3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRRE PROTEIN
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTEA 3DTKA 3DTIA
chains in the Genus database with same CATH superfamily
4RAYA 4CYCB 2IS2A 1JNUA 1ZELA 2KIFA 4YFXF 4AWXB 4NEED 5CTMA 1T8IA 3V42A 5TGFA 3N6IA 4RS8A 2LY9A 2FEZA 5G4YA 1XGJA 1ITYA 4OPZA 2R7XA 4MLLA 3USNA 1J75A 1ZG1A 3JSPA 2YU3A 4UV8A 4L9TA 4I5SA 3IXBA 4LPZA 3ZG5A 4FUWA 3SZGA 4NHJA 2IS6A 5E1ZB 4DYRA 1QVUA 3O3KA 2E1CA 3VOYA 1ZR4A 3EYIA 4XMYA 3ZMUA 1TBXA 5C4XJ 5F64A 4QSHA 1LI0A 2D01A 1HZOA 4DE2A 2F4IA 2VBWA 1KZHA 2RNGA 3KSIA 2CMPA 1JTGA 4C9YA 2KL4A 5KK1A 3SDGA 2RCXA 1SD7A 4E04A 5E20A 4DXCA 3WHBA 4R3JA 3SQNA 5E8IA 3S1MJ 1P0ZA 2DA7A 3KP6A 4JPAA 4I6ZA 2ZFWA 1FMVA 4M6YA 3QU3A 2NRAC 4ZJ1A 1YSPA 5F27A 2YIGA 3KEOA 3UNGC 3K4MA 3EQVA 1SLNA 1JUMA 3A0SA 2ZOHA 2WC2A 3HOWJ 3HKZA 3QP5A 3MXSA 4PFOA 2X6OA 4BJ6C 1FTZA 3H5RA 2HKXA 3QYBA 3T4TA 2JA5J 1HQCA 4WKIA 4E3LA 2VODA 4ZYAA 1CK3A 4S2IA 4B44A 4XK4A 3FG8A 2DQRA 1ZKJA 1VQ8I 3D5SC 5FKLA 1EAKA 3F0CA 1JTDA 3VYUB 3OOVA 1YCMA 1H89C 5D3CA 5JLXA 5IT9K 3F9KA 3MVPA 3H9QA 1O3TA 3JYIA 2PX9A 2O6GE 5DUIA 1YYVA 3PQKA 3DTEA 3I3LA 3OYGA 4PPRA 4XXRA 1XDSA 5GAHJ 3IH2A 3CMMA 2KT0A 2FMLA 3S1QJ 2MBFA 2E1MC 4PSXA 2INWA 5IPAA 5DKLA 5F83A 2W3HA 4Y3OA 4UQIS 1IOUA 4E7JA 5D6FA 1PWPA 2NVXJ 1ZXVA 2LD5A 4BHPA 3BFGA 5C3EJ 4OLGA 3C2GA 5L09A 4A3IJ 2ZMEB 1HCRA 1X3ZB 3G4PA 4Z2YA 5HWWA 2BY1A 4XICA 3QNCA 1PI4A 2BTFP 3BQ8A 2EQRA 4UA7A 4MCWA 4LLNA 5JLWA 2D1VA 1PDNC 5FFZA 2QPJA 3L2RA 4B47A 2VOOA 3KECA 1MNCA 1QVTA 4IF4A 1BKCA 2O9BA 5FD6A 1TS0A 4ZZLA 1MWRA 2DDYA 1TNSA 2EZIA 3O64A 2XFTA 3UB8A 2EWVA 2V1AA 4GXOA 2HR3A 1N9NA 2LKSA 2MZIA 1EH7A 5TISC 3W6JB 1QRYA 4Q0HA 2R7VA 2G2WA 1PWDA 5F0CA 1JAOA 5K5RA 2ZSIB 3Q81A 4OWRB 5HWTA 4ESJA 3A3JA 5TR7A 4LIVA 4BXFA 2Q1ZB 4CGZA 1KQ9A 3VOZA 3S1NJ 1DP6A 4YELA 5DFYA 4CYDA 1O07A 1H8YA 3RPQA 3Q3SA 5E3LA 4A7BA 2M7UA 3A02A 1G28A 1A6IA 3MFKA 2NS7A 1OKRA 1GV2A 4JIJA 4QPOA 5LBQA 1BLPA 2LF8A 1MNDA 1WHUA 2ERPA 3EDHA 4UUSB 3ZQFA 3DBHB 2AYKA 2R7OA 2OAP1 1ONHA 1DRMA 4R70A 4EV0A 1PUFA 3Q7VA 4S2OA 3B92A 4Y15A 4WYYA 1YSQA 1EROA 3MFXA 3FHZA 2DT6A 5J8CA 1X4OA 2A6EF 1RGZA 3FMQA 5LABA 2W1RA 1H88C 5EPHA 2R7DA 4IL6C 3HUNA 4OOYA 5FATA 4OIQF 5HNFA 3TT4A 3BG7A 1LL8A 1Z77A 3ONQA 2K86A 2XA7S 2Y9ZA 3E6BA 2JA7J 4L9JA 2KDOA 3WU1B 2O5RA 3RYPA 5HOOA 3JR9A 4GJ4A 4IJGA 2QM3A 4BE2A 3GRJA 3OYMA 966CA 3FPVA 4LRZE 1D1BA 4A0ZA 1B59A 1OTBA 2TRTA 3IHBA 3LUNA 3ZQQA 4M4XA 3EQLF 3DXJF 2E3XA 4MBFA 4DRTA 1UCRA 1OS2A 1AXBA 4WBGA 4M3FA 5I0LA 3LMMA 1BQOA 4RBOA 2GWRA 2MLKA 5D1TA 2Y30A 3J81K 4Z6YA 1ODVA 4CA0A 1ZLJA 3BROA 2ELKA 4GO1A 3G5CA 4R8HA 4PKYA 2CSOA 3IF6A 3NEUA 1W5CC 4EJTA 4J4MA 4L0LA 3UE3A 3PBRA 2ZQ7A 1XSVA 4L5IA 4DW6A 1VF9A 4XQFA 2QA4I 5FDSA 1V54H 1CI9A 1KQ8A 2WB1A 2Q2EA 2V20A 2Z16A 1KGEA 2HOTA 4B43A 3HJKA 4FETA 3CP2A 1IADA 2M8EA 3IX8A 1R36A 1BYWA 4GYIA 2QQAA 4O0PA 4WELA 1LE8A 2EFOA 5FB2A 2PJPA 4RGUA 1USTA 5B5EC 1HTZA 1I1GA 3F1PB 5DJTA 1Z6TA 3PNYA 2CFXA 3JRCA 4GDBA 2ZMVA 4R0QA 5F6AA 1FY7A 4XKCA 2DMNA 1X1PA 2ETHA 1MD0A 2K3FA 2R7ZJ 2R7WA 2MW8A 3NECA 2Y6CA 2BXZA 2HYGD 3BG3A 4BQAA 3JPUA 1R71A 1YMXA 3FX3A 2HDWA 1FOKA 1FOFA 2V1BA 4LGWA 5ILVA 2RVCA 2HP6A 3DWKA 3LQBA 1F2KA 5D2BA 4LG0A 4FXYP 2CYYA 3KP4A 1YRNB 1GHMA 1K6YA 2QQ9A 1QJJA 3P1VA 3SFIA 1U3EM 2PEXA 1BBYA 1A04A 3VFHA 5F1FA 4A3CJ 3C7VA 3S3NA 2P08A 3AKZA 2PBYA 3NX7A 3IV5A 3D9YA 5E2HA 3MSHA 1YJ9I 3J7AY 1YLJA 2WGWB 5JMYA 4HYEA 4ZH4F 2LREA 2HDCA 2HQ5A 5HVQC 4XR6A 4I3IA 1Y54A 1ZS0A 2HOSA 4KN7X 4H6JA 1J09A 3SS4A 4C6YA 2L0KA 2SRTA 5CXWA 3BR2A 4MHGA 3D1NI 3K2ZA 5FAQA 2O0YA 4H49A 4PGHA 3HHGA 1OMEA 2XF3A 3DLLF 2EIKH 4K91A 3LIRA 1WFXA 2B18A 1VB6A 2IW5A 5FLXK 5E8GA 3DP7A 3HLGA 3KE2A 1ESIA 4KZ8A 1R49A 3T4SA 1XC5A 3L0TA 3PBTA 1VFCA 1XA1A 1SHVA 1BUVM 5GHXA 4L0ZB 3LIKA 5HPIA 4I38A 4JX5A 2PI0A 2XD5A 2MZHA 5CGWA 5AJGA 3CPTA 5DTSA 4BBRJ 2EFPA 4K0WA 4HH3A 4PKUA 1BJZA 2JRTA 2KZVA 5HX9A 3QPTA 2KX6A 1WRJA 2W57A 3ZQ7A 1IJWC 1P7JA 1K7QA 2VK3A 3J80K 3OPLA 4E7ZA 3QYEA 1KBCA 4G6TB 4KNYA 2PQ8A 3HOTA 5E18F 2LDUA 3IX4A 1RM8A 3ZUKA 1G3TA 2D5VA 1Z0XA 5EVIB 1AF0A 4M3BA 1C8TA 3K9TA 1NZUA 1RC9A 2Y2OA 3O5YA 1SMYF 4JP0A 1IAGA 2V6EA 3K7AJ 3ZHHA 2Y2LA 1B9NA 4RA7A 4K0XA 1UWPX 3GLXA 5FJ8J 1FTTA 4H2EA 1FR6A 3RTYA 3G3ZA 4WZ4A 1CGEA 4BGDA 4HSTA 3KSGA 3FM3A 5L79A 5FQ9A 3X2QH 4KMUX 1XN7A 2MH9A 2R92J 2K40A 1F5MA 3TO7A 4S2MA 4M3DA 4AIJA 5J8XA 2W14A 2KJCA 4KIFA 3PXPA 5DCMA 2I10A 2EZKA 3NQOA 2PDRA 1OS9A 3KFWX 4ID4A 3PAEA 2A3UA 1T39A 1BM6A 3CO7C 4AVZA 1FSYA 2KPMA 3AFHA 2Y4AA 2IA2A 4BHBA 3JRGA 2WAQA 3OYIA 5EEAA 1N4OA 1GA0A 1KU7A 3GQZA 2DPDA 2EXAA 5DEQA 4C75A 4OKPA 3JAMK 3BTCA 4FX0A 3BYDA 4AYKA 2DO7A 1FSHA 3CZDA 3E2KA 3OYAA 4HPQA 1B72A 1O57A 3N8LA 1L3LA 3TSKA 1MMAA 2WBMA 4ESPA 5EGOB 2KFDA 2ECCA 1X3UA 3REOA 2R5ZB 1UFMA 1FR1A 3GTCA 1T08B 3SDBA 5CTNA 4AIGA 2ID3A 1PWCA 3S7OA 1S7EA 4RAGA 2JN6A 4R4RA 4O6JA 4NBQA 1TQMA 4UUTA 2VUMJ 2FU4A 1S67L 2EILH 1J0RA 4OOMA 3B6CA 3GECA 3FXOA 5CHMA 4KJZA 4HX4A 3ZQLA 4FVLA 3SZPA 3ECHA 5CECA 2W27A 1XFYA 4WZ5C 3E6CC 3LSKA 1VQ6I 3HUOA 2HFHA 4I7HA 5M18A 2EZHA 3WRZA 1MH4A 3GTPJ 1NXYA 5D7WA 3KP3A 5IP6A 2B0LA 1P4AA 1MDMA 2EV5A 2EX6A 2M87A 4BEHB 1TP4A 3M6BA 3OS1A 4ENNA 3JW4A 1ACFA 4FTHA 4IBRA 2A49A 3HPGA 3UY6A 3AIGA 3FKWA 4ZYEA 5HL6A 3S1RJ 2V8FA 1R1UA 1MMDA 2O3FA 1K57C 3CMEI 2Y2KA 2W48A 4A5NA 3OBFA 2DFIA 1EI5A 3H5NA 3CC7I 3NARA 4O7DA 3ML6A 2MGQA 3OS2A 3L0VA 1B8IA 2PMZA 5FL3A 3KX2A 2CH0A 1CGFA 1SEUA 2IGKA 4IHVA 1QIAA 4BKXA 5JVGF 4ZR5A 1X0OA 1MBEA 5IOZA 3U9GA 4IJOA 2M1BA 2KP6A 5HLGA 5HAQA 3EOIA 4IQJA 2H10A 3MKWB 5D8LB 3CC4I 1RNLA 3RKQA 2OAQ1 5I2ZA 4V2GA 1MMNA 1K7GA 4ETXA 1HDPA 1TQPA 2EV6A 4C2UA 4RMNA 4CLCE 1TTYA 3T1BA 1WI9A 2JIHA 1GO8P 1QPMA 1UG2A 3SEZA 2FUG2 1CQAA 3EGDC 3TBIA 2R5YB 2Y2ZA 3C7JA 4N9LA 5LGUA 3SW1A 2WV0A 3TDZC 4IBXA 5A90A 4GN2A 3N4IA 1VNDA 3TSGA 2HP9A 2I5UA 1U2WA 1L0OC 4Y2FA 2XSJC 1Z6FA 4YIIA 1DP9A 5DTTA 3DPFA 2V1UA 2JE5A 3AYKA 1ZN2A 3K6GA 3PUFA 1BUDA 4M9XA 2YR2A 3ZRGA 3LILA 3LSMA 3DV8A 2DA4A 4BXXJ 3ESWB 4UEYA 2PD7A 1LVKA 1SVOA 4OOLA 1W5TA 2YB9A 3BW6A 1XGMA 2A05A 2ACGA 1VQNI 3MF0A 2W3EA 3G42A 3ZVTA 1K78A 1FMWA 3F3XA 2JA2A 1YQSA 1ZVXA 1BW5A 1D3YA 3KMEA 3H9WA 1QU3A 3BR0A 4H82A 2A24B 4L63A 2P74A 4EETB 3ZQHA 1SKOB 4L9NA 2OI0A 4JA1A 3A0HC 4U0YA 4KZ7A 4NDLA 2GXAA 2Z3YA 1Q1VA 1R1JA 1WJAA 2X02A 2J3TC 3HPHA 1WJDA 3HUGA 2B5RA 5AQBA 4HW0A 3QQAA 1M6KA 1MZBA 1NYMA 2XF5A 4HV6A 2L1MA 2PJTA 2CUJA 3CLOA 1W36C 1MMBA 4U0TA 2F5EA 1GSVA 4WF0A 3QP8A 5GPCA 1MBKA 1E3HA 3H0DA 3RDIA 1U5TC 4M73A 2DDAA 1CGPA 2K3PA 4ZTKA 1JAPA 2OTJI 3G6EI 1J7NA 1WQ2A 3MKEA 3TS4A 3FXKA 1S72I 1Y28A 2XDVA 1T56A 1L6JA 1LLBA 5D5XB 3EUHA 4N1XA 2DBBA 3GVAA 5L3FA 2ZQ9A 2X7MA 5HZHA 1RRJA 1D8MA 3S2HJ 3BEBA 4H0EA 2P04A 1ERQA 2IT0A 4BY1J 2OY4A 1SDEA 1ZHFA 3CDHA 3HIFA 5L3DA 3AL0C 1OR7C 4E3IA 2X3CA 5BPDA 1TWGJ 1REPC 4QIWN 3TW6A 2Q0OA 3I4PA 4CZZA 3B33A 1QO0D 1R7JA 4A3DJ 1G3WA 3UE6A 3BWGA 1HW5A 2O36A 2R7TA 1R58A 4G7OF 4RAZA 2GZWA 1ES3A 5CKTA 2M2EA 4EBPA 4XKVA 3LIBA 2DA2A 4OP8A 3KO6A 4M6VA 1E3OC 2GXGA 4ESBA 2PFBA 4IZZA 3I0TA 3DKWA 3EGXC 1FILA 2EA9A 1MZUA 4A93J 4EERA 1BR4A 3UB6A 4BU2A 2DNSA 1PYYA 3E0YA 5K5OA 2H0TA 5GADJ 1JKRC 3UDFA 1HKTA 4NXGA 3EPZA 5B5OA 5GAGJ 1WCMJ 1AYKA 2FV5A 3HOSA 5IT5A 3M8EA 3KYQA 2LH9A 1JH1A 1LEAA 3SJMA 4KG2A 3IXGA 1QZYA 3BCBA 3GW2A 3H5AA 4JOMA 1SVMA 2E19A 3PFYA 1ALQA 4P6BA 2WGIA 1G6OA 5LHGA 1HFCA 2D45A 3U4LP 2V9PA 1WVRA 2LC2A 1R1HA 3JRFA 3TO6A 2DK8A 4GDNA 5TGTA 4R3VA 3HBUP 1XCBA 3LR4A 3OCLA 4OIRF 4R38A 3BDDA 4Z9QA 4UHUA 3NRVA 3S15J 2X1CA 3CZ6A 3CCJI 2JRMA 2Y2NA 4GLQA 3DL1A 2BY3A 4KUMA 5I43A 2Z2DA 4A3FJ 2ZC7A 3H9JA 3F8NA 1XX2A 5CEDA 3MQ0A 5FGMA 4GWMA 4C3QA 3BJNA 3HB2P 2O7OA 2DJNA 1SLMA 1I6XA 4RLFA 1F9NA 3OL4A 1TZLA 2XSDC 2HVSA 2DAOA 2M8GX 2Z33A 3JSOA 1SAXA 2GIZA 3M7GA 4CH7A 2EX9A 4HQMA 3T4OA 1L0DA 1BI3A 4UVCA 5DM6F 1NLZA 2X6WA 1D0YA 4GW9A 3F22A 1EUBA 3K10A 5DTKA 5JHUA 1IEMA 4G3VA 3DWZA 4JGRA 3T8RA 1GDTA 3G32A 3CUEA 5H6RA 3QRFF 5EOOA 2OV5A 3I4MJ 4E6WA 2WOAA 5D6EA 3GUDA 3LSJA 2UXNA 3F21A 3BLSA 4WEJA 3K4BA 3GLLA 3FIWA 3F8MA 2PMUA 3BG9A 3OIPA 1DPRA 5DFXA 2AXTC 2WZZA 3G1OA 2XGDA 3BLYA 3G2ZA 5KVRA 3H3ZA 2MLRA 2JSDA 5IP9J 3RCOA 4MN5A 2HTJA 3GCMA 4ILWD 4KA4A 4EBLA 1OCTC 3KSFA 1SAUA 1B6AA 1WGXA 1JGSA 4RQ9A 2VJJA 4N92A 5FFXA 3VEPA 3HTUA 1FPQA 1BL0A 3KHIA 2LSOA 3LGPA 1DU0A 4P1WA 3DSLA 3TOBA 2EPFA 1T18A 1J9MA 2VPRA 1D8KA 4QKZA 3CMZA 3GFLA 4A12A 2H09A 1KGFA 1ONVA 5HD5A 3QPLA 2VPLA 3HYGA 4KDPA 3KRYA 4ON1A 3FHNA 2V9KA 3LNQA 