3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
molecule keywords IRRE PROTEIN
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTKA 3DTEA 3DTIA
chains in the Genus database with same CATH superfamily
1B1BA 2NVXJ 3QPLA 3MKLA 5HLGA 1B8IA 2QSHX 4HY8A 2WB1A 3D1NI 1IYPA 5E2GA 2R7VA 2XGNA 3ELMA 1YAXA 4P1WA 3FMRA 3TMOA 4XORA 5DF7A 3O6BB 1K78B 2QWWA 1FYMA 1LI0A 1TTYA 2ZMEC 4XNFA 3MR0A 4P6BA 1C0WA 3G34A 3I4NJ 2XAJA 3GO5A 2XPUA 2XC7A 3GTGJ 3LR5A 2MH2A 2E19A 1P4WA 3Q82A 4A3DJ 4Q0IA 1BJZA 5CPRB 4E7HA 4QHCA 5F82A 2OTJI 3E7LA 5TBMB 2FBHA 3IF5A 4HYEA 4FXQA 5HODA 1JAQA 1P9QC 4XXRA 4CYDA 1MBFA 3OSGA 4N9HA 1YOVB 2YU9J 3ASNH 3Q9VA 4XSZF 1IELA 5E3MA 5JYPA 1XA1A 3LSGA 3R7WA 4Y52J 1J3WA 4RGXA 5GAEJ 3I5UA 1JKOC 2ZC2A 2NUPC 1Z05A 1MMPA 3S1YA 2XF7A 3Q9SA 2VJ4A 4XONA 4BY7J 1WE4A 2PU2A 4L9TA 3BT9A 5GHYA 3TJZC 5CXAA 4NUBA 1YW8A 5HAQA 2HGCA 3CF2A 1FM1A 3UMEA 3OYCA 1N9LA 2D1OA 5J47A 2EIMH 2YS9A 1EKEA 1A5JA 1E4DA 2IXSA 3JSPA 2BBYA 3EDGA 1K57C 2EBIA 1ZG3A 3SFZA 2HYFA 3KSGA 5D8LB 4O3MA 4HW0A 1IFQA 2P04A 3LILA 2HP6A 2Z6DA 3LQ0A 1R1JA 2EFQA 1E3HA 4FSFA 1CQTA 6PAXA 5F0HA 1X1AA 3S8PA 1T2KA 2FEZA 2DMQA 3T5XA 4GNUA 1HY7A 1VQ4I 5HS7A 1MW7A 1ESIA 4JXSA 3ZNTA 2FQ4A 4KN4X 5U47A 2A49A 2R5ZA 4UVCA 4GCVA 1HFSA 2GM4A 4ZYEA 4XLNF 2Z9OA 1ZGJA 4HH2A 3J80Z 1EV7A 2DTZA 4NKPA 3HBUP 3W3CA 2JRMA 2KRHA 2A8HA 4H30A 4A3JJ 3GLLA 1E25A 2OY4A 1Z7UA 5DS9A 3WU2C 2PT7A 1VQ7I 1RC9A 3MSHA 1H8AC 1AF0A 4AIDA 1HKQA 3E6BA 4EFSA 4PFOA 2ETHA 4MBFA 2HVQA 1ZK8A 3BCAA 5I43A 3QHYA 4KN7X 1TT0A 1ETVA 5J6XA 4C30A 4G3KA 3ZQGA 1WJBA 2ZXJA 3CMAI 5F68A 5IU1A 4UUTA 4R3AA 3RJPA 2FJ1A 5FI7A 2UUZA 4MTEA 3SDBA 4OWRB 2I47A 2A24B 3KECA 4HNTA 4CUGA 5FKLA 1H0MA 1OM7A 2I8DA 2K7LA 2BY2A 3IH8A 1G12A 5M18A 4X25A 3VOZA 1XMAA 2CJJA 1KUHA 3H3VK 1WI9A 3A0BC 4NXBA 3JRHA 4XBHA 3HHHA 1RI7A 1W5SA 3AGFA 1FCMA 1S4RA 1DTHA 1VQOI 2MGQA 4D7MA 3BR1A 2H10A 1TNSA 4XUXA 3KP4A 2VQGA 4F55A 1DU6A 4H8RA 5A8BA 2W13A 4L18B 3S7QA 1I5ZA 3BR6A 2KQRA 5ILUA 1LEBA 1CGFA 4PKSA 3IS2A 3VB2A 4A3FJ 4KDPA 4JF6A 1SANA 4GR3A 2BEOA 1AWCA 2X01A 1H9TA 2XV4S 2MA3A 1F98A 1S0WA 4F93B 1T18A 4KZ5A 1S29A 4DJ3A 3E4QA 4HHDA 3B8ZA 4QKZA 1USTA 3EETA 1O07A 1WVRA 1EH8A 1BIBA 1R4MB 2IWDA 2KOIA 5B5OA 2B5RA 1UHSA 3VSLA 2CU7A 3F6OA 5CTNA 2NS7A 3C1DA 1IDYA 3LEZA 1NXYA 3LIRA 1X1CA 2AXLA 1RGZA 2DCFA 2VXDA 1FTTA 4M3KA 3ZPLA 2W00A 1D1JA 2D1VA 1JJ8C 4OONA 4YFMA 2EFPA 2M2EA 2RNGA 2JCHA 1UTZA 1UFMA 4BXXJ 3VOYA 1DJCA 3GZ5A 3KLNA 3LIBA 1WNIA 4K91A 3QP1A 4QTRA 4O8GA 5L2FA 3L7HA 3DTIA 4JQGA 4GXOA 3BJOA 1GHMA 1RESA 3GFJA 5D5UB 1QMFA 2H5SA 2HJEA 3KETA 2KKOA 3I55I 4WXDA 4N9KA 4FTHA 2OVXA 3EOIA 1EH7A 3LJZA 2L7MP 2O8XA 2RV8A 3BOQA 4OU0A 3FISA 3QODA 3HOWJ 1R00A 3R61A 4MFDA 3HREA 3UPNA 1J0RA 2ICWG 5EVID 2OAZA 3WTZA 3CHWP 2GJ3A 3TT4A 2VQHA 2OPTA 5IP9J 3F6VA 2FFFB 4GW9A 2ESNA 5EDNA 3S22A 1OISA 1LDJA 1X1BA 1YIOA 4LMYA 4U7BA 2KX6A 2Z2LB 3W4PA 1LE8B 3IAS2 3O2XA 3BCBA 2PBIA 3VOEA 3SS5A 1I50J 5HLTA 3G1MA 1H8MA 3BFEA 1YHQI 5HX9A 1LL8A 4IJOA 3IT9A 2WKIA 3AL0B 5J8CA 2GLOA 5K7ZA 4I03A 3RIRA 1K4TA 1JVJA 5FQIA 1IO2A 5E3NA 2D01A 3O8GA 1G59A 1J7KA 3HVFA 2E1MB 3J7YJ 2J5PA 1ALQA 3H5AA 1MGTA 1BSGA 4BH9A 3ZHHA 4QPOA 4KZ3A 2WAQA 3EUKL 1OMJA 4GGGA 4HSRA 1BQOA 1BI2A 2R3SA 5F83A 4AIJA 2JKFA 1M40A 1MBEA 1D1AA 1U5TB 2DT7B 2QYOA 5FASA 1MBGA 2LTPA 1QA6A 4V19K 4PMAA 2FV5A 1PWGA 3UN7A 1LPQA 3E6DA 3QWLA 4RGSA 4CJNA 2ZQAA 1PP7U 4Y0TA 4IXAA 2F5CA 1F5MA 1JKRC 1T19A 3AFHA 4II2A 3D9YA 3Q07A 2Z33A 3Q7VB 4OQHA 2M30A 4ME4A 3E5QA 5EUAA 4Y13A 4QSHA 1S4SA 2HOSA 1C8TA 4GCZA 3D5RC 3IRRA 1DP6A 1GUUA 3CG5A 5CECA 4CHUA 2V1NA 2G0EA 4CA0A 3I7GA 1QHHD 2L3DA 3BPVA 3JVUA 1XA7A 1NTCA 1KDWA 3HUOA 5HL6A 2IT0A 1OCCH 2F5VA 1VQNI 1W4MA 3PFIA 1IN7A 2JK3A 5JR3A 1LFPA 5H20A 4XOPA 1LSVA 2PEXA 4AD9A 1TWCJ 3OPLA 1OMIA 1SVOA 1L3LA 3FYZA 3FXUA 1KVMA 4OPYA 3I71A 4BD0A 1FZPB 3PBQA 3RI4A 1F43A 2ME6A 3HDBA 5GTHC 4Q48A 1W5CC 4P96A 1D0ZA 4AU7A 1UB9A 5HLHA 1LUJB 4G7OF 3P7NA 3PBNA 1RRJA 1IJWC 4PKQA 1F9NA 1JAOA 4ZDXA 3UE1A 4ASNA 1D0YA 4UVAA 3DXJF 2WZZA 4XSXF 5CQEA 1CF7A 3PR6A 4XM6A 2K86A 3ZMTA 3BTLA 4DE2A 3N8RA 4B4CA 3EWKA 1Y54A 1EJ9A 1NZUA 2PU4A 3WV1A 1BM6A 3FKWA 4MEXF 3A02A 2DA1A 2MYSA 1HLVA 1LEAA 2ISYA 1RP5A 2ZM0A 3BTCA 1O7EA 3B6AA 3VSKA 1SD5A 1ZTUA 2V1AA 1ZGWA 2ZMFA 4L9EA 5IHVA 2GAUA 1G4KA 2K4BA 4BGDA 5FFXA 4E7KA 2K27A 1CEFA 2Y2IA 1Q3AA 1JWVA 1M1EB 2F4MB 2NYXA 3GUDA 4KT6A 2VI6A 2ZFWA 4ZDOA 2PD8A 3CPTB 3DSLA 2C6YA 2J3WA 5LBQA 4PHTA 2M9HA 4CCLA 2Y59A 2R4GA 3J80K 3QP2A 2DK5A 2HDCA 5FRNA 1LT0A 3ZCOA 4E3MA 2R5ZB 5TISC 3HRTA 5L3DA 3IH4A 2LVSA 4DRTA 3K1MA 5FI2A 3N97A 2M7VA 5CEBA 2KLOA 1K6YA 1R1VA 1TWFJ 1Y8QB 2EX2A 3A0RA 4L9VA 3O8HA 5FAOA 1KQ0A 1CQRA 2XKPA 1XM5A 4KIGA 2DA3A 2WBMA 1VQMI 1PDNC 2HYGD 3NARA 4KISA 4RX2A 3CCUI 4ABZA 1PZOA 2J7VA 1IRXA 2H94A 3MFKA 1TDLA 4Z9QA 5KZHA 3DF8A 4F7ZA 1BLSA 3GTMJ 3IWIA 2N8GA 2ZSHB 1PYVA 3BY6A 3J81K 3C7UA 1GVDA 2CO5A 3B47A 1U78A 3LJGA 4X56A 3A0HC 1T1BA 1XFZA 2VKVA 5HPFA 4HF2A 4MMNA 3V96B 2Y69H 1WZ2A 1WJEA 2JUCA 1ZG1A 1VETB 4HOBA 1AKLA 4BY1J 4JGPA 3N4MA 5B1BH 2BLSA 4KT5C 4EJTA 3OIPA 4AUXA 2XAQA 1K57A 2Y6DA 5IY5H 1IZ1A 4JF4A 2K40A 3ZMSA 4KITB 4I76A 3CPTA 1XJ2A 2EROA 4GDFA 2LB9A 3WRZA 3P1VA 3MFDA 3OOUA 3HOXJ 4G7HF 2R7ZJ 4YOFA 1YW9A 5JHUA 1OCRH 3G4PA 2O3EA 1MD0A 5F1JA 3KX0X 4KZ6A 2P7CB 4B4ZA 1FOYA 2MZHA 1T39A 2DMNA 1R1TA 3ASOH 5CXWA 4HNBA 4E3KA 3F16A 3SEZA 4AYBA 3F1AA 1MC0A 3PO3J 2OW1A 3P98A 3OYKA 4A6EA 3IS2B 1FSEA 3E1SA 3KP2A 4IJAA 1FCOA 2JKRI 3RTTA 2X1EA 3WTTC 4P6ZM 2W82A 4DZJA 3LIAA 1U5TC 1W8YA 1FMWA 1SVMA 2BHZA 1QQIA 2H0YA 4CLCC 5CHUA 1WGXA 2P8TA 2XB5A 4OVDA 2FE3A 3DKWA 4JK1X 2Z99A 1AA7A 4HSTA 3FKIJ 2RQQA 4DBRA 3FBIB 5CVVA 5B5EC 3W2WA 1F2KA 1TF1A 3G32A 1IKGA 3LNQA 1UAAA 4BJPA 2ZLYA 3T12B 3MAJA 1BW6A 1IEMA 3OOVA 2MC4A 2PJPA 1SAXA 2VN2A 1TBXA 4OOIA 4EEFG 1FT9A 1ZKJA 4JIJA 4BQNA 4XRMA 1YQAA 4OPRA 5DTSA 3BC8A 3MEXA 3NWSA 2YSRA 5E18F 1AKHA 4PSXA 3HM5A 1IXRC 2X51A 3TOAA 1OT6A 3LI8A 2DA4A 4A93J 4XLAA 3KYCB 4P5OA 3OS0A 4EQQA 4R23A 1ZGAA 3M6BA 2RAEA 3E2LA 2M45A 1MH3A 4PM8A 2CW0F 1BZAA 1YW7A 2DYRH 2TCTA 2D2WA 3DP7A 2BY1A 1HBXG 3UMDA 3WWXA 1CGEA 3T1BA 2ID3A 4L5IA 4FE4A 3ZQIA 3ZXSA 1HTDA 4I39A 4I5SA 4JYKA 2A05A 2WKRA 2OV5A 2YPRA 4O5VA 4LB5A 3F15A 4WX9A 3HUGB 3SS4A 1GXPA 3RQIA 2OWJA 4JGOA 3AG3H 3ZMDA 3L09A 3GMWA 2PX9A 4N4NB 1KU9A 4CCOA 1ZR4A 2ZJ2A 2ZMAA 1NHAA 4ETSA 1K54A 2Y8HA 1NRJA 1U5TA 4KZ4A 1XFWA 4N1XA 2XGCA 2QA4I 4BDYA 1R1HA 1KE3A 4UUSB 1BI3A 4WN5A 2J83A 4CQHA 1OYIA 3EQVA 2EV5A 1PWWA 2KRCA 4ON0A 2XGEA 4ZDPA 2EIJH 2ZNYA 4EWFA 3CP8A 3PL8A 3MZFA 4OIPF 5EPHA 1J59A 5A93A 3H5NA 3G42A 1Z21A 2RC4A 3HOSA 1ULYA 2KFDA 4D5FA 3N7WA 4X55A 1CI9A 2RJPA 3PHYA 3JYIA 3LAJA 4MBHA 3A01B 1X2NA 2HZDA 4MTDA 1JE8A 1DJAA 1KGEA 1FLSA 2HNHA 1OM6A 3H3ZA 4HX3A 2L7ZA 4PKTA 3IV5A 3ICYA 2VL8A 5FQMA 5I94A 3GX4X 2VGLM 4PKUA 4IVKA 2XD1A 3T8TA 1FIKA 2DYSH 4EVIA 2INWA 1AYKA 2G7UA 4U0VA 2VQLA 2L54A 1OJGA 2A6TA 1QHGA 5FKOA 1CF7B 2EILH 3LO7A 1GE6A 2LD5A 1BKCE 4DZPA 3F9KA 2CMNA 1M6KA 3A3DA 2W0DA 1ATLA 2RREA 1DP7P 3R6SA 5LGTA 4LLOB 1ZTRA 3C3WA 5AIPA 1HQCA 2STTA 2W1RA 5J7EA 3DV8A 5DF8A 5LEKA 2WGWA 5DF9A 2L01A 4TV7A 2XASA 2HQAA 3PBTA 3EPZA 3V5MA 2W1OA 3GZNB 5IPAA 1UHWA 5A90A 3U1DA 4AIKA 2QF7A 3LFUA 3PNYA 4P9FA 3CJRB 3MZYA 1PP8F 2R92J 1HTZA 2Y55A 1APLC 1XC5A 1Z0XA 3HOTA 2ZMEA 1XURA 1CXVA 4IF4A 5AQ9A 4E3NA 3H9GA 5LHIA 1ACFA 4S0HB 1W63M 3A01A 1RKWA 1KUFA 3LSHA 2W3HA 4C6YA 3O3VA 2EX6A 2CKIA 3ABTA 2QKPA 3HBVP 1RKTA 2KL4A 3WODF 1Z3XA 3B6CA 4CZCA 1PFLA 1R36A 2KRFA 2EPFA 2JPCA 4HQMA 1ETOA 3LA2A 4IL6C 1J75A 1Z09A 2L4RA 1ZYRF 3RCOA 3GDIA 2Z6CA 1RMZA 3FF5A 4KJZA 3G73A 1V9ZA 3GYHX 2VPRA 3I64A 1I1GA 1YSQA 3TSGA 2DOEA 4FASD 3Q7ZA 4OPZA 1XTAA 3BJ6A 5C3EJ 3JRAA 4C2TA 4N9LA 2XS4A 5KK1A 3BY8A 3UNGC 2H27A 3HSEA 1SDEA 1OLTA 2M34A 4F3QA 3HDDA 2PAVP 5GHXA 3VV4A 2M0MA 1JHHA 1IADA 1T8IA 5F6AA 2JPBA 3R4KA 4HJ6A 1E2XA 4MN7A 2YB9A 4PM5A 2HDWA 4QU3A 1TC3C 2HKOA 3L2RA 5IOZA 3VFZA 4C3IJ 2QM3A 2FFYA 2V9AA 4Y15A 3RPUD 3J7ZI 3CI6A 4LPZA 3UB5P 4YNRA 2NVQJ 2HDUA 2JBFA 4XK4A 3HLGA 4LCMA 2R7RA 3GTLJ 3LFVA 1SLMA 3COAC 1H88C 2H09A 3BG9A 2W14A 1YLFA 4KENB 4DOZA 4ZJ1A 2EH3A 2JN6A 1X1PA 2GOMA 4E3LA 2IWCA 5GHZA 2FRHA 4GYIA 2XDVA 2HDRA 1PYYA 2QQ9A 3W6JB 4IJGA 4XRSG 3DTMA 4HDUA 3BG3A 3L9FA 3BWGA 4IUKA 4PUSA 4YWZA 3S4XA 4MNUA 4MBKA 2CGPA 4Q8IA 2OZRA 5FATA 1LVAA 5ICFA 3L1PA 4HDVA 1S67L 2FZ0A 4FVLA 5CVJA 4R3JA 3J7AO 1R54A 1IABA 1JAPA 2NS0A 3HTUA 3SW1A 5CZMA 2LDUA 3FV7A 2VXZA 3DLAA 1BBYA 2W24A 4LFUA 1P9RA 1TS0A 