3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
molecule keywords IRRE PROTEIN
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTEA 3DTKA 3DTIA
chains in the Genus database with same CATH superfamily
1USNA 1K7QA 2VBYA 5J1YA 3LQQA 3M1EA 1YITI 5CVVA 3U4LP 3JVUA 3S1YA 3OMYA 2E5ZA 2ZMVA 3KYZA 1NH3A 3LY3A 3MXSA 4DGWB 3LEAA 3TO9A 3MXRA 3QOPA 3I9V2 2V1ZA 2VL8A 2VJ5A 4XLAA 4L9GA 3V3SA 1SDNA 3LEZA 4H76A 2MW8A 3RDIA 2G0EA 4KMFA 4N9IA 2HGVA 3LAPA 4P6ZS 2WY8Q 3EWKA 2D1NA 4XLFA 5EVIC 3ZMZA 1P4WA 2P5KA 4R6LA 2CQQA 3LE9A 3WTSC 4B43A 2O6GE 3GTPJ 3AG4H 3LGOA 4BU2A 4ESJA 2E8IA 1KQ0A 4P87A 1BZSA 5DD4A 4XBFA 2F5CA 5HAPA 2Y48A 1MGTA 2LF8A 3LGPA 1E3HA 2G9WA 2NYXA 4L6TA 2DJIA 1S6RA 5JVGF 1IELA 3HJEA 5HODA 4PPRA 5DTSA 3ELMA 4GUYA 1WYCA 2OV5A 4LFUA 2ZSIB 1Y0UA 5DM7F 1WSUA 3G2YA 5F6FA 4X25A 3UDIA 3ZUKA 2DA2A 5BPDA 3OV8A 3PR6A 1MSFC 2L01A 1X3UA 4XICA 2ZJ9A 1IG7A 1O3RA 2IEKA 2W85A 3GTCA 2XB0X 4D1QA 3EYIA 1YQYA 5FQMA 3PIPF 2Z9OA 3I0TA 4K0XA 2H94A 2E71A 4JX4A 2XGNA 5F69A 4TV7A 2FMLA 2R7UA 3E2LA 4U88A 5GAHJ 2K9NA 3P5JA 3LR0A 3MKFA 2RAEA 1ETYA 2L54A 2HU6A 4WF6A 5AQAA 2KQRA 2ETHA 3ONQA 4M6YA 4RGSA 5GTIC 2X6OA 3HSRA 2O8KA 3C5AA 4RB0A 4AWXB 3F8NA 4KN4X 5HPFA 5FI6A 3OPPA 5H8XA 2A5YB 2J5OA 5DS9A 5LGTA 3V7SA 3HY7A 4CLCD 3PL8A 1W36D 1QZEA 1MY8A 3EETA 2ZJQF 1MBHA 2JPCA 3BR2A 2D1OA 5D2BA 3A3DA 3EEAA 4EETB 3UE6A 3ZGKA 1Y39A 1Z67A 3LIAA 3HTUA 4E3KA 4OIRF 1XUCA 2XF5A 3H5NA 2H8WA 2P4WA 4NC7A 5EDNA 1ZXCA 1SAXA 4O5VA 3U9GA 4RGRA 1MWTA 5CPRB 5LHGA 1ES4A 4DOZA 1HA8A 4FTXA 4MNRA 1Z7UA 5A91A 5HDDA 3LMMA 2O61A 1I2SA 3TJZC 1YCMA 3FM3A 3BJNA 1K7IA 4F3LA 3G6OA 2FU4A 3WTTC 2FOWA 3L00A 1V4RA 3VSLA 1ZG3A 2VJIA 3T4KA 3P9CA 1KBCA 1GV2A 1PFLA 1AA7A 2HPIA 4JQGA 1S29A 4EV0A 1Y0VA 2KLIA 4XT2B 4AUOA 2HVQA 