3V8KA 1HTDA 5HDGA 2XAHA 1XG1A 3CESA 3I5UA 1J9IA 2JT6A 3BQZA 3I59A 3HLEA 1CXVA 2W1OA 1DTHA 4BWIA 4DF6A 2GX5A 4IHYA 2M4GA 4DJ3A 2XGNA 1U6GA 2WV1A 4EJOA 4S0HB 2NVQJ 3BP8A 3L09A 3BJ6A 3FK6A 1PUFB 1KU9A 3Q7VB 1UWNX 5DF9A 1LKXA 5DD8A 1SZVA 3UMEA 1MBHA 1K61A 1JGGA 4RB1A 3VE3A 2LP0A 1OFCX 4GCVA 1YI2I 2W0DA 4I3AA 4OONA 5HFOA 1XMAA 3HUMA 4R3BA 3R0JA 3EDPA 1YAXA 3CHWP 4X25A 5BNGA 3K4LA 1IC8A 2CJJA 3Q0VA 2RDPA 2CO5A 1I2SA 4H76A 2ZMEC 2X0LA 3HY9A 5BOYA 2KHMA 1PWGA 3OR1C 3LL7A 1BT5A 4ON0A 4HDVA 5HARA 4L9EA 3HB9A 2W3DA 5GHYA 4JPMA 4LG3A 4FCFA 4PKWA 2VQCA 3FXJA 2JK3A 5DVAA 5FO5A 4JXGA 4X1MA 4JGQA 2PG4A 4AUOA 2DPUA 3TG9A 3F1OA 2DW2A 2NVUB 1I27A 1XJ4A 5ICEA 1IF1A 3NULA 3DFGA 1FBUA 1NYYA 4R6LA 2ZXHA 3IXDA 4F3LA 1XGIA 3GV9A 2FNAA 4A6DA 2XB5A 4N9IA 1FBLA 1QQIA 4D0PA 3GF2A 4HNUA 4BQQA 5HAPA 1BSGA 4GS9A 3IF6B 2J3WA 3RYRA 4A3MJ 3WTXC 2V4BA 4C30A 4Y3IA 1YKDA 4LITA 3LCEA 4PKYG 3GTJJ 2CC1A 1KUGA 3CAXA 1T0FC 4IUHA 2VT2A 1LEBA 3JREA 1RKTA 2Q2EB 3V7RA 3JRHA 1RGYA 2EFXA 4ETZA 4DXBA 1EKEA 1DQUA 1XCVA 1FSEA 4DKIA 1LE8B 1LJ9A 3OYHA 4KG6A 4F91B 1LQ1A 5E2EA 2V6CA 4P9FA 4GB7A 3F1NA 2VKEA 1A31A 3DWLE 2Z1DA 1SFEA 3FDYA 2WY7Q 1FCMA 3CCVI 2FD5A 2Y0SA 1LFUP 3G1MA 4M3GA 2DA3A 4GRIA 4HZFA 2VV7A 3T1RA 3VP1A 1AHDP 1YOUA 1FQGA 3P24A 4WEKA 3BG6A 1VQ7I 4I35A 2L01A 2L0RA 3IRRA 1MSFC 2P5KA 2WK0A 2QF7A 5L2FA 2N8RA 2AQEA 3ISGA 4D5CA 3PBOA 3R6SA 4LOCA 3C2HA 1GCEA 2EBIA 4XLAA 4LG0B 2LB9A 3OOUA 2WTEA 3BTIA 2L54A 1MSEC 3ZG9B 2Y8HA 1CF0A 3AG4H 3WU2C 2OWJA 1IYQA 2DA1A 2F6CA 2R3SA 2AHQA 4OH0A 1I76A 4HIAA 2GXBA 3CO6C 1DJAA 3K7NA 1IYOA 2DW4A 4LV0A 2OU2A 4DYQA 1GKDA 1ETOA 3RI4A 3QP1A 4IOCF 3CD6I 1PYVA 2IEKA 4A0XA 1K25A 5B1BH 4EGZA 2H8WA 4IEJA 2VA0A 4F52A 4HSRA 3F6VA 2X6YA 1LFPA 4G7HF 4UVBA 1IRFA 1LDDA 3GR2A 1BOBA 1BQQM 1H9GA 4HQAA 2CU7A 1W7PD 1G4DA 3OL3A 4LLGF 3S2WA 4EATA 2AQFA 4LV2A 5A8BA 2OCCH 1UMTA 3HLBA 1Z3YA 4U7DA 4HBUA 3H3VK 2OC6A 1ZARA 4JLFA 1IACA 3MA2A 3VFFA 2MC3A 3FK7A 2PHYA 4GWNA 2G9WA 4MNRA 1DP3A 1MNMC 4BDZA 1OTIA 1HV5A 2JC7A 2VX8A 3TGNA 3GTKJ 1XXMA 2KDZA 1H8MA 3BECA 5HWVA 3GFJA 4E6XA 4XLNF 4C3HJ 3LOCA 2L2OA 1FLSA 3H7WA 2E34A 4WL9A 2IGNA 2Y6DA 3H82A 4ZYHA 2DOAA 3CPTB 3DEWA 3B02A 2KJBA 3B2ZA 2EINH 2XAJA 2RQQA 3DTIA 3ZDJA 1J5YA 5DYMA 4HX8A 2VJIA 1M40A 5CLSA 1ZH5A 3FC7A 2V4JC 2W25A 2VN2A 4DQ2A 1GE7A 2XPWA 1U60A 2DTRA 1BZSA 4AUXA 4ENMA 3I53A 1BIBA 3HSEA 1UMSA 2VONA 2UZKA 3G73A 1LT0A 4F3QA 1FT9A 1H8ZA 1ZRDA 2O61A 2QZ8A 1H8AC 4HBTA 4LENA 2L9VA 2JMWA 2E7XA 4FASD 4HQEA 4BACA 3NDGA 1BC7C 2XAUA 1ULYA 3BJOA 3V96B 5I5LA 2ZQDA 2FV9A 4PKVA 1PW1A 2QZ6A 3OYBA 1BLHA 1KAPP 3M6HA 4QJGA 2I47A 1ZTUA 2ZSHB 5LGTA 1WYBA 2ZBBA 5DCMB 4EXOA 5IT9Z 1XFZA 1N77A 3QWLA 3NIAA 1A85A 2GNXA 1CQRA 2ZJ9A 4OU0A 2L7MP 3P01A 3BFEA 3WV2A 4RB3C 2TDXA 1YLYA 4Y4RA 3BTLA 5BMZA 1YW8A 3MCZA 4AD9A 4Y7PA 2E5ZA 2HXIA 2X6XA 1B72B 3E5QA 4CJNA 4MFEA 3Q9VA 4CICA 3H1CA 4PM6A 1YQYA 1JANA 3GDIA 1BI1A 1FOYA 3QPSA 4B88A 1IAWA 2RC4A 3D5LA 3MKLA 1IYSA 4CLCA 3C5AA 2ZL1A 2OXWA 3C1DA 3I58A 3Q0UA 3WTWC 3TQNA 1UHMA 2DDBA 4NKPA 3D3OA 3LA2A 1ONGA 1W79A 4I76A 3D5RC 3LFVA 3B6AA 5IY5H 1LVAA 2HDDA 2GIVA 2KLOA 2VBYA 2VZWA 1MW7A 4EM0B 3ABTA 2M7VA 4Y52J 4XUZA 1XDUA 1YW7A 1I3QJ 1BLCA 1TW2A 2JA8J 3FXQA 5J1YA 3ZFZA 1MDMB 2YUSA 2R7UA 1OCOH 5CVUA 1IN4A 4A3JJ 3QHYA 3DLAA 4K08A 3MZDA 1W5SA 2M45A 4XN3A 3WS0A 4KN4X 1ZGWA 2FRHA 2ZC3B 2LTPA 4DBRA 1JT0A 2CWEA 4D2OA 4XBFA 1YIJI 2DCFA 4XLCA 3VSLA 4LCMA 2XIGA 4HJ3A 2HGCA 5CQGA 4ZAMA 2RREA 2JN7A 4R4SA 4JXWA 2B95A 4C3JJ 2ZC5B 5HS9A 3VYTB 4AYBN 4A3WA 2K9CA 5KZHA 1QIBA 1V3FA 1B8IB 3L2WA 4BS9A 2GJ3A 4II2A 2E1MB 4JGOA 4FISA 5J7EA 1XJ6A 3A3FA 3GO5A 1JUPA 3FV7A 2WUQA 3MZ8A 2LKPA 4KZ5A 2BW3A 1F98A 3SHIA 4P85A 2JKFA 3FF5A 2F5CA 3GX4X 3T1XA 3GEZA 3WTSC 4EQQA 2K31A 3ZPLA 2XDMA 4LK0F 2ZJRF 1BLSA 2E8JA 4DDYA 3ROUA 2ESNA 2VV6A 1TS6A 1MJ9A 1Z7LA 2Y31A 4J00A 3CMAI 2CW0F 2VL8A 2F5DA 1VQPI 3IH4A 1AU7A 4JGPA 1TC3C 2HI3A 3OV8A 2XD1A 2QJ5A 5E2FA 2OXZA 1HOMA 4WMCA 2CUEA 1WA9A 3TOIA 2BV6A 3KYDB 3F8CA 1TWHJ 3GTGJ 4X53A 2JT1A 1S1ZA 2K4JA 2LY2A 5EVEA 5FDHA 5EEHA 3LIEA 1XKZA 4A6EA 4IHTA 3C7UA 3S93A 1VTNC 3IH9A 5BQTA 2HF6A 5IT3A 2CW7A 4K2EA 3K4KA 1HA8A 4EV4A 4Q0JA 830CA 4YIFA 2P6TA 5EM1A 2OZUA 2C5WB 1K78B 4I39A 1HSJA 2Z9OA 4OQHA 2XQZA 2IP2A 3MKYB 3P98A 1ETXA 3RKXA 2AO9A 1Y39A 1QHGA 4X0GA 3DW0A 3J81Z 2K9NA 1UGUA 4HG2A 1NZOA 2DXIA 3DPEA 2GZAA 1FIPA 5MC7A 4PHTA 1LSWA 5JR3A 4M3KA 4S2NC 2XAQA 3TE8A 5C5KA 1KE3A 2PBDP 2BE5F 4N4OB 2PYPA 2WKQA 3A3DA 1PP8F 1ZTRA 3HUGB 3DQVC 1P97A 4OPYA 3OYFA 3HL2A 1JHFA 4YG2F 4FTXA 1TLHB 3HXLA 2EV0A 2OW1A 3S1YA 1K38A 3KIOA 1G6NA 4U88A 1XUDA 4IX7A 3FBNB 3LE9A 3HGYA 1FJLA 4I01A 2L02A 3IUOA 2L4AA 2BZTA 2NOGA 3VWBA 3O2PE 1R9TJ 5TFQA 2OY2A 1QHHD 2A69F 2CUZA 3ELKA 2R4GA 5ILUA 3LEAA 3OYKA 3ASOH 1XTAA 4RYEA 3T5XA 4LFUA 1Q2PA 4EMSA 2B63J 5KSCA 4WXDA 1SD4A 1ODDA 3W6KB 5D5WB 5F5YA 2EIJH 3HDDA 1G59A 2ESHA 4XM8A 1KA8A 2B02A 1RPWA 2WKEA 4HOBA 4JXSA 1XPXA 3VFZA 2K7LA 2XEPA 3MFDA 4II3A 1ES4A 4X69A 5DF7A 4E3MA 3HBRA 1JVJA 5GL9A 3GZ6A 4GNUA 1SANA 5AQ9A 2E36A 3ZMVA 1Y1WJ 3N97A 5CHJA 5J1UA 1RR7A 5FKKA 2CV0A 2KRCA 2V8CA 4N9KA 3UKGA 1A5JA 4HBLA 3N2VA 2LKXA 1Y8RB 2NNNA 3ZG8B 2Z5UA 3WODF 4XRSA 4MIMA 3DAVA 3LEQA 3OY9A 2L7KA 4O3MA 2KRJA 4F55A 1VETA 1X2NA 1BTLA 1EW0A 4QD4A 2ZC6B 2RV8A 3ZMZA 2W3FA 3F15A 2VJ4A 3V7CA 3E2LA 5HDSA 2ME6A 3Q82A 5CVVA 3OWTA 5L3BA 4YOFA 4HMAA 2FQ4A 1VQ9I 2W4SA 5D1UA 1DJBA 2ZC2A 3Q1FA 5FLXZ 4MN6A 4I0BA 3TVCA 4Y0TA 2NS0A 2V1ZA 1IUFA 5K7ZA 4MBKA 3TMOA 4LRYC 3S3OA 2FZ0A 2DFHA 4YIRX 2HDSA 3CWFA 1CI8A 4D7MA 2GM4A 3CI6A 1AKLA 2XH9A 3I9V2 2VKVA 2VB6A 1P92A 4L6TA 3HRMA 1K55C 1IUYA 2EA2A 1A0KA 1EH8A 2PN6A 1KDWA 4P9UA 3V67A 1T33A 1MBGA 3O8GA 5K7FA 1FBQA 3J80Z 2IGMA 5CEBA 4R1GA 5F0FA 4L9VA 3V39A 4NC7A 3HTSB 2I8DA 4BBVA 2WAFA 1X58A 2FBHA 2FBKA 4EESA 3SOIA 1GHCA 4PM8A 3PFIA 4HEA2 4IHXA 3RJPA 5HS8A 1IRXA 1R5HA 4KMFA 3MR0A 1QZEA 3LSGA 2JUCA 1PJRA 1SCWA 3CCRI 1G3SA 1X2MA 3OSFA 2A07F 2ZOIA 3N7WA 1S29A 2DT7B 3NWTA 4KIBA 3A1YA 3AGEA 5I12A 3GFMA 4NQWA 5BOTA 1T1CA 1I2WA 4KZAA 3LFUA 4RGRA 4GHIA 1JUSA 4F92B 2KDKA 3LEZA 2CRGA 2QENA 3UPNA 1XFUA 3JCUC 4E4HA 3R4KA 3RQIA 1G12A 1G05A 3U1DA 3HREA 3AG3H 1NH3A 1V5FA 1ZAOA 4EBNA 1PWVA 1KQ0A 1UG0A 3NJAA 1WH5A 2V0UA 2P6SA 2VGLM 4I03A 3V4GA 3F6OA 4NXEA 3DKXA 3I7GA 1K54A 4EQIA 4G7ZF 5FAPA 2CV2A 1U78A 4BJTA 4EEFG 1P4XA 4N1HA 2G7HA 2EFUA 3LIAA 1KU3A 2XPVA 3I56I 2OAZA 1XUCA 3HYIA 1IN6A 4X6AJ 3W4OA 3JAMZ 3IP4B 1KE0A 1TDGA 2Y2GA 5BPAA 2VLGA 1S5LC 1I50J 2R9XA 4AU7A 4EM1A 3P5JA 5D5VB 1RMZA 2M7BA 2X1DA 4Q4ZF 2V9AA 1RKWA 1P6RA 1L0FA 3SS5A 3VV4A 1JWPA 1JAQA 3ZQGA 3BZ6A 2F2EA 4XBHA 3GWZA 4GD6A 2A8HA 4PZJA 4X1EA 1WWXA 4V2FA 4H1QA 5CHUA 2QGUA 3HM5A 1RZ4A 4R79A 1K7AA 1HDDC 1XSXA 4FXQA 2W15A 4B4ZA 1MMRA 2BOLA 2KRFA 5BOHA 4JX4A 1NLYA 4KUOA 2QQBA 1IZ1A 4BLMA 3HEFA 5B66C 2ZKZA 3ZG7B 1AA7A 3O87A 3O3VA 1MMSA 1HC8A 3NWSA 2Y2IA 2M0MA 1MWSA 3LYXA 3R0AA 3I59B 4DD8A 5CXAA 4IEDA 2ZXIA 3EUKL 3ERMA 4KUKA 2ID6A 3HJIA 1D06A 2K85A 4NNJA 1O7LA 4UA6A 4BAYA 4MTDA 3QOEA 3IWIA 3HY7A 3CC2I 1YP1A 3CTAA 3OYEA 1FM1A 2E71A 3HSFA 1OPXA 4UB8C 4KICA 3CF2A 4N0BA 4EEUA 4MLOA 5F6FA 5A91A 5DM7F 1IRZA 4BBTA 4FU4A 4OOIA 3HGGA 5KSHA 3IWOA 4PGGA 4RGSA 3VP0A 4PKQA 2AVXA 2NAZA 3CCUI 4G9LA 4P55A 5DCFA 3KZYA 4WK8F 1FCNA 2OBPA 2K27A 2HZ5A 5A2QK 2HPMA 1P7IA 2WB1N 4DPEA 3ABUA 3EQUA 3A3EA 4JQGA 2LVSA 5EJCA 1LNWA 3M07A 1WZ2A 456CA 5FLVA 5KAIC 3WTTC 3L7HA 1SFXA 4EUVA 3JVUA 2C6WB 4FE7A 4QHCA 4FT8A 3T8TA 1KGGA 5L07A 3KYCB 2ZM2A 1MY8A 5A92A 1JK3A 4F3LB 1T19A 3IL2A 3UDIA 4KIGA 5F1JA 1BR2A 1MGTA 2K5CA 2MFZA 2HPIA 1FEXA 5IYCJ 2RQPA 3OHOA 2XKPA 3H9GA 4CDGA 2L7FP 1Q2QA 1J2XA 1YX3A 5K5BA 2ADUA 4GS9B 2KIQA 1S7OA 3KZZA 4L5JA 4FE4A 1C0WA 4GR3A 1ETKA 2I9VA 2IWCA 3GFIA 3LSIA 1E17A 3CJTB 3LR5A 1BN5A 2E8IA 3Q5FA 1XGOA 3KLNA 5E3MA 3UB9A 5EG0A 2FE3A 3NI9A 3QP2A 4HLYA 3OPHA 1LL5A 3H92A 4KT5C 3VSKA 1GSWA 1WYCA 5J8FA 3IAS2 5DUKA 3F1NB 1VQOI 4CCNA 1S4BP 2CKIA 1PP7U 1MKIA 3PSIA 5L10A 2LNBA 4G3KA 2EFNA 5M1AA 1W5DA 4G94A 1JHHA 3K70D 1HVBA 2KLIA 1YW9A 3B73A 4AVPA 4HJ6A 1NK2P 2A6TA 1EA3A 5HLTA 1R5GA 3DCFA 3PIOF 2P7CB 4QB8A 2IGOA 3HBVP 2MZEA 1YIOA 3T4QA 3IH3A 5D8KB 2ZMAA 3G34A 2KISA 3HRTA 3DNGA 3BOQA 2VT3A 4BMWA 1Z9CA 3FISA 2BEOA 2STTA 2VJWA 4E3NA 1R4MB 5D3OA 5EVID 4GFBA 1BUEA 2E5NA 1R22A 4IQ4A 1BW6A 4RB0A 3HOZJ 1G6AA 1TT5B 2DFEA 1ORKA 2JKRI 1ZYRF 3DF8A 1OYIA 3MZHA 2ZXWH 4KISA 2HDQA 1K6OA 2Y2HA 3KYLA 3VYRB 2XAGA 2VIXA 2DA5A 3L1PA 3ZOBA 2ZC4B 4C3IJ 3JTGA 1F9IA 1R4NB 4M9ZA 1D7XA 