2BASA 2M4GA 2YKHA 3A0SA 3GR2A 5E2EA 3JAMK 4P9UA 3HOUJ 4DE3A 2WUQA 4GO1A 5LEJA 3GTCA 3JVVA 3WTXC 2ZXWH 3GW2A 3PM1A 3ZRGA 5IYDJ 3HC7A 1DGWY 4IHWA 2HPIA 5A2QZ 2A24A 2WKPA 5IYCJ 5D1SA 4XN3A 2YIGA 3BR0A 5K7FA 4A3BJ 4ESPA 4KZ9A 2LK2A 5TJJA 3Q3SA 1BOBA 3OYMA 4ZYHA 1IN6A 4IOCF 3K2ZA 4LITA 4RX3A 3F22A 2WGVA 2XGXA 3BLYA 3B2ZA 2E2JJ 2JKGA 1TQPA 3RPUA 1FWZA 2ZL1B 4F94A 1MMQA 2F2EA 4R3VA 2R5YA 5I4OA 4I99C 2BG1A 1S5LC 2MABA 1AWIA 5HW3A 2IS2A 2Y91A 5IYBJ 1X3UA 1L2SA 4JOMA 2YKFA 4MN6A 3W2ZA 2Y2HA 2LKXA 2DA2A 4KZBA 1PUFB 2PBDP 1UMTA 2K31A 3Q0WA 5G18A 3LI9A 1FPQA 2PJRB 4FOFA 4MDZA 2JQ7A 1ASTA 2FOKA 3U2RA 1DUXC 4CCJA 1ZP5A 1WJAA 2MLSA 2OOLA 1IAAA 3ABUA 2EWNA 3C2BA 2WWYA 2VBZA 3VP0A 2H6CA 3M8JA 2XAGA 4Q0HA 2R7OA 5D4SA 3NDGA 1YO5C 2LY9A 4AM3A 4FTXA 3VDXA 1LFUP 3UE0A 4KG5A 1P7IA 3MZEA 1BI1A 3Q81A 4IPAA 2IVMA 4O7DA 4PKRA 1KGSA 2O9LA 2LLKA 2DDYA 4D0PA 2KT0A 4XM8A 1DPUA 5J1YA 1Y1WJ 1YJ9I 2E36A 3TOBA 1A0KA 4JP0A 2MFZA 2XB0X 2XQZA 2BXZA 5M5XJ 1OPXA 3EEHA 2FNAA 3T1XA 2HS5A 3SS3A 5KNLA 1G2HA 2KJCA 1O3QA 2PR5A 1Y0VA 4GUYA 3SOIA 4UUSA 1XSDA 1CGPA 3A3JA 1X1DA 1G5UA 2CUFA 3UR3C 3CO6C 4BYYA 4LRZE 3T4QA 3ZQ5A 3QU6A 3E5XA 3RKQA 1FR1A 2QQAA 1XPXA 3BG6A 3S1QJ 1PWCA 4PKYG 1YX3A 3LICA 3LSRA 2DN0A 2ID6A 4PM7A 3F8NA 3R7WB 4WZVA 2FMLA 3MKYB 1W0TA 1K61A 1OS9A 2R7QA 5HDDA 4UUVA 1IYSA 3I53A 3ZGAB 2WA0A 1YTYA 3K4KA 1ZVXA 1P9WA 2G2UA 2LREA 3H7WA 5HAIA 2IGKA 1BKCA 2YR2A 4GS9B 4AWXB 3EWJA 2WAFA 5FLMJ 2FF4A 1GA0A 1I2WA 3FX3A 2DMWA 4S04A 2X6YA 3W2VA 4G3VA 1VB6A 1Y0UA 1KA8A 1NYMA 5F0FA 3PSIA 1LQ1A 3CCYA 4AYBN 1WYCA 2H0TA 1T0FA 1J7NA 1B72B 4R4SA 5CVUA 3K70C 2FA5A 1XDUA 3TO7A 3EEAA 5DEQA 4XQFA 4IEJA 1K55C 4B4XA 1NLYA 3DNGA 2JNPA 2DCEA 3K9TA 2OXZA 4EERA 4E7SA 3LY4A 3IUOA 1IV6A 3DBRB 1EWZA 2PHYA 1PWQA 3JRIA 2EX8A 4JGQA 1L6JA 5DD4A 4XL9A 2FNPA 1IRZA 4A7BA 2XKOA 2F5EA 2P7JA 1GSVA 2KIFA 2LH9A 3F72A 1UJ8A 1IRGA 4S2PA 1OCOH 1MNEA 1XPBA 5E2HA 3S32A 3ZG0A 2R9WA 3Q7VA 3P9IA 1G3SA 2ZM8A 2DO7A 1L0OC 4B3AA 5HVQC 5EGOB 2XA7S 4UA7A 2EA4A 1OM8A 2I10A 2J5OA 2VB6A 4N9IA 2R0QC 2HOTA 1HA8A 1E3UA 1BLPA 3FWLA 3K2AA 4EW7A 3QP8A 1BN5A 4LG0A 3TGNA 3A4CA 4EV0A 3OYGA 3V67A 1OS2A 4DMZA 1ES4A 2ZKZA 4HIAA 3IHAA 5J4VA 4MCWA 1T08B 5DFYA 3MQ0A 1U9OA 4LV2A 1EAKA 3CCRI 3GTOJ 1EF4A 3TS4A 2VOOA 2ZJPF 4GOGA 2L9RA 3UE3A 4KUMA 3LGOA 3D3OA 4G9LA 4WF0A 3S3MA 1WKMA 1G3TA 3RQ4A 4IHSA 2XEPA 4H1QA 3DFGA 4N92A 1VQKI 2Y2LA 2WY8Q 2Y4AA 2KHMA 2YUSA 3HL9A 3U2AA 5FB2A 3OBFA 2YX7A 5FROA 3HRSA 3KEYA 3VODA 1JWPA 4LCLA 4ENKA 1GSXA 1NG7A 3ZCZA 2K9LA 2MC3A 2OZUA 3OOPA 4DYRA 3DAVA 5D4RA 1HCRA 1HV5A 2IJLA 2HDDA 5BOHA 1KGGA 4Z1WA 1F36A 4JA1A 5EM1A 5CYVA 3I4MJ 4R4RA 1B3DA 3ESWB 3UNWA 4G12A 3EUAA 4A3WA 1H3QA 1QIBA 2K2NA 1I1IP 3LMMA 4H6JA 3BPXA 3M1CA 3TOIA 4XLFA 4U87A 4M3GA 5EZHA 1Z6RA 3IWQA 4KQRA 2JA8J 5EVIA 2WAQN 1XJ3A 2ME0A 4C2UA 4LG0B 1R6RA 1RPWA 3LSKA 3C8CA 4KZ8A 1BZSA 1R5HA 2W1TB 4HG2A 1U60A 2XAHA 1MWRA 4LK1F 1S7EA 2JN7A 4HJ4A 2XS3A 1SD7A 4KMUX 4L9NA 2XSDC 1JUPA 2BVMA 3B33A 4X53A 4RLQA 3S17J 3OC2A 4KZ7A 2PMZA 1EW0A 5H8XA 4ILWD 1OMEA 2CQQA 1FCNA 4HP4A 1DMTA 5JYOA 4EESA 2RKHA 3GVAA 1Y93A 1Y8JA 2EIKH 1FILA 4LRYC 3FM5A 3LA3A 4OP5A 2VJIA 3ABLH 3HL2A 1KE0A 4P0MA 1L0GA 3SH7A 5JFRA 5EVEA 3VE3A 3M2KA 1YOUA 3OR2C 3G1OA 1Y4OA 3VMAA 1SFKA 1PW8A 5D5WB 1T6SA 2CC1A 1G05A 2B95A 1OO9A 2CV1A 2L1MA 1XFUA 2KIQA 2O7OA 3ZQQA 2QYBA 5EEGA 1LVKA 1T98A 3ML6A 1Z3YA 3CCJI 1HVBA 2HV1A 4AFIA 5FQJA 2K9SA 5BNGA 2VA0A 3NY4A 1JIWP 4NDLA 1XGJA 3MS6A 5J1UA 3RXXA 2Y31A 5B5PA 2DFHA 2E1CA 3TP3A 2M4KA 4EQIA 5DM6F 1XJ6A 2QJ5A 1SD6A 1TQIA 4OINF 1MJAA 1PI4A 4HX8A 2OZ6A 3BZCA 4D5CA 1EH6A 4H2EA 4ZRRA 1H9GA 1JWZA 2W3DA 2ZL1A 5CVIA 3G71I 4IHXA 4QWOA 2P5KA 2LY2A 5DJUA 1D5YA 4Q0JA 5EJCA 3NULA 3VP3A 4DYQA 3U9GA 1UZCA 1SEUA 3I58A 2K02A 5LBRA 4GFBA 1ONHA 4C75A 2V8CA 1CAQA 2YU3A 4HLYA 4CH7A 4EATA 4A3EJ 3N05A 1SC7A 3MQOA 1T95A 3NJAA 1Q1HA 1A6QA 2L02A 1P97A 1LDKB 5D7WA 3SHIA 1FSWA 1P6RA 1BM9A 2HXOA 2LRDA 4HBLA 4PJJA 4AXQA 5FA7A 4KFCA 4FU4A 3PFYA 3FDYA 1XCVA 1YE9A 4GHIB 2N8RA 5EEAA 3U21A 3VFFA 3N8LA 2KLIA 2O36A 2X02A 2R7FA 5ILVA 3BW6A 1W63Q 2OA4A 3WG9A 1K6SA 3HLFA 2F6CA 4G3WA 3E6CC 1FYLA 1T33A 3JRDA 5I2ZA 2XLNA 1L0FA 2DA7A 5EFWA 2HDQA 3F8BA 4NEED 2MZIA 1VQ9I 4ETZA 3KYLA 3ULFA 4JQFA 4M6YA 4LENA 1A36A 5J4EA 1J09A 1LL9A 1S66L 4NC8A 2JKTM 4DF9A 2VV7A 3NAUA 4RBOA 4HAMA 2ZC6B 2V7FA 4HQAA 2V9VA 4NK3A 4A5NA 2MSYA 4E7ZA 4ZTFA 4HMAA 4QB8A 2LY1A 4OP8A 3UVCA 1D0XA 3VOLA 3GFLA 4BU2A 3LEAA 4RB3C 4G7ZF 2W0NA 4EEPA 3WG7H 1Z7LA 1Z91A 3HBLA 4UB6C 4B43A 4OQIA 2WV1A 4JF5A 2M7UA 3CLOA 5DTDA 3KZIC 5JI6A 3S16J 2V4BA 3UDXA 4PM6A 1UELB 1WFXA 2DOAA 2IGOA 2NXNB 4YIIA 2NNYA 3OY9A 3BJAA 3QPHA 1ZR2A 4D2OA 1BQQM 4CYCA 2HWVA 1VQQA 4KUOA 1F1ZA 1MJ9A 1JJ9A 3CP2A 4PZJA 1YPRA 5J8FA 4S2IA 3FXLA 3K1NA 2A69F 3S2WA 4D7NA 2V0UA 1YQYA 2FSWA 2GIVA 4BUPA 2Y2GA 3V8KA 1H71P 1MXOA 4Y0UA 2E7WA 2JA2A 3OYJA 2MBFA 2A6EF 4J19A 1B8IB 4K0WA 5EGOA 3E8RA 4EBLA 5FJ8J 4XCTA 2JTVA 1IXSB 1AOYA 1LSWA 2L4MA 4BXUA 2WY7Q 1B59A 2CMPA 3M9AA 3P9CA 1FYKA 3ECOA 4RAZA 4ZJ2A 3FK7A 4CPKA 5DYMA 1W7PB 2XVCA 1KYWA 4B48A 5IT9K 1I5QA 1HD8A 3AGEA 4OLGA 1MZBA 1ZELA 3C7JA 2E7XA 1VNDA 4CGZA 2WZXA 3L2QA 2Y2MA 3LIDA 4GB7A 4XLCA 4E6KG 4IHVA 5IS1A 1I27A 1OQYA 3RDIA 4HQEA 3QNBA 5FEFA 3HGGA 4WBGA 4UXNA 1K7IA 2IBDA 4GR0A 2XD5A 4R6LA 2IS1A 1FSYA 1BOAA 4PGHA 3KYQA 2HKXA 2B63J 3LR3A 1C7KA 2DBBA 2RGVA 3KLOA 5ICCA 2JKRM 2Q0OA 4HF0A 4NB5A 5IOYA 2ESHA 1E0EA 3UB6A 5HARA 1KGFA 5L79A 1IYOA 4FT8A 4JBAA 2QEXI 3MQQA 4A3LJ 3IC7A 2QBYA 1GE5A 1T56A 4ZJZA 4KZAA 4Y7NJ 4FH2A 4I35A 2EV6A 1N25A 4M9XA 4BJ6C 1JTDA 1VETA 2A5YB 5F1RA 5EM0A 1C3IA 1I6HJ 1OYWA 4WF6A 2VLAA 4UQIS 2OI0A 3K4LA 1NK3P 3E97A 3F1PA 4XKWA 1OTAA 2CQKA 2QCOA 2J9PA 2KMUA 2MLRA 5TFQA 2W12A 4FXYP 3MXSA 3VTGA 2ZXHA 3G4SI 3IX8A 1XX5A 1X0OA 2ECBA 1S4BP 1K55A 2X7MA 2HDSA 3CJMA 5GAGJ 2OJED 4AVZA 3I59A 4V2FA 3ZFZA 4CLCD 2X6WA 3ZVTA 4QJGA 3HLBA 3HG9A 1ZQ3P 4IZZA 3EYYA 4M6VA 1MIJA 1OTBA 3FPWA 3CCLI 1YS7A 4UV8A 1R49A 1IRFA 4I3AA 4N1HA 3LJTA 2VC0A 3HCYA 3IX3A 3K10A 4U88A 3ZG9B 5L7FA 3KP7A 4CZZA 5DFXA 4KQQA 2FD5A 3B92A 1MKMA 3MCZA 2R9XA 3QU3A 4WZ5C 2ZOIA 3CUEA 2VE9A 4YRVA 3BQZA 4OQ0A 3CZ6A 1Y8RB 2PQ8A 2V1UA 1PJRA 2WAEA 5LHGA 1DY6A 2P9VA 2UZKA 4L6TA 2Y9ZA 4B44A 3AKZA 2EXBA 5FI6A 3MJQA 1ON2A 5ILSA 3CCQI 4XBFA 2BW3B 5B3SH 5A92A 2CYYA 4H4KC 4HP9A 3SH8A 2K9CA 1HDPA 3FMQA 1AU7A 4LV0A 5GL9A 3FXOA 1R7JA 2DLLA 3ZYTA 2L2OA 3WE2A 5LRSA 1WH5A 2P6SA 2F5FA 3S1NJ 5J3WA 2DI3A 1U8RA 1X3WB 4LOCA 4BBRJ 4BNCA 2GZAA 3VFHA 3LMCA 3TO9A 2F48A 2KPMA 2HEOA 3CTAA 1F4KA 1O0TA 2JT6A 1MNDA 4XT2B 1F5TA 3FK6A 1GLNA 2JE5A 2WB1N 3ELKA 5F5YA 2QSFX 4W97A 3IX4A 2XF5A 1XP4A 1RR7A 4A5RA 3DEEA 2V0WA 2GA2A 4L9JA 1KZHA 2VT3A 1BYWA 3N6IA 3DTKA 2CLTA 2P0WA 3DPLC 3ITBA 1KUKA 2VKSA 4HX7A 5GLBA 4K2EA 2Q2EA 4RGRA 3O2PE 1B9MA 3ZMUA 1P7JA 1Y0NA 1NWZA 4A0YA 3S3NA 3EGXC 4X68A 5F27A 1H5XA 4NBQA 3QP6A 4BHBA 4EBPA 1O0QA 1SD4A 2K9QA 2EWWA 3S7PA 2CQXA 3WE3A 5L3FA 1ODVA 1HSJA 3I4PA 3K3CA 1FOKA 3I7JA 4DXCA 2FBKA 5CRFA 2BW3A 1UCRA 2E5ZA 3G2YA 2BYVE 3F1OA 4ENMA 2R7SA 1Q1VA 2XH9A 1O7LA 1G8XA 2DQRA 4BXFA 2DDAA 2Z2MB 4LLNA 5HZHA 1ODDA 4EM2A 1NK2P 2MH9A 4LK0F 1FEXA 1NRFA 4ZBEA 3UB9A 2JA5J 3BLSA 2CS3A 2JT1A 4RM3A 1WPKA 4HPQA 2Y2PA 2V26A 1V5FA 3HRUA 3PNTA 2WGIA 4BQAA 1HKTA 4HH3A 4LV3A 4EXOA 5FEGA 3CCEI 2AIGP 3FWEA 3C18A 1WRJA 1QVUA 1MDMA 4JGRA 2Z5UA 4KIBA 4YIRX 4U7DA 5JVGF 3OPPA 4S2NA 4MO7A 3GFIA 1UGUA 3T8RA 4RA2A 2HJ9C 2PD7A 1BSWA 1FBLA 3F18A 2CV0A 3WGHA 1K79A 1PUFA 1KU3A 2Q2EB 2UXXA 1BIAA 2Z1DA 1LE8A 5GLCA 2Y2NA 3RZOJ 2WKEA 2OCEA 2Y75A 5CQGA 1XAXA 3AYUA 1V3FA 3IBJA 5E43A 5L8MA 1G3WA 1WA9A 1KUGA 1IGNA 5BPAA 3NCKA 1JGSA 1JUSA 4NXFA 1P92A 2V1XA 3CQZJ 1T1AA 1JT6A 1I6XA 4LIVA 2J3TC 2R78A 3WS1A 4IKFA 2DT6A 2JSDA 2NVUB 4GJ4A 2XRNA 4HV5A 4ZC3A 2IP2A 2OUMA 4YG2F 3DL1A 3LWFA 1BW5A 1YSPA 4WMCA 5DCMA 4KYWA 4E7IA 3MD2A 2GXAA 3KEQA 2VGJA 1UEAA 1ZXCA 1VF9A 1X19A 3F8MA 3K4JA 3V4GA 2X48A 4CCNA 3CUOA 5GPAA 4GKUA 5EG0B 2OAQ1 1YLTA 3GXOA 3GFMA 3ZQHA 1ONGA 4OIQF 1VQ6I 3QNCA 2CUJA 5HOOA 3GVBA 5I5LA 4M3FA 2FX0A 3S14J 3H82A 2RJQA 5IT5A 2FXAA 3K7AJ 1DPRA 4FQGA 4C2MJ 4MN5A 1TNTA 5AVFA 5E3LA 2PR6A 5GLAA 3RYRA 2CG4A 1R9TJ 4EETB 3O64A 4ANJA 3IQAA 3OYIA 4ENJA 3BLMA 4AIHA 2GNXA 3HPHA 4PM9A 4B88A 4WXHA 2FQ3A 4FD8A 3MVPA 1V55H 5FSRA 2OW9A 4HNUA 3MA2A 1YLPA 4L7AA 1YRNA 5F64A 3WGIA 3E2KA 5E17F 2BVLA 3NWTA 1WYBA 2G7HA 2HF6A 3EDPA 1G6NA 3BY9A 1JNUA 4KQDA 1YP1A 1ZHFA 4K0XA 3W8KA 3P01A 3GBOA 1T0FC 1LSXA 4JP4A 4ESJA 2PMZN 3MMYB 3B3XA 