4QY6A 1JJ9A 3EUHA 2LSOA 3CCJI 3OPLA 5CX7A 4A5RA 1JUMA 4IHVA 2LFBA 3IP4B 1UTTA 4AUXA 2V1UA 1BULA 2XLNA 4JIJA 4UUSA 1DU0A 2JSDA 3MZEA 5KIZA 3VE4A 3UB8A 3I4PA 2QEXI 3IUOA 1ONGA 3RIRA 3TBIA 1MNEA 1GSXA 1SHVA 3H82B 3VOZA 1T2KA 3T50A 1J9IA 3JTGA 1V54H 2OCCH 1OFCX 2GXGA 3MKLA 4BJTA 2R5YB 3RTRA 2GLOA 1Q1HA 2K9QA 3DKYA 5FAOA 1HLUP 4YNRA 1OKRA 1Z6FA 5EOOA 4U0WA 5KAIC 4I5SA 3C4OA 3CUEA 3S3OA 3L2VA 1JTXA 2P5VA 3BLMA 2AXTC 1IAWA 1XURA 3BZ6A 3W6JB 5LD2C 1Y1WJ 2FFYA 2OWJA 3DEEA 4HPQA 1XXMA 2OWHA 1QVTA 3MFXA 4LPZA 4WBGA 5HAQA 4H82A 2DAOA 1Z7LA 1BR2A 2KFDA 1KVMA 1DGWY 2CKIA 2Y2HA 1YI2I 4F3LB 4PM8A 3BOQA 1DQUA 1VTNC 2F48A 4B48A 3G30A 3QOEA 3SEQA 3KECA 3M6HA 1YYVA 3E97A 1OYIA 1MJ9A 1SD7A 4ZJZA 1HBXG 3LI9A 4F7ZA 4JKTA 4FE7A 1D0XA 4ZC3A 3REOA 2VUMJ 5DTKA 1SLNA 3AG2H 2Y9ZA 1CF7B 3HC7A 3AKZA 1JKYA 2CV2A 3OZHA 1FYKA 3GF2A 1GKCA 4FVLA 1IABA 1GVDA 5AQ7A 4FXQA 3QRFF 4EJVA 3CF5F 2EV5A 3T1XA 2ZM0A 1CK3A 2X3AA 1YOVB 3LUQA 5A8BA 1ENHA 3W2AA 1J75A 3QNCA 2BYVE 4XKWA 3PFYA 3QYBA 3PBTA 1SFOJ 1PWUA 1T98A 4EJUA 4DBRA 3LWFA 3CC4I 4EBPA 1CGEA 3NWTA 1ASTA 3MQQA 1OZ9A 3F17A 2DCFA 2V8CA 3ZHHA 2I47A 1T0FA 4P5OA 2QM3A 1Y8JA 1R5ID 2Z99A 2DFIA 2Q9MA 1BOBA 1S0WA 2VGKA 3NDEA 4YFXF 2E1CA 1R7JA 1BC7C 2CO5A 2WZZA 5BOHA 4DPEA 4H3XA 1TZLA 2KLOA 4HX4A 1W63M 2OOLA 2OZ6A 1B72B 4P6BA 1W7PA 4A2UA 1OLTA 3OR2C 4PJLA 1H89C 4JX6A 3FZVA 1T95A 3PYPA 3NARA 2JQ7A 3RTTA 4HHDA 4I7HA 1QMEA 3HDBA 1KZHA 5HLTA 5E18F 2L4MA 3H36A 2DLLA 3BG5A 1BI1A 1QPIA 1KGEA 1MSEC 4PM5A 1HLVA 3W4OA 3G3ZA 3MZDA 1XMKA 1ZHHB 4N4NB 4KJZA 5ICGA 4ZJ3A 2Q9NA 1OT9A 1N75A 4HJ6A 2KL4A 2K7LA 2DT7B 4WK8F 1UB9A 4U0TA 3VMAA 2QQAA 1X0OA 4GDNA 1ZTQA 1W36C 2WKPA 830CA 4KUMA 3H7WA 4YFMA 4DDSA 1E3UD 2JKGA 1MNMC 4EEUA 2BHYA 3B02A 1GXDA 1I1GA 1XMXA 3CKIA 3DPUA 