2EJRA 3NDEA 5EVLA 1JT6A 3QOPA 1UEAA 2WKHA 3C3WA 4BY7J 3ZMDA 2IA1A 3FXRA 1JJ8C 2XR0A 3OSGA 1DP7P 1U9OA 2OSUA 1IN8A 1KOUA 4HLXA 4MGRA 4WF6A 4BD0A 3H7WB 4F94A 3AAFA 2EWWA 1F1ZA 5G18A 4O01A 3H82B 5FI7A 4S2NA 2OOLA 1Z05A 3N05A 4Q48A 4CLCD 2O9AA 1OLTA 1NG7A 2YKFA 3ZNTA 2IPQX 3VTGA 3FKIJ 2ACJA 4MFDA 2GDNA 2JCHA 2ZNZA 2PLYA 2K4BA 1HXDA 1ZRCA 2HZTA 4OAZA 4ZJ3A 4E7LA 2JQ7A 1XFXA 2WAQN 2NVYJ 3QP6A 3DWBA 3LSRA 5FQMA 2IJLA 4L19A 4X55A 1E0EA 2XGCA 1Y8JA 2HQNA 5IP7J 3PSFA 1J3WA 4EFSA 3TO9A 1ETVA 1PWWA 3L9FA 4OIOF 3IC7A 3ZQCA 1LUJB 2BY0A 2A5YB 2Z6CA 1YG2A 2BVLA 3S4XA 1ZR2A 3S2DJ 1STZA 5BPIA 1IW7F 2OPTA 3V3SA 3AYUA 3AL0B 4DV8A 2XLNA 4A3EJ 3LJTA 1U0JA 2HU9A 3RPUA 2ME0A 4PCQA 4QU3A 1X1CA 2FSWA 4KENB 1WI3A 4DE0A 1ZGAA 2XHKA 3HVFA 2OW9A 4PKSA 2CW8A 1KUIA 2YU9J 3JRBA 1FNNA 2W82A 4LCLA 2ZLYA 3BFFA 3E7LA 5J1RA 4Q0IA 3WE3A 3S7QA 1EH6A 3FKJA 3SXYA 2FMYA 3F8FA 3UPPA 5CERA 2IWDA 4G6DA 1LI9A 1C7KA 3HOUJ 1N9OA 1KUFA 3ZXSA 3I71A 4XNFA 4BQOA 2JSPA 3IF5A 2DK5A 2X71A 2Z2SB 5AVFA 2LF7A 4CLCB 3S14J 2ZL1B 2DTZA 2JNPA 3KEQA 2ISZA 4CCKA 3P9IA 2PMZN 3JRAA 1K0KA 3CLQA 1BOAA 3V7SA 5B3SH 1QA6A 1MMQA 4IHWA 1JTYA 5KNLA 4WMCD 3B8ZA 2MYSA 3FM5A 3RJUA 4HAMA 3A01A 5EDNA 1D1AA 2J5OA 1XGSA 1YHQI 1KONA 5D5UB 2K9MA 3ZXHA 2HWVA 3ZQ5A 2X4HA 4YFMA 1LDJA 4MNUA 2KOIA 4PJMA 4U0XA 2A61A 4HJ4A 4AIDA 1IRGA 2Z2MB 4IHQA 4I02A 4BL2A 5FEFA 1X4PA 2DW1A 4XSXF 2FNPA 1NWZA 3MMHA 2ELJA 3L2QA 1SD6A 4H30A 3HCYA 5JVTA 1Z7UA 2UV0E 4XT2A 3RZOJ 3UN7A 3P7NA 3J7ZI 2XFSA 3CCSI 4WF2A 3T4KA 4GYGA 2FFYA 3COAC 1YM1A 4MTEA 1I5QA 2G2UA 2V7FA 5HAIA 3VP3A 1AKHA 3FZCA 5E3NA 2FOWA 2XF6A 1Y8QB 1TNTA 5B5PA 4UQIM 5F68A 2R78A 1CEFA 3DU6A 2QVOA 4MN7A 3RIRA 2BW3B 4FH4A 5LEJA 1KUKA 2HOAA 5FQKA 4E3KA 2COMA 1ZK8A 3P9KA 1LL9A 4U87A 1R23A 1D0XA 1FWZA 3MAJA 4E6KG 5M3FJ 2K9SA 2LY1A 4PKTA 4P96A 4A0YA 2PU2A 2MC4A 3TDUC 1Z21A 2VV8A 2H6CA 3HLCA 4EUZA 5GLCA 2J9OA 2M1CA 4EGYA 5CVRA 5GTIC 1L0EA 3KETA 4ZDPA 3PL8A 1YS6A 1OCZH 2GOXB 2H5SA 1J59A 2JVGA 3V5MA 1P9RA 1YT4A 1FP1D 1GO7P 1HW1A 3FWLA 2VQLA 4Y17A 2BHZA 2VC1A 3LJZA 5J4EA 1N25A 3M9AA 1BI0A 3MKZA 3T1SA 3M8JA 3KZIC 2M4KA 2UWXA 3LFKA 2QYBA 5J3LA 3PNTA 3LY4A 2OXUA 2VASA 2FBIA 2KRHA 2XRLA 4FX4A 2Y9YA 3LR3A 3P9CA 1HY7A 4WCGA 1UHWA 2IS1A 3NY4A 2GLOA 1ZG6A 1OCPA 2G7UA 3K4JA 4HNVA 4LLLA 3CUOA 2DW0A 3E3VA 3LSHA 1CK7A 2CQNA 5F04A 3ZVWA 1FSWA 3LAPA 1AOYA 2KKOA 2VLAA 1TVFA 1YLTA 1WJFA 2HKOA 2P5LC 2OD5A 1JIWP 1K4SA 3SH8A 1USNA 3E8RA 5LGNA 5EYRA 4R23A 2JA6J 4MEXF 2Y2PA 3ZCOA 1JJ9A 2QWSA 2WYXA 3E1SA 3N8SA 3QU6A 4G0DA 5E79C 3S8PA 2ZNYA 1I73A 3LO7A 1CF7A 5FROA 4DJ2A 3IWFA 3LUMA 5FRNA 4L18B 3ABLH 3M3YJ 3VB2A 2VC0A 4GUYA 3SEQA 4XSZF 3PJRA 2XA7M 1T38A 4KQDA 2NNYA 3HBLA 4KZ9A 2JBFA 3DBRB 5L3CA 3ABMH 5FAOA 1H71P 2JJ7A 1Y0UA 4M72A 2YUFA 5C44J 2OVZA 3CCEI 3IWZA 4E7HA 4II7A 4XOTA 3NOPC 1IN7A 5DTDA 1IO2A 1XJ2A 4HP9A 3G2YA 2RAEA 1C3BA 3BR1A 3ASNH 1IAEA 2J5PA 4ZBEA 4BQMA 2V79A 1G8XA 2ELHA 2OJED 1JI8A 3CJQB 3B3XA 2VBXA 1JJ6C 1KYZA 4HOIA 4AFIA 3K4NA 3KSHA 2MSYA 2V26A 5LFAA 3E4OA 2H1KA 2OQRA 3Q7ZA 1SDNA 2E1OA 4D7NA 2LYCA 1EF4A 2HJEA 1XD7A 3A0RA 3NAUA 1G68A 4PJ0C 4B9OA 1G2HA 2Z99A 4GZBA 3OS0A 4U7BA 1D8JA 3A0VA 2YSRA 1E4DA 3SYTA 4WK7A 1R1VA 4UY8I 1N78A 4D60A 3ZR8X 2F5VA 3TEDA 2MG4A 1VETB 2QJ7A 1P4WA 4GR8A 4XRSG 5FA7A 3A03A 2JSCA 1ZG3A 2J7VA 4KITB 4NXBA 3CUQC 3HZJA 2M9HA 4MQ9F 3LUQA 4UA9A 5FKNA 3M4OJ 4PK4A 1JKQC 4YFNF 1GHPA 2G0EA 3O88A 3E5UA 1K56A 3QODA 4YEJA 3PM1A 4RM3A 1YS7A 4ABZA 2R93J 4IOAF 1ZKGA 4DN0A 3V50A 5D4RA 1S3JA 1E3UA 4LLOB 3LQQA 5AQAA 1Y1VJ 2WZXA 3RSNA 3TKYA 3VOLA 4ANJA 1FOWA 1XAXA 3OIOA 2ZJPF 4J19A 3EWJA 3M2JA 1YE9A 1QUAA 2XC7A 1HSTA 4A3LJ 4D9JA 1FZPB 1PZOA 4Q5SF 2XF7A 2R7QA 4L5EA 3A0BC 3GMWA 2KIUA 3H0GJ 3KYEA 2B9SA 3R7WA 2ZXJA 3PO2J 3PAGA 1ZP5A 2OVXA 2HVRA 2Z2LB 3EUHC 5CVJA 1SMPA 1SU3A 4EQ1A 1D0ZA 4FHTA 2P7VB 3V3RA 1R1IA 5LHHA 1XPBA 4LV1A 2O99A 3CDIA 4JBFA 4NQWB 1JWVA 2J83A 4QTRA 3VMAA 4XM7A 1BSWA 4GHIB 4MBHA 1D7EA 1OM6A 2LLKA 4A5RA 2ZQAA 4GKUA 2LBFA 4BH9A 2N8GA 1NK3P 4L9FA 2JKGA 4XL9A 4QPRA 3KEJA 4PKRA 1NJ4A 2XPUA 3W8KA 1IDYA 4HA8A 2GA1A 3EDZA 2M0CA 3B47A 2EWNA 2DU9A 2CFOA 2Y2MA 1YITI 2X48A 5AIQA 4AIHA 2P9VA 3PBQA 1YLFA 4DIQA 4EU0A 2V1XA 2L4RA 5LLQA 3VE4A 1RR8C 4E7KA 4CSWA 2AIGP 2DMUA 2ZFUA 4LJZF 3PO3J 4MDZA 1OT9A 1DJCA 1IYPA 2VGJA 1XMKA 3K69A 4RX2A 1HOVA 4G9YA 2Y0MA 1N9LA 4I2OA 5LHIA 1ZLKA 1MWTA 1UZCA 1ES5A 5HL1A 3ISPA 1GSXA 5EZGA 3BWLA 2MABA 3OIQA 1CEGA 5TRDA 3TJZC 3GBOA 5IYBJ 2Y2JA 2HV1A 4OINF 1XM5A 2MLSA 2BG1A 1O4XA 3O6BB 1G5UA 3EDGA 1ZREA 4AXQA 3O86A 2QMIA 1YLPA 4BBSJ 3IAM2 4F7ZA 4G3WA 3PQJA 2A68F 4XORA 4X6TA 1VQLI 3EHXA 1NY0A 2JKRM 2QKLB 1VQKI 5J6XA 3IHUA 3EDIA 1GVDA 4OQGA 1BIWA 1IGNA 3S7PA 3MD2A 1LDKB 4W1UA 3UDXA 1D5JA 4GCZA 1OO9A 2XGXA 1FLIA 4S04A 1ON2A 1S0WA 4HF2A 1HF0A 4ZYDA 1IDZA 1ZHHB 5HSQA 2USNA 1ES2A 4W97A 3DPTA 2E2IJ 2UV1A 5I3MA 1RETA 1GLNA 2OLUA 2GAUA 1IV6A 2MH2A 3C18A 3CCQI 4EVIA 4BD1A 1SC7A 3E6DA 4XRMA 1O3RA 3QAHA 3WV3A 1YTYA 1R00A 4YINA 1A36A 4ZRRA 1UTTA 3BZCA 2K9LA 2OW2A 2OQGA 4WM9A 4PDKA 3HRUA 1VEUA 4FCYA 1MJBA 1MIJA 1ETYA 3O8HA 3MZYA 3D0SA 4QPQA 3Q2GA 3QYFA 3A2KA 3I4NJ 3FYZA 2Y69H 3KX0X 2E2DA 4S2LA 5K1YA 4KZ3A 2VKSA 3WE2A 2YX7A 1M1EB 4EM2A 1QMEA 1W1WE 3IH8A 3FWEA 3UE0A 1O0QA 2KQRA 3R61A 1PWQA 4HP4A 4UVAA 4XKBA 3OYDA 3CUEC 4UUVA 3ITAA 2K9QA 1V5EA 3OOPA 3L2UA 3IXHA 1R55A 5GAEJ 1XB4A 2P4WA 1B8YA 1U9NA 1USSA 4I09A 4NK3A 2E2JJ 2HS5A 4GR0A 1WJCA 2IAIA 2L9SA 3UPOA 1IKIA 4A5MA 1OT6A 1LSXA 4FD8A 2NXNB 3LKAA 4CPKA 2Y0SN 2GBYA 1YX5A 3GZNB 4KG5A 5FRMA 2XAFA 4Y0OA 3HOXJ 4JX6A 5F08A 1S6LA 3OC2A 3UO9A 1JWZA 2VJ5A 2GQQA 3LJGA 4WZ5A 4GD8A 1OM7A 2L9NA 1Z1DA 2W1TA 4JK1X 1RI7A 1QICA 1Z3XA 3PR6A 4HESA 1MKMA 2WAEA 2LMDA 4BL0B 3VP2A 1IXCA 2OTLI 3WGHA 5HDDA 4DGWB 1IXRC 3MEXA 6PAXA 5I4OA 2M3AA 2QKMB 2VGKA 3VP4A 5CVIA 2D2WA 1DY6A 1E3PA 2W3GA 3WTVC 2O9CA 2FJ1A 5EG0B 4Y7NJ 1LB2A 2V2FF 1R6RA 2CV1A 3K7LA 1NHAA 3D4FA 3OYLA 1WE4A 3E6MA 3AG2H 2O9LA 4NG2A 1K57A 3CCLI 4DBQA 3DU5A 1ENHA 1N75A 1QBJA 2CLTA 4X1LA 3IKTA 4QY5A 4ARZA 3OHLA 1W8YA 4BJPA 2JKTI 3K4CA 3I7IA 1QZZA 2R7SA 1YLWA 1W7PA 4WN5A 3VOEA 2L4MA 1TWCJ 1YFHA 1K7IA 1OCRH 1UJ8A 1X19A 3CMYA 3F16A 4BL3A 3PBNA 5J4YA 2UUZA 2WKRA 2DLLA 1FCOA 3U2RA 1WPKA 2PJRA 2L0WA 3TL4X 4IRGA 3GSGA 2PR5A 4J01A 1EB6A 1GKCA 2EZLA 3M2KA 3U2AA 3BC8A 1K6RA 1S7AA 2W0NA 1IFQA 5L8MA 4JF4A 2HJ9C 4C2MJ 2UWMA 1OM8A 1P2FA 5E2GA 5JHFA 1EWZA 1Y56A 3H3UA 2HDUA 1OCCH 1PRQA 2AS5F 2FFFB 2KIMA 2K02A 1SATA 2O8XA 3IX3A 2A2LA 2WKPA 3F8BA 4EJUA 5E17F 2K2NA 3CJRB 5FSRA 4RAFA 5CRFA 3FKVA 3RKYA 1JKYA 1H0MA 1CAQA 5GLDA 3UNWA 4B4CA 1C3IA 3RPUD 5H8XA 4WXHA 4EJWA 1UMQA 4H6JB 5CX7A 2FXAA 2PBIA 4UXNA 2HU6A 1QPIA 1T98A 1UELB 2VE8A 3RXWA 3WU0A 3TW8A 1O7EA 1BC8C 2J80A 2EROA 1GXDA 3ZMSA 3NOTC 4XKWA 2HQAA 2E1NA 3VPRA 3F18A 1Y93A 4Y0UA 1JTXA 3GTLJ 1OJGA 4P5OA 2CUFA 1APLC 3BRMA 1TS8A 2JHEA 1RUOA 2IBDA 1BIAA 5LBRA 4OQ0A 4I99C 3OYCA 5FKMA 4EW7A 1L0GA 1P9WA 3JRIA 2PAVP 1D1JA 4PJJA 2XK1A 2Y48A 3DTKA 1QJIA 2P81A 2QQ8A 4AIKA 3IS2A 4ZDLA 1B1BA 1I3AA 1WJ5A 1W63Q 4FOFA 5E43A 3HL9A 4R3AA 2E7WA 1LSVA 4ZJ2A 1YJNI 1YJWI 3ZN0A 2Y91A 3WV1A 2DOEA 3VDXA 2R9WA 4B09A 3PUBA 1ZG4A 5EEGA 5ERIA 3ELMA 3FZVA 2J0TA 4JF5A 1GV5A 4RA2A 1OTAA 4O5VA 5GTHC 4E3JA 4HH2A 4BHCA 3HC7A 4OAYA 1U5TA 3W2AA 3S3MA 1OYWA 2VXDA 1R54A 3K2AA 3SZTA 1ACIA 4MEYF 2W84A 2F4OB 3UB5P 2QBYA 3EETA 5TJJA 1O0TA 2I72A 1VQQA 2H1LA 3RFBA 3LK8A 3HLFA 5E1XA 3ZGAB 3L2CA 1VI0A 2HEOA 2XVCA 3W2VA 1OR7A 3MKFA 2DMWA 4CCOA 3C38A 2X51A 5M5WJ 3LIFA 2OZ6A 1Y0NA 2A6HF 3NCKA 3E98A 1ZG5A 1BM9A 2OLVA 2XV4S 2ZJ2A 2H8RA 5TBMA 2XKOA 3CCMI 3T4JA 1Z6RA 1ZTQA 4KQQA 3LA7A 1MBJA 2VQGA 1S66L 3U1RA 3ITBA 4ZJZA 1Q1HA 3K1MA 1WNIA 4FQGA 3SH9A 3U21A 5ILSA 4AM3A 2K7SA 5FQJA 4CO8A 3CUQA 2QSFX 4ZDXA 1W8QA 2TCTA 3OCNA 1Y0VA 3WS1A 2E2HJ 5JFRA 1AWCA 3PYPA 3TOAA 3F72A 1T1AA 5LRSA 1H5XA 1FIKA 4B48A 3M8FA 2W00A 2EX8A 1SFOJ 3R60A 4QWOA 2BLSA 3C30A 3FXLA 4MEZA 3LMCA 3A01B 3K70C 2E60A 5HLHA 4DZPA 4OQIA 1S8NA 1W0UA 3SS3A 4IUWA 4OP5A 2L7ZA 1IG7A 4NC6A 4L0YB 3KEKA 5GLAA 4GDFA 1PWUA 1DDNA 4CUGA 1PVEA 1ERDA 3EEAA 2YKHA 5FQIA 1ROSA 3E4QA 4U0WA 4XIDA 3GXOA 3HG9A 3HOVJ 2HNHA 4I98B 5U47A 4XM6A 3IWQA 4XT2B 5IOYA 1P9QC 4ZYGA 2ZBKA 1FOXA 1A86A 1HFSA 1XGNA 5EVIC 5DKKA 3IBRA 5HW3A 1SVLA 4CQHA 5EM0A 3WHCA 1OPCA 2OV7A 5JI6A 1K4EA 1S4SA 2W85A 3MXRA 1AKHB 1PIOA 4BDYA 3BCAA 3LSTA 2DJIA 3BG5A 2RN7A 3M1EA 4A3GJ 2IWBA 4BXUA 5IS1A 5CJ9A 3RKWA 3IKVA 4LK1F 1OISA 1HLVA 3SH7A 3W4QA 3BY8A 5EV0A 5FLMJ 4ZTJA 1F4KA 3UE1A 2HGVA 