3PIPF 3IRQA 4LLLA 5TGTA 1TS7A 3GV9A 1GXDA 3DBLB 4IVNA 2I5UA 4XICA 4D1QA 1O3TA 1UG0A 3JREA 3LK8A 5ICEA 1OCZH 2ZQ9A 5B66C 3T4OA 4E70A 4HX4A 3S1RJ 3HPGA 3GTPJ 1K78A 1FR6A 3BQAA 5AQ7A 1D8KA 3BTJA 4E3OA 1GO8P 2PYRA 4Z6YA 3TO6A 3RYPA 4R79A 1W36D 2QBYB 3PIOF 3NOTC 5E2FA 1DU0A 2DPDA 3EQUA 5HDCA 5H6RA 2NAZA 1QZYA 5TRDA 2H1KA 5FFZA 3LKAA 2NOJB 3OZHA 3Q5FA 2HVSA 3HSRA 4LV1A 4DV8A 4EM0B 2STWA 5HWVA 2VQCA 5D6FA 4H82A 1ZG4A 1L0EA 1E3OC 2E8JA 3LUQA 3EDZA 1YRNB 1DP3A 4EJUA 2GXBA 1TDGA 5HLIA 4I3JA 2A2LA 3WHBA 5HS8A 3HJIA 4CTHA 4JPMA 3ONQA 5LRRA 1SU3A 1QICA 3TDUC 1D7EA 1VQ5I 3LSJA 1YLJA 3UE6A 3DPTA 2LR8A 3HRMA 4XKVA 5EF6A 4L5EA 4S2MA 4KNYA 2PMUA 3DLLF 5BMZA 4WLAA 5GLDA 2VC1A 1RM8A 1S72I 1I2SA 3WTYC 3DKXA 1FQGA 2P08A 4LGWA 4O6JA 1K7QA 1XUDA 1H89C 3G31A 2ERPA 1Y28A 5FQQA 3TEDA 1ETXA 2HYJA 3RTYA 4X1LA 2MLKA 4RMNA 2A3UA 1G6AA 4MNRA 2Q9NA 1FNNA 1R1IA 4ZTJA 1MNMC 1WJCA 1ERQA 3FZCA 1V9YA 3ITAA 3KMEA 2IRFG 1FSHA 4PAUA 2E1OA 1RR8C 1ZHHB 2E2DA 5GTIC 1QRYA 2K7SA 4HJ3A 1N9NA 3NI9A 5F0CA 3X2QH 1GA9A 2VZWA 4EM1A 4F92B 4IX7A 1MMSA 2HTJA 3OYDA 2OLUA 2Y2JA 1C3BA 3KEJA 3M6HA 1PWUA 2W15A 5H2FC 4QY6A 3ZXHA 3BTIA 1USNA 1LDDA 3H5RA 1UWPX 2RDPA 1K56D 4BAYA 3ZN0A 5FLVA 4EJOA 2FU4A 1SMTA 1MMBA 2CRGA 1YYVA 2DQLA 3OIQA 1XUCA 4H49A 3ISPA 2ELKA 2DPUA 3H9JA 1VQLI 3DWLE 3KZZA 1ZKGA 1S1YA 1OYYA 2O5RA 2RN7A 4E7LA 1HW2A 5D3CA 1G6OA 4LD5A 2EX9A 3LSIA 4WKIA 2IA2A 1OFCX 5D5XB 2ZQCA 4S2LA 2C6WB 2D45A 5KSHA 1X58A 3LYXA 4EUZA 3UO9A 1A86A 1IXCA 4BQQA 4A3IJ 4NHJA 3LEQA 2OCCH 1IUFA 1TVFA 2BXYA 2DFFA 2EA2A 2Y0SN 2PRFA 3BEBA 5FDSA 3JSOA 1PIOA 1QIAA 3LE9A 3V7CA 1LLBA 4F91B 3TW7A 3HYGA 1W36C 1NLZA 5M1AA 4CLCB 4DF6A 3P24A 3BQ8A 3IH2A 5K5QA 3CUEC 3OHLA 2DDBA 1E3UD 3A3FA 3OCNA 5F1GA 2PLYA 1RUNA 1MDMB 2EQRA 2V2FF 5FO5A 2L5QA 4W1UA 3TE8A 1BR4A 2BV6A 3BFCA 1NG6A 3HB2P 4BHPA 2Y48A 2AHQA 2ZJRF 1FP1D 1OJ5A 3H35A 2AQEA 2JSPA 4HEA2 2TCLA 1KOUA 5BQTA 1RCJA 2X3CA 2H6BA 2EB7A 5DDGA 1YIJI 4DGWB 2M7AA 2LG4A 3OPHA 3WTUC 3V42A 2M3AA 3HUMA 2OV7A 1YMXA 4JBFA 1PZPA 1UWNX 3H7WB 4GQLA 4WF2A 3CF5F 2DJIA 4UHTA 4XIDA 2A68F 3OYAA 2HU6A 4BBUA 1MY8A 1Y1VJ 3V3SA 1QPIA 1JKQC 4N0BA 1J9MA 3M7GA 4AVPA 1VTNC 3PBOA 2H8RA 2X4HA 1XGMA 3O88A 3ZG8B 4D60A 3FBNB 3GTQJ 1XFQA 3NOUC 3P09A 2AYKA 3JW4A 2L0WA 2K5CA 2R93J 3CCMI 2VX8A 4GDNA 3GBGA 1O57A 3PNVA 2JT5A 3CMEI 1VFCA 2E60A 4R1HA 1G9KA 2B9SA 3OWTA 2ZC5B 4L19A 4EMSA 4GHIA 4AUOA 456CA 2KIMA 4E3JA 2LMDA 5K1YA 4HV6A 2JWTA 4FX4A 2OXUA 3E0YA 2Y6CA 2EFWA 3ZQCA 5CX7A 1XN7A 2QKMB 5D6EA 3JRCA 3FG8A 2PN6A 4WMCD 5FDHA 2I9VA 4MGRA 3ERED 3CMYA 4PPRA 3S2HJ 1W1WE 2H1LA 1MBHA 2R7UA 3GZ6A 4GDBA 1FBQA 1KVLA 1MWSA 3Q1FA 5EOEA 4I01A 4G8XA 5GAHJ 3D5LA 5CTMA 1DGRM 5DD8A 5KIZA 1FMVA 3D0SA 4WZ5A 2ZO4A 3JR9A 2J9OA 2PFBA 3RKXA 1F9IA 3QPSA 1RIOH 3UDFA 1YT4A 2OQRA 3HOVJ 3MF0A 3TSKA 2G2WA 3NIAA 2DAOA 2M87A 3E5UA 1A31A 2VKEA 1KE4A 1DRMA 4U0WA 2WYXA 4WWCA 4L0ZB 3IHBA 3BZ6A 1QNTA 2DMUA 4UNOA 1HDDC 4OAZA 2KJBA 4DDYA 4KG6A 1ROSA 1UHMA 5J1RA 3PJRA 1SCWA 4CYCB 2PYPA 3S7OA 4JKTA 4WCGA 4GN2A 4ZYDA 2MZEA 1GDTA 1MMRA 2X3AA 3AAFA 2DOFA 4OMZA 5AQBA 2ZC3B 3M4OJ 1U2WA 2J80A 3C5AA 3IP4B 2L7KA 4IHTA 1XD7A 2W3GA 2XK1A 1IN8A 2QPNA 1UMSA 2X6OA 2ZXIA 2OTLI 2LF7A 4BL3A 3Q2HA 1FBUA 1JUMA 2ZFUA 4FCYA 4UY8I 4DKIA 2OVZA 1XB4A 4A3MJ 1WCMJ 3ZDJA 5L3CA 1IDZA 3BZKA 1IKIA 4EQ1A 3ROUA 4M4XA 2R7DA 5FKKA 4IQ4A 3TBIA 4R70A 4X69A 3JAMZ 3JRBA 4GD8A 2CQNA 1QBJA 1D5VA 2JZYA 2QUFA 2ZD8A 4E4HA 1UMQA 4I6ZA 5IT9Z 3MMHA 4A69C 1IYQA 3E0JB 3K4BA 2XIGA 3ZMZA 1H8ZA 2BTFP 2W25A 2Y9YA 1K6OA 5HDSA 4O0PA 4XUZA 4AC0A 2OY2A 4Q4ZF 4KUKA 1PUEE 2QSGX 3V8JA 1I76A 2FV9A 1VEUB 1B4AA 2M1CA 1QJIA 2FUG2 4B09A 2O0YA 3IXBA 3CUQB 2Y0MA 5J3LA 3B73A 5ICGA 1OJLA 2IA0A 3P5JA 4HESA 1X4OA 3ZG5A 5D1TA 3MZ8A 3OL4A 3ZG7B 2E8IA 4WK8F 3E3VA 2VKDA 4X6TA 1OTEA 1XX2A 3W2AA 2XUBA 3HIFA 2CFXA 1FP2A 1S6RA 5KSCA 5HL1A 5L3EA 4H84A 4M73A 2LP0A 1V4RA 3E6MA 3KZYA 4ZZDA 3F23A 4OIOF 2KZVA 2CH0A 1R1UA 3KEOA 3SZPA 1FJLA 1ZRCA 2P74A 2EA9A 3N2VA 5M19A 1BR1A 2QQ8A 4HBTA 4OMYA 3R60A 1I39A 3FXRA 1FOWA 2P4WA 2HOEA 3DCFA 1YLYA 3PYPA 2HZ5A 3D4FA 4Y0OA 4P55A 3I0TA 5EVIC 3SZTA 4I2OA 1V54H 2IAIA 1W7FA 3CMZA 3K6GA 4Y3IA 2GWRA 1KONA 3ZNYA 3A03A 3KSHA 2E3XA 3SXYA 2DTRA 2LB5A 4M71A 3LY3A 4I0AA 1Z1DA 3SQNA 2L4AA 1MWUA 4JX4A 4CLCA 2NOGA 3SFIA 1HSTA 4JX5A 1GHCA 1VEUA 1VI0A 4ESFA 2LNBA 5HSQA 4G9YA 4MHGA 5D3OA 1UG2A 2R5YB 2KDZA 4NC7A 1SFOJ 3LUMA 2K3PA 3V3RA 3LGPA 4XLPF 2JKTI 2W3FA 1FOXA 2VASA 3HKZN 1YI2I 5KHDA 2MD0A 3HTSB 4OOYA 4OKPA 4PKWA 2F5DA 4HNVA 1XCBA 1ETKA 1SKFA 4Z2YA 5HS9A 2WC2A 1FBSA 1J5YA 3F0CA 2K9NA 1XGOA 4MLOA 2O9CA 4Q1LA 4ZR5A 1YITI 3DQVC 1IV8A 3CJTB 2HQ5A 4DJAA 4OAYA 4ZTKA 5JHFA 1MBKA 1G3YA 1ERDA 5A2QK 3FKVA 4OPQA 3EDHA 5JMYA 3PQJA 1QMEA 1E3PA 5BOXA 5FKNA 1B8YA 3M07A 3A1YA 4JX6A 3WU0A 1ENHA 2OSUA 3K70D 1I1SA 1QUAA 3PUBA 3WS4A 4YFXF 1SFEA 3FXMA 3HZJA 3KYDB 4BD1A 3PAGA 3ECHA 5IP6A 1P4AA 1R23A 3TQNA 1YX5A 1JKPC 3I56I 4IEDA 1PWPA 5DVAA 5CHMA 3SH9A 3T4LA 3LIKA 2AVXA 2IWBA 2PJRA 2TDXA 3UB8A 3SDGA 3ZR8X 3BA0A 3LSTA 1K83J 3L7WA 2FH5A 3G6EI 3FXKA 1MZUA 5EE8A 5E1XA 2NS8A 3VE4A 4Y17A 4R38A 4UEYA 5JLWA 2JJ7A 2QLZA 3AL0C 4LLGF 4RS8A 1TS6A 2O61A 3GLXA 4IVIA 3BFDA 4Y4RA 3AYKA 1W7PD 4X1MA 5DUKA 4UAAA 3MXRA 1PWDA 2NNNA 3DU5A 1TL8A 1HW1A 1SRPA 3RSNA 3VYSB 2L7FP 3PQKA 5ERIA 2HPMA 3KEKA 3T0YA 5K5RA 3BYDA 4ZYAA 1FY7A 2W84A 2J3TD 2AXTC 5L3GA 3PAEA 5DKLA 1W0UA 2RL3A 3M2JA 5AVEA 1YQSA 2M0CA 1BTLA 2JHEA 3OYFA 4BWIA 4EV4A 3DEWA 2K9MA 4BBSJ 3LL7A 4BE2A 1MWTA 3ZVSA 4M3DA 1YM1A 4IBXA 1ITYA 1ETYA 1PNEA 3HHGA 3CDLA 2ZC4B 3DPUA 2XGDA 5LGUA 1K4SA 1QU3A 2IS4A 3LCEA 2PG4A 3E4OA 3PBRA 1LFBA 3ABKH 4L9GA 3LIFA 2M7BA 4IRIA 1TVIA 4H3XA 2CQ7A 3HUGA 2NVTJ 4BMWA 1GXQA 3RPQA 1OT9A 2DMPA 4NQWB 1IUYA 3RKWA 4X6AJ 4RQ9A 1JKYA 3QRFF 3FPVA 4IOAF 4UB8C 5DCFA 5FLXK 1JIZA 1BR2A 2FBIA 4RAFA 2OU2A 3H1CA 3ZOBA 5FD6A 3QPTA 5FRMA 4I7HA 3DW0A 2K3FA 3T4KA 5MC7A 2HQNA 1O3SA 5FAPA 2AQFA 4PJLA 5EOOA 2EV0A 3BG5A 3LA7A 4BACA 3ZN1A 2GIZA 2ZQ7A 1GHPA 3IWOA 3LR0A 1D1CA 3A3IA 1DQUA 5EYRA 2V4JC 1XFVA 3QOEA 1YLZA 2IA1A 2ADUA 3GMEA 5E1ZB 4B93A 3CJQB 1QGPA 2Y79A 2DFIA 3HSFA 4JXVA 4PJMA 4OH0A 3CESA 3TDZC 5HWWA 1ZXVA 1TT5B 5LLQA 1GV5A 1S8NA 3HJKA 4DPEA 4R1GA 4XN0A 4CCMA 5CHJA 3BR5A 5HWTA 4ARZB 2ZB9A 4ETXA 3GCMA 4KQOA 4B1RA 2HGVA 3F1NB 2CWEA 3H82B 5DJTA 1GKDA 1SATA 3DWBA 4XKCA 5F1FA 1ZREA 4MLLA 4WYYA 5BS6A 4PGGA 5GPCA 4IBRA 3K7NA 1IN5A 5CGXA 1MSEC 5DM7F 2H28A 4PK4A 4B9OA 1LJ9A 1QJJA 2A61A 1KBCA 4DBQA 4GD6A 5FQKA 3CWFA 3VP1A 3TVCA 1NY0A 1N75A 3EUHA 2OC6A 2W48A 4M9SA 4XOTA 1STZA 4XR6A 5GADJ 1T38A 2XSSA 1ON1A 2QJ7A 4YFNF 3K69A 3C4OA 2K2GA 1HOMA 2DJNA 1VM1A 4OOMA 3LUNA 3OYBA 3WV2A 1U3EM 1IN4A 4YINA 2LKSA 4DQ2A 2W7NA 1FIAA 2R7XA 2VGLS 5E8IA 3S7NA 2ECCA 5EZGA 2XF3A 2XDMA 2LBFB 2VE8A 4E7JA 3NOPC 1HOVA 1PW1A 4A3KJ 1OTDA 2Z2SB 3BDDA 1JHFA 2QPJA 1ZG5A 1TWGJ 3BRMA 4RLFA 2HTSA 5HNFA 3IXGA 4NXGA 1GVJA 4RB1A 4EGYA 5EVIB 4BENA 2VIXA 2EINH 3R0AA 4ZZLA 1GV2A 2A3SA 2OF7A 2EZKA 2OD5A 1J9IA 1TWAJ 2DK8A 3O87A 3IXDA 3RTSA 2OXWA 5M5YJ 2KDKA 3USNA 3BR2A 1IACA 4GR8A 1WJ5A 1BJAA 3CUQA 4C3HJ 1IG7A 5DTKA 1GO7P 1N9OA 4DE0A 3F1NA 4M6XA 3EYIA 2ACGA 3IF6C 1G49A 2W4SA 3C4PA 2HR3A 5C4JJ 3V8LA 4KMFA 1JI8A 2VEAA 1MMGA 3V7SA 2TRTA 3DPEA 2VOPA 5F69A 1K4FA 4IQJA 2MD5A 2ZC7A 5EV0A 2Q8KA 1SKOB 2QWSA 2X6XA 3J7AY 4F52A 2O99A 3F3XA 1ES2A 1HXDA 2IGMA 3C2HA 3ZQLA 5H6QA 3SJMA 1LB2A 1NZOA 1YLWA 2V1BA 4UA6A 2LSOA 3B42A 3HY9A 3PBSA 5D2BA 3GTKJ 3N2UA 4WM9A 2DRWA 3MKEA 4FH4A 3BWLA 4UA9A 4NNJA 2IW5A 3FKJA 4ZDLA 3REOA 4RYEA 2DODA 9ANTA 1SFXA 4FUWA 1O7FA 5ED4A 3BFFA 2OW2A 1RZ4A 3UPOA 3L0VA 4OIRF 1V5EA 2WTEA 1U8BA 5TGFA 4A5MA 1XFNA 5LGNA 1Z77A 4FISA 1VQPI 4FETA 2X85A 2E2IJ 4HF1A 2IPQX 5IT3A 1FTZA 1N9BA 3IXHA 5C5KA 2X0LA 3CAXA 3OCLA 2WO9A 5I12A 1WWXA 3BQYA 2W57A 1IC8A 2I72A 3I54A 3BFGA 3VP4A 2YUFA 1OZ9A 2VONA 4EU0A 3TG9A 1WQ2A 1TLHB 1OR7C 1DDNA 1WI3A 1ND1A 3W4OA 5JLXA 4WEKA 2ZBBA 3ZMVA 1OPCA 1SAUA 2XAFA 1GCEA 4QD4A 1RUOA 4IUWA 5E20A 1ZS0A 3HEFA 1SVLA 2VBWA 3QAHA 3OIOA 2VODA 3S2DJ 2JVHA 4ZJ3A 2UWXA 1KUIA 4DD8A 1N4OA 2J8YA 1YCMA 2ACJA 1XJ4A 2EZHA 3T4JA 3NBLA 4II3A 5TR7A 3EHYA 2JC7A 4GS9A 4DJ2A 4G6QA 4F3LB 2MLGA 4BS9A 1GHIA 5M5WJ 3OL3A 1Z3JA 4X1EA 5HDKA 5J4YA 4PKYA 4R8HA 2E2HJ 5DUIA 3MWMA 2JA6J 4RA7A 1MMDA 2KP6A 3HDAP 2PMHA 3DTEA 1Z67A 4XLHA 4MQ9F 4QPQA 4EJWA 3HXLA 3IKVA 3S1MJ 5F08A 5DCMB 3Q0VA 2DXIA 3UPPA 3GSGA 4E3IA 2Z3YA 5L10A 2C5WB 3OPRA 3K2NA 2L0RA 2L9SA 2Q1ZB 1SFUA 3BECA 3WS2A 4M3EA 3M1EA 3KP5A 1CGLA 3EUHC 4WXCA 4RM2A 