3MA2A 4I39A 2M7BA 4MFEA 4O0PA 3HXLA 2R3SA 3FKWA 5C44J 2HV1A 1A04A 2Z1DA 3MAJA 4FTHA 3EQUA 4LK0F 3ZNYA 4HF0A 4A6DA 3F8MA 1P9WA 1EV7A 4IO9F 1LT0A 4CCKA 4FH4A 2EILH 4I2OA 4QSHA 4LENA 3BFFA 2JRTA 4A7BA 1B4AA 4HLXA 1ZGAA 1HTDA 5HW3A 2Y31A 3HG9A 1SD6A 1NLYA 3QP2A 1FCMA 3I59A 3LA2A 1MD0A 2EH3A 5E3NA 4B93A 4BBVA 5CERA 1FP1D 3F1PB 2WBMA 3CMAI 1E2XA 1MNCA 2MZIA 3MFKA 3CJNA 3S1NJ 3HUOA 3CCEI 3FV7A 5I3MA 2CGPA 2ZQCA 3F8BA 2RL3A 1WCMJ 4DJ3A 4BXXJ 4NG2A 4KICA 1IKIA 3ZGAB 3KX2A 4EJTA 3A0HC 2L9NA 2Y59A 4OONA 1R1JA 2O03A 3OYGA 3RPQA 1NLZA 4BH9A 3ICYA 4M3KA 3DCFA 4MN7A 3VP1A 2O9BA 4R0QA 5HLHA 2R7TA 1D8JA 1S7EA 4CGZA 1OMEA 3RYRA 2L7MP 3CUQA 5D6FA 4IQJA 3WHCA 4E7IA 3BWGA 3ML6A 3SFZA 2KOIA 2LR8A 4U7BA 2ZQ8A 3W4PA 3VSKA 3E4PA 3ZQQA 2K5CA 5KCMA 2V1XA 3N2UA 2KISA 2K27A 3MN2A 3VFZA 3LSRA 1OJ5A 4KENB 4LK1F 4YFKF 2FXAA 1TC3C 1OTAA 3ABTA 2DOAA 2R7FA 2PR5A 2MZHA 4DZJA 2C6YA 1YHQI 4CLCA 2A07F 2EJRA 4ZYHA 2BW3B 3QPLA 4OOLA 1D1JA 3FISA 2E36A 3QPSA 5CXWA 4G94A 4HNBA 4H1QA 5EE8A 3LJTA 4L18B 1GKDA 5TJJA 4ID4A 4KFCA 1R1VA 2WB1A 3TE8A 3GTKJ 2I8DA 3OSGA 1GDTA 3CITA 1IRZA 2E5NA 5L3GA 3V39A 3OIPA 2XD1A 1LE8B 5E8IA 2EPFA 3OYIA 2ZO4A 1FOXA 4KQDA 5HLIA 4PJ0C 1TT5B 3AG3H 1W5TA 2HDUA 3QP5A 4PK4A 1HY7A 3NEUA 2V79A 2XR0A 5CEDA 1P9RA 2FA5A 1KE4A 5L3CA 3GBOA 2B9SA 3HVFA 2V20A 3UMDA 2ZSHB 3W2VA 5DJUA 4CLCE 3ZQHA 4X68A 4E70A 3VV4A 5HFOA 3UPOA 1G3TA 4JXVA 1S1ZA 2IT0A 5EM1A 1Y54A 2BGCA 3FMSA 3JRCA 4RAYA 2HDCA 2WGVA 4WL9A 2XGDA 3AGEA 1TQIA 4R3VA 3BY6A 2WTEA 3RQIA 2ZMEB 5J8FA 2JJ7A 4UEYA 1USTA 1YIOA 3KP7A 4EEPA 1MWUA 4IEDA 3ZQCA 5EEGA 3NQOA 1U2WA 3IH2A 4I6ZA 1ZS0A 1I5QA 2JKRM 4BXFA 1BW6A 2ZL1A 2M7VA 2X01A 2HTSA 3NAUA 1WJ5A 2JMWA 4QJGA 4HBLA 3DTEA 2FJ1A 2DU9A 3HZJA 4A3LJ 5AVFA 3Q0UA 2O0YA 4MHGA 3J80Z 1EF4A 3KP5A 