4H8RA 1OMIA 5KCMA 2R7FA 3HOYJ 3Q9SA 5ED4A 2LK2A 5HS7A 4EWFA 1ZGJA 3J7YJ 2XROA 4CYCA 4I0AA 4LB5A 1S6RA 2ZQ8A 3ERED 4DE1A 5KAFC 3FMSA 2VOPA 1TDLA 5JYPA 1IN5A 2CGPA 3L00A 3G71I 4RGXA 5M5YJ 1IELA 2Y55A 4H84A 3VODA 1RIOH 2CQXA 1SMTA 2KZGA 2XS4A 2BYVE 1CQTA 5FASA 2X9DA 4RB2C 5A2QZ 3S22A 4CLCC 2PR6A 4IRIA 3K1NA 5HD3A 2RKHA 1JIZA 3TW7A 3OPRA 5AONA 4LV3A 2HDRA 3KP2A 2XASA 1JE8A 2D1HA 4E3OA 2MJ6A 2QUFA 4OIPF 1QGPA 3G35A 4NUBA 1WSUA 2LB5A 1L2SA 2TCLA 3WRTA 4HHDA 4QLCU 5ICGA 5G4ZA 3H35A 4DNCA 4DE3A 3EWKA 3V8JA 4XM3A 4IXAA 2BY2A 4M9SA 3LWFA 3C2BA 3ULFA 4JXVA 3QP4A 2WGVA 3F17A 2WKIA 5GP9A 1ASTA 4FH2A 2Q9MA 4D5FA 4HY8A 3ZN1A 3UB7A 2DFFA 1KDSA 2CQKA 2RNJA 1VQ4I 5M3MJ 2OWHA 4HX3A 1S9HA 2X3AA 2GOMA 4BE0A 1TWAJ 5J4VA 1D8FA 2M5WA 2F5FA 2QSHX 1B4AA 5E1WA 4X68A 1FX7A 4OMYA 3GMEA 4HNBA 1TEMA 3CITA 2FX0A 4XUXA 1OJLA 2QYOA 1WKMA 5F82A 1XSDA 5CZMA 5E3OA 1F43A 2D02A 1V5GA 1SD5A 5A93A 3Q0WA 2BXYA 1E25A 4KQOA 3D72A 5F1GA 5DDGA 3WS4A 1K56D 3E4PA 2XRNA 3ZYTA 3SHFA 1ZC2A 3CDLA 3ZNYA 4ENKA 5LEKA 5HDNA 1XURA 1CF7B 2CQQA 5HNHA 1RCJA 2Y59A 4DOZA 2EX2A 1E3UD 3F23A 1XS9A 2JT5A 1Q3AA 2IXSA 2P8TA 4DYCA 5BS6A 1Y6IA 4S05A 1XFQA 2JPBA 2X01A 1I39A 4RLQA 2EA4A 4S2KA 4H4KC 3KLOA 3SFZA 2JUGA 5FEGA 4IVIA 1D1CA 2HXOA 2ZJQF 3LIDA 5EE8A 2LG4A 1EJ9A 2H94A 4WZVA 4P6ZM 2HQRA 3BM6A 4Y13A 2Q9NA 2DCEA 5LRRA 5D1SA 2WO8A 3PHYA 4GOGA 1IV8A 4DDSA 2ZMEA 1K6SA 3TP0A 3F1AA 2XB0X 1NG6A 1KU2A 4LD5A 1H9TA 4OLDA 3BPVA 1YOVB 4S2PA 2OUMA 1G49A 1DGWY 3S7NA 1Y4OA 1A6QA 2Z6DA 4ME4A 3AG1H 3RXXA 1OTEA 3DPUA 4CCLA 3VYSB 3GTMJ 4XN0A 4BJ5C 1OJ5A 2DRWA 2ZB9A 1DPUA 3HDBA 1W0TA 1Z91A 3RQ4A 4WX9A 3JRDA 3QPHA 4BBUA 4IUKA 3HKZN 3LR0A 5M19A 2OZRA 4BNCA 1K4FA 1XP4A 2W12A 3MWMA 3UR3C 1TF1A 2LFBA 1PW8A 4UV9A 1BULA 5HPFA 4WKEA 1CGLA 3PBSA 4IHSA 1YMSA 3G30A 3CP8A 2P5VA 4B1RA 3CJMA 3MQQA 3RTTA 3GZ5A 4PFPA 5H20A 3CJNA 1JKOC 3EHYA 4GQLA 3ULQB 3ECOA 3PNVA 4ZTFA 2V1NA 4XLEA 1FIAA 4EEPA 4ETSA 1T0FA 3OZHA 2VI6A 4KZ6A 3C2WA 3LA3A 5AIPA 4R1HA 4YWZA 2H27A 2XSSA 1KVLA 1T6SA 3T4LA 3U1KA 2ZM0A 4UUSA 3W3CA 1MXOA 1MJAA 5HODA 3S32A 3KWVC 5EZHA 1RUNA 4OMZA 1GA9A 2R0QC 2FH5A 1YPRA 3FPWA 4HF1A 4GF1A 3IQAA 1ETWA 2EH3A 4P0MA 5L7FA 1I1IP 1O3QA 2NOJB 3T50A 1BR1A 3BTJA 4PJLA 3R7WB 3E97A 2WY8Q 4CHUA 2M7AA 3PTEA 1KYWA 2BVMA 4F93B 3FXUA 1UHSA 5JYOA 5KHDA 4QY6A 3IBJA 5ICFA 3G4SI 3MZEA 5J40A 5BOXA 3FBIB 2ZM8A 4Z1WA 4JQFA 5K5QA 2J8YA 1ATLA 4ESFA 1X1DA 3FMRA 3KPHA 1K4TA 2JZYA 4YNRA 1BKCE 4WXCA 3NHQA 1BI2A 3HLDA 4XLFA 1RESA 4P6ZS 3LICA 1OMJA 2LBFB 1O7FA 1HKSA 5D4SA 5FI2A 4ZC3A 4CXFA 4DMZA 5DS9A 2V0WA 5FD5A 4KFCA 5FI6A 4DZJA 3ZG0A 2PYRA 4WUJA 3KEYA 2J9PA 3LAJA 2HTSA 2P9VB 3LI8A 1WH7A 3ZMTA 4CCJA 2HPBA 2JKTM 3EYYA 4O8GA 3BY6A 4XOPA 1GXPA 2YX4A 5CGXA 4OPQA 2H6BA 1CJFA 4FSFA 5ICCA 2WO9A 2QCOA 3BFDA 2QHKA 2VBZA 3CQZJ 4PJNA 2M30A 2X85A 4UB6C 2MLGA 3G6OA 4G12A 3S17J 4HRIA 4LRXC 2FF4A 1DUXC 5H2FC 1QNTA 3J7AO 3TRCA 4MO7A 4MQVA 3T0YA 4JP4A 1GHIA 4D1QA 4MMNA 2FA5A 5AQ7A 2QWWA 1IAAA 4TV7A 1BJAA 2NUPC 2E35A 1X3WB 1PFLA 4JBAA 1XFWA 4A2UA 4KYWA 3BR3A 1E2XA 3MMYB 4M6XA 2L5QA 1ZXCA 3OLOA 2KMUA 3F1PA 3K2NA 4HF0A 3E5XA 2NS8A 1GT0C 2OCEA 3DBAA 1XFNA 4Y33A 1AWIA 4N4NB 4HEFA 2MD5A 3G2BA 4XONA 3WTUC 4C2TA 4I3JA 2EFWA 4BE1A 1QMFA 1ZQ3P 4S2JA 5F69A 3N8RA 4X56A 1SKFA 2EK5A 2V1DA 1NRJA 3W2ZA 3WS2A 2W7NA 4RX3A 2JWTA 1YRNA 3RH8B 1B9MA 4BUPA 4A69C 1S1YA 2CG4A 3DBLB 2B7EA 1VEUB 2F4MB 3MS6A 1Z3JA 3LGOA 3T12B 1VZ0A 1EV7A 2DT5A 4XLHA 3E0JB 2MA3A 1A35A 3BT9A 1RP5A 3BQYA 5F0HA 4XCTA 2Q8KA 2WGWA 3I54A 4IJAA 1YLZA 2ZCWA 1G4KA 4OVDA 2PD8A 1F36A 1R5ID 2Y2QA 2XGEA 2ICWG 5EOEA 2DOFA 2L9RA 1KE4A 4V19K 4BYYA 3W6VA 3C4PA 1ND1A 2PMHA 2JTVA 4WWCA 1K54C 1W4MA 3EEHA 2UXXA 5GPAA 3ICYA 2X3BA 1YO5C 4Y5FA 2EB7A 3BY9A 3DPLC 4IPAA 3LQRA 3MBZA 4HV5A 5J3WA 2BHYA 2CS3A 3IRQA 1JXSA 2VGLS 1GUUA 3WTYC 2DYSH 3K0LA 3OR2C 3K1PA 1T1BA 4BQNA 1I5ZA 2WA0A 1MMGA 4M3EA 2F48A 4PUSA 3LY3A 1MMPA 3ZGKA 2HOEA 5FKOA 1J7KA 4IVKA 2O03A 3BFCA 1PZPA 1OQYA 3F1OB 2L3DA 1OTDA 3AGFA 3W2WA 3BA0A 1XJ3A 1IKGA 5CUHA 3QNBA 4B3AA 3KYZA 5EF6A 1UAAA 1OYYA 4ASNA 2W1TB 1BKCI 1HBXG 3KP7A 4JF6A 2HZDA 2IS4A 1S4RA 4E7IA 4L9GA 4LIUA 4NXFA 2PU4A 2NVTJ 1TL8A 3TP3A 3CKIA 5HDKA 3HDAP 2BGCA 3BLMA 3W4PA 4G8XA 4P87A 2QLZA 1BZAA 5EVIA 3NC8A 2QSGX 1K83J 3K3DA 4RM2A 3OYJA 4BENA 4Q8IA 4B8XA 4M71A 2PRFA 2D1NA 2ZO4A 2HYJA 3MN2A 3Q2HA 4WLAA 1LPQA 3L7WA 2CQ7A 2STWA 2Y75A 4HNTA 4NB5A 4ITVA 3WWXA 2DN0A 4ARZB 2EFQA 2WWYA 3AGDA 2P7JA 4B93A 1DU6A 1SFKA 4NETA 4IN9A 1GXQA 3WG9A 3H36A 2J3TD 1W7PB 2COBA 2MD0A 1V4RA 1MBLA 3I7JA 2O8KA 3G1LA 2NYXA 1NRFA 2WADA 2DA6A 2ISYA 1ESUA 1VHMA 2JPCA 4YRVA 4PM9A 1W36D 1G9KA 5L3GA 2HYFA 2PJRB 5CGSA 3FXMA 5H6QA 2YPRA 1Z67A 4A3BJ 3OPPA 2RGVA 1TWFJ 4HI4A 4LB6B 2X1EA 3NOUC 1I6HJ 1XFVA 2ECBA 1V9ZA 3F19A 5DF8A 4M74A 2HP5A 1NTCA 1TS7A 1PUEE 1IXSB 4B4XA 1FBSA 2IVMA 3IT9A 1N9BA 1D5YA 3JVVA 2DMQA 3GVBA 3A3IA 5I94A 4IKFA 3C8CA 3L2VA 5CQEA 4XLPF 1V55H 3ABKH 3CCYA 5FQQA 3HHHA 1U8RA 2IRFG 1DP8A 5EFWA 1KGSA 2BASA 5EGOA 3OYNA 4QWQA 4UNOA 3UVCA 1MPLA 1R1TA 3WTZA 1XMXA 2R5ZA 3GTOJ 1FYLA 3ZP5A 2XUBA 4L7AA 3HLWA 2BBYA 5J47A 2DQLA 4RVAA 1MWUA 2RL3A 2FOKA 4UAAA 9ANTA 3HSRA 1DGRM 1U8BA 3K3CA 1W7FA 2W13A 1ZRFA 3L9KA 1F5TA 1DMTA 4XRFA 1FC3A 3A4CA 2R7RA 2M34A 2QPNA 2V9VA 3KCCA 2EIMH 4AC0A 2A3SA 1PNEA 2K2GA 3LQ0A 1YQAA 3IF6C 4BEHA 3NBLA 4N9HA 1POGA 5DJUA 3IHAA 2OW0A 3N2UA 1T2KA 1HKQA 4IVNA 3KMCA 1X1BA 1VM1A 3N4MA 2DMTA 1FYMA 2O3EA 1SFUA 4NC8A 1TW3A 4CZCA 2DYRH 4PM5A 3LSPA 1MNEA 3IS2B 5GLBA 1Z09A 1TQIA 1FYKA 3ZCZA 4PSWA 3G31A 4ENJA 1IABA 2P0WA 5AVEA 4G6QA 1UB9A 1I1SA 4Q1LA 1VQ5I 4KZ4A 4HX7A 3EUAA 2POJA 2DODA 1HW2A 2W24A 2Y79A 3DEEA 4A3KJ 2HVQA 1ON1A 5LD2C 1KUHA 3CG5A 4KQRA 1GE6A 1ETQA 1U5TB 4EJVA 1UTZA 3M1CA 3RTRA 1K79A 4DF9A 4ZZDA 3GYHX 2QBYB 2D1OA 2XS3A 4DJAA 2ZMFA 2QKPA 2AXLA 2NUTC 3BJAA 3BPXA 1X1AA 3PIPF 3DTMA 3WGGA 3MZFA 3I64A 4HDUA 3S16J 1B3DA 3WGIA 1ERMA 5GHZA 2R5YA 1MBFA 3WG7H 4E7SA 1XX5A 4H3XA 1XA7A 5C4JJ 3I55I 3B42A 1WJBA 2LR8A 1LHYA 2IA0A 3MJQA 5KMWA 2DI3A 1T95A 3HJEA 4AYBA 4CTHA 1BA5A 5TBMB 3V8LA 2VE9A 1G3YA 4E70A 3UMDA 4ZDOA 4PMAA 2H28A 1O3SA 3WS5A 2A5WA 2GA2A 5EECA 5KIZA 3BZKA 2LOOA 2C6YA 3C4OA 5L3EA 2DMPA 1OZ9A 4Q47A 3GTQJ 1HD8A 3CUQB 3O2XA 2OA4A 4RDUA 5DD4A 1LFBA 3MXQA 5HDCA 2LRDA 1MC0A 1TD5A 3DEUA 2FQ3A 2YS9A 2H0YA 3RTSA 3HRSA 3CF5F 3Q07A 2VEAA 2A24A 3VI1A 3ZQIA 3DKYA 2QEXI 1SKOA 3BR5A 3MQOA 4PM7A 2RJPA 3BR6A 4YFKF 3OMYA 2VKHA 3KP5A 1V9YA 1W63M 1WJEA 4U0VA 5EUAA 4LMYA 4OPRA 5IU1A 5B1AH 4PAUA 1JKPC 1SRPA 3LI9A 4CCMA 5HLIA 5IHVA 4JKTA 4JYKA 1K55A 1TVIA 1GVJA 5CYVA 4GGGA 2PT7A 4B3XA 1PI5A 1KVMA 1GE5A 1CIZA 2RJQA 3BQAA 3JTHA 2VQHA 3GBGA 2VKDA 3T1QB 4IRHA 4UHTA 2DDFA 2ZQCA 2ERQA 4U3TA 1H3QA 5K7HA 1TT0A 3ZVSA 4KZBA 2VXZA 5IYDJ 3RZDJ 2JVHA 4IO9F 5DV5A 5CPRB 2CMNA 1D5VA 2OF7A 2EXBA 4KT6A 1MH3A 5M5XJ 1FP2A 1HLUP 5F1RA 2ZD8A 1VQMI 3P09A
chains in the Genus database with same CATH topology
3ZUKA 2JNPA 4H82A 2DT6A 2IGMA 2LYCA 2BW3A 2IS2A 3BLYA 1PYVA 1X4OA 3SHIA 4CCKA 2MLRA 4JP4A 3HC7A 4OAYA 1AF0A 2JSDA 1ZELA 4L63A 4NC7A 5CZMA 2I8DA 2E2DA 2WAFA 5LABA 4L7AA 3RCOA 3W2AA 3S3MA 1C8TA 2VXDA 4D1QA 2OI0A 1V5GA 4JA1A 1R54A 1IAGA 3V42A 4F52A 4HSRA 2V6EA 4HEA2 1MMQA 2X6YA 5KNLA 3OS0A 1IRXA 4U7BA 1R1JA 4ILWD 1LFPA 3B8ZA 2MYSA 1O0QA 1WJAA 2KQRA 1BQQM 1BOBA 5HNFA 3LSGA 3TT4A 1IAAA 1SAUA 1DGRM 1PJRA 3BG7A 3SYTA 3VSKA 1O0TA 1PWQA 4WK7A 1N78A 3HPHA 1WJDA 3ZR8X 3OL3A 2R7XA 3IAS2 4XKBA 3ONQA 1XFWA 2F5VA 3OYDA 1Z7LA 1D1AA 4H2EA 2W13A 3USNA 4EATA 2AQFA 3LK8A 4CCNA 1KONA 1S4BP 3MMYB 4J00A 2K9MA 1UMTA 2CKIA 1CGEA 2L5QA 4BGDA 2DT7B 3ZXHA 3NWTA 1V5EA 4HSTA 1ZXCA 2XF5A 1Z3YA 2VL8A 3A1YA 3PSIA 4GR8A 2VJJA 3L2UA 1R55A 1XURA 2KMUA 2KDOA 5BOTA 5L79A 2OC6A 2PJTA 1DMTA 2CUJA 5HNHA 1IACA 3MA2A 2O5RA 3A4CA 4PJMA 3LFUA 5HOOA 2R7RA 1B8YA 4DOZA 4KITB 3KHIA 3SZGA 4F92B 1W36C 1DP3A 2IS6A 1MMBA 3LGPA 3W2VA 4BDZA 4P1WA 3DSLA 1XFUA 3K70D 2K2GA 3LQ0A 4CCOA 1HV5A 2JT5A 2W14A 4QKZA 4GR0A 4XMYA 1Q3AA 1WJCA 2IXSA 4BE2A 2OXZA 2L9SA 3OYMA 4E4HA 2X51A 4BEHA 966CA 1G12A 1G05A 1X4PA 4Y33A 4PK4A 2VPLA 2DW1A 2A6TA 3HYGA 1EA3A 1Y6IA 1D1BA 4N4NB 5HLTA 2L2OA 1V5FA 3H0DA 1FLSA 1OS9A 2OW0A 3KRYA 4ON1A 2ELJA 4RLQA 3L2QA 3G2BA 2F4IA 3FHNA 3QODA 4XONA 4YEJA 1YX5A 2V9KA 4C2TA 4H30A 4H4KC 2K3PA 5FRMA 1JAPA 3LKAA 1PWVA 3N2UA 1BM6A 2LY2A 4RM3A 2RNGA 2IGNA 3KMCA 2CMPA 4AVZA 1J7NA 2Y6DA 3LUNA 1X1BA 2KPMA 3TS4A 4C9YA 2IGOA 2JUGA 2DOAA 2KL4A 3HBVP 1UG0A 3ZQQA 3AFHA 4BE1A 1HTDA 2XDVA 1L6JA 2MZEA 2E3XA 