3GECA 5L09A 1P2FA 4RDUA 1TQMA 2VV8A 4Y3OA 2X1CA 4C9YA 2VUMJ 2WOAA 5TBMA 1T1CA 4NETA 3QOPA 2MG4A 1B9NA 4I38A 3HOZJ 4ESBA 1K0KA 1WJFA 1ZTQA 5E1WA 3CJNA 3G1LA 1MH4A 5LHHA 4J01A 2JMWA 3CLQA 3MKZA 3O86A 4UHUA 1EB6A 1QZEA 1S9HA 2DMTA 4NC6A 2XPWA 1G28A 4MQVA 4M9ZA 5A91A 1VZ0A 2Y0SA 1Z9CA 1FOFA 4S2NC 3BP8A 3OV8A 1ZAOA 2VBYA 2HOAA 4G6DA 4WELA 1MKIA 2VLGA 3HB9A 2JRTA 2OAP1 5CUHA 4F3LA 5F6FA 3LSMA 5FAQA 3IH3A 2KISA 2WADA 1ZRFA 2WK0A 3EGDC 5JVTA 3TL4X 1JH1A 5HNHA 4QY5A 5CEDA 3SEQA 3CO7C 2XAUA 1N78A 3G2BA 3IBRA 2FMYA 3JTHA 3NRVA 5K5OA 3IL2A 3IF6A 1LNWA 4BJTA 2ISZA 1NYYA 3OHOA 1TP4A 3CC2I 1MBJA 1RNLA 1SZVA 1LKXA 4LRXC 3MN2A 3T1RA 3UB7A 1LL5A 3WGGA 2GXGA 3S3OA 1IAGA 3WRTA 3JTGA 1R4NB 1Q2PA 2V8FA 4L9FA 4C3QA 1NJ4A 3WS0A 3WS5A 2VK3A 4ARZA 3N8SA 3PSFA 3F17A 1K6RA 3LQQA 3OYNA 3NX7A 3KCCA 3G2ZA 3RKYA 1CK3A 2VT2A 4PJ0C 3KP3A 3KX2A 1HF0A 2QGUA 2LF8A 3AGDA 3OYLA 3MBZA 2Y2QA 4ID4A 4LIUA 4S05A 2XFSA 2FOWA 3O3KA 2PBYA 3GWZA 2QKLB 3L9KA 4OOLA 1TZLA 4U0XA 2ZMEB 5HD3A 1XFYA 2KRJA 2EXAA 1ETWA 4LB6B 3O5YA 2X3BA 3MKWB 2ELJA 3C38A 3K1PA 3F21A 4NXEA 1KU7A 4CO8A 2B0LA 3GEZA 2H8WA 2BGCA 1XKZA 3OSFA 2ZJ9A 3HLCA 1BIWA 3B02A 1XG1A 3WU1B 4HLXA 5LD2C 3VWBA 2BHYA 1CF0A 4QLCU 4WK7A 2X71A 3IF6B 4E6WA 4YEJA 3PTEA 4ZAMA 1LHYA 2K4JA 2ZCWA 2F4IA 3ERMA 1EROA 4ZH4F 4BQMA 3Q2GA 4QPRA 1R55A 3PO2J 5DV5A 1REPC 4A0ZA 2VGKA 4BQOA 3HBRA 1GE7A 1O4XA 3RTRA 3T50A 3LOCA 3FIWA 3I59B 5KCMA 4HRIA 2R7TA 1KAPP 5BOYA 3VYRB 2EZLA 5E8GA 1DP8A 1WHUA 2LBFA 4RB0A 2COMA 2V79A 4WEJA 1Z6TA 2CUZA 3NQOA 4XKBA 4B3XA 3AG1H 2DW1A 3MFXA 2YX4A 5AONA 2OLVA 2D1HA 2DW4A 3A0VA 3HLWA 2O03A 4LG3A 1SHVA 3DBAA 3GF2A 3VYTB 4C3JJ 4CICA 3H0DA 4D9JA 3OYHA 4A3CJ 3RFBA 1CJFA 2DA6A 2F4OB 3H36A 1ZC2A 2ZQ8A 4GLQA 3CC7I 1GT0C 2O9AA 1R71A 1K7GA 5DTTA 2DW2A 2BY0A 2BZTA 2E5NA 4JLFA 2UV0E 3M8EA 2LC2A 1TS8A 4CLCE 2WKHA 4GYGA 4E6XA 3DPFA 5M3MJ 3UY6A 2HQRA 3JRFA 2RNJA 2VJ5A 3T1SA 2V9KA 3CC4I 1W5DA 4XRFA 1H8YA 2EFXA 2Q9MA 3BR3A 2BE5F 1BLHA 3TW8A 1X2MA 2GOXB 2NUTC 1ETQA 1A85A 3SYTA 3EQLF 3JCUC 1VHMA 1ORKA 4A2UA 1L0DA 5HD5A 3T4SA 2DU9A 2M8EA 1SKOA 3E4PA 2MW8A 4MEZA 4MIMA 3W4QA 4FX0A 4K08A 3V39A 5HAPA 1IAEA 3OLOA 3KRYA 4BJ5C 5J8XA 4XM7A 1S1ZA 3ISGA 5EECA 1DJBA 4DDSA 2IGNA 3KSIA 2G9WA 2RVCA 2HP9A 1WJDA 3HKZA 1FLIA 3NEUA 4I98B 1Y6IA 1E17A 1W8QA 1RETA 5I0LA 1EUBA 1NH3A 4J4MA 1IW7F 2NVYJ 2W3EA 5CERA 1S7AA 1ZLKA 4A12A 2Y2OA 4HBUA 1CIZA 2E1MC 1KYZA 4MEYF 4MFEA 3AG4H 2GBYA 3JRGA 4H0EA 3KYZA 3L0TA 2KDOA 1I3QJ 4YIFA 1ZLJA 4EJVA 4WUJA 1MSFC 3OS2A 2VV6A 4JXWA 1GKCA 3H9QA 3E98A 3LQBA 2O6GE 4XT2A 2CSOA 5FL3A 1IAWA 1PWVA 2P5LC 1HZOA 2ZMVA 4ZYGA 5FD5A 1FX7A 3SHFA 3F1OB 2E35A 3C2WA 3KSFA 4RGUA 3HLEA 1D8FA 1S7OA 3D5SC 1D7XA 4A6DA 2Y2KA 4UQIM 1AXBA 2DDFA 2VKHA 3ZUKA 3QYFA 4I3IA 4B47A 966CA 4UV9A 3L2WA 1K25A 3KYEA 3C7VA 1D8MA 1OTIA 5F04A 1YJWI 2HVRA 1B6AA 4HI4A 2X9DA 2LYCA 1ZRDA 1U6GA 1JXSA 3KO6A 4Y7PA 5KVRA 1MMNA 4A3GJ 2Y2ZA 3G5CA 1JTYA 2GQQA 4V2GA 2COBA 1TWHJ 2ZSIB 3L2UA 2QHKA 3UKGA 4CDGA 4IRGA 4LJZF 4IUHA 4S2KA 4S2OA 4IHQA 3C2GA 1ACIA 3GQZA 4I09A 4H76A 3JPUA 1AKHB 3CDHA 4Q47A 2VBXA 2PDRA 2CW8A 3CCSI 4BLMA 2XA7M 1FC3A 1JJ6C 2XPVA 4X0GA 1XGSA 3CD6I 3OS1A 1QVTA 1W7PA 2E1NA 2GX5A 2ZNZA 3EDIA 1BULA 4M72A 1D06A 2GDNA 4OLDA 1JGGA 1MMAA 3I7IA 1YG2A 1KQ9A 4PKVA 3VP2A 1XFXA 3F8FA 4Y33A 2QZ8A 1BUVM 2E34A 2XSJC 1YKDA 1A6IA 3WHCA 1B72A 1OCPA 3WTSC 4UVBA 2L9NA 1ES3A 1RGYA 1UTTA 3G3ZA 830CA 4GRIA 2EWVA 2EK5A 3F8CA 3K4CA 2HXIA 2KIUA 3QQAA 1JT0A 2E71A 1USSA 1BLCA 3ZQFA 1QO0D 1X3ZB 3IH9A 4I02A 5AJGA 2CW7A 1PI5A 5EG0A 2JSCA 3L2VA 5AIQA 3KP6A 4CSWA 1WSUA 4PDKA 2P81A 2UV1A 3DU6A 1K4EA 4L0LA 3ABMH 1VQ8I 5AQAA 2HPBA 1BUEA 3VPRA 2B7EA 4IRHA 3HGYA 3IHUA 2JVGA 3H0GJ 3HOYJ 3AIGA 3HY7A 2GZWA 4FCFA 4BHCA 4EGZA 1K7AA 3BM6A 1D1BA 2JA7J 3C30A 4DN0A 2PJTA 1SMPA 1HKSA 1ESUA 4ITVA 2GA1A 5L07A 3RXWA 1XSXA 3ZVWA 1XMXA 4CXFA 2ZQDA 4RVAA 4BL2A 3AG2H 4B8XA 3WTWC 1DP9A 3H9WA 2OBPA 5LABA 1CQAA 1LI9A 4QIWN 4L0YB 4IO9F 2QZ6A 3GTJJ 1HFCA 4WZ4A 1J2XA 3K4MA 4PFPA 2AO9A 5HDGA 3H92A 4EUVA 1D3YA 3T1QB 4J00A 1FIPA 2JUGA 2Y30A 2LFBA 2W27A 2WO8A 5DKKA 4P87A 3TKYA 3KMCA 3KHIA 3PUFA 3QP5A 3FMSA 3N4IA 3NC8A 1BA5A 1YFHA 2EZIA 1BC7C 2HI3A 1Q2QA 2EFUA 2USNA 3LAPA 4P85A 3K7LA 4GWMA 3Q0UA 1OCTC 2M1BA 4FHTA 4YFKF 3RZDJ 2A5WA 2WKQA 4BEHA 2ZJQF 2CV2A 4S2JA 3DBHB 5C44J 2DT5A 1IF1A 3KE2A 2P7VB 3M3YJ 3MZHA 4Y2FA 1YS6A 4EBNA 1I3AA 2M8GX 1A35A 5EVLA 5FGMA 5J40A 2ZM2A 2JIHA 1ZARA 1QZZA 3K4NA 1POGA 4RB2C 4RAYA 2MJ6A 2O9BA 3U1RA 5FLXZ 1XGNA 5BPIA 1BT5A 2X1DA 3HUNA 1SLNA 4NG2A 1OR7A 4CCKA 3CMMA 2RCXA 2ERQA 4GZBA 5D1UA 4H6JB 1Y39A 5KMWA 4HZFA 2HFHA 3NHQA 3IKTA 3UDIA 2M5WA 1IOUA 3P9KA 2P6TA 1SDNA 3PXPA 1HW5A 2W1TA 1R58A 2UXNA 1V5GA 4U0TA 5HPIA 2BY3A 4M3BA 3TP0A 4KG2A 5K7HA 1AHDP 4HOIA 5CLSA 1K38A 2XR0A 1ZG6A 5IP7J 1ZN2A 3KPHA 5E79C 3ZQ7A 2A6HF 3VYUB 4R0QA 1JK3A 2QMIA 1SMYF 5B1AH 3DWKA 3KFWX 1G68A 4BDZA 3WV3A 1S6LA 3H3UA 2HU9A 3FXJA 4DNCA 2V6EA 3W6VA 2O3FA 1Z6FA 3LR4A 4JXGA 3LIEA 3KWVC 1I73A 1HC8A 4BEHB 4EEUA 1A04A 4GWNA 4DE1A 3V50A 1G4DA 2HZTA 3OR1C 3VI1A 2DFEA 3U4LP 1P4XA 3KIOA 4YELA 4BE1A 2DW0A 4Y5FA 3FC7A 1KU2A 4U3TA 4IN9A 5HDNA 2DNSA 1U0JA 5HFOA 1PVEA 4XLEA 4JPAA 2LOOA 5BOTA 1K56A 3F1PB 4G0DA 1MNCA 4HEFA 3I9V2 4XMYA 2V20A 4I0BA 1BUDA 3DEUA 3FHZA 4L63A 2ZOHA 3CUQC 3V7RA 1XS9A 2XF6A 4DIQA 5CKTA 1TEMA 2RQPA 5CGWA 1YMSA 3HYIA 5FQ9A 3OMYA 4OQGA 4ON1A 3GRJA 4G6TB 3IAM2 3FHNA 4XRSA 1XMKA 3BJNA 1TW2A 2IS6A 2PI0A 3MKFA 3QP4A 1CK7A 1TW3A 2QVOA 2OQGA 4P6ZS 3IWZA 4BBVA 4PSWA 5EEHA 3ULQB 4AIGA 1S3JA 1CI8A 1JTGA 3NECA 4PCQA 1EI5A 4M74A 3NDEA 1W5TA 3CCVI 2B18A 5C4XJ 2D1NA 2ZBKA 5GP9A 4A0XA 3MXQA 3TRCA 3DKYA 2EJRA 1JTXA 1WH7A 2QQBA 3S15J 3RJUA 1GSWA 2LKPA 3CDIA 5KAIC 5KAFC 2P9VB 4E04A 1K54C 4DXBA 3L2CA 3K0LA 3S93A 5M3FJ 4ENNA 1D8JA 2EFNA 2B02A 2XHKA 1ONVA 2AS5F 4U0YA 3FM3A 3QYEA 1BC8C 4II7A 2BOLA 1BL0A 1MPLA 2DA5A 3A3EA 5CJ9A 4KA4A 3HJEA 5CGSA 5E3OA 2V1DA 1R22A 4BKXA 4N4OB 2OW0A 2SRTA 2L0KA 3G35A 4KICA 1ERMA 4BE0A 3QYBA 4KIFA 3SZGA 3LFKA 4HA8A 1XSVA 4QWQA 5L3BA 2HP5A 1U9NA 3LSPA 2V1ZA 3T4TA 1TD5A 2XFTA 3G6OA 1X4PA 3WTVC 1JANA 5G4YA 1XDSA 3ZP5A 2J0TA 2IEKA 2Z2DA 3ZGKA 3VEPA 2XRLA 3A2KA 4WKEA 1BKCI 4Q5SF 1R5GA 3L00A 2NRAC 3OYEA 1XGIA 1BI0A 3CKIA 3LQRA 1P0ZA 5D5VB 2OWHA 4AYKA 2P5VA 2QENA 3BROA 4DW6A 3HLDA 2R7WA 2CFOA 1D5JA 1MJBA 5D8KB 2W85A 4XM3A 1YJNI 3CITA 3K3DA 1MBLA 2VJWA 3F19A 1EA3A 2L9VA 2POJA 4DYCA 3R0JA 5CVRA 2A07F 1O3RA 2D02A 3J81Z 1PRQA 3M8FA 3RH8B 4IHYA 4NQWA 1R5ID 2D5VA 3W6KB 2K85A 1QPMA 2CUEA 3I3LA 4PJNA 5K5BA 4BBTA 3D72A 2WV0A 4FE7A 3U1KA 2KZGA 1W79A 5BPDA 2VPLA 3DWZA 2VJJA 1KQ8A 3EHXA 4G94A 3FXQA 1OKRA 2ELHA 3TW6A 5LFAA 2UWMA 1ES5A 3CZDA 4WL9A 4GF1A 2V6CA 2V9PA 2O8KA 1XXMA 3G30A 4O01A 1N77A 5I3MA 3FZVA 1Y56A 3IWFA 3MZDA 3BG7A 5G4ZA 2XROA 2Z16A 4L5JA 2WGWB 4RAGA 2EFOA 5FKMA 1CEGA 4R3BA 1HLUP 1ZH5A 1KDSA 4BL0B
chains in the Genus database with same CATH topology
4PUSA 2OUMA 4IQJA 2OZRA 2WB1A 4E7IA 2X6XA 3MD2A 3J7AY 4F52A 2R7VA 1UEAA 1ZXCA 3ELMA 4P1WA 4FVLA 1X19A 2IGMA 3C2HA 3TMOA 3K4JA 5I43A 4XORA 3HY9A 4CCNA 1R54A 1IABA 1JAPA 5D2BA 4XNFA 5CZMA 3N2UA 2VXZA 3DLAA 2XC7A 4WKIA 2M4GA 2CUJA 5HOOA 4NNJA 4EFSA 5CPRB 4E7HA 3FKJA 4ZDLA 4FXQA 3ZRGA 3HC7A 1DGWY 1P9QC 2HPIA 1JAQA 3O64A 5D1SA 2JSDA 2OW2A 4XN3A 4ANJA 2YIGA 3OYIA 3L0VA 1V5EA 3HPHA 3KMEA 3LSGA 2OW9A 1BOBA 4L7AA 4HNUA 3MA2A 3OYMA 1MMPA 2XF7A 2BVLA 2VJ4A 2X85A 3NWTA 4FETA 4LITA 4XONA 2N8RA 2RJQA 2WO9A 5CXAA 5I12A 3BLYA 4NUBA 3B2ZA 3CF2A 1MMQA 5I4OA 1FM1A 2YUFA 4R3VA 3OYCA 2D1OA 2MABA 2IXSA 1OR7C 1YP1A 2IS2A 3EDGA 4JP4A 1ND1A 3GBOA 4JOMA 1T0FC 3MMYB 3LQ0A 3LILA 1SAUA 4IUWA 1R1JA 1GXDA 5TGTA 1UMTA 1ZS0A 4D1QA 1X1AA 3S8PA 1UG0A 2PJRB 1ASTA 1HY7A 3LK8A 2JVHA 4CCJA 1ZP5A 1WJAA 1KUIA 1MW7A 2MLSA 1IAAA 3HPGA 4DD8A 1GO8P 1YCMA 4R79A 4II3A 1W36D 3EHYA 1HFSA 3M8JA 3HBUP 2R7OA 4BS9A 3W3CA 3VDXA 3OL3A 1Z3JA 2KRHA 2A8HA 3LKAA 2NOJB 2HVSA 4PKRA 1MMDA 2KP6A 4DV8A 3DTEA 4XLHA 4H30A 2DDYA 4QPQA 3HXLA 2OY4A 4XM8A 2VQCA 2DXIA 4H82A 1AF0A 3EDZA 1DP3A 2L0RA 2L9SA 2MFZA 2Q1ZB 4PFOA 4CTHA 2HVQA 3ONQA 3BCAA 1SU3A 1QICA 1CGLA 5KNLA 3EUHC 1S4BP 3DPTA 4RM2A 1TT0A 4XKVA 1Y0VA 4C30A 4GUYA 1WJBA 2X1CA 4Y3OA 4C9YA 1X1DA 2WOAA 3UR3C 1RM8A 1K7QA 3DKXA 2UUZA 3SDBA 1XUDA 4OWRB 2I47A 2ERPA 3BG6A 3KECA 4HNTA 4CUGA 1WJFA 1YX3A 1OM7A 2I8DA 1ZTQA 4RMNA 1G12A 4J01A 3MKZA 1EB6A 1S9HA 4WZVA 1R1IA 1KUHA 3MKYB 4ZTJA 1OS9A 1VZ0A 2R7QA 1WJCA 2Y0SA 4XBHA 2WA0A 1DTHA 3K4KA 1ZVXA 2E2DA 2LREA 2IGKA 1BKCA 5CUHA 