3WU1B 2GOXB 5CYVA 1T39A 2ZKZA 4KT6A 1YQSA 2Y0SN 4HQAA 3T1SA 1XUDA 2Y8HA 4HJ3A 3ULQB 1FWZA 3V8LA 4JPMA 1FTTA 1QVUA 2PQ8A 2CS3A 5GLBA 4DQ2A 4DE2A 2VN2A 1O3QA 1FBQA 1RGYA 2MGQA 1K7GA 1K6OA 2EZKA 2W4SA 2AQEA 2FSWA 1G49A 3HYGA 3DQVC 1F5MA 1TL8A 1JTYA 4EQIA 2HQNA 3FK6A 3MCZA 4HX8A 3KSGA 4MEYF 3OYMA 4OIOF 2XIGA 4EWFA 2PBDP 3C2HA 5F0FA 4IKFA 1GSVA 3HB2P 4A3MJ 4PCQA 2BV6A 4WZ5A 4EUZA 4A3WA 2HQRA 2YIGA 2X71A 4RX2A 3WS2A 3O3KA 2L9RA 4MN6A 2XSDC 1S4BP 4ZYEA 3SOIA 1STZA 2WKHA 3VTGA 3IF6B 3CUQB 2P08A 4IN9A 3K4LA 2LREA 2Q2EA 3QU3A 1DDNA 1A5JA 3N7WA 3P1VA 4LIUA 5DJTA 3K1MA 5JHFA 1ETXA 2P7JA 2IGMA 4ZDLA 1FYLA 1LFPA 2VC0A 2JE5A 2R93J 4XR6A 2EFQA 2PG4A 2ACGA 5FKLA 1E3UA 1E3PA 1PVEA 2AXLA 4BAYA 3C2BA 1NK2P 2OVZA 3KZYA 5DFXA 3J7AY 1YLFA 3HIFA 1W7FA 3JR9A 5AQBA 1ZXVA 1Z09A 4OP5A 3NBLA 2HI3A 2L0KA 3FPVA 1WJCA 5HSQA 1R1IA 2A8HA 1EH8A 4H84A 3BJ6A 3LSJA 2LVSA 5EEAA 1LUJB 1IFQA 1R23A 3E5XA 2ZMAA 4U0XA 3ZOBA 2DMPA 4OINF 4IVIA 4WZ4A 1FT9A 1SD4A 2W1RA 3PJRA 3PBNA 4MBKA 1XDSA 2EQRA 3KEQA 2JKRI 2R9XA 4CPKA 2PEXA 3GFJA 3F0CA 1TLHB 4AYBA 3L2WA 2VV6A 1K78B 3CDIA 4E6XA 1P92A 4Q1LA 2NS7A 4OQIA 3UPNA 3GFMA 1LSXA 2GIZA 3L9FA 1ERMA 1KVLA 3HDAP 1TT0A 2OZUA 2M0CA 5J6XA 3O2XA 5B5OA 5HX9A 4RDUA 3F1OA 4E3OA 2YSRA 3K4KA 5ICCA 2JHEA 4WMCD 5F82A 2Y2JA 1N4OA 3RTYA 3S7OA 1SU3A 5JYOA 1T6SA 2AS5F 2RN7A 3OSFA 2WKQA 3H82A 5I0LA 2VASA 3IKVA 5CVJA 1IDYA 2UZKA 3CLQA 3GTGJ 1MDMA 2PRFA 4PDKA 4YEJA 2J8YA 4E7LA 3FKIJ 2OI0A 1I50J 2PMZA 1N77A 2I10A 1CI9A 2Z2LB 1U5TA 1BI3A 2GJ3A 5DYMA 1PI5A 2L7ZA 2A6TA 5FO5A 1Z91A 4OQHA 4YINA 4OMYA 3GEZA 5LRRA 3UN7A 1JWPA 2J3TD 2PMHA 1XB4A 2DW4A 4R1HA 4A0ZA 3ZMTA 3I4MJ 2XDMA 1T38A 1L6JA 5D3CA 1X1AA 2A3SA 2Y9YA 3DTIA 3MWMA 2Y2OA 4BENA 5HS9A 2D1VA 1VNDA 3UNWA 2OAP1 3JVVA 3ZN1A 3HCYA 3ITAA 3MVPA 1OCZH 3S8PA 1R4MB 2DK8A 4ZJ1A 1YMSA 1BW5A 3TOIA 1GSWA 3Q7ZA 1IV8A 2DCEA 1L0DA 2QHKA 1JT0A 1TQMA 2PMZN 2R78A 2XEPA 4X56A 2M5WA 1FSEA 3I3LA 3S7NA 3TVCA 4EJWA 2M8EA 1N9LA 4OMZA 2ZLYA 4E7SA 1R1HA 1SVLA 2DMUA 2FFFB 3ZDJA 2BW3A 2WA0A 5FKOA 1XGJA 1RP5A 1SRPA 2EX9A 3EHXA 2JT1A 2K9LA 2M7AA 3BTJA 4C2MJ 3D4FA 4FCFA 4GHIB 2DMWA 2VPRA 2LKSA 4DE3A 4S2NC 1Z3JA 4ZDPA 1VETB 2DJNA 4GO1A 4M6VA 4A3CJ 1QU3A 3E6DA 4HSTA 2PT7A 2W0NA 5FLXZ 3C4PA 4JGRA 1Z6TA 3MKWB 4IOAF 3IBRA 3K7LA 4LV3A 2DA5A 1VQ4I 1XD7A 2AQFA 1PUFB 4Y3IA 3TDZC 1AU7A 1U3EM 3O88A 5KSHA 4IRGA 2HS5A 2ZQ7A 1MXOA 2NOGA 4JOMA 4RAZA 4DIQA 1VQMI 1UELB 1E25A 2K4BA 1SC7A 4HLYA 3DWKA 1MWSA 2R4GA 4HQEA 3CDHA 2XHKA 3T4QA 1T1CA 1PYVA 1SAUA 1VFCA 5F1FA 4PHTA 4A0YA 2V26A 4AC0A 1L2SA 1FP2A 4WLAA 4ZYDA 5LBRA 2CV1A 4CYCB 5K7ZA 2NS8A 3CMMA 1QIAA 3KFWX 2M1BA 3FXKA 4AVPA 4FU4A 3FXJA 1XC5A 3I7JA 4XONA 1XMAA 2TCTA 5LRSA 3FXUA 1GXPA 2VQCA 2SRTA 1N9BA 4UVBA 1RR7A 1U6GA 4ZAMA 4WEJA 1B9NA 2YU3A 1IACA 3W2ZA 1WJBA 3GTLJ 2EFWA 2Z2DA 5HL1A 4S2PA 3G42A 1IXCA 1WRJA 2QQBA 4DXBA 3RZDJ 4EJOA 3NECA 2BOLA 3BTIA 3A03A 3HGGA 5JI6A 2ZQAA 3CWFA 2Y2KA 4WEKA 5AQ9A 1QJJA 5TGTA 3CD6I 1PWVA 4GR8A 3VOEA 1IKGA 4GZBA 2ZFUA 4D7NA 3N8SA 5G4ZA 2RJPA 2KKOA 1MW7A 1REPC 1CJFA 3C2WA 3EOIA 1RCJA 3DNGA 3SYTA 5EJCA 3HOTA 1C0WA 4MGRA 1EB6A 5F1RA 2PJTA 1Y93A 2ELHA 4ENNA 2OVXA 3WGGA 3ABLH 3JTHA 3AL0C 1G28A 2ZXWH 1OTIA 2CUFA 2H09A 5L3DA 2IW5A 3Q82A 5CECA 1NTCA 1PW1A 1IO2A 3MR0A 3K4CA 2F4OB 1FBSA 3OYKA 2MYSA 2NVYJ 3T4LA 1AOYA 2OQRA 1FOKA 1BKCI 3U2AA 4ESFA 4CCNA 1NRFA 1SMYF 2CFOA 3KSFA 1HSTA 2KZGA 1DY6A 5FL3A 1CQRA 2B02A 2K9MA 3L9KA 2QKMB 3M1CA 2Y75A 2ZOHA 2DMNA 4ZZDA 1ES2A 5J7EA 2X02A 2XVCA 2ZMFA 3S2WA 1RUOA 1SFUA 4HSRA 2CC1A 2N8GA 5F64A 4Y2FA 2L02A 1FPQA 1ERDA 