2O3EA 3S93A 4NC8A 1D1CA 2WAQA 4CZCA 3CESA 3OYIA 3B2ZA 4I03A 2LG4A 1MNEA 2JT6A 4WZVA 1OS2A 3DKXA 1CXVA 1ZTQA 3I7GA 2CW7A 2W1OA 2X7MA 5I0LA 3K4KA 2VJ5A 2DCEA 3LMMA 1BQOA 3RSNA 2W7NA 1DTHA 2RQQA 3DNGA 3DTIA 2WO8A 2CV2A 4ANJA 1D8MA 2V7FA 2VQGA 2M4GA 3U1RA 4PSWA 3LJGA 4BJTA 4BUPA 1HA8A 5D1TA 4JPAA 2VJIA 4AYKA 4ZJZA 2V4JC 1IABA 2OY4A 830CA 2XF6A 1OM7A 1FMVA 2L9NA 2P0WA 1GE7A 1WNIA 3OYAA 4HPQA 3U21A 3F1AA 5B5PA 4Q1LA 2YIGA 1NG6A 1QICA 4CA0A 3AL0C 1OR7C 2E5NA 1Z3XA 3EWJA 1YE9A 2X3CA 2WAEA 1QUAA 1Z3JA 3UNGC 4IQ4A 3K4MA 2XC7A 1VZ0A 3G5CA 3EUAA 1BZSA 1XUCA 4XLHA 4BL0B 1MMAA 4D9JA 1SLNA 3MKYB 3E0JB 2POJA 1UMSA 2OUMA 3IP4B 1G49A 1LKXA 3HKZA 1DGWY 2WBMA 4DGWB 4PFOA 2XF7A 1Y0VA 1QHGA 4J4MA 4BJ6C 3DEEA 3DU6A 4X0GA 1R1HA 5BPAA 3H5RA 3QYBA 5I4OA 2M3AA 2HVQA 2QKMB 2R7QA 5LD2C 2BW3B 4XCTA 1KUHA 4AU7A 2O36A 2R7TA 4HG2A 1GE6A 3DPUA 4F3QA 1KUKA 1RMZA 4WKIA 4CCLA 3SDBA 2DXIA 2M7BA 4ZYAA 3VYSB 4KISA 3DPEA 1ZP5A 2X1DA 2OVXA 1G4KA 2W0DA 4AIGA 4XN0A 4BJ5C 4B44A 4XQFA 2HVRA 1UTZA 5CKTA 4B48A 3M1CA 4XKVA 3RTRA 3KYLA 3VYRB 1JAQA 4U87A 2WB1A 3HDBA 1D0XA 2VIXA 2W00A 4DF9A 2Z16A 1R6RA 4E6KG 3D5SC 1EAKA 2LY1A 3RQ4A 2CV1A 3EUHC 3K7LA 4PKTA 1SMPA 4B43A 1ND1A 1SU3A 3K4LA 4XBHA 4FETA 4N4OB 4FASD 3OYLA 3LMCA 3CP2A 4BACA 2D1OA 1IADA 3K70C 3HUGB 3VYUB 2A8HA 2E60A 2MC4A 1D0ZA 4KJZA 2OZRA 3DQVC 4IZZA 1Z21A 2X3BA 4FVLA 4DJAA 1R1IA 4H1QA 4H76A 2XAUA 1D7XA 1XFYA 2W12A 4IUWA 3V96B 1YCMA 3DPLC 3LSKA 4DBQA 5D3CA 3OYFA 3HL2A 1UEAA 2FV9A 3F9KA 3DU5A 4NQWB 3HY9A 1BR4A 1N75A 4R79A 2CLTA 4BU2A 4PKVA 3HXLA 2J83A 3UR3C 1X1AA 2OW1A 3KEKA 2CS3A 4ZDPA 3PL8A 4XM7A 1BSWA 4FXQA 3H9QA 2W15A 5BOYA 2KHMA 4WKEA 1MMRA 3OYBA 1CGLA 5D7WA 3OR2C 3PNYA 1OM6A 1KAPP 1PWUA 3OR1C 3DTEA 1XUDA 4IX7A 2LBFA 1B3DA 2BOLA 3I3LA 3OYGA 3OHLA 3CP8A 3LL7A 4CUGA 2GOXB 3FBNB 1ERDA 2I47A 2JVGA 4BQNA 3K4CA 3CMMA 2ZSHB 3I7IA 4XL9A 3LE9A 3RTTA 2WA0A 4XKCA 1MMGA 4E7SA 4PFPA 1ROSA 4H3XA 1GO7P 1XFZA 4BEHB 3EHYA 3KEJA 2E1MC 1N77A 4GQLA 2R7SA 4PKRA 4WF6A 4LG3A 4PKWA 3HG9A 4PUSA 3OS1A 1WJBA 1A85A 2VQCA 3PNVA 2R7WA 1MMPA 3EDZA 2HNHA 2VQLA 3IUOA 4PSXA 4ZTFA 2V1NA 1CQRA 1K7IA 4Y3OA 3ZGKA 2CFOA 2Y6CA 3VWBA 3HPGA 3EPZA 3AIGA 3LJZA 4XM6A 4AUOA 1AA7A 5B5OA 2DW2A 1X19A 4XLEA 1P9QC 3F16A 1AYKA 3MKZA 2OY2A 2FV5A 1QHHD 1T95A 2CUZA 3NWSA 3HOSA 3WV2A 3M8JA 4E7JA 1A86A 1HFSA 2M0MA 2UUZA 2M4KA 3W2WA 4AYBA 4DIQA 3BA0A 4CTHA 1PWPA 1ZXVA 2HDWA 2LH9A 3PNTA 3N05A 4ZDOA 5CUHA 2PJRA 4Y4RA 2OXUA 1MMDA 2ZXHA 2VASA 1JH1A 3TL4X 2A5WA 2OV7A 1OLTA 1NG7A 2R4GA 4DD8A 3VTGA 3LQBA 3O2XA 2KRHA 4E7KA 5D2BA 3LEAA 5CXAA 3OYKA 1UAAA 4CSWA 4FXYP 2LOOA 2ZXIA 3C2GA 2AIGP 3EUKL 4J01A 1EB6A 3BCBA 1GKCA 1K6YA 4BDYA 1QJJA 3H5AA 3BC8A 3BCAA 4JOMA 3P1VA 2ZFUA 2DJIA 4NNJA 3W3CA 3PFYA 1HY7A 1FBLA 3S32A 2E5ZA 2IS1A 3KWVC 2X6XA 4OAZA 2UWMA 3H5NA 1OM8A 3QOEA 1BKCI 4E7LA 1HOVA 5D1SA 5JHFA 1XFXA 3HY7A 1YP1A 1YQYA 4HNUA 1Y56A 4BQQA 3OS2A 2HZDA 3S3NA 1HFCA 1G59A 2IS4A 3L0VA 4GF1A 3K4JA 3DWBA 1JANA 3OYEA 4E7IA 2DW0A 2PMZA 4LIUA 5L7FA 3AKZA 4XM8A 1FM1A 2QPJA 3KX2A 3LSHA 4ZTJA 3NX7A 2CH0A 3L2RA 2MABA 3OIQA 1CGFA 2LC2A 2IGKA 4C30A 3D5LA 4B47A 3CF2A 2LRDA 1I1IP 1CK7A 1E0EA 1QIAA 3KECA 1SATA 3CKIA 4II3A 3GBOA 2NOJB 4LITA 1MNCA 4ZR5A 1BR1A 3HDAP 5KCMA 4MLOA 3J7AY 4PJLA 1BKCA 2VLAA 4IJOA 2WY8Q 3CJRB 5TGTA 1WJFA 5JMYA 4R3VA 2M7AA 2MLSA 1Y8JA 2OXWA 3HBUP 4FU4A 3RTSA 2KP6A 2LREA 2BVMA 4F93B 1KUGA 1JKYA 3PSFA 5HVQC 4IQJA 1T0FC 2DDYA 1CAQA 3O64A 4EFSA 4XR6A 1JIWP 4PKQA 3EDGA 5KHDA 3MKWB 2Q2EB 1ZS0A 3VI1A 1USNA 1C3IA 3DKYA 3RPUD 3E8RA 5H8XA 4AXQA 2X1CA 3CZ6A 5I2ZA 2CV0A 2KRCA 4G9LA 3IAM2 4RM2A 3ZCOA 1PWWA 3OYJA 1JJ9A 1J09A 5I12A 1MMNA 2MZIA 1K7GA 3DL1A 2RJPA 4XORA 3N2VA 2HU6A 2SRTA 3D5RC 1DQUA 2D1NA 3FBIB 3E1SA 1UELB 5I43A 2Z2DA 4JQFA 3OMYA 3Q2HA 3H9JA 4C2UA 2KLOA 2VKHA 2R7VA 4RMNA 1ATLA 3EHXA 4G0DA 1X1DA 3OYHA 1WJEA 1MW7A 4H84A 4H49A 2BVLA 2QKLB 2HPMA 4GWNA 1JAOA 1BKCE 3TSKA 4F91B 4HNTA 3S8PA 2EROA 2JIHA 4GWMA 1GO8P 3OY9A 1GXDA 2L7KA 3EDIA 4ITVA 2ZSIB 4XLFA 4OWRB 3HB2P 1SLMA 3SEZA 2KRJA 2FUG2 3AYUA 4XKWA 3AL0B 4F55A 1BIWA 3DWLE 1I73A 2Z1DA 2HQAA 4DPEA 3LIRA 2XS4A 4DV8A 3FDYA 1WFXA 2WY7Q 1SRPA 1OMJA 2LBFB 2Y0SA 5FROA 3LJTA 4JQGA 3TBIA 3MD2A 4CCMA 4RLFA 3F18A 1U0JA 1LDKB 1Y93A 3F15A 4LIVA 2R7UA 2HU9A 1SFKA 3OL4A 4GRIA 4BXFA 2VJ4A 1TZLA 4ZC3A 4IN9A 1D5JA 1YOUA 2Q1ZB 2HVSA 3P24A 4P5OA 3OWTA 456CA 3LUMA 5FRNA 1X1CA 4HMAA 4YELA 3BG6A 2MD0A 3DLAA 1JIZA 3L0TA 4I35A 4CH7A 2W4SA 1OO9A 5D1UA 4XN3A 1BUVM 2L0RA 3KEYA 2OW9A 4PKSA 3OYCA 4GUYA 4B3XA 3LIKA 2WADA 2CW8A 4A7BA 4DBRA 3SEQA 1KUIA 3PJRA 2N8RA 1GE5A 2AQEA 1CIZA 2V4BA 2W82A 4NUBA 2RJQA 4YRVA 3TVCA 2TCLA 1W36D 2XSJC 1G9KA 2MZHA 2USNA 4XLCA 2PJRB 3DPTA 3H35A 2VQHA 3C2HA 3GBGA 2VKDA 3VSLA 2X6WA 4PJJA 3DPFA 1D0YA 4XM3A 2UV1A 5I3MA 1JK3A 4XLAA 5CQGA 3AYKA 1EUBA 1GLNA 3DTKA 3FKJA 3K6GA 3TMOA 4CCJA 2DDFA 1QJIA 2RREA 1BUDA 1H71P 3K10A 2ERQA 4JIJA 4QPOA 4PKUA 3OOUA 3S3OA 2YUFA 2OVZA 4E7HA 1MNDA 1BR2A 4XOTA 4XOPA 3F17A 3ZRGA 4ZDLA 2ERPA 3LILA 1TT0A 2K5CA 2X1EA 3LSMA 3EDHA 1WJ5A 2KZVA 2MFZA 2HPIA 3ZVSA 1ASTA 1XFVA 3F19A 3WV3A 1AKLA 2VXZA 3VYTB 1C7KA 2F6CA 3OHOA 1KUFA 1LVKA 4A3WA 2JVHA 3I9V2 2AYKA 3ZXSA 3H9GA 1IAEA 2K9CA 2VB6A 4XNFA 2WO9A 2XS3A 4BQOA 1YX3A 1G8XA 1QIBA 1UTTA 2K9LA 2R7OA 2YB9A 2JSPA 1I76A 2OW2A 2WOAA 4L6TA 1JI8A 1K7QA 4PJNA 3WV1A 3CJQB 5CPRB 4HX3A 3VDXA 3L2WA 1S9HA 2X3AA 3G42A 4BS9A 2GOMA 4BE0A 2Z2SB 3PUBA 4E7ZA 4GR3A 1FMWA 3QYEA 4II2A 4IKFA 2X85A 3L2VA 1D8FA 3K4BA 1KBCA 2E1MB 4G6TB 2JA2A 5CQEA 3K4NA 4L19A 2V26A 3K7NA 3HOTA 1ZVXA 5LFAA 3ELMA 4KT6A 2J0TA 3B92A 3KMEA 4QPQA 3Q2GA 3QYFA 1RM8A 3OYNA 3OIPA 3A2KA 4HRIA 1QU3A 3UVCA 1GKDA 3LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTE A;  3DTK A;  3DTI A; 
#chains in the Genus database with same CATH topology
 4RAY A;  4CYC B;  2IS2 A;  1JNU A;  1ZEL A;  2KIF A;  4YFX F;  4AWX B;  4NEE D;  5CTM A;  1T8I A;  3V42 A;  5TGF A;  3N6I A;  4RS8 A;  2LY9 A;  2FEZ A;  5G4Y A;  1XGJ A;  1ITY A;  4OPZ A;  2R7X A;  4MLL A;  3USN A;  1J75 A;  1ZG1 A;  3JSP A;  2YU3 A;  4UV8 A;  4L9T A;  4I5S A;  3IXB A;  4LPZ A;  3ZG5 A;  4FUW A;  3SZG A;  4NHJ A;  2IS6 A;  5E1Z B;  4DYR A;  1QVU A;  3O3K A;  2E1C A;  3VOY A;  1ZR4 A;  3EYI A;  4XMY A;  3ZMU A;  1TBX A;  5C4X J;  5F64 A;  4QSH A;  1LI0 A;  2D01 A;  1HZO A;  4DE2 A;  2F4I A;  2VBW A;  1KZH A;  2RNG A;  3KSI A;  2CMP A;  1JTG A;  4C9Y A;  2KL4 A;  5KK1 A;  3SDG A;  2RCX A;  1SD7 A;  4E04 A;  5E20 A;  4DXC A;  3WHB A;  4R3J A;  3SQN A;  5E8I A;  3S1M J;  1P0Z A;  2DA7 A;  3KP6 A;  4JPA A;  4I6Z A;  2ZFW A;  1FMV A;  4M6Y A;  3QU3 A;  2NRA C;  4ZJ1 A;  1YSP A;  5F27 A;  2YIG A;  3KEO A;  3UNG C;  3K4M A;  3EQV A;  1SLN A;  1JUM A;  3A0S A;  2ZOH A;  2WC2 A;  3HOW J;  3HKZ A;  3QP5 A;  3MXS A;  4PFO A;  2X6O A;  4BJ6 C;  1FTZ A;  3H5R A;  2HKX A;  3QYB A;  3T4T A;  2JA5 J;  1HQC A;  4WKI A;  4E3L A;  2VOD A;  4ZYA A;  1CK3 A;  4S2I A;  4B44 A;  4XK4 A;  3FG8 A;  2DQR A;  1ZKJ A;  1VQ8 I;  3D5S C;  5FKL A;  1EAK A;  3F0C A;  1JTD A;  3VYU B;  3OOV A;  1YCM A;  1H89 C;  5D3C A;  5JLX A;  5IT9 K;  3F9K A;  3MVP A;  3H9Q A;  1O3T A;  3JYI A;  2PX9 A;  2O6G E;  5DUI A;  1YYV A;  3PQK A;  3DTE A;  3I3L A;  3OYG A;  4PPR A;  4XXR A;  1XDS A;  5GAH J;  3IH2 A;  3CMM A;  2KT0 A;  2FML A;  3S1Q J;  2MBF A;  2E1M C;  4PSX A;  2INW A;  5IPA A;  5DKL A;  5F83 A;  2W3H A;  4Y3O A;  4UQI S;  1IOU A;  4E7J A;  5D6F A;  1PWP A;  2NVX J;  1ZXV A;  2LD5 A;  4BHP A;  3BFG A;  5C3E J;  4OLG A;  3C2G A;  5L09 A;  4A3I J;  2ZME B;  1HCR A;  1X3Z B;  3G4P A;  4Z2Y A;  5HWW A;  2BY1 A;  4XIC A;  3QNC A;  1PI4 A;  2BTF P;  3BQ8 A;  2EQR A;  4UA7 A;  4MCW A;  4LLN A;  5JLW A;  2D1V A;  1PDN C;  5FFZ A;  2QPJ A;  3L2R A;  4B47 A;  2VOO A;  3KEC A;  1MNC A;  1QVT A;  4IF4 A;  1BKC A;  2O9B A;  5FD6 A;  1TS0 A;  4ZZL A;  1MWR A;  2DDY A;  1TNS A;  2EZI A;  3O64 A;  2XFT A;  3UB8 A;  2EWV A;  2V1A A;  4GXO A;  2HR3 A;  1N9N A;  2LKS A;  2MZI A;  1EH7 A;  5TIS C;  3W6J B;  1QRY A;  4Q0H A;  2R7V A;  2G2W A;  1PWD A;  5F0C A;  1JAO A;  5K5R A;  2ZSI B;  3Q81 A;  4OWR B;  5HWT A;  4ESJ A;  3A3J A;  5TR7 A;  4LIV A;  4BXF A;  2Q1Z B;  4CGZ A;  1KQ9 A;  3VOZ A;  3S1N J;  1DP6 A;  4YEL A;  5DFY A;  4CYD A;  1O07 A;  1H8Y A;  3RPQ A;  3Q3S A;  5E3L A;  4A7B A;  2M7U A;  3A02 A;  1G28 A;  1A6I A;  3MFK A;  2NS7 A;  1OKR A;  1GV2 A;  4JIJ A;  4QPO A;  5LBQ A;  1BLP A;  2LF8 A;  1MND