3EWJA 2WAFA 2VQGA 4F55A 3LSMA 2W13A 4AYKA 4PKSA 1CGFA 2KQRA 2WADA 2X6YA 3W2VA 4F92B 4IX7A 3TL4X 1JH1A 5HNHA 3PSIA 3OYDA 3SEQA 4GR3A 2XAUA 1N78A 3G2BA 1J7NA 1PWUA 2W15A 3KEJA 4BJTA 4F93B 1USNA 3H5RA 3B8ZA 3OHOA 3K70C 4QKZA 3ZXHA 1LKXA 1MMBA 4XQFA 1IAGA 3S3OA 3OIQA 3DNGA 1XUCA 4H49A 2JNPA 2DCEA 2OXZA 5B5OA 4E7SA 1PWQA 3IUOA 3H9JA 3VSLA 3DWLE 4E7LA 2O5RA 1L6JA 5D3CA 4A7BA 4XL9A 3LIRA 1X1CA 3LSIA 2VXDA 3PSFA 3F17A 2LH9A 2W00A 3N2VA 1A86A 3OYNA 1MNEA 4BQQA 3S32A 2RNGA 1UTZA 1UTTA 3KX2A 5HVQC 1WNIA 1QIAA 3OYLA 1OM8A 4LIUA 4JQGA 3DTIA 2J83A 2VB6A 3LE9A 2QKLB 4F91B 1TZLA 1HA8A 1XFYA 3HYGA 1W36C 2KRJA 3A4CA 3OYGA 3P24A 2X3BA 3MKWB 2ELJA 2OVXA 3OHLA 3LJZA 3QODA 1EAKA 2L5QA 3TS4A 1BR4A 5LD2C 3VWBA 1NG6A 3HB2P 3TT4A 2VQHA 4G9LA 3S3MA 3RQ4A 4WK7A 3H35A 2AQEA 1X1BA 2JSPA 4HEA2 4YEJA 4U7BA 2TCLA 4H1QA 2X3CA 2WY8Q 3IAS2 2F4IA 3BCBA 2KHMA 3O2XA 3Q2GA 4DGWB 5HLTA 1R55A 4IJOA 2M7AA 5FROA 2LG4A 3KEYA 4BQOA 3V42A 1NG7A 3AL0B 2K9LA 2M3AA 1GE7A 4I03A 2OV7A 4GQLA 3RTRA 5KCMA 4HRIA 2R7TA 1G59A 1KAPP 5BOYA 1HV5A 2DJIA 3VYRB 2E1MB 4JA1A 3OYAA 1B3DA 2HU6A 2LBFA 3H5AA 3EUAA 2CUZA 4A3WA 4XKBA 1QIBA 1I1IP 4QPOA 4B3XA 2WAQA 3EUKL 2DW1A 3LMMA 1OMJA 3M1CA 3FBNB 4XLFA 4U87A 4HSRA 4LG3A 1BQOA 2AYKA 2K5CA 3VYTB 3H0DA 4D9JA 4C2UA 3OYHA 3GBGA 3PNVA 1R6RA 2JT5A 3LSKA 1BZSA 2E60A 2DW2A 2DT7B 1D1AA 1G9KA 4HG2A 1K7GA 2PJTA 3OWTA 3NX7A 4L19A 2E5NA 2XS3A 2FV5A 456CA 4AUOA 2LC2A 2BVMA 2OXUA 3DPFA 2Y6CA 4RLQA 2VJ5A 2PMZA 2V9KA 2QKMB 5H8XA 4ILWD 3HDAP 3AFHA 4II2A 2GOXB 1DMTA 1A85A 3SYTA 1Y8JA 1Y93A 3AIGA 2R7UA 1C8TA 2VJIA 3D5RC 3HL2A 2V1NA 1YOUA 3D5LA 3OR2C 1DGRM 1QHHD 4CA0A 1IAEA 1SFKA 4BJ5C 1FMVA 1OO9A 1XFUA 1G05A 3KRYA 4XM7A 2CV1A 2IGNA 2F5VA 3ZQQA 1WJDA 1LVKA 1Z3YA 3HKZA 1LFPA 4XOPA 1Y6IA 1EUBA 3TSKA 1JIWP 5I0LA 4J4MA 5B5PA 1CIZA 3HDBA 2E1MC 2M4KA 1D0ZA 4AU7A 4PKQA 4OAZA 3L0TA 2KDOA 1JAOA 1ROSA 1D0YA 3PJRA 5CQEA 3OS2A 1GKCA 3LQBA 3H9QA 4H2EA 3WV1A 1PWVA 1BM6A 2MYSA 2LY2A 2MZEA 1MMRA 2X3AA 3VSKA 1G4KA 2O3EA 1D8FA 3IP4B 3D5SC 1D7XA 4BGDA 2L7KA 4E7KA 1Q3AA 1CAQA 2DDFA 2VKHA 4CH7A 3QYFA 4EATA 4KT6A 3N05A 4B47A 4ZDOA 1T95A 2ZXIA 1UMSA 3DSLA 966CA 3L2WA 1LDKB 2ZFUA 1D8MA 2OVZA 3Q2HA 5D7WA 3SHIA 4CCLA 2LRDA 2R4GA 4PJJA 2HVRA 4AXQA 5FRNA 2LYCA 4FU4A 3ZCOA 3PFYA 3FDYA 4IQ4A 1YE9A 3TBIA 1MMNA 2KLOA 3U21A 1K6YA 3G5CA 2ZSIB 2F6CA 1CQRA 3L2UA 4E4HA 2WBMA 5I2ZA 3E0JB 3C2GA 3K4BA 4H76A 4KISA 2MZIA 1IRXA 3KYLA 4JQFA 2OY2A 2CW8A 1J09A 2ZSHB 1PYVA 4NC8A 4X0GA 4DF9A 1I76A 2FV9A 3OS1A 2V7FA 1QJIA 2FUG2 3EDIA 3LJGA 1XFZA 4E7ZA 4ZTFA 4HMAA 1MMAA 2LY1A 3I7IA 3V96B 3UVCA 1D0XA 1WJEA 1X4OA 4PKVA 5D1TA 1XFXA 1AKLA 4Y33A 4BU2A 3OL4A 3LEAA 1BUVM 1Z7LA 4B43A 2VKDA 3OIPA 2XSJC 2Y6DA 3W2AA 4KITB 2L9NA 2V4BA 2EROA 4H84A 830CA 4GRIA 3P1VA 1UELB 1WFXA 2DOAA 2IGOA 3K4CA 1BQQM 3OOUA 3OY9A 2KZVA 2CH0A 1JJ9A 2CW7A 3CP2A 1BIWA 3L2VA 4CSWA 2MZHA 1BR1A 2UV1A 3DU6A 1YQYA 3F16A 3SEZA 4AYBA 3F1AA 3ZUKA 4BUPA 2OW1A 2JVGA 1H71P 3OYKA 3HY7A 3E1SA 3OYJA 2JA2A 3K6GA 3RTTA 2X1EA 1D1BA 3E8RA 4XCTA 2W82A 1KONA 1FMWA 2E3XA 1SMPA 4ITVA 2WY7Q 2CMPA 1AA7A 4HSTA 4DBRA 2RQQA 1OS2A 3FBIB 5LABA 3W2WA 4B48A 1UAAA 1ZELA 1HFCA 4NC7A 3K4MA 2MC4A 4PFPA 3L2QA 4XLCA 4E6KG 3LUMA 2K3PA 3LGPA 2VASA 4J00A 1K7IA 2JUGA 4JIJA 4BQNA 2MD0A 5KHDA 2WO8A 4GR0A 4PKWA 3KMCA 3BC8A 3KHIA 3NWSA 2IS1A 4PSXA 2X51A 2USNA 1C7KA 4MLOA 3K7LA 4GWMA 4Q1LA 4ZR5A 3DQVC 4XLAA 2A5WA 5L79A 4BEHA 4P5OA 4DJAA 3OS0A 2CV2A 1E0EA 4OAYA 5JHFA 1MMGA 3EDHA 1ERDA 5JMYA 1GE5A 4ZJZA 1B8YA 3A1YA 1CGEA 2JIHA 3K4NA 4I35A 4BJ6C 3K70D 3U1RA 1QUAA 3PUBA 3ZXSA 1C3IA 1HTDA 4WF6A 2X1DA 2VLAA 1SLNA 4CCKA 1YX5A 3CMMA 3K4LA 2ERQA 1PWPA 2OI0A 3F15A 3HUGB 5D1UA 3LIKA 4XKWA 2PJRA 2MLRA 2KMUA 4FXYP 3ZR8X 4N4NB 2W12A 3BA0A 4CCOA 2ZXHA 3VTGA 1V5GA 2X7MA 1XFWA 4BDYA 1R1HA 4AVZA 3AL0C 2X6WA 3VYUB 3AYKA 3HG9A 4Y4RA 1JK3A 4IZZA 1PWWA 2KRCA 4ZDPA 4BDZA 3WV3A 3DU5A 1SRPA 3LJTA 3RSNA 3VYSB 3KEKA 2HU9A 3CP8A 3K10A 3PL8A 2HPMA 2V6EA 3G42A 4ZYAA 3H5NA 1Z21A 3B92A 3HOSA 3KWVC 1I73A 4BEHB 4GWNA 3OYFA 4YRVA 2RJPA 3OR1C 2K9MA 3CZ6A 3LL7A 4BE2A 1PJRA 2WAEA 3VI1A 2HZDA 4L6TA 3ZVSA 4YELA 4B44A 2HNHA 3AKZA 4BE1A 3DPUA 1FLSA 1OM6A 2DW0A 4HX3A 1QU3A 2IS4A 2BW3B 4IN9A 4PKTA 4H4KC 1U0JA 2VL8A 2K9CA 4PKUA 2M7BA 4XLEA 4JPAA 2LOOA 4H3XA 5BOTA 1AYKA 2L2OA 4G0DA 1MNCA 3I9V2 4NQWB 4XMYA 2VQLA 1JKYA 3LMCA 2KPMA 1BUDA 2A6TA 1QHGA 1O0TA 4L63A 1JIZA 1BR2A 2XF6A 5CKTA 4DIQA 1MNDA 5FRMA 1BKCE 1GE6A 3F9KA 1GLNA 2JT6A 2O36A 3OMYA 2W0DA 1ATLA 4ON1A 2RREA 4G6TB 2XF5A 3IAM2 2AQFA 3DEEA 3FHNA 4PJLA 2IS6A 1CK7A 2CLTA 3DTKA 2P0WA 3DPLC 4BACA 1KUKA 2HQAA 4PSWA 3EPZA 4AIGA 2W1OA 1D1CA 1DQUA 2V4JC 3LFUA 3PNYA 3CJRB 3QOEA 1XFVA 2D1NA 3CJQB 3HOTA 3S3NA 1XURA 3DKYA 1CXVA 4PJMA 3H9GA 3CESA 1ZXVA 1O0QA 1KUFA 3LSHA 4DPEA 3S93A 4XN0A 4CCMA 3I7GA 3QYEA 4XM6A 2CKIA 2BOLA 2BW3A 1SATA 3DWBA 1GKDA 3HBVP 2E5ZA 2KL4A 4XKCA 2SRTA 1Z3XA 4N4OB 4CZCA 2R7SA 2OW0A 3K7NA 1G8XA 4BE0A 3QYBA 3SZGA 4BXFA 4PK4A 1QJJA 3RCOA 1KBCA 4DBQA 3TVCA 1RMZA 1N75A 4KJZA 1JANA 1X4PA 2CS3A 2OC6A 4XOTA 4RM3A 4XR6A 4FASD 4HPQA 2J0TA 2V26A 1V5FA 3PNTA 2Z2DA 2K2GA 3ZGKA 3A2KA 4WKEA 2AIGP 3WV2A 4C2TA 3OYBA 1BKCI 2XS4A 3LUNA 5L7FA 3OYEA 3CKIA 3UNGC 1OLTA 4F3QA 2W7NA 2R7XA 1IADA 2M0MA 1HOVA 1BSWA 1FBLA 2R7WA 2CFOA 2LBFB 4E7JA 1D5JA 4XM3A 2CV0A 3F18A 2QPJA 2Z2SB 2YB9A 3F19A 1EA3A 2POJA 2Q2EB 2HDWA 4RLFA 2Z1DA 5HNFA 3L2RA 3RPUD 2VIXA 4PJNA 3I3LA 5CQGA 3AYUA 3RTSA 2OXWA 2R7RA 1KUGA 2VPLA 1SLMA 2W14A 2VJJA 3EHXA 3USNA 5BPAA 2UWMA 5LFAA 1IACA 4GF1A 1WJ5A 4DOZA 4GR8A 1GO7P 2GOMA 1N77A 5I3MA 1G49A 1Y56A 2XDVA 2W4SA 3BG7A 4LIVA 1JI8A 2Z16A 4IKFA 2DT6A 3DPEA 3DL1A 4ZC3A 4BL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTE A;  3DTI A; 
#chains in the Genus database with same CATH topology
 1B1B A;  2NVX J;  3QPL A;  3MKL A;  5HLG A;  1B8I A;  2QSH X;  4HY8 A;  2WB1 A;  3D1N I;  1IYP A;  5E2G A;  2R7V A;  2XGN A;  3ELM A;  1YAX A;  4P1W A;  3FMR A;  3TMO A;  4XOR A;  5DF7 A;  3O6B B;  1K78 B;  2QWW A;  1FYM A;  1LI0 A;  1TTY A;  2ZME C;  4XNF A;  3MR0 A;  4P6B A;  1C0W A;  3G34 A;  3I4N J;  2XAJ A;  3GO5 A;  2XPU A;  2XC7 A;  3GTG J;  3LR5 A;  2MH2 A;  2E19 A;  1P4W A;  3Q82 A;  4A3D J;  4Q0I A;  1BJZ A;  5CPR B;  4E7H A;  4QHC A;  5F82 A;  2OTJ I;  3E7L A;  5TBM B;  2FBH A;  3IF5 A;  4HYE A;  4FXQ A;  5HOD A;  1JAQ A;  1P9Q C;  4XXR A;  4CYD A;  1MBF A;  3OSG A;  4N9H A;  1YOV B;  2YU9 J;  3ASN H;  3Q9V A;  4XSZ F;  1IEL A;  5E3M A;  5JYP A;  1XA1 A;  3LSG A;  3R7W A;  4Y52 J;  1J3W A;  4RGX A;  5GAE J;  3I5U A;  1JKO C;  2ZC2 A;  2NUP C;  1Z05 A;  1MMP A;  3S1Y A;  2XF7 A;  3Q9S A;  2VJ4 A;  4XON A;  4BY7 J;  1WE4 A;  2PU2 A;  4L9T A;  3BT9 A;  5GHY A;  3TJZ C;  5CXA A;  4NUB A;  1YW8 A;  5HAQ A;  2HGC A;  3CF2 A;  1FM1 A;  3UME A;  3OYC A;  1N9L A;  2D1O A;  5J47 A;  2EIM H;  2YS9 A;  1EKE A;  1A5J A;  1E4D A;  2IXS A;  3JSP A;  2BBY A;  3EDG A;  1K57 C;  2EBI A;  1ZG3 A;  3SFZ A;  2HYF A;  3KSG A;  5D8L B;  4O3M A;  4HW0 A;  1IFQ A;  2P04 A;  3LIL A;  2HP6 A;  2Z6D A;  3LQ0 A;  1R1J A;  2EFQ A;  1E3H A;  4FSF A;  1CQT A;  6PAX A;  5F0H A;  1X1A A;  3S8P A;  1T2K A;  2FEZ A;  2DMQ A;  3T5X A;  4GNU A;  1HY7 A;  1VQ4 I;  5HS7 A;  1MW7 A;  1ESI A;  4JXS A;  3ZNT A;  2FQ4 A;  4KN4 X;  5U47 A;  2A49 A;  2R5Z A;  4UVC A;  4GCV A;  1HFS A;  2GM4 A;  4ZYE A;  4XLN F;  2Z9O A;  1ZGJ A;  4HH2 A;  3J80 Z;  1EV7 A;  2DTZ A;  4NKP A;  3HBU P;  3W3C A;  2JRM A;  2KRH A;  2A8H A;  4H30 A;  4A3J J;  3GLL A;  1E25 A;  2OY4 A;  1Z7U A;  5DS9 A;  3WU2 C;  2PT7 A;  1VQ7 I;  1RC9 A;  3MSH A;  1H8A C;  1AF0 A;  4AID A;  1HKQ A;  3E6B A;  4EFS A;  4PFO A;  2ETH A;  4MBF A;  2HVQ A;  1ZK8 A;  3BCA A;  5I43 A;  3QHY A;  4KN7 X;  1TT0 A;  1ETV A;  5J6X A;  4C30 A;  4G3K A;  3ZQG A;  1WJB A;  2ZXJ A;  3CMA I;  5F68 A;  5IU1 A;  4UUT A;  4R3A A;  3RJP A;  2FJ1 A;  5FI7 A;  2UUZ A;  4MTE A;  3SDB A;  4OWR B;  2I47 A;  2A24 B;  3KEC A;  4HNT A;  4CUG A;  5FKL A;  1H0M A;  1OM7 A;  2I8D A;  2K7L A;  2BY2 A;  3IH8 A;  1G12 A;  5M18 A;  4X25 A;  3VOZ A;  1XMA A;  2CJJ A;  1KUH A;  3H3V K;  1WI9 A;  3A0B C;  4NXB A;  3JRH A;  4XBH A;  3HHH A;  1RI7 A;  1W5S A;  3AGF A;  1FCM A;  1S4R A;  1DTH A;  1VQO I;  2MGQ A;  4D7M A;  3BR1 A;  2H10 A;  1TNS A;  4XUX A;  3KP4 A;  2VQG A;  4F55 A;  1DU6 A;  4H8R A;  5A8B A;  2W13 A;  4L18 B;  3S7Q A;  1I5Z A;  3BR6 A;  2KQR A;  5ILU A;  1LEB A;  1CGF A;  4PKS A;  