;  5EEH A;  3RDI A;  2KIF A;  3SH9 A;  2J5O A;  4Y3O A;  5DTD A;  4IEJ A;  3RKQ A;  3KYL A;  4P87 A;  5EGO A;  1JHF A;  3JRI A;  3T1Q B;  1YI2 I;  3CCJ I;  4HIA A;  3FWE A;  2DA1 A;  4PCQ A;  2DFE A;  5DYM A;  2HOT A;  4R1H A;  3AGF A;  2EPF A;  2V1N A;  2N8R A;  4X68 A;  1AOY A;  2M5W A;  4FH2 A;  2CWE A;  3E7L A;  4NG2 A;  1CK3 A;  3HY7 A;  3H7W B;  4C3I J;  3CF5 F;  1YO5 C;  5J3W A;  2M4K A;  2UWX A;  2HKO A;  3V5M A;  1JJ9 A;  1BR1 A;  3KYC B;  1FQG A;  4H8R A;  1HV5 A;  3KEJ A;  1K78 A;  1KUF A;  2OBP A;  5HDK A;  1T08 B;  5BPD A;  4KMF A;  4BEH A;  2KRF A;  5DJT A;  2DPD A;  3OYC A;  3GLL A;  1KU9 A;  4ABZ A;  3M2K A;  2IWC A;  3UDF A;  3OPL A;  2EIL H;  5ILU A;  1OTD A;  4JBA A;  4ETS A;  4E7I A;  4WF0 A;  3FHN A;  4Q0J A;  1N77 A;  1W0U A;  2WGW A;  3RTY A;  4CPK A;  2K9M A;  3VWB A;  2WOA A;  5CVV A;  1ZLK A;