A;  1WHU A;  2ERP A;  3EDH A;  4UUS B;  3ZQF A;  3DBH B;  2AYK A;  2R7O A;  2OAP 1;  1ONH A;  1DRM A;  4R70 A;  4EV0 A;  1PUF A;  3Q7V A;  4S2O A;  3B92 A;  4Y15 A;  4WYY A;  1YSQ A;  1ERO A;  3MFX A;  3FHZ A;  2DT6 A;  5J8C A;  1X4O A;  2A6E F;  1RGZ A;  3FMQ A;  5LAB A;  2W1R A;  1H88 C;  5EPH A;  2R7D A;  4IL6 C;  3HUN A;  4OOY A;  5FAT A;  4OIQ F;  5HNF A;  3TT4 A;  3BG7 A;  1LL8 A;  1Z77 A;  3ONQ A;  2K86 A;  2XA7 S;  2Y9Z A;  3E6B A;  2JA7 J;  4L9J A;  2KDO A;  3WU1 B;  2O5R A;  3RYP A;  5HOO A;  3JR9 A;  4GJ4 A;  4IJG A;  2QM3 A;  4BE2 A;  3GRJ A;  3OYM A;  966C A;  3FPV A;  4LRZ E;  1D1B A;  4A0Z A;  1B59 A;  1OTB A;  2TRT A;  3IHB A;  3LUN A;  3ZQQ A;  4M4X A;  3EQL F;  3DXJ F;  2E3X A;  4MBF A;  4DRT A;  1UCR A;  1OS2 A;  1AXB A;  4WBG A;  4M3F A;  5I0L A;  3LMM A;  1BQO A;  4RBO A;  2GWR A;  2MLK A;  5D1T A;  2Y30 A;  3J81 K;  4Z6Y A;  1ODV A;  4CA0 A;  1ZLJ A;  3BRO A;  2ELK A;  4GO1 A;  3G5C A;  4R8H A;  4PKY A;  2CSO A;  3IF6 A;  3NEU A;  1W5C C;  4EJT A;  4J4M A;  4L0L A;  3UE3 A;  3PBR A;  2ZQ7 A;  1XSV A;  4L5I A;  4DW6 A;  1VF9 A;  4XQF A;  2QA4 I;  5FDS A;  1V54 H;  1CI9 A;  1KQ8 A;  2WB1 A;  2Q2E A;  2V20 A;  2Z16 A;  1KGE A;  2HOT A;  4B43 A;  3HJK A;  4FET A;  3CP2 A;  1IAD A;  2M8E A;  3IX8 A;  1R36 A;  1BYW A;  4GYI A;  2QQA A;  4O0P A;  4WEL A;  1LE8 A;  2EFO A;  5FB2 A;  2PJP A;  4RGU A;  1UST A;  5B5E C;  1HTZ A;  1I1G A;  3F1P B;  5DJT A;  1Z6T A;  3PNY A;  2CFX A;  3JRC A;  4GDB A;  2ZMV A;  4R0Q A;  5F6A A;  1FY7 A;  4XKC A;  2DMN A;  1X1P A;  2ETH A;  1MD0 A;  2K3F A;  2R7Z J;  2R7W A;  2MW8 A;  3NEC A;  2Y6C A;  2BXZ A;  2HYG D;  3BG3 A;  4BQA A;  3JPU A;  1R71 A;  1YMX A;  3FX3 A;  2HDW A;  1FOK A;  1FOF A;  2V1B A;  4LGW A;  5ILV A;  2RVC A;  2HP6 A;  3DWK A;  3LQB A;  1F2K A;  5D2B A;  4LG0 A;  4FXY P;  2CYY A;  3KP4 A;  1YRN B;  1GHM A;  1K6Y A;  2QQ9 A;  1QJJ A;  3P1V A;  3SFI A;  1U3E M;  2PEX A;  1BBY A;  1A04 A;  3VFH A;  5F1F A;  4A3C J;  3C7V A;  3S3N A;  2P08 A;  3AKZ A;  2PBY A;  3NX7 A;  3IV5 A;  3D9Y A;  5E2H A;  3MSH A;  1YJ9 I;  3J7A Y;  1YLJ A;  2WGW B;  5JMY A;  4HYE A;  4ZH4 F;  2LRE A;  2HDC A;  2HQ5 A;  5HVQ C;  4XR6 A;  4I3I A;  1Y54 A;  1ZS0 A;  2HOS A;  4KN7 X;  4H6J A;  1J09 A;  3SS4 A;  4C6Y A;  2L0K A;  2SRT A;  5CXW A;  3BR2 A;  4MHG A;  3D1N I;  3K2Z A;  5FAQ A;  2O0Y A;  4H49 A;  4PGH A;  3HHG A;  1OME A;  2XF3 A;  3DLL F;  2EIK H;  4K91 A;  3LIR A;  1WFX A;  2B18 A;  1VB6 A;  2IW5 A;  5FLX K;  5E8G A;  3DP7 A;  3HLG A;  3KE2 A;  1ESI A;  4KZ8 A;  1R49 A;  3T4S A;  1XC5 A;  3L0T A;  3PBT A;  1VFC A;  1XA1 A;  1SHV A;  1BUV M;  5GHX A;  4L0Z B;  3LIK A;  5HPI A;  4I38 A;  4JX5 A;  2PI0 A;  2XD5 A;  2MZH A;  5CGW A;  5AJG A;  3CPT A;  5DTS A;  4BBR J;  2EFP A;  4K0W A;  4HH3 A;  4PKU A;  1BJZ A;  2JRT A;  2KZV A;  5HX9 A;  3QPT A;  2KX6 A;  1WRJ A;  2W57 A;  3ZQ7 A;  1IJW C;  1P7J A;  1K7Q A;  2VK3 A;  3J80 K;  3OPL A;  4E7Z A;  3QYE A;  1KBC A;  4G6T B;  4KNY A;  2PQ8 A;  3HOT A;  5E18 F;  2LDU A;  3IX4 A;  1RM8 A;  3ZUK A;  1G3T A;  2D5V A;  1Z0X A;  5EVI B;  1AF0 A;  4M3B A;  1C8T A;  3K9T A;  1NZU A;  1RC9 A;  2Y2O A;  3O5Y A;  1SMY F;  4JP0 A;  1IAG A;  2V6E A;  3K7A J;  3ZHH A;  2Y2L A;  1B9N A;  4RA7 A;  4K0X A;  1UWP X;  3GLX A;  5FJ8 J;  1FTT A;  4H2E A;  1FR6 A;  3RTY A;  3G3Z A;  4WZ4 A;  1CGE A;  4BGD A;  4HST A;  3KSG A;  3FM3 A;  5L79 A;  5FQ9 A;  3X2Q H;  4KMU X;  1XN7 A;  2MH9 A;  2R92 J;  2K40 A;  1F5M A;  3TO7 A;  4S2M A;  4M3D A;  4AIJ A;  5J8X A;  2W14 A;  2KJC A;  4KIF A;  3PXP A;  5DCM A;  2I10 A;  2EZK A;  3NQO A;  2PDR A;  1OS9 A;  3KFW X;  4ID4 A;  3PAE A;  2A3U A;  1T39 A;  1BM6 A;  3CO7 C;  4AVZ A;  1FSY A;  2KPM A;  3AFH A;  2Y4A A;  2IA2 A;  4BHB A;  3JRG A;  2WAQ A;  3OYI A;  5EEA A;  1N4O A;  1GA0 A;  1KU7 A;  3GQZ A;  2DPD A;  2EXA A;  5DEQ A;  4C75 A;  4OKP A;  3JAM K;  3BTC A;  4FX0 A;  3BYD A;  4AYK A;  2DO7 A;  1FSH A;  3CZD A;  3E2K A;  3OYA A;  4HPQ A;  1B72 A;  1O57 A;  3N8L A;  1L3L A;  3TSK A;  1MMA A;  2WBM A;  4ESP A;  5EGO B;  2KFD A;  2ECC A;  1X3U A;  3REO A;  2R5Z B;  1UFM A;  1FR1 A;  3GTC A;  1T08 B;  3SDB A;  5CTN A;  4AIG A;  2ID3 A;  1PWC A;  3S7O A;  1S7E A;  4RAG A;  2JN6 A;  4R4R A;  4O6J A;  4NBQ A;  1TQM A;  4UUT A;  2VUM J;  2FU4 A;  1S67 L;  2EIL H;  1J0R A;  4OOM A;  3B6C A;  3GEC A;  3FXO A;  5CHM A;  4KJZ A;  4HX4 A;  3ZQL A;  4FVL A;  3SZP A;  3ECH A;  5CEC A;  2W27 A;  1XFY A;  4WZ5 C;  3E6C C;  3LSK A;  1VQ6 I;  3HUO A;  2HFH A;  4I7H A;  5M18 A;  2EZH A;  3WRZ A;  1MH4 A;  3GTP J;  1NXY A;  5D7W A;  3KP3 A;  5IP6 A;  2B0L A;  1P4A A;  1MDM A;  2EV5 A;  2EX6 A;  2M87 A;  4BEH B;  1TP4 A;  3M6B A;  3OS1 A;  4ENN A;  3JW4 A;  1ACF A;  4FTH A;  4IBR A;  2A49 A;  3HPG A;  3UY6 A;  3AIG A;  3FKW A;  4ZYE A;  5HL6 A;  3S1R J;  2V8F A;  1R1U A;  1MMD A;  2O3F A;  1K57 C;  3CME I;  2Y2K A;  2W48 A;  4A5N A;  3OBF A;  2DFI A;  1EI5 A;  3H5N A;  3CC7 I;  3NAR A;  4O7D A;  3ML6 A;  2MGQ A;  3OS2 A;  3L0V A;  1B8I A;  2PMZ A;  5FL3 A;  3KX2 A;  2CH0 A;  1CGF A;  1SEU A;  2IGK A;  4IHV A;  1QIA A;  4BKX A;  5JVG F;  4ZR5 A;  1X0O A;  1MBE A;  5IOZ A;  3U9G A;  4IJO A;  2M1B A;  2KP6 A;  5HLG A;  5HAQ A;  3EOI A;  4IQJ A;  2H10 A;  3MKW B;  5D8L B;  3CC4 I;  1RNL A;  3RKQ A;  2OAQ 1;  5I2Z A;  4V2G A;  1MMN A;  1K7G A;  4ETX A;  1HDP A;  1TQP A;  2EV6 A;  4C2U A;  4RMN A;  4CLC E;  1TTY A;  3T1B A;  1WI9 A;  2JIH A;  1GO8 P;  1QPM A;  1UG2 A;  3SEZ A;  2FUG 2;  1CQA A;  3EGD C;  3TBI A;  2R5Y B;  2Y2Z A;  3C7J A;  4N9L A;  5LGU A;  3SW1 A;  2WV0 A;  3TDZ C;  4IBX A;  5A90 A;  4GN2 A;  3N4I A;  1VND A;  3TSG A;  2HP9 A;  2I5U A;  1U2W A;  1L0O C;  4Y2F A;  2XSJ C;  1Z6F A;  4YII A;  1DP9 A;  5DTT A;  3DPF A;  2V1U A;  2JE5 A;  3AYK A;  1ZN2 A;  3K6G A;  3PUF A;  1BUD A;  4M9X A;  2YR2 A;  3ZRG A;  3LIL A;  3LSM A;  3DV8 A;  2DA4 A;  4BXX J;  3ESW B;  4UEY A;  2PD7 A;  1LVK A;  1SVO A;  4OOL A;  1W5T A;  2YB9 A;  3BW6 A;  1XGM A;  2A05 A;  2ACG A;  1VQN I;  3MF0 A;  2W3E A;  3G42 A;  3ZVT A;  1K78 A;  1FMW A;  3F3X A;  2JA2 A;  1YQS A;  1ZVX A;  1BW5 A;  1D3Y A;  3KME A;  3H9W A;  1QU3 A;  3BR0 A;  4H82 A;  2A24 B;  4L63 A;  2P74 A;  4EET B;  3ZQH A;  1SKO B;  4L9N A;  2OI0 A;  4JA1 A;  3A0H C;  4U0Y A;  4KZ7 A;  4NDL A;  2GXA A;  2Z3Y A;  1Q1V A;  1R1J A;  1WJA A;  2X02 A;  2J3T C;  3HPH A;  1WJD A;  3HUG A;  2B5R A;  5AQB A;  4HW0 A;  3QQA A;  1M6K A;  1MZB A;  1NYM A;  2XF5 A;  4HV6 A;  2L1M A;  2PJT A;  2CUJ A;  3CLO A;  1W36 C;  1MMB A;  4U0T A;  2F5E A;  1GSV A;  4WF0 A;  3QP8 A;  5GPC A;  1MBK A;  1E3H A;  3H0D A;  3RDI A;  1U5T C;  4M73 A;  2DDA A;  1CGP A;  2K3P A;  4ZTK A;  1JAP A;  2OTJ I;  3G6E I;  1J7N A;  1WQ2 A;  3MKE A;  3TS4 A;  3FXK A;  1S72 I;  1Y28 A;  2XDV A;  1T56 A;  1L6J A;  1LLB A;  5D5X B;  3EUH A;  4N1X A;  2DBB A;  3GVA A;  5L3F A;  2ZQ9 A;  2X7M A;  5HZH A;  1RRJ A;  1D8M A;  3S2H J;  3BEB A;  4H0E A;  2P04 A;  1ERQ A;  2IT0 A;  4BY1 J;  2OY4 A;  1SDE A;  1ZHF A;  3CDH A;  3HIF A;  5L3D A;  3AL0 C;  1OR7 C;  4E3I A;  2X3C A;  5BPD A;  1TWG J;  1REP C;  4QIW N;  3TW6 A;  2Q0O A;  3I4P A;  4CZZ A;  3B33 A;  1QO0 D;  1R7J A;  4A3D J;  1G3W A;  3UE6 A;  3BWG A;  1HW5 A;  2O36 A;  2R7T A;  1R58 A;  4G7O F;  4RAZ A;  2GZW A;  1ES3 A;  5CKT A;  2M2E A;  4EBP A;  4XKV A;  3LIB A;  2DA2 A;  4OP8 A;  3KO6 A;  4M6V A;  1E3O C;  2GXG A;  4ESB A;  2PFB A;  4IZZ A;  3I0T A;  3DKW A;  3EGX C;  1FIL A;  2EA9 A;  1MZU A;  4A93 J;  4EER A;  1BR4 A;  3UB6 A;  4BU2 A;  2DNS A;  1PYY A;  3E0Y A;  5K5O A;  2H0T A;  5GAD J;  1JKR C;  3UDF A;  1HKT A;  4NXG A;  3EPZ A;  5B5O A;  5GAG J;  1WCM J;  1AYK A;  2FV5 A;  3HOS A;  5IT5 A;  3M8E A;  3KYQ A;  2LH9 A;  1JH1 A;  1LEA A;  3SJM A;  4KG2 A;  3IXG A;  1QZY A;  3BCB A;  3GW2 A;  3H5A A;  4JOM A;  1SVM A;  2E19 A;  3PFY A;  1ALQ A;  4P6B A;  2WGI A;  1G6O A;  5LHG A;  1HFC A;  2D45 A;  3U4L P;  2V9P A;  1WVR A;  2LC2 A;  1R1H A;  3JRF A;  3TO6 A;  2DK8 A;  4GDN A;  5TGT A;  4R3V A;  3HBU P;  1XCB A;  3LR4 A;  3OCL A;  4OIR F;  4R38 A;  3BDD A;  4Z9Q A;  4UHU A;  3NRV A;  3S15 J;  2X1C A;  3CZ6 A;  3CCJ I;  2JRM A;  2Y2N A;  4GLQ A;  3DL1 A;  2BY3 A;  4KUM A;  5I43 A;  2Z2D A;  4A3F J;  2ZC7 A;  3H9J A;  3F8N A;  1XX2 A;  5CED A;  3MQ0 A;  5FGM