3IS2 A;  3VB2 A;  4A3F J;  4KDP A;  4JF6 A;  1SAN A;  4GR3 A;  2BEO A;  1AWC A;  2X01 A;  1H9T A;  2XV4 S;  2MA3 A;  1F98 A;  1S0W A;  4F93 B;  1T18 A;  4KZ5 A;  1S29 A;  4DJ3 A;  3E4Q A;  4HHD A;  3B8Z A;  4QKZ A;  1UST A;  3EET A;  1O07 A;  1WVR A;  1EH8 A;  1BIB A;  1R4M B;  2IWD A;  2KOI A;  5B5O A;  2B5R A;  1UHS A;  3VSL A;  2CU7 A;  3F6O A;  5CTN A;  2NS7 A;  3C1D A;  1IDY A;  3LEZ A;  1NXY A;  3LIR A;  1X1C A;  2AXL A;  1RGZ A;  2DCF A;  2VXD A;  1FTT A;  4M3K A;  3ZPL A;  2W00 A;  1D1J A;  2D1V A;  1JJ8 C;  4OON A;  4YFM A;  2EFP A;  2M2E A;  2RNG A;  2JCH A;  1UTZ A;  1UFM A;  4BXX J;  3VOY A;  1DJC A;  3GZ5 A;  3KLN A;  3LIB A;  1WNI A;  4K91 A;  3QP1 A;  4QTR A;  4O8G A;  5L2F A;  3L7H A;  3DTI A;  4JQG A;  4GXO A;  3BJO A;  1GHM A;  1RES A;  3GFJ A;  5D5U B;  1QMF A;  2H5S A;  2HJE A;  3KET A;  2KKO A;  3I55 I;  4WXD A;  4N9K A;  4FTH A;  2OVX A;  3EOI A;  1EH7 A;  3LJZ A;  2L7M P;  2O8X A;  2RV8 A;  3BOQ A;  4OU0 A;  3FIS A;  3QOD A;  3HOW J;  1R00 A;  3R61 A;  4MFD A;  3HRE A;  3UPN A;  1J0R A;  2ICW G;  5EVI D;  2OAZ A;  3WTZ A;  3CHW P;  2GJ3 A;  3TT4 A;  2VQH A;  2OPT A;  5IP9 J;  3F6V A;  2FFF B;  4GW9 A;  2ESN A;  5EDN A;  3S22 A;  1OIS A;  1LDJ A;  1X1B A;  1YIO A;  4LMY A;  4U7B A;  2KX6 A;  2Z2L B;  3W4P A;  1LE8 B;  3IAS 2;  3O2X A;  3BCB A;  2PBI A;  3VOE A;  3SS5 A;  1I50 J;  5HLT A;  3G1M A;  1H8M A;  3BFE A;  1YHQ I;  5HX9 A;  1LL8 A;  4IJO A;  3IT9 A;  2WKI A;  3AL0 B;  5J8C A;  2GLO A;  5K7Z A;  4I03 A;  3RIR A;  1K4T A;  1JVJ A;  5FQI A;  1IO2 A;  5E3N A;  2D01 A;  3O8G A;  1G59 A;  1J7K A;  3HVF A;  2E1M B;  3J7Y J;  2J5P A;  1ALQ A;  3H5A A;  1MGT A;  1BSG A;  4BH9 A;  3ZHH A;  4QPO A;  4KZ3 A;  2WAQ A;  3EUK L;  1OMJ A;  4GGG A;  4HSR A;  1BQO A;  1BI2 A;  2R3S A;  5F83 A;  4AIJ A;  2JKF A;  1M40 A;  1MBE A;  1D1A A;  1U5T B;  2DT7 B;  2QYO A;  5FAS A;  1MBG A;  2LTP A;  1QA6 A;  4V19 K;  4PMA A;  2FV5 A;  1PWG A;  3UN7 A;  1LPQ A;  3E6D A;  3QWL A;  4RGS A;  4CJN A;  2ZQA A;  1PP7 U;  4Y0T A;  4IXA A;  2F5C A;  1F5M A;  1JKR C;  1T19 A;  3AFH A;  4II2 A;  3D9Y A;  3Q07 A;  2Z33 A;  3Q7V B;  4OQH A;  2M30 A;  4ME4 A;  3E5Q A;  5EUA A;  4Y13 A;  4QSH A;  1S4S A;  2HOS A;  1C8T A;  4GCZ A;  3D5R C;  3IRR A;  1DP6 A;  1GUU A;  3CG5 A;  5CEC A;  4CHU A;  2V1N A;  2G0E A;  4CA0 A;  3I7G A;  1QHH D;  2L3D A;  3BPV A;  3JVU A;  1XA7 A;  1NTC A;  1KDW A;  3HUO A;  5HL6 A;  2IT0 A;  1OCC H;  2F5V A;  1VQN I;  1W4M A;  3PFI A;  1IN7 A;  2JK3 A;  5JR3 A;  1LFP A;  5H20 A;  4XOP A;  1LSV A;  2PEX A;  4AD9 A;  1TWC J;  3OPL A;  1OMI A;  1SVO A;  1L3L A;  3FYZ A;  3FXU A;  1KVM A;  4OPY A;  3I71 A;  4BD0 A;  1FZP B;  3PBQ A;  3RI4 A;  1F43 A;  2ME6 A;  3HDB A;  5GTH C;  4Q48 A;  1W5C C;  4P96 A;  1D0Z A;  4AU7 A;  1UB9 A;  5HLH A;  1LUJ B;  4G7O F;  3P7N A;  3PBN A;  1RRJ A;  1IJW C;  4PKQ A;  1F9N A;  1JAO A;  4ZDX A;  3UE1 A;  4ASN A;  1D0Y A;  4UVA A;  3DXJ F;  2WZZ A;  4XSX F;  5CQE A;  1CF7 A;  3PR6 A;  4XM6 A;  2K86 A;  3ZMT A;  3BTL A;  4DE2 A;  3N8R A;  4B4C A;  3EWK A;  1Y54 A;  1EJ9 A;  1NZU A;  2PU4 A;  3WV1 A;  1BM6 A;  3FKW A;  4MEX F;  3A02 A;  2DA1 A;  2MYS A;  1HLV A;  1LEA A;  2ISY A;  1RP5 A;  2ZM0 A;  3BTC A;  1O7E A;  3B6A A;  3VSK A;  1SD5 A;  1ZTU A;  2V1A A;  1ZGW A;  2ZMF A;  4L9E A;  5IHV A;  2GAU A;  1G4K A;  2K4B A;  4BGD A;  5FFX A;  4E7K A;  2K27 A;  1CEF A;  2Y2I A;  1Q3A A;  1JWV A;  1M1E B;  2F4M B;  2NYX A;  3GUD A;  4KT6 A;  2VI6 A;  2ZFW A;  4ZDO A;  2PD8 A;  3CPT B;  3DSL A;  2C6Y A;  2J3W A;  5LBQ A;  4PHT A;  2M9H A;  4CCL A;  2Y59 A;  2R4G A;  3J80 K;  3QP2 A;  2DK5 A;  2HDC A;  5FRN A;  1LT0 A;  3ZCO A;  4E3M A;  2R5Z B;  5TIS C;  3HRT A;  5L3D A;  3IH4 A;  2LVS A;  4DRT A;  3K1M A;  5FI2 A;  3N97 A;  2M7V A;  5CEB A;  2KLO A;  1K6Y A;  1R1V A;  1TWF J;  1Y8Q B;  2EX2 A;  3A0R A;  4L9V A;  3O8H A;  5FAO A;  1KQ0 A;  1CQR A;  2XKP A;  1XM5 A;  4KIG A;  2DA3 A;  2WBM A;  1VQM I;  1PDN C;  2HYG D;  3NAR A;  4KIS A;  4RX2 A;  3CCU I;  4ABZ A;  1PZO A;  2J7V A;  1IRX A;  2H94 A;  3MFK A;  1TDL A;  4Z9Q A;  5KZH A;  3DF8 A;  4F7Z A;  1BLS A;  3GTM J;  3IWI A;  2N8G A;  2ZSH B;  1PYV A;  3BY6 A;  3J81 K;  3C7U A;  1GVD A;  2CO5 A;  3B47 A;  1U78 A;  3LJG A;  4X56 A;  3A0H C;  1T1B A;  1XFZ A;  2VKV A;  5HPF A;  4HF2 A;  4MMN A;  3V96 B;  2Y69 H;  1WZ2 A;  1WJE A;  2JUC A;  1ZG1 A;  1VET B;  4HOB A;  1AKL A;  4BY1 J;  4JGP A;  3N4M A;  5B1B H;  2BLS A;  4KT5 C;  4EJT A;  3OIP A;  4AUX A;  2XAQ A;  1K57 A;  2Y6D A;  5IY5 H;  1IZ1 A;  4JF4 A;  2K40 A;  3ZMS A;  4KIT B;  4I76 A;  3CPT A;  1XJ2 A;  2ERO A;  4GDF A;  2LB9 A;  3WRZ A;  3P1V A;  3MFD A;  3OOU A;  3HOX J;  4G7H F;  2R7Z J;  4YOF A;  1YW9 A;  5JHU A;  1OCR H;  3G4P A;  2O3E A;  1MD0 A;  5F1J A;  3KX0 X;  4KZ6 A;  2P7C B;  4B4Z A;  1FOY A;  2MZH A;  1T39 A;  2DMN A;  1R1T A;  3ASO H;  5CXW A;  4HNB A;  4E3K A;  3F16 A;  3SEZ A;  4AYB A;  3F1A A;  1MC0 A;  3PO3 J;  2OW1 A;  3P98 A;  3OYK A;  4A6E A;  3IS2 B;  1FSE A;  3E1S A;  3KP2 A;  4IJA A;  1FCO A;  2JKR I;  3RTT A;  2X1E A;  3WTT C;  4P6Z M;  2W82 A;  4DZJ A;  3LIA A;  1U5T C;  1W8Y A;  1FMW A;  1SVM A;  2BHZ A;  1QQI A;  2H0Y A;  4CLC C;  5CHU A;  1WGX A;  2P8T A;  2XB5 A;  4OVD A;  2FE3 A;  3DKW A;  4JK1 X;  2Z99 A;  1AA7 A;  4HST A;  3FKI J;  2RQQ A;  4DBR A;  3FBI B;  5CVV A;  5B5E C;  3W2W A;  1F2K A;  1TF1 A;  3G32 A;  1IKG A;  3LNQ A;  1UAA A;  4BJP A;  2ZLY A;  3T12 B;  3MAJ A;  1BW6 A;  1IEM A;  3OOV A;  2MC4 A;  2PJP A;  1SAX A;  2VN2 A;  1TBX A;  4OOI A;  4EEF G;  1FT9 A;  1ZKJ A;  4JIJ A;  4BQN A;  4XRM A;  1YQA A;  4OPR A;  5DTS A;  3BC8 A;  3MEX A;  3NWS A;  2YSR A;  5E18 F;  1AKH A;  4PSX A;  3HM5 A;  1IXR C;  2X51 A;  3TOA A;  1OT6 A;  3LI8 A;  2DA4 A;  4A93 J;  4XLA A;  3KYC B;  4P5O A;  3OS0 A;  4EQQ A;  4R23 A;  1ZGA A;  3M6B A;  2RAE A;  3E2L A;  2M45 A;  1MH3 A;  4PM8 A;  2CW0 F;  1BZA A;  1YW7 A;  2DYR H;  2TCT A;  2D2W A;  3DP7 A;  2BY1 A;  1HBX G;  3UMD A;  3WWX A;  1CGE A;  3T1B A;  2ID3 A;  4L5I A;  4FE4 A;  3ZQI A;  3ZXS A;  1HTD A;  4I39 A;  4I5S A;  4JYK A;  2A05 A;  2WKR A;  2OV5 A;  2YPR A;  4O5V A;  4LB5 A;  3F15 A;  4WX9 A;  3HUG B;  3SS4 A;  1GXP A;  3RQI A;  2OWJ A;  4JGO A;  3AG3 H;  3ZMD A;  3L09 A;  3GMW A;  2PX9 A;  4N4N B;  1KU9 A;  4CCO A;  1ZR4 A;  2ZJ2 A;  2ZMA A;  1NHA A;  4ETS A;  1K54 A;  2Y8H A;  1NRJ A;  1U5T A;  4KZ4 A;  1XFW A;  4N1X A;  2XGC A;  2QA4 I;  4BDY A;  1R1H A;  1KE3 A;  4UUS B;  1BI3 A;  4WN5 A;  2J83 A;  4CQH A;  1OYI A;  3EQV A;  2EV5 A;  1PWW A;  2KRC A;  4ON0 A;  2XGE A;  4ZDP A;  2EIJ H;  2ZNY A;  4EWF A;  3CP8 A;  3PL8 A;  3MZF A;  4OIP F;  5EPH A;  1J59 A;  5A93 A;  3H5N A;  3G42 A;  1Z21 A;  2RC4 A;  3HOS A;  1ULY A;  2KFD A;  4D5F A;  3N7W A;  4X55 A;  1CI9 A;  2RJP A;  3PHY A;  3JYI A;  3LAJ A;  4MBH A;  3A01 B;  1X2N A;  2HZD A;  4MTD A;  1JE8 A;  1DJA A;  1KGE A;  1FLS A;  2HNH A;  1OM6 A;  3H3Z A;  4HX3 A;  2L7Z A;  4PKT A;  3IV5 A;  3ICY A;  2VL8 A;  5FQM A;  5I94 A;  3GX4 X;  2VGL M;  4PKU A;  4IVK A;  2XD1 A;  3T8T A;  1FIK A;  2DYS H;  4EVI A;  2INW A;  1AYK A;  2G7U A;  4U0V A;  2VQL A;  2L54 A;  1OJG A;  2A6T A;  1QHG A;  5FKO A;  1CF7 B;  2EIL H;  3LO7 A;  1GE6 A;  2LD5 A;  1BKC E;  4DZP A;  3F9K A;  2CMN A;  1M6K A;  3A3D A;  2W0D A;  1ATL A;  2RRE A;  1DP7 P;  3R6S A;  5LGT A;  4LLO B;  1ZTR A;  3C3W A;  5AIP A;  1HQC A;  2STT A;  2W1R A;  5J7E A;  3DV8 A;  5DF8 A;  5LEK A;  2WGW A;  5DF9 A;  2L01 A;  4TV7 A;  2XAS A;  2HQA A;  3PBT A;  3EPZ A;  3V5M A;  2W1O A;  3GZN B;  5IPA A;  1UHW A;  5A90 A;  3U1D A;  4AIK A;  2QF7 A;  3LFU A;  3PNY A;  4P9F A;  3CJR B;  3MZY A;  1PP8 F;  2R92 J;  1HTZ A;  2Y55 A;  1APL C;  1XC5 A;  1Z0X A;  3HOT A;  2ZME A;  1XUR A;  1CXV A;  4IF4 A;  5AQ9 A;  4E3N A;  3H9G A;  5LHI A;  1ACF A;  4S0H B;  1W63 M;  3A01 A;  1RKW A;  1KUF A;  3LSH A;  2W3H A;  4C6Y A;  3O3V A;  2EX6 A;  2CKI A;  3ABT A;  2QKP A;  3HBV P;  1RKT A;  2KL4 A;  3WOD F;  1Z3X A;  3B6C A;  4CZC A;  1PFL A;  1R36 A;  2KRF A;  2EPF A;  2JPC A;  4HQM A;  1ETO A;  3LA2 A;  4IL6 C;  1J75 A;  1Z09 A;  2L4R A;  1ZYR F;  3RCO A;  3GDI A;  2Z6C A;  1RMZ A;  3FF5 A;  4KJZ A;  3G73 A;  1V9Z A;  3GYH X;  2VPR A;  3I64 A;  1I1G A;  1YSQ A;  3TSG A;  2DOE A;  4FAS D;  3Q7Z A;  4OPZ A;  1XTA A;  3BJ6 A;  5C3E J;  3JRA A;  4C2T A;  4N9L A;  2XS4 A;  5KK1 A;  3BY8 A;  3UNG C;  2H27 A;  3HSE A;  1SDE A;  1OLT A;  2M34 A;  4F3Q A;  3HDD A;  2PAV P;  5GHX A;  3VV4 A;  2M0M A;  1JHH A;  1IAD A;  1T8I A;  5F6A A;  2JPB A;  3R4K A;  4HJ6 A;  1E2X A;  4MN7 A;  2YB9 A;  4PM5 A;  2HDW A;  4QU3 A;  1TC3 C;  2HKO A;  3L2R A;  5IOZ A;  3VFZ A;  4C3I J;  2QM3 A;  2FFY A;  2V9A A;  4Y15 A;  3RPU D;  3J7Z I;  3CI6 A;  4LPZ A;  3UB5 P;  4YNR A;  2NVQ J;  2HDU A;  2JBF A;  4XK4 A;  3HLG A;  4LCM A;  2R7R A;  3GTL J;  3LFV A;  1SLM A;  3COA C;  1H88 C;  2H09 A;  3BG9 A;  2W14 A;  1YLF A;  4KEN B;  4DOZ A;  4ZJ1 A;  2EH3 A;  2JN6 A;  1X1P A;  2GOM A;  4E3L A;  2IWC A;  5GHZ A;  2FRH A;  4GYI A;  2XDV A;  2HDR A;  1PYY A;  2QQ9 A;  3W6J B;  4IJG A;  4XRS G;  3DTM A;  4HDU A;  3BG3 A;  3L9F A;  3BWG A;  4IUK A;  4PUS A;  4YWZ A;  3S4X A;  4MNU A;  4MBK A;  2CGP A;  4Q8I A;  2OZR A;  5FAT A;  1LVA A;  5ICF A;  3L1P A;  4HDV A;  1S67 L;  2FZ0 A;  4FVL A;  5CVJ A;  4R3J A;  3J7A O;  1R54 A;  1IAB A;  1JAP A;  2NS0 A;  3HTU A;  3SW1 A;  5CZM A;  2LDU A;  3FV7 A;  2VXZ A;  3DLA A;  1BBY A;  2W24 A;  4LFU A;  1P9R A;  1TS0 A;  2BAS A;  2M4G A;  2YKH A;  3A0S A;  3GR2 A;  5E2E A;  3JAM K;  4P9U A;  3HOU J;  4DE3 A;  2WUQ A;  4GO1 A;  5LEJ A;  3GTC A;  3JVV A;  3WTX C;  2ZXW H;  3GW2 A;  3PM1 A;  3ZRG A;  5IYD J;  3HC7 A;  1DGW Y;  4IHW A;  2HPI A;  5A2Q Z;  2A24 A;  2WKP A;  5IYC J;  5D1S A;  4XN3 A;  2YIG A;  3BR0 A;  5K7F A;  4A3B J;  4ESP A;  4KZ9 A;  2LK2 A;  5TJJ A;  3Q3S A;  1BOB A;  3OYM A;  4ZYH A;  1IN6 A;  4IOC F;  3K2Z A;  4LIT A;  4RX3 A;  3F22 A;  2WGV A;  2XGX A;  3BLY A;  3B2Z A;  2E2J J;  2JKG A;  1TQP A;  3RPU A;  1FWZ A;  2ZL1 B;  4F94 A;  1MMQ A;  2F2E A;  4R3V A;  2R5Y A;  5I4O A;  4I99 C;  2BG1 A;  1S5L C;  2MAB A;  1AWI A;  5HW3 A;  2IS2 A;  2Y91 A;  5IYB J;  1X3U A;  1L2S A;  4JOM A;  2YKF A;  4MN6 A;  3W2Z A;  2Y2H A;  2LKX A;  2DA2 A;  4KZB A;  1PUF B;  2PBD P;  1UMT A;  2K31 A;  3Q0W A;  5G18 A;  3LI9 A;  1FPQ A;  2PJR B;  4FOF A;  4MDZ A;  2JQ7 A;  1AST A;  2FOK A;  3U2R A;  1DUX C;  4CCJ A;  1ZP5 A;  1WJA A;  2MLS A;  2OOL A;  1IAA A;  3ABU A;  2EWN A;  3C2B A;  2WWY A;  2VBZ A;  3VP0 A;  2H6C A;  3M8J A;  2XAG A;  4Q0H A;  2R7O A;  5D4S A;  3NDG A;  1YO5 C;  2LY9 A;  4AM3 A;  4FTX A;  3VDX A;  1LFU P;  3UE0 A;  4KG5 A;  1P7I A;  3MZE A;  1BI1 A;  3Q81 A;  4IPA A;  2IVM A;  4O7D A;  4PKR A;  1KGS A;  2O9L A;  2LLK A;  2DDY A;  4D0P A;  2KT0 A;  4XM8 A;  1DPU A;  5J1Y A;  1Y1W J;  1YJ9 I;  2E36 A;  3TOB A;  1A0K A;  4JP0 A;  2MFZ A;  2XB0 X;  2XQZ A;  2BXZ A;  5M5X J;  1OPX A;  3EEH A;  2FNA A;  3T1X A;  2HS5 A;  3SS3 A;  5KNL A;  1G2H A;  2KJC A;  1O3Q A;  2PR5 A;  1Y0V A;  4GUY A;  3SOI A;  4UUS A;  1XSD A;  1CGP A;  3A3J A;  1X1D A;  1G5U A;  2CUF A;  3UR3 C;  3CO6 C;  4BYY A;  4LRZ E;  3T4Q A;  3ZQ5 A;  3QU6 A;  3E5X A;  3RKQ A;  1FR1 A;  2QQA A;  1XPX A;  3BG6 A;  3S1Q J;  1PWC A;  4PKY G;  1YX3 A;  3LIC A;  3LSR A;  2DN0 A;  2ID6 A;  4PM7 A;  3F8N A;  3R7W B;  4WZV A;  2FML A;  3MKY B;  1W0T A;  1K61 A;  1OS9 A;  2R7Q A;  5HDD A;  4UUV A;  1IYS A;  3I53 A;  3ZGA B;  2WA0 A;  1YTY A;  3K4K A;  1ZVX A;  1P9W A;  2G2U A;  2LRE A;  3H7W A;  5HAI A;  2IGK A;  1BKC A;  2YR2 A;  4GS9 B;  4AWX B;  3EWJ A;  2WAF A;  5FLM J;  2FF4 A;  1GA0 A;  1I2W A;  3FX3 A;  2DMW A;  4S04 A;  2X6Y A;  3W2V A;  4G3V A;  1VB6 A;  1Y0U A;  1KA8 A;  1NYM A;  5F0F A;  3PSI A;  1LQ1 A;  3CCY A;  4AYB N;  1WYC A;  2H0T A;  1T0F A;  1J7N A;  1B72 B;  4R4S A;  5CVU A;  3K70 C;  2FA5 A;  1XDU A;  3TO7 A;  3EEA A;  5DEQ A;  4XQF A;  4IEJ A;  1K55 C;  4B4X A;  1NLY A;  3DNG A;  2JNP A;  2DCE A;  3K9T A;  2OXZ A;  4EER A;  4E7S A;  3LY4 A;  3IUO A;  1IV6 A;  3DBR B;  1EWZ A;  2PHY A;  1PWQ A;  3JRI A;  2EX8 A;  4JGQ A;  1L6J A;  5DD4 A;  4XL9 A;  2FNP A;  1IRZ A;  4A7B A;  2XKO A;  2F5E A;  2P7J A;  1GSV A;  2KIF A;  2LH9 A;  3F72 A;  1UJ8 A;  1IRG A;  4S2P A;  1OCO H;  1MNE A;  1XPB A;  5E2H A;  3S32 A;  3ZG0 A;  2R9W A;  3Q7V A;  3P9I A;  1G3S A;  2ZM8 A;  2DO7 A;  1L0O C;  4B3A A;  5HVQ C;  5EGO B;  2XA7 S;  4UA7 A;  2EA4 A;  1OM8 A;  2I10 A;  2J5O A;  2VB6 A;  4N9I A;  2R0Q C;  2HOT A;  1HA8 A;  1E3U A;  1BLP A;  3FWL A;  3K2A A;  4EW7 A;  3QP8 A;  1BN5 A;  4LG0 A;  3TGN A;  3A4C A;  4EV0 A;  3OYG A;  3V67 A;  1OS2 A;  4DMZ A;  1ES4 A;  2ZKZ A;  4HIA A;  3IHA A;  5J4V A;  4MCW A;  1T08 B;  5DFY A;  3MQ0 A;  1U9O A;  4LV2 A;  1EAK A;  3CCR I;  3GTO J;  1EF4 A;  3TS4 A;  2VOO A;  2ZJP F;  4GOG A;  2L9R A;  3UE3 A;  4KUM A;  3LGO A;  3D3O A;  4G9L A;  4WF0 A;  3S3M A;  1WKM A;  1G3T A;  3RQ4 A;  4IHS A;  2XEP A;  4H1Q A;  3DFG A;  4N92 A;  1VQK I;  2Y2L A;  2WY8 Q;  2Y4A A;  2KHM A;  2YUS A;  3HL9 A;  3U2A A;  5FB2 A;  3OBF A;  2YX7 A;  5FRO A;  3HRS A;  3KEY A;  3VOD A;  1JWP A;  4LCL A;  4ENK A;  1GSX A;  1NG7 A;  3ZCZ A;  2K9L A;  2MC3 A;  2OZU A;  3OOP A;  4DYR A;  3DAV A;  5D4R A;  1HCR A;  1HV5 A;  2IJL A;  2HDD A;  5BOH A;  1KGG A;  4Z1W A;  1F36 A;  4JA1 A;  5EM1 A;  5CYV A;  3I4M J;  4R4R A;  1B3D A;  3ESW B;  3UNW A;  4G12 A;  3EUA A;  4A3W A;  1H3Q A;  1QIB A;  2K2N A;  1I1I P;  3LMM A;  4H6J A;  3BPX A;  3M1C A;  3TOI A;  4XLF A;  4U87 A;  4M3G A;  5EZH A;  1Z6R A;  3IWQ A;  4KQR A;  2JA8 J;  5EVI A;  2WAQ N;  1XJ3 A;  2ME0 A;  4C2U A;  4LG0 B;  1R6R A;  1RPW A;  3LSK A;  3C8C A;  4KZ8 A;  1BZS A;  1R5H A;  2W1T B;  4HG2 A;  1U60 A;  2XAH A;  1MWR A;  4LK1 F;  1S7E A;  2JN7 A;  4HJ4 A;  2XS3 A;  1SD7 A;  4KMU X;  4L9N A;  2XSD C;  1JUP A;  2BVM A;  3B33 A;  4X53 A;  4RLQ A;  3S17 J;  3OC2 A;  4KZ7 A;  2PMZ A;  1EW0 A;  5H8X A;  4ILW D;  1OME A;  2CQQ A;  1FCN A;  4HP4 A;  1DMT A;  5JYO A;  4EES A;  2RKH A;  3GVA A;  1Y93 A;  1Y8J A;  2EIK H;  1FIL A;  4LRY C;  3FM5 A;  3LA3 A;  4OP5 A;  2VJI A;  3ABL H;  3HL2 A;  1KE0 A;  4P0M A;  1L0G A;  3SH7 A;  5JFR A;  5EVE A;  3VE3 A;  3M2K A;  1YOU A;  3OR2 C;  3G1O A;  1Y4O A;  3VMA A;  1SFK A;  1PW8 A;  5D5W B;  1T6S A;  2CC1 A;  1G05 A;  2B95 A;  1OO9 A;  2CV1 A;  2L1M A;  1XFU A;  2KIQ A;  2O7O A;  3ZQQ A;  2QYB A;  5EEG A;  1LVK A;  1T98 A;  3ML6 A;  1Z3Y A;  3CCJ I;  1HVB A;  2HV1 A;  4AFI A;  5FQJ A;  2K9S A;  5BNG A;  2VA0 A;  3NY4 A;  1JIW P;  4NDL A;  1XGJ A;  3MS6 A;  5J1U A;  3RXX A;  2Y31 A;  5B5P A;  2DFH A;  2E1C A;  3TP3 A;  2M4K A;  4EQI A;  5DM6 F;  1XJ6 A;  2QJ5 A;  1SD6 A;  1TQI A;  4OIN F;  1MJA A;  1PI4 A;  4HX8 A;  2OZ6 A;  3BZC A;  4D5C A;  1EH6 A;  4H2E A;  4ZRR A;  1H9G A;  1JWZ A;  2W3D A;  2ZL1 A;  5CVI A;  3G71 I;  4IHX A;  4QWO A;  2P5K A;  2LY2 A;  5DJU A;  1D5Y A;  4Q0J A;  5EJC A;  3NUL A;  3VP3 A;  4DYQ A;  3U9G A;  1UZC A;  1SEU A;  3I58 A;  2K02 A;  5LBR A;  4GFB A;  1ONH A;  4C75 A;  2V8C A;  1CAQ A;  2YU3 A;  4HLY A;  4CH7 A;  4EAT A;  4A3E J;  3N05 A;  1SC7 A;  3MQO A;  1T95 A;  3NJA A;  1Q1H A;  1A6Q A;  2L02 A;  1P97 A;  1LDK B;  5D7W A;  3SHI A;  1FSW A;  1P6R A;  1BM9 A;  2HXO A;  2LRD A;  4HBL A;  4PJJ A;  4AXQ A;  5FA7 A;  4KFC A;  4FU4 A;  3PFY A;  3FDY A;  1XCV A;  1YE9 A;  4GHI B;  2N8R A;  5EEA A;  3U21 A;  3VFF A;  3N8L A;  2KLI A;  2O36 A;  2X02 A;  2R7F A;  5ILV A;  3BW6 A;  1W63 Q;  2OA4 A;  3WG9 A;  1K6S A;  3HLF A;  2F6C A;  4G3W A;  3E6C C;  1FYL A;  1T33 A;  3JRD A;  5I2Z A;  2XLN A;  1L0F A;  2DA7 A;  5EFW A;  2HDQ A;  3F8B A;  4NEE D;  2MZI A;  1VQ9 I;  4ETZ A;  3KYL A;  3ULF A;  4JQF A;  4M6Y A;  4LEN A;  1A36 A;  5J4E A;  1J09 A;  1LL9 A;  1S66 L;  4NC8 A;  2JKT M;  4DF9 A;  2VV7 A;  3NAU A;  4RBO A;  4HAM A;  2ZC6 B;  2V7F A;  4HQA A;  2V9V A;  4NK3 A;  4A5N A;  2MSY A;  4E7Z A;  4ZTF A;  4HMA A;  4QB8 A;  2LY1 A;  4OP8 A;  3UVC A;  1D0X A;  3VOL A;  3GFL A;  4BU2 A;  3LEA A;  4RB3 C;  4G7Z F;  2W0N A;  4EEP A;  3WG7 H;  1Z7L A;  1Z91 A;  3HBL A;  4UB6 C;  4B43 A;  4OQI A;  2WV1 A;  4JF5 A;  2M7U A;  3CLO A;  5DTD A;  3KZI C;  5JI6 A;  3S16 J;  2V4B A;  3UDX A;  4PM6 A;  1UEL B;  1WFX A;  2DOA A;  2IGO A;  2NXN B;  4YII A;  2NNY A;  3OY9 A;  3BJA A;  3QPH A;  1ZR2 A;  4D2O A;  1BQQ M;  4CYC A;  2HWV A;  1VQQ A;  4KUO A;  1F1Z A;  1MJ9 A;  1JJ9 A;  3CP2 A;  4PZJ A;  1YPR A;  5J8F A;  4S2I A;  3FXL A;  3K1N A;  2A69 F;  3S2W A;  4D7N A;  2V0U A;  1YQY A;  2FSW A;  2GIV A;  4BUP A;  2Y2G A;  3V8K A;  1H71 P;  