1K4FA 2VT2A 3RSNA 3FBNB 2KIMA 3RI4A 4Z6YA 4Q5SF 1QMFA 4GF1A 4WKEA 4L7AA 2OJED 3S2DJ 2XF3A 2E7WA 1VM1A 1D1CA 3D5LA 3BQ8A 4PMAA 4PJNA 3DWBA 1OTDA 2Y79A 3FWLA 4NKPA 1PZOA 3MMYB 2IWCA 2OAQ1 1KGSA 2XGCA 1LLBA 4DF6A 1FOFA 1XX5A 4HIAA 4ZTFA 4BD0A 1JT6A 2ZJ2A 3PNVA 3JSOA 2DFHA 1LDJA 3V67A 2G2WA 1WGXA 4ETSA 1H8MA 4DRTA 1TVFA 1K56D 2E34A 1G9KA 3PIOF 1JE8A 2DBBA 5GP9A 2PJPA 3HL2A 2DNSA 2ZC4B 5BPIA 5A2QK 4M9ZA 3NIAA 4NXEA 4JA1A 1AWIA 4A12A 2DT5A 2YUSA 3ABKH 3CO6C 5FLXK 5F1GA 4BLMA 2EFOA 2M4GA 2HDDA 5G4YA 4E3MA 1PUEE 2K9SA 3G4PA 4HNVA 3LIKA 1C3BA 1D8KA 5ILVA 2G7HA 3GMWA 3HDDA 2DYSH 1P6RA 5CQGA 1HC8A 1XA1A 2V0WA 3ISPA 3H9GA 2FX0A 4QWOA 3LSHA 1ONHA 3K2ZA 2L1MA 1OO9A 3LCEA 2COMA 1L3LA 5I94A 4P1WA 2IS2A 4Q0IA 1KA8A 4LITA 2ERPA 2EIKH 2NNYA 3SH9A 3UMEA 2Z6DA 3OOVA 4K2EA 5F6AA 2V1DA 1SFKA 1LI9A 5CXAA 1PIOA 2IP2A 1I2WA 4ESBA 3WE3A 2NVTJ 1U8RA 4Y0TA 2L4AA 3SXYA 4QIWN 1S7AA 2MC4A 4NETA 4YELA 1HQCA 3DXJF 4P0MA 2W13A 1LVKA 1DRMA 4RX3A 2F6CA 3VPRA 3A01B 4X1EA 3ZQIA 4KITB 2DW2A 4AXQA 3IWQA 2KP6A 3FBIB 3H5AA 4XOTA 2VE8A 2XFTA 2KRJA 1HCRA 1U5TB 5E17F 1YLTA 3PSFA 5EM0A 1R5GA 3F9KA 4MO7A 3VDXA 2VZWA 4IUHA 4K0WA 1QQIA 2ZD8A 4DBQA 4XORA 3S17J 3K69A 4CCOA 4YFNF 3FG8A 2JT5A 4RGUA 1OJLA 1IRGA 1SCWA 1D3YA 4NXGA 3R0AA 3HPHA 1R1TA 4JYKA 4YIRX 1L0GA 1WNIA 4J00A 2V9AA 3PBQA 4X6TA 1BC8C 1UEAA 3UVCA 3IS2B 2WUQA 2OV7A 4NC6A 3LK8A 2A05A 2XH9A 2FV9A 3MXQA 2IVMA 2K85A 3HRMA 3H1CA 3KLOA 2QYBA 4Y0UA 3VODA 3UB5P 5E3MA 4KQRA 5FQJA 2FOKA 1I76A 4B09A 3L2UA 2P6TA 1K79A 3JRGA 1MKMA 2R7VA 4CYCA 1ZG1A 4UV8A 4NQWA 3H9QA 5J4EA 1A6QA 1CEGA 4S05A 1IADA 5M3FJ 3IXHA 3L0TA 2IXSA 1K6YA 3EDZA 3V8KA 1LJ9A 1I39A 2J9PA 4O01A 3S2HJ 5CGXA 4E3LA 1G12A 1PYYA 1OM7A 1ZH5A 4A3KJ 5FKNA 3L1PA 3ESWB 3KP2A 3H9WA 5CEBA 3ZMUA 3FYZA 3IQAA 