A;  4GWM A;  4C3Q A;  3BJN A;  3HB2 P;  2O7O A;  2DJN A;  1SLM A;  1I6X A;  4RLF A;  1F9N A;  3OL4 A;  1TZL A;  2XSD C;  2HVS A;  2DAO A;  2M8G X;  2Z33 A;  3JSO A;  1SAX A;  2GIZ A;  3M7G A;  4CH7 A;  2EX9 A;  4HQM A;  3T4O A;  1L0D A;  1BI3 A;  4UVC A;  5DM6 F;  1NLZ A;  2X6W A;  1D0Y A;  4GW9 A;  3F22 A;  1EUB A;  3K10 A;  5DTK A;  5JHU A;  1IEM A;  4G3V A;  3DWZ A;  4JGR A;  3T8R A;  1GDT A;  3G32 A;  3CUE A;  5H6R A;  3QRF F;  5EOO A;  2OV5 A;  3I4M J;  4E6W A;  2WOA A;  5D6E A;  3GUD A;  3LSJ A;  2UXN A;  3F21 A;  3BLS A;  4WEJ A;  3K4B A;  3GLL A;  3FIW A;  3F8M A;  2PMU A;  3BG9 A;  3OIP A;  1DPR A;  5DFX A;  2AXT C;  2WZZ A;  3G1O A;  2XGD A;  3BLY A;  3G2Z A;  5KVR A;  3H3Z A;  2MLR A;  2JSD A;  5IP9 J;  3RCO A;  4MN5 A;  2HTJ A;  3GCM A;  4ILW D;  4KA4 A;  4EBL A;  1OCT C;  3KSF A;  1SAU A;  1B6A A;  1WGX A;  1JGS A;  4RQ9 A;  2VJJ A;  4N92 A;  5FFX A;  3VEP A;  3HTU A;  1FPQ A;  1BL0 A;  3KHI A;  2LSO A;  3LGP A;  1DU0 A;  4P1W A;  3DSL A;  3TOB A;  2EPF A;  1T18 A;  1J9M A;  2VPR A;  1D8K A;  4QKZ A;  3CMZ A;  3GFL A;  4A12 A;  2H09 A;  1KGF A;  1ONV A;  5HD5 A;  3QPL A;  2VPL A;  3HYG A;  4KDP A;  3KRY A;  4ON1 A;  3FHN A;  2V9K A;  3LNQ A;  3V8K A;  1HTD A;  5HDG A;  2XAH A;  1XG1 A;  3CES A;  3I5U A;  1J9I A;  2JT6 A;  3BQZ A;  3I59 A;  3HLE A;  1CXV A;  2W1O A;  1DTH A;  4BWI A;  4DF6 A;  2GX5 A;  4IHY A;  2M4G A;  4DJ3 A;  2XGN A;  1U6G A;  2WV1 A;  4EJO A;  4S0H B;  2NVQ J;  3BP8 A;  3L09 A;  3BJ6 A;  3FK6 A;  1PUF B;  1KU9 A;  3Q7V B;  1UWN X;  5DF9 A;  1LKX A;  5DD8 A;  1SZV A;  3UME A;  1MBH A;  1K61 A;  1JGG A;  4RB1 A;  3VE3 A;  2LP0 A;  1OFC X;  4GCV A;  1YI2 I;  2W0D A;  4I3A A;  4OON A;  5HFO A;  1XMA A;  3HUM A;  4R3B A;  3R0J A;  3EDP A;  1YAX A;  3CHW P;  4X25 A;  5BNG A;  3K4L A;  1IC8 A;  2CJJ A;  3Q0V A;  2RDP A;  2CO5 A;  1I2S A;  4H76 A;  2ZME C;  2X0L A;  3HY9 A;  5BOY A;  2KHM A;  1PWG A;  3OR1 C;  3LL7 A;  1BT5 A;  4ON0 A;  4HDV A;  5HAR A;  4L9E A;  3HB9 A;  2W3D A;  5GHY A;  4JPM A;  4LG3 A;  4FCF A;  4PKW A;  2VQC A;  3FXJ A;  2JK3 A;  5DVA A;  5FO5 A;  4JXG A;  4X1M A;  4JGQ A;  2PG4 A;  4AUO A;  2DPU A;  3TG9 A;  3F1O A;  2DW2 A;  2NVU B;  1I27 A;  1XJ4 A;  5ICE A;  1IF1 A;  3NUL A;  3DFG A;  1FBU A;  1NYY A;  4R6L A;  2ZXH A;  3IXD A;  4F3L A;  1XGI A;  3GV9 A;  2FNA A;  4A6D A;  2XB5 A;  4N9I A;  1FBL A;  1QQI A;  4D0P A;  3GF2 A;  4HNU A;  4BQQ A;  5HAP A;  1BSG A;  4GS9 A;  3IF6 B;  2J3W A;  3RYR A;  4A3M J;  3WTX C;  2V4B A;  4C30 A;  4Y3I A;  1YKD A;  4LIT A;  3LCE A;  4PKY G;  3GTJ J;  2CC1 A;  1KUG A;  3CAX A;  1T0F C;  4IUH A;  2VT2 A;  1LEB A;  3JRE A;  1RKT A;  2Q2E B;  3V7R A;  3JRH A;  1RGY A;  2EFX A;  4ETZ A;  4DXB A;  1EKE A;  1DQU A;  1XCV A;  1FSE A;  4DKI A;  1LE8 B;  1LJ9 A;  3OYH A;  4KG6 A;  4F91 B;  1LQ1 A;  5E2E A;  2V6C A;  4P9F A;  4GB7 A;  3F1N A;  2VKE A;  1A31 A;  3DWL E;  2Z1D A;  1SFE A;  3FDY A;  2WY7 Q;  1FCM A;  3CCV I;  2FD5 A;  2Y0S A;  1LFU P;  3G1M A;  4M3G A;  2DA3 A;  4GRI A;  4HZF A;  2VV7 A;  3T1R A;  3VP1 A;  1AHD P;  1YOU A;  1FQG A;  3P24 A;  4WEK A;  3BG6 A;  1VQ7 I;  4I35 A;  2L01 A;  2L0R A;  3IRR A;  1MSF C;  2P5K A;  2WK0 A;  2QF7 A;  5L2F A;  2N8R A;  2AQE A;  3ISG A;  4D5C A;  3PBO A;  3R6S A;  4LOC A;  3C2H A;  1GCE A;  2EBI A;  4XLA A;  4LG0 B;  2LB9 A;  3OOU A;  2WTE A;  3BTI A;  2L54 A;  1MSE C;  3ZG9 B;  2Y8H A;  1CF0 A;  3AG4 H;  3WU2 C;  2OWJ A;  1IYQ A;  2DA1 A;  2F6C A;  2R3S A;  2AHQ A;  4OH0 A;  1I76 A;  4HIA A;  2GXB A;  3CO6 C;  1DJA A;  3K7N A;  1IYO A;  2DW4 A;  4LV0 A;  2OU2 A;  4DYQ A;  1GKD A;  1ETO A;  3RI4 A;  3QP1 A;  4IOC F;  3CD6 I;  1PYV A;  2IEK A;  4A0X A;  1K25 A;  5B1B H;  4EGZ A;  2H8W A;  4IEJ A;  2VA0 A;  4F52 A;  4HSR A;  3F6V A;  2X6Y A;  1LFP A;  4G7H F;  4UVB A;  1IRF A;  1LDD A;  3GR2 A;  1BOB A;  1BQQ M;  1H9G A;  4HQA A;  2CU7 A;  1W7P D;  1G4D A;  3OL3 A;  4LLG F;  3S2W A;  4EAT A;  2AQF A;  4LV2 A;  5A8B A;  2OCC H;  1UMT A;  3HLB A;  1Z3Y A;  4U7D A;  4HBU A;  3H3V K;  2OC6 A;  1ZAR A;  4JLF A;  1IAC A;  3MA2 A;  3VFF A;  2MC3 A;  3FK7 A;  2PHY A;  4GWN A;  2G9W A;  4MNR A;  1DP3 A;  1MNM C;  4BDZ A;  1OTI A;  1HV5 A;  2JC7 A;  2VX8 A;  3TGN A;  3GTK J;  1XXM A;  2KDZ A;  1H8M A;  3BEC A;  5HWV A;  3GFJ A;  4E6X A;  4XLN F;  4C3H J;  3LOC A;  2L2O A;  1FLS A;  3H7W A;  2E34 A;  4WL9 A;  2IGN A;  2Y6D A;  3H82 A;  4ZYH A;  2DOA A;  3CPT B;  3DEW A;  3B02 A;  2KJB A;  3B2Z A;  2EIN H;  2XAJ A;  2RQQ A;  3DTI A;  3ZDJ A;  1J5Y A;  5DYM A;  4HX8 A;  2VJI A;  1M40 A;  5CLS A;  1ZH5 A;  3FC7 A;  2V4J C;  2W25 A;  2VN2 A;  4DQ2 A;  1GE7 A;  2XPW A;  1U60 A;  2DTR A;  1BZS A;  4AUX A;  4ENM A;  3I53 A;  1BIB A;  3HSE A;  1UMS A;  2VON A;  2UZK A;  3G73 A;  1LT0 A;  4F3Q A;  1FT9 A;  1H8Z A;  1ZRD A;  2O61 A;  2QZ8 A;  1H8A C;  4HBT A;  4LEN A;  2L9V A;  2JMW A;  2E7X A;  4FAS D;  4HQE A;  4BAC A;  3NDG A;  1BC7 C;  2XAU A;  1ULY A;  3BJO A;  3V96 B;  5I5L A;  2ZQD A;  2FV9 A;  4PKV A;  1PW1 A;  2QZ6 A;  3OYB A;  1BLH A;  1KAP P;  3M6H A;  4QJG A;  2I47 A;  1ZTU A;  2ZSH B;  5LGT A;  1WYB A;  2ZBB A;  5DCM B;  4EXO A;  5IT9 Z;  1XFZ A;  1N77 A;  3QWL A;  3NIA A;  1A85 A;  2GNX A;  1CQR A;  2ZJ9 A;  4OU0 A;  2L7M P;  3P01 A;  3BFE A;  3WV2 A;  4RB3 C;  2TDX A;  1YLY A;  4Y4R A;  3BTL A;  5BMZ A;  1YW8 A;  3MCZ A;  4AD9 A;  4Y7P A;  2E5Z A;  2HXI A;  2X6X A;  1B72 B;  3E5Q A;  4CJN A;  4MFE A;  3Q9V A;  4CIC A;  3H1C A;  4PM6 A;  1YQY A;  1JAN A;  3GDI A;  1BI1 A;  1FOY A;  3QPS A;  4B88 A;  1IAW A;  2RC4 A;  3D5L A;  3MKL A;  1IYS A;  4CLC A;  3C5A A;  2ZL1 A;  2OXW A;  3C1D A;  3I58 A;  3Q0U A;  3WTW C;  3TQN A;  1UHM A;  2DDB A;  4NKP A;  3D3O A;  3LA2 A;  1ONG A;  1W79 A;  4I76 A;  3D5R C;  3LFV A;  3B6A A;  5IY5 H;  1LVA A;  2HDD A;  2GIV A;  2KLO A;  2VBY A;  2VZW A;  1MW7 A;  4EM0 B;  3ABT A;  2M7V A;  4Y52 J;  4XUZ A;  1XDU A;  1YW7 A;  1I3Q J;  1BLC A;  1TW2 A;  2JA8 J;  3FXQ A;  5J1Y A;  3ZFZ A;  1MDM B;  2YUS A;  2R7U A;  1OCO H;  5CVU A;  1IN4 A;  4A3J J;  3QHY A;  3DLA A;  4K08 A;  3MZD A;  1W5S A;  2M45 A;  4XN3 A;  3WS0 A;  4KN4 X;  1ZGW A;  2FRH A;  2ZC3 B;  2LTP A;  4DBR A;  1JT0 A;  2CWE A;  4D2O A;  4XBF A;  1YIJ I;  2DCF A;  4XLC A;  3VSL A;  4LCM A;  2XIG A;  4HJ3 A;  2HGC A;  5CQG A;  4ZAM A;  2RRE A;  2JN7 A;  4R4S A;  4JXW A;  2B95 A;  4C3J J;  2ZC5 B;  5HS9 A;  3VYT B;  4AYB N;  4A3W A;  2K9C A;  5KZH A;  1QIB A;  1V3F A;  1B8I B;  3L2W A;  4BS9 A;  2GJ3 A;  4II2 A;  2E1M B;  4JGO A;  4FIS A;  5J7E A;  1XJ6 A;  3A3F A;  3GO5 A;  1JUP A;  3FV7 A;  2WUQ A;  3MZ8 A;  2LKP A;  4KZ5 A;  2BW3 A;  1F98 A;  3SHI A;  4P85 A;  2JKF A;  3FF5 A;  2F5C A;  3GX4 X;  3T1X A;  3GEZ A;  3WTS C;  4EQQ A;  2K31 A;  3ZPL A;  2XDM A;  4LK0 F;  2ZJR F;  1BLS A;  2E8J A;  4DDY A;  3ROU A;  2ESN A;  2VV6 A;  1TS6 A;  1MJ9 A;  1Z7L A;  2Y31 A;  4J00 A;  3CMA I;  2CW0 F;  2VL8 A;  2F5D A;  1VQP I;  3IH4 A;  1AU7 A;  4JGP A;  1TC3 C;  2HI3 A;  3OV8 A;  2XD1 A;  2QJ5 A;  5E2F A;  2OXZ A;  1HOM A;  4WMC A;  2CUE A;  1WA9 A;  3TOI A;  2BV6 A;  3KYD B;  3F8C A;  1TWH J;  3GTG J;  4X53 A;  2JT1 A;  1S1Z A;  2K4J A;  2LY2 A;  5EVE A;  5FDH A;  5EEH A;  3LIE A;  1XKZ A;  4A6E A;  4IHT A;  3C7U A;  3S93 A;  1VTN C;  3IH9 A;  5BQT A;  2HF6 A;  5IT3 A;  2CW7 A;  4K2E A;  3K4K A;  1HA8 A;  4EV4 A;  4Q0J A;  830C A;  4YIF A;  2P6T A;  5EM1 A;  2OZU A;  2C5W B;  1K78 B;  4I39 A;  1HSJ A;  2Z9O A;  4OQH A;  2XQZ A;  2IP2 A;  3MKY B;  3P98 A;  1ETX A;  3RKX A;  2AO9 A;  1Y39 A;  1QHG A;  4X0G A;  3DW0 A;  3J81 Z;  2K9N A;  1UGU A;  4HG2 A;  1NZO A;  2DXI A;  3DPE A;  2GZA A;  1FIP A;  5MC7 A;  4PHT A;  1LSW A;  5JR3 A;  4M3K A;  4S2N C;  2XAQ A;  3TE8 A;  5C5K A;  1KE3 A;  2PBD P;  2BE5 F;  4N4O B;  2PYP A;  2WKQ A;  3A3D A;  1PP8 F;  1ZTR A;  3HUG B;  3DQV C;  1P97 A;  4OPY A;  3OYF A;  3HL2 A;  1JHF A;  4YG2 F;  4FTX A;  1TLH B;  3HXL A;  2EV0 A;  2OW1 A;  3S1Y A;  1K38 A;  3KIO A;  1G6N A;  4U88 A;  1XUD A;  4IX7 A;  3FBN B;  3LE9 A;  3HGY A;  1FJL A;  4I01 A;  2L02 A;  3IUO A;  2L4A A;  2BZT A;  2NOG A;  3VWB A;  3O2P E;  1R9T J;  5TFQ A;  2OY2 A;  1QHH D;  2A69 F;  2CUZ A;  3ELK A;  2R4G A;  5ILU A;  3LEA A;  3OYK A;  3ASO H;  1XTA A;  4RYE A;  3T5X A;  4LFU A;  1Q2P A;  4EMS A;  2B63 J;  5KSC