1MXO A;  4Y0U A;  2E7W A;  2JA2 A;  3OYJ A;  2MBF A;  2A6E F;  4J19 A;  1B8I B;  4K0W A;  5EGO A;  3E8R A;  4EBL A;  5FJ8 J;  4XCT A;  2JTV A;  1IXS B;  1AOY A;  1LSW A;  2L4M A;  4BXU A;  2WY7 Q;  1B59 A;  2CMP A;  3M9A A;  3P9C A;  1FYK A;  3ECO A;  4RAZ A;  4ZJ2 A;  3FK7 A;  4CPK A;  5DYM A;  1W7P B;  2XVC A;  1KYW A;  4B48 A;  5IT9 K;  1I5Q A;  1HD8 A;  3AGE A;  4OLG A;  1MZB A;  1ZEL A;  3C7J A;  2E7X A;  1VND A;  4CGZ A;  2WZX A;  3L2Q A;  2Y2M A;  3LID A;  4GB7 A;  4XLC A;  4E6K G;  4IHV A;  5IS1 A;  1I27 A;  1OQY A;  3RDI A;  4HQE A;  3QNB A;  5FEF A;  3HGG A;  4WBG A;  4UXN A;  1K7I A;  2IBD A;  4GR0 A;  2XD5 A;  4R6L A;  2IS1 A;  1FSY A;  1BOA A;  4PGH A;  3KYQ A;  2HKX A;  2B63 J;  3LR3 A;  1C7K A;  2DBB A;  2RGV A;  3KLO A;  5ICC A;  2JKR M;  2Q0O A;  4HF0 A;  4NB5 A;  5IOY A;  2ESH A;  1E0E A;  3UB6 A;  5HAR A;  1KGF A;  5L79 A;  1IYO A;  4FT8 A;  4JBA A;  2QEX I;  3MQQ A;  4A3L J;  3IC7 A;  2QBY A;  1GE5 A;  1T56 A;  4ZJZ A;  4KZA A;  4Y7N J;  4FH2 A;  4I35 A;  2EV6 A;  1N25 A;  4M9X A;  4BJ6 C;  1JTD A;  1VET A;  2A5Y B;  5F1R A;  5EM0 A;  1C3I A;  1I6H J;  1OYW A;  4WF6 A;  2VLA A;  4UQI S;  2OI0 A;  3K4L A;  1NK3 P;  3E97 A;  3F1P A;  4XKW A;  1OTA A;  2CQK A;  2QCO A;  2J9P A;  2KMU A;  2MLR A;  5TFQ A;  2W12 A;  4FXY P;  3MXS A;  3VTG A;  2ZXH A;  3G4S I;  3IX8 A;  1XX5 A;  1X0O A;  2ECB A;  1S4B P;  1K55 A;  2X7M A;  2HDS A;  3CJM A;  5GAG J;  2OJE D;  4AVZ A;  3I59 A;  4V2F A;  3ZFZ A;  4CLC D;  2X6W A;  3ZVT A;  4QJG A;  3HLB A;  3HG9 A;  1ZQ3 P;  4IZZ A;  3EYY A;  4M6V A;  1MIJ A;  1OTB A;  3FPW A;  3CCL I;  1YS7 A;  4UV8 A;  1R49 A;  1IRF A;  4I3A A;  4N1H A;  3LJT A;  2VC0 A;  3HCY A;  3IX3 A;  3K10 A;  4U88 A;  3ZG9 B;  5L7F A;  3KP7 A;  4CZZ A;  5DFX A;  4KQQ A;  2FD5 A;  3B92 A;  1MKM A;  3MCZ A;  2R9X A;  3QU3 A;  4WZ5 C;  2ZOI A;  3CUE A;  2VE9 A;  4YRV A;  3BQZ A;  4OQ0 A;  3CZ6 A;  1Y8R B;  2PQ8 A;  2V1U A;  1PJR A;  2WAE A;  5LHG A;  1DY6 A;  2P9V A;  2UZK A;  4L6T A;  2Y9Z A;  4B44 A;  3AKZ A;  2EXB A;  5FI6 A;  3MJQ A;  1ON2 A;  5ILS A;  3CCQ I;  4XBF A;  2BW3 B;  5B3S H;  5A92 A;  2CYY A;  4H4K C;  4HP9 A;  3SH8 A;  2K9C A;  1HDP A;  3FMQ A;  1AU7 A;  4LV0 A;  5GL9 A;  3FXO A;  1R7J A;  2DLL A;  3ZYT A;  2L2O A;  3WE2 A;  5LRS A;  1WH5 A;  2P6S A;  2F5F A;  3S1N J;  5J3W A;  2DI3 A;  1U8R A;  1X3W B;  4LOC A;  4BBR J;  4BNC A;  2GZA A;  3VFH A;  3LMC A;  3TO9 A;  2F48 A;  2KPM A;  2HEO A;  3CTA A;  1F4K A;  1O0T A;  2JT6 A;  1MND A;  4XT2 B;  1F5T A;  3FK6 A;  1GLN A;  2JE5 A;  2WB1 N;  3ELK A;  5F5Y A;  2QSF X;  4W97 A;  3IX4 A;  2XF5 A;  1XP4 A;  1RR7 A;  4A5R A;  3DEE A;  2V0W A;  2GA2 A;  4L9J A;  1KZH A;  2VT3 A;  1BYW A;  3N6I A;  3DTK A;  2CLT A;  2P0W A;  3DPL C;  3ITB A;  1KUK A;  2VKS A;  4HX7 A;  5GLB A;  4K2E A;  2Q2E A;  4RGR A;  3O2P E;  1B9M A;  3ZMU A;  1P7J A;  1Y0N A;  1NWZ A;  4A0Y A;  3S3N A;  3EGX C;  4X68 A;  5F27 A;  1H5X A;  4NBQ A;  3QP6 A;  4BHB A;  4EBP A;  1O0Q A;  1SD4 A;  2K9Q A;  2EWW A;  3S7P A;  2CQX A;  3WE3 A;  5L3F A;  1ODV A;  1HSJ A;  3I4P A;  3K3C A;  1FOK A;  3I7J A;  4DXC A;  2FBK A;  5CRF A;  2BW3 A;  1UCR A;  2E5Z A;  3G2Y A;  2BYV E;  3F1O A;  4ENM A;  2R7S A;  1Q1V A;  2XH9 A;  1O7L A;  1G8X A;  2DQR A;  4BXF A;  2DDA A;  2Z2M B;  4LLN A;  5HZH A;  1ODD A;  4EM2 A;  1NK2 P;  2MH9 A;  4LK0 F;  1FEX A;  1NRF A;  4ZBE A;  3UB9 A;  2JA5 J;  3BLS A;  2CS3 A;  2JT1 A;  4RM3 A;  1WPK A;  4HPQ A;  2Y2P A;  2V26 A;  1V5F A;  3HRU A;  3PNT A;  2WGI A;  4BQA A;  1HKT A;  4HH3 A;  4LV3 A;  4EXO A;  5FEG A;  3CCE I;  2AIG P;  3FWE A;  3C18 A;  1WRJ A;  1QVU A;  1MDM A;  4JGR A;  2Z5U A;  4KIB A;  4YIR X;  4U7D A;  5JVG F;  3OPP A;  4S2N A;  4MO7 A;  3GFI A;  1UGU A;  3T8R A;  4RA2 A;  2HJ9 C;  2PD7 A;  1BSW A;  1FBL A;  3F18 A;  2CV0 A;  3WGH A;  1K79 A;  1PUF A;  1KU3 A;  2Q2E B;  2UXX A;  1BIA A;  2Z1D A;  1LE8 A;  5GLC A;  2Y2N A;  3RZO J;  2WKE A;  2OCE A;  2Y75 A;  5CQG A;  1XAX A;  3AYU A;  1V3F A;  3IBJ A;  5E43 A;  5L8M A;  1G3W A;  1WA9 A;  1KUG A;  1IGN A;  5BPA A;  3NCK A;  1JGS A;  1JUS A;  4NXF A;  1P92 A;  2V1X A;  3CQZ J;  1T1A A;  1JT6 A;  1I6X A;  4LIV A;  2J3T C;  2R78 A;  3WS1 A;  4IKF A;  2DT6 A;  2JSD A;  2NVU B;  4GJ4 A;  2XRN A;  4HV5 A;  4ZC3 A;  2IP2 A;  2OUM A;  4YG2 F;  3DL1 A;  3LWF A;  1BW5 A;  1YSP A;  4WMC A;  5DCM A;  4KYW A;  4E7I A;  3MD2 A;  2GXA A;  3KEQ A;  2VGJ A;  1UEA A;  1ZXC A;  1VF9 A;  1X19 A;  3F8M A;  3K4J A;  3V4G A;  2X48 A;  4CCN A;  3CUO A;  5GPA A;  4GKU A;  5EG0 B;  2OAQ 1;  1YLT A;  3GXO A;  3GFM A;  3ZQH A;  1ONG A;  4OIQ F;  1VQ6 I;  3QNC A;  2CUJ A;  5HOO A;  3GVB A;  5I5L A;  4M3F A;  2FX0 A;  3S14 J;  3H82 A;  2RJQ A;  5IT5 A;  2FXA A;  3K7A J;  1DPR A;  4FQG A;  4C2M J;  4MN5 A;  1TNT A;  5AVF A;  5E3L A;  2PR6 A;  5GLA A;  3RYR A;  2CG4 A;  1R9T J;  4EET B;  3O64 A;  4ANJ A;  3IQA A;  3OYI A;  4ENJ A;  3BLM A;  4AIH A;  2GNX A;  3HPH A;  4PM9 A;  4B88 A;  4WXH A;  2FQ3 A;  4FD8 A;  3MVP A;  1V55 H;  5FSR A;  2OW9 A;  4HNU A;  3MA2 A;  1YLP A;  4L7A A;  1YRN A;  5F64 A;  3WGI A;  3E2K A;  5E17 F;  2BVL A;  3NWT A;  1WYB A;  2G7H A;  2HF6 A;  3EDP A;  1G6N A;  3BY9 A;  1JNU A;  4KQD A;  1YP1 A;  1ZHF A;  4K0X A;  3W8K A;  3P01 A;  3GBO A;  1T0F C;  1LSX A;  4JP4 A;  4ESJ A;  2PMZ N;  3MMY B;  3B3X A;  3PIP F;  3IRQ A;  4LLL A;  5TGT A;  1TS7 A;  3GV9 A;  1GXD A;  3DBL B;  4IVN A;  2I5U A;  4XIC A;  4D1Q A;  1O3T A;  1UG0 A;  3JRE A;  3LK8 A;  5ICE A;  1OCZ H;  2ZQ9 A;  5B66 C;  3T4O A;  4E70 A;  4HX4 A;  3S1R J;  3HPG A;  3GTP J;  1K78 A;  1FR6 A;  3BQA A;  5AQ7 A;  1D8K A;  3BTJ A;  4E3O A;  1GO8 P;  2PYR A;  4Z6Y A;  3TO6 A;  3RYP A;  4R79 A;  1W36 D;  2QBY B;  3PIO F;  3NOT C;  5E2F A;  1DU0 A;  2DPD A;  3EQU A;  5HDC A;  5H6R A;  2NAZ A;  1QZY A;  5TRD A;  2H1K A;  5FFZ A;  3LKA A;  2NOJ B;  3OZH A;  3Q5F A;  2HVS A;  3HSR A;  4LV1 A;  4DV8 A;  4EM0 B;  2STW A;  5HWV A;  2VQC A;  5D6F A;  4H82 A;  1ZG4 A;  1L0E A;  1E3O C;  2E8J A;  3LUQ A;  3EDZ A;  1YRN B;  1DP3 A;  4EJU A;  2GXB A;  1TDG A;  5HLI A;  4I3J A;  2A2L A;  3WHB A;  5HS8 A;  3HJI A;  4CTH A;  4JPM A;  3ONQ A;  5LRR A;  1SU3 A;  1QIC A;  3TDU C;  1D7E A;  1VQ5 I;  3LSJ A;  1YLJ A;  3UE6 A;  3DPT A;  2LR8 A;  3HRM A;  4XKV A;  5EF6 A;  4L5E A;  4S2M A;  4KNY A;  2PMU A;  3DLL F;  5BMZ A;  4WLA A;  5GLD A;  2VC1 A;  1RM8 A;  1S72 I;  1I2S A;  3WTY C;  3DKX A;  1FQG A;  2P08 A;  4LGW A;  4O6J A;  1K7Q A;  1XUD A;  1H89 C;  3G31 A;  2ERP A;  1Y28 A;  5FQQ A;  3TED A;  1ETX A;  2HYJ A;  3RTY A;  4X1L A;  2MLK A;  4RMN A;  2A3U A;  1G6A A;  4MNR A;  2Q9N A;  1FNN A;  1R1I A;  4ZTJ A;  1MNM C;  1WJC A;  1ERQ A;  3FZC A;  1V9Y A;  3ITA A;  3KME A;  2IRF G;  1FSH A;  4PAU A;  2E1O A;  1RR8 C;  1ZHH B;  2E2D A;  5GTI C;  1QRY A;  2K7S A;  4HJ3 A;  1N9N A;  3NI9 A;  5F0C A;  3X2Q H;  1GA9 A;  2VZW A;  4EM1 A;  4F92 B;  4IX7 A;  1MMS A;  2HTJ A;  3OYD A;  2OLU A;  2Y2J A;  1C3B A;  3KEJ A;  3M6H A;  1PWU A;  2W15 A;  5H2F C;  4QY6 A;  3ZXH A;  3BTI A;  1USN A;  1LDD A;  3H5R A;  1UWP X;  2RDP A;  1K56 D;  4BAY A;  3ZN0 A;  5FLV A;  4EJO A;  2FU4 A;  1SMT A;  1MMB A;  2CRG A;  1YYV A;  2DQL A;  3OIQ A;  1XUC A;  4H49 A;  3ISP A;  2ELK A;  2DPU A;  3H9J A;  1VQL I;  3DWL E;  3KZZ A;  1ZKG A;  1S1Y A;  1OYY A;  2O5R A;  2RN7 A;  4E7L A;  1HW2 A;  5D3C A;  1G6O A;  4LD5 A;  2EX9 A;  3LSI A;  4WKI A;  2IA2 A;  1OFC X;  5D5X B;  2ZQC A;  4S2L A;  2C6W B;  2D45 A;  5KSH A;  1X58 A;  3LYX A;  4EUZ A;  3UO9 A;  1A86 A;  1IXC A;  4BQQ A;  4A3I J;  4NHJ A;  3LEQ A;  2OCC H;  1IUF A;  1TVF A;  2BXY A;  2DFF A;  2EA2 A;  2Y0S N;  2PRF A;  3BEB A;  5FDS A;  3JSO A;  1PIO A;  1QIA A;  3LE9 A;  3V7C A;  1LLB A;  4F91 B;  3TW7 A;  3HYG A;  1W36 C;  1NLZ A;  5M1A A;  4CLC B;  4DF6 A;  3P24 A;  3BQ8 A;  3IH2 A;  5K5Q A;  3CUE C;  3OHL A;  2DDB A;  1E3U D;  3A3F A;  3OCN A;  5F1G A;  2PLY A;  1RUN A;  1MDM B;  2EQR A;  2V2F F;  5FO5 A;  2L5Q A;  4W1U A;  3TE8 A;  1BR4 A;  2BV6 A;  3BFC A;  1NG6 A;  3HB2 P;  4BHP A;  2Y48 A;  2AHQ A;  2ZJR F;  1FP1 D;  1OJ5 A;  3H35 A;  2AQE A;  2JSP A;  4HEA 2;  2TCL A;  1KOU A;  5BQT A;  1RCJ A;  2X3C A;  2H6B A;  2EB7 A;  5DDG A;  1YIJ I;  4DGW B;  2M7A A;  2LG4 A;  3OPH A;  3WTU C;  3V42 A;  2M3A A;  3HUM A;  2OV7 A;