2L9VA 1GT0C 1D7XA 5J4YA 4II7A 3CCMI 3OS0A 2CQXA 1CF0A 2WGWB 3IWZA 2W3EA 3F6OA 1BN5A 1X1PA 2DQLA 1JHFA 4MBHA 2F4IA 2E35A 2TRTA 2HVSA 1KUHA 3BDDA 3BCAA 5K7FA 4UUVA 2LOOA 3FZCA 3K70C 3LQ0A 3KZZA 2IGOA 4F94A 2V4JC 3OYLA 4MNUA 1KQ8A 1UG2A 1ZGJA 5L8MA 4LLGF 1EAKA 1V5GA 1MMQA 2JNPA 2TDXA 1A6IA 4KA4A 2PN6A 3G1MA 1OMIA 1UTZA 5AONA 3F1PA 2LKPA 5IOYA 1Z6RA 3IKTA 3CZDA 2XA7M 3O3VA 1ZN2A 2Z2MB 4MMNA 1H0MA 1J5YA 3LSMA 1PRQA 2Y2NA 4GS9B 5H2FC 4KZ4A 3T4TA 3HLCA 1ND1A 3BTCA 3G34A 2AO9A 1YW7A 4DF9A 3GLLA 4G3WA 2QCOA 5ICFA 1YJWI 3IT9A 2CV0A 3CPTB 2OXZA 2GZWA 4NDLA 3ZN0A 3F22A 4BKXA 2R7XA 1XA7A 1XFXA 1K4TA 2XB5A 2K02A 5M18A 2QA4I 1R58A 2P0WA 5LGNA 3VWBA 3A01A 3JRBA 2IBDA 3HREA 4OKPA 3GSGA 2CW7A 3GVAA 4I02A 2BVMA 2J5PA 2JA2A 4PZJA 3COAC 1KDWA 4BQNA 2XD5A 4GD8A 4B4CA 2IS1A 1HFCA 2KMUA 4KDPA 2WGIA 2N8RA 4M74A 2R5ZB 4DV8A 5FKKA 1K54C 1T19A 4Y3OA 3PXPA 4HMAA 1NJ4A 2DFEA 1LI0A 2JUCA 5CVIA 5FDSA 3K1NA 3WE2A 4UUSB 4EGZA 4IRIA 3CAXA 2RV8A 2XQZA 2EXAA 2BY2A 2VK3A 5FQKA 4BL3A 2GWRA 3PO3J 4X69A 1QRYA 2QSGX 1MDMB 2Y69H 3S3NA 3PBSA 2P8TA 2EV0A 5K5OA 2D2WA 2ZBBA 2R7SA 3BM6A 5DF8A 3IWOA 1JK3A 1J09A 4QHCA 2RKHA 4A69C 1P2FA 3BQYA 4OIPF 2JBFA 1MBEA 2JSCA 2PD8A 4GLQA 2V0UA 2HP5A 1C8TA 4H49A 1SFEA 3ZMVA 1WJAA 2BXYA 3IWFA 3GYHX 4IUWA 2E3XA 3I5UA 5BOTA 1R49A 5E2EA 5J3LA 3WV1A 4MQ9F 1BKCE 3QP4A 4M3GA 4L0LA 3E0JB 5JR3A 2XAGA 3OYJA 3N8RA 3K9TA 5C5KA 3M8EA 5CTNA 1DP6A 1H9GA 3AG1H 2E1MB 5JYPA 3LUNA 5JLXA 1D8MA 1PWDA 4H6JB 1XDUA 1Z3YA 2K3PA 2B0LA 1VQKI 3B6CA 2H5SA 3TP0A 2GIVA 4Q0JA 4DMZA 3WODF 2LY9A 1VQ9I 2LY2A 2MH2A 2Y2IA 1QO0D 1X3ZB 1BUDA 3H9JA 3GLXA 1YTYA 1BIBA 1ITYA 1EROA 2JA5J 4NQWB 1MBKA 2WKRA 2XSSA 4U3TA 1FQGA 4P6ZM 4XT2A 4PKVA 3LSPA 2DDAA 3IHUA 2QPJA 3AFHA 5CKTA 4JP4A 3KZIC 3PFIA 3MJQA 4HJ4A 