A;  4WXD A;  1SD4 A;  1ODD A;  3W6K B;  5D5W B;  5F5Y A;  2EIJ H;  3HDD A;  1G59 A;  2ESH A;  4XM8 A;  1KA8 A;  2B02 A;  1RPW A;  2WKE A;  4HOB A;  4JXS A;  1XPX A;  3VFZ A;  2K7L A;  2XEP A;  3MFD A;  4II3 A;  1ES4 A;  4X69 A;  5DF7 A;  4E3M A;  3HBR A;  1JVJ A;  5GL9 A;  3GZ6 A;  4GNU A;  1SAN A;  5AQ9 A;  2E36 A;  3ZMV A;  1Y1W J;  3N97 A;  5CHJ A;  5J1U A;  1RR7 A;  5FKK A;  2CV0 A;  2KRC A;  2V8C A;  4N9K A;  3UKG A;  1A5J A;  4HBL A;  3N2V A;  2LKX A;  1Y8R B;  2NNN A;  3ZG8 B;  2Z5U A;  3WOD F;  4XRS A;  4MIM A;  3DAV A;  3LEQ A;  3OY9 A;  2L7K A;  4O3M A;  2KRJ A;  4F55 A;  1VET A;  1X2N A;  1BTL A;  1EW0 A;  4QD4 A;  2ZC6 B;  2RV8 A;  3ZMZ A;  2W3F A;  3F15 A;  2VJ4 A;  3V7C A;  3E2L A;  5HDS A;  2ME6 A;  3Q82 A;  5CVV A;  3OWT A;  5L3B A;  4YOF A;  4HMA A;  2FQ4 A;  1VQ9 I;  2W4S A;  5D1U A;  1DJB A;  2ZC2 A;  3Q1F A;  5FLX Z;  4MN6 A;  4I0B A;  3TVC A;  4Y0T A;  2NS0 A;  2V1Z A;  1IUF A;  5K7Z A;  4MBK A;  3TMO A;  4LRY C;  3S3O A;  2FZ0 A;  2DFH A;  4YIR X;  2HDS A;  3CWF A;  1CI8 A;  4D7M A;  2GM4 A;  3CI6 A;  1AKL A;  2XH9 A;  3I9V 2;  2VKV A;  2VB6 A;  1P92 A;  4L6T A;  3HRM A;  1K55 C;  1IUY A;  2EA2 A;  1A0K A;  1EH8 A;  2PN6 A;  1KDW A;  4P9U A;  3V67 A;  1T33 A;  1MBG A;  3O8G A;  5K7F A;  1FBQ A;  3J80 Z;  2IGM A;  5CEB A;  4R1G A;  5F0F A;  4L9V A;  3V39 A;  4NC7 A;  3HTS B;  2I8D A;  4BBV A;  2WAF A;  1X58 A;  2FBH A;  2FBK A;  4EES A;  3SOI A;  1GHC A;  4PM8 A;  3PFI A;  4HEA 2;  4IHX A;  3RJP A;  5HS8 A;  1IRX A;  1R5H A;  4KMF A;  3MR0 A;  1QZE A;  3LSG A;  2JUC A;  1PJR A;  1SCW A;  3CCR I;  1G3S A;  1X2M A;  3OSF A;  2A07 F;  2ZOI A;  3N7W A;  1S29 A;  2DT7 B;  3NWT A;  4KIB A;  3A1Y A;  3AGE A;  5I12 A;  3GFM A;  4NQW A;  5BOT A;  1T1C A;  1I2W A;  4KZA A;  3LFU A;  4RGR A;  4GHI A;  1JUS A;  4F92 B;  2KDK A;  3LEZ A;  2CRG A;  2QEN A;  3UPN A;  1XFU A;  3JCU C;  4E4H A;  3R4K A;  3RQI A;  1G12 A;  1G05 A;  3U1D A;  3HRE A;  3AG3 H;  1NH3 A;  1V5F A;  1ZAO A;  4EBN A;  1PWV A;  1KQ0 A;  1UG0 A;  3NJA A;  1WH5 A;  2V0U A;  2P6S A;  2VGL M;  4I03 A;  3V4G A;  3F6O A;  4NXE A;  3DKX A;  3I7G A;  1K54 A;  4EQI A;  4G7Z F;  5FAP A;  2CV2 A;  1U78 A;  4BJT A;  4EEF G;  1P4X A;  4N1H A;  2G7H A;  2EFU A;  3LIA A;  1KU3 A;  2XPV A;  3I56 I;  2OAZ A;  1XUC A;  3HYI A;  1IN6 A;  4X6A J;  3W4O A;  3JAM Z;  3IP4 B;  1KE0 A;  1TDG A;  2Y2G A;  5BPA A;  2VLG A;  1S5L C;  1I50 J;  2R9X A;  4AU7 A;  4EM1 A;  3P5J A;  5D5V B;  1RMZ A;  2M7B A;  2X1D A;  4Q4Z F;  2V9A A;  1RKW A;  1P6R A;  1L0F A;  3SS5 A;  3VV4 A;  1JWP A;  1JAQ A;  3ZQG A;  3BZ6 A;  2F2E A;  4XBH A;  3GWZ A;  4GD6 A;  2A8H A;  4PZJ A;  4X1E A;  1WWX A;  4V2F A;  4H1Q A;  5CHU A;  2QGU A;  3HM5 A;  1RZ4 A;  4R79 A;  1K7A A;  1HDD C;  1XSX A;  4FXQ A;  2W15 A;  4B4Z A;  1MMR A;  2BOL A;  2KRF A;  5BOH A;  4JX4 A;  1NLY A;  4KUO A;  2QQB A;  1IZ1 A;  4BLM A;  3HEF A;  5B66 C;  2ZKZ A;  3ZG7 B;  1AA7 A;  3O87 A;  3O3V A;  1MMS A;  1HC8 A;  3NWS A;  2Y2I A;  2M0M A;  1MWS A;  3LYX A;  3R0A A;  3I59 B;  4DD8 A;  5CXA A;  4IED A;  2ZXI A;  3EUK L;  3ERM A;  4KUK A;  2ID6 A;  3HJI A;  1D06 A;  2K85 A;  4NNJ A;  1O7L A;  4UA6 A;  4BAY A;  4MTD A;  3QOE A;  3IWI A;  3HY7 A;  3CC2 I;  1YP1 A;  3CTA A;  3OYE A;  1FM1 A;  2E71 A;  3HSF A;  1OPX A;  4UB8 C;  4KIC A;  3CF2 A;  4N0B A;  4EEU A;  4MLO A;  5F6F A;  5A91 A;  5DM7 F;  1IRZ A;  4BBT A;  4FU4 A;  4OOI A;  3HGG A;  5KSH A;  3IWO A;  4PGG A;  4RGS A;  3VP0 A;  4PKQ A;  2AVX A;  2NAZ A;  3CCU I;  4G9L A;  4P55 A;  5DCF A;  3KZY A;  4WK8 F;  1FCN A;  2OBP A;  2K27 A;  2HZ5 A;  5A2Q K;  2HPM A;  1P7I A;  2WB1 N;  4DPE A;  3ABU A;  3EQU A;  3A3E A;  4JQG A;  2LVS A;  5EJC A;  1LNW A;  3M07 A;  1WZ2 A;  456C A;  5FLV A;  5KAI C;  3WTT C;  3L7H A;  1SFX A;  4EUV A;  3JVU A;  2C6W B;  4FE7 A;  4QHC A;  4FT8 A;  3T8T A;  1KGG A;  5L07 A;  3KYC B;  2ZM2 A;  1MY8 A;  5A92 A;  1JK3 A;  4F3L B;  1T19 A;  3IL2 A;  3UDI A;  4KIG A;  5F1J A;  1BR2 A;  1MGT A;  2K5C A;  2MFZ A;  2HPI A;  1FEX A;  5IYC J;  2RQP A;  3OHO A;  2XKP A;  3H9G A;  4CDG A;  2L7F P;  1Q2Q A;  1J2X A;  1YX3 A;  5K5B A;  2ADU A;  4GS9 B;  2KIQ A;  1S7O A;  3KZZ A;  4L5J A;  4FE4 A;  1C0W A;  4GR3 A;  1ETK A;  2I9V A;  2IWC A;  3GFI A;  3LSI A;  1E17 A;  3CJT B;  3LR5 A;  1BN5 A;  2E8I A;  3Q5F A;  1XGO A;  3KLN A;  5E3M A;  3UB9 A;  5EG0 A;  2FE3 A;  3NI9 A;  3QP2 A;  4HLY A;  3OPH A;  1LL5 A;  3H92 A;  4KT5 C;  3VSK A;  1GSW A;  1WYC A;  5J8F A;  3IAS 2;  5DUK A;  3F1N B;  1VQO I;  4CCN A;  1S4B P;  2CKI A;  1PP7 U;  1MKI A;  3PSI A;  5L10 A;  2LNB A;  4G3K A;  2EFN A;  5M1A A;  1W5D A;  4G94 A;  1JHH A;  3K70 D;  1HVB A;  2KLI A;  1YW9 A;  3B73 A;  4AVP A;  4HJ6 A;  1NK2 P;  2A6T A;  1EA3 A;  5HLT A;  1R5G A;  3DCF A;  3PIO F;  2P7C B;  4QB8 A;  2IGO A;  3HBV P;  2MZE A;  1YIO A;  3T4Q A;  3IH3 A;  5D8K B;  2ZMA A;  3G34 A;  2KIS A;  3HRT A;  3DNG A;  3BOQ A;  2VT3 A;  4BMW A;  1Z9C A;  3FIS A;  2BEO A;  2STT A;  2VJW A;  4E3N A;  1R4M B;  5D3O A;  5EVI D;  4GFB A;  1BUE A;  2E5N A;  1R22 A;  4IQ4 A;  1BW6 A;  4RB0 A;  3HOZ J;  1G6A A;  1TT5 B;  2DFE A;  1ORK A;  2JKR I;  1ZYR F;  3DF8 A;  1OYI A;  3MZH A;  2ZXW H;  4KIS A;  2HDQ A;  1K6O A;  2Y2H A;  3KYL A;  3VYR B;  2XAG A;  2VIX A;  2DA5 A;  3L1P A;  3ZOB A;  2ZC4 B;  4C3I J;  3JTG A;  1F9I A;  1R4N B;  4M9Z A;  1D7X A;  2EJR A;  3NDE A;  5EVL A;  1JT6 A;  3QOP A;  1UEA A;  2WKH A;  3C3W A;  4BY7 J;  3ZMD A;  2IA1 A;  3FXR A;  1JJ8 C;  2XR0 A;  3OSG A;  1DP7 P;  1U9O A;  2OSU A;  1IN8 A;  1KOU A;  4HLX A;  4MGR A;  4WF6 A;  4BD0 A;  3H7W B;  4F94 A;  3AAF A;  2EWW A;  1F1Z A;  5G18 A;  4O01 A;  3H82 B;  5FI7 A;  4S2N A;  2OOL A;  1Z05 A;  3N05 A;  4Q48 A;  4CLC D;  2O9A A;  1OLT A;  1NG7 A;  2YKF A;  3ZNT A;  2IPQ X;  3VTG A;  3FKI J;  2ACJ A;  4MFD A;  2GDN A;  2JCH A;  2ZNZ A;  2PLY A;  2K4B A;  1HXD A;  1ZRC A;  2HZT A;  4OAZ A;  4ZJ3 A;  4E7L A;  2JQ7 A;  1XFX A;  2WAQ N;  2NVY J;  3QP6 A;  3DWB A;  3LSR A;  5FQM A;  2IJL A;  4L19 A;  4X55 A;  1E0E A;  2XGC A;  1Y8J A;  2HQN A;  5IP7 J;  3PSF A;  1J3W A;  4EFS A;  3TO9 A;  1ETV A;  1PWW A;  3L9F A;  4OIO F;  3IC7 A;  3ZQC A;  1LUJ B;  2BY0 A;  2A5Y B;  2Z6C A;  1YG2 A;  2BVL A;  3S4X A;  1ZR2 A;  3S2D J;  1STZ A;  5BPI A;  1IW7 F;  2OPT A;  3V3S A;  3AYU A;  3AL0 B;  4DV8 A;  2XLN A;  4A3E J;  3LJT A;  1U0J A;  2HU9 A;  3RPU A;  2ME0 A;  4PCQ A;  4QU3 A;  1X1C A;  2FSW A;  4KEN B;  1WI3 A;  4DE0 A;  1ZGA A;  2XHK A;  3HVF A;  2OW9 A;  4PKS A;  2CW8 A;  1KUI A;  2YU9 J;  3JRB A;  1FNN A;  2W82 A;  4LCL A;  2ZLY A;  3BFF A;  3E7L A;  5J1R A;  4Q0I A;  3WE3 A;  3S7Q A;  1EH6 A;  3FKJ A;  3SXY A;  2FMY A;  3F8F A;  3UPP A;  5CER A;  2IWD A;  4G6D A;  1LI9 A;  1C7K A;  3HOU J;  1N9O A;  1KUF A;  3ZXS A;  3I71 A;  4XNF A;  4BQO A;  2JSP A;  3IF5 A;  2DK5 A;  2X71 A;  2Z2S B;  5AVF A;  2LF7 A;  4CLC B;  3S14 J;  2ZL1 B;  2DTZ A;  2JNP A;  3KEQ A;  2ISZ A;  4CCK A;  3P9I A;  2PMZ N;  3JRA A;  1K0K A;  3CLQ A;  1BOA A;  3V7S A;  5B3S H;  1QA6 A;  1MMQ A;  4IHW A;  1JTY A;  5KNL A;  4WMC D;  3B8Z A;  2MYS A;  3FM5 A;  3RJU A;  4HAM A;  3A01 A;  5EDN A;  1D1A A;  2J5O A;  1XGS A;  1YHQ I;  1KON A;  5D5U B;  2K9M A;  3ZXH A;  2HWV A;  3ZQ5 A;  2X4H A;  4YFM A;  1LDJ A;  4MNU A;  2KOI A;  4PJM A;  4U0X A;  2A61 A;  4HJ4 A;  4AID A;  1IRG A;  2Z2M B;  4IHQ A;  4I02 A;  4BL2 A;  5FEF A;  1X4P A;  2DW1 A;  4XSX F;  2FNP A;  1NWZ A;  3MMH A;  2ELJ A;  3L2Q A;  1SD6 A;  4H30 A;  3HCY A;  5JVT A;  1Z7U A;  2UV0 E;  4XT2 A;  3RZO J;  3UN7 A;  3P7N A;  3J7Z I;  2XFS A;  3CCS I;  4WF2 A;  3T4K A;  4GYG A;  2FFY A;  3COA C;  1YM1 A;  4MTE A;  1I5Q A;  2G2U A;  2V7F A;  5HAI A;  3VP3 A;  1AKH A;  3FZC A;  5E3N A;  2FOW A;  2XF6 A;  1Y8Q B;  1TNT A;  5B5P A;  4UQI M;  5F68 A;  2R78 A;  1CEF A;  3DU6 A;  2QVO A;  4MN7 A;  3RIR A;  2BW3 B;  4FH4 A;  5LEJ A;  1KUK A;  2HOA A;  5FQK A;  4E3K A;  2COM A;  1ZK8 A;  3P9K A;  1LL9 A;  4U87 A;  1R23 A;  1D0X A;  1FWZ A;  3MAJ A;  4E6K G;  5M3F J;  2K9S A;  2LY1 A;  4PKT A;  4P96 A;  4A0Y A;  2PU2 A;  2MC4 A;  3TDU C;  1Z21 A;  2VV8 A;  2H6C A;  3HLC A;  4EUZ A;  5GLC A;  2J9O A;  2M1C A;  4EGY A;  5CVR A;  5GTI C;  1L0E A;  3KET A;  4ZDP A;  3PL8 A;  1YS6 A;  1OCZ H;  2GOX B;  2H5S A;  1J59 A;  2JVG