2HKOA 4BBSJ 4WKIA 3F19A 1Y56A 3PUBA 4A3JJ 3HHGA 4MIMA 1CGLA 1BL0A 4HP4A 1ZR4A 3SJMA 1AHDP 3T4OA 4CSWA 4II2A 2DA3A 3PSIA 1QPMA 1WKMA 1ZKGA 3LYXA 4HH3A 4UA9A 1QNTA 3DEWA 1YRNA 1RUNA 4C30A 2MLGA 3DTMA 1Q1VA 2I9VA 1IXSB 5GPCA 3N4MA 1FSYA 1RR8C 5EEHA 2ZJPF 1B8IB 5CRFA 3VP2A 2EA4A 3CTAA 2AYKA 2IRFG 3RQ4A 4B3XA 5JVTA 2STWA 5FEGA 3UE3A 4PKRA 3NOTC 4HQMA 1P0ZA 1UHSA 3M07A 4PGGA 3W2WA 3BT9A 3KSHA 4B4XA 4XSXF 4EUVA 3SHIA 4IHXA 2W3GA 3EUHC 2CQKA 2CUJA 4G6DA 3S32A 1UMSA 3LR5A 3D72A 1WQ2A 4XIDA 5F27A 3HLFA 1WA9A 2PMUA 3I71A 4N92A 2QGUA 2ESHA 5HS8A 2BVLA 1FILA 4X55A 1XSVA 1MMSA 2VQHA 1YE9A 2Q1ZB 1HW1A 1ALQA 4HDVA 4HV6A 1WJFA 1E17A 3WRTA 3MKYB 1OR7A 2X51A 3ZG9B 1FEXA 1F1ZA 1ACFA 3GR2A 4M71A 4LV2A 5FAPA 4QPOA 1XCBA 3IRRA 4HH2A 4M9XA 5IP9J 3N97A 2OTLI 4JGOA 1JJ8C 4EFSA 1LQ1A 2M45A 1AKHA 3U2RA 1NHAA 1WH7A 3TO7A 2BY1A 3CJTB 1ZLKA 4XUZA 1XGNA 3OBFA 2Y91A 3VYTB 1M1EB 1ZG4A 1ROSA 2A24B 3RZOJ 3EHYA 2KJCA 3J81Z 1DU6A 5IYCJ 3OCNA 1K54A 1UHWA 5CGSA 2WC2A 5H6RA 4EM1A 4MTDA 5KSCA 2X9DA 4YG2F 4D2OA 1LDKB 2FV5A 4JGQA 3QNBA 2DA6A 3E2KA 1W5DA 1LL8A 4J01A 1OCRH 2ZCWA 1LL9A 3GZNB 2D02A 2QZ6A 2ZOIA 5EPHA 1JAQA 1IAEA 3P98A 3ECOA 4OPYA 1GHPA 3HJIA 3T4JA 3LA3A 3KEJA 3CI6A 1IAAA 5IT9Z 2X0LA 1YMXA 3A4CA 3GMEA 4KYWA 1SKOA 4MQVA 3N6IA 5L09A 2W0DA 1T1AA 4G7ZF 1S1YA 2Y2LA 4DZPA 2JK3A 1B8IA 2KRHA 3WS5A 4B3AA 3BR6A 4Y13A 1ZGWA 1KUKA 3LILA 3E4OA 3BR3A 1HZOA 4EATA 3W4QA 1BI0A 2F5VA 1ZHFA 2VPLA 4EVIA 3F1OB 5EG0A 5EVEA 2DFFA 5GPAA 2ECCA 4OPRA 4B1RA 1JGSA 4B9OA 4RB2C 4EESA 5HPIA 4IL6C 3BY8A 4HBUA 1IN8A 1G3SA 4BUPA 5K7HA 4LLLA 1CEFA 2E60A 5FRMA 3IX3A 4QU3A 3TKYA 2ZBKA 1X1BA 1XGOA 1EKEA 1ZARA 3NRVA 4PSXA 3A3FA 2LB5A 2VV8A 3LFVA 4GKUA 3ZFZA 1R71A 4Y4RA 3CC2I 1PW8A 3CUEC 1W1WE 4XRSA 3KPHA 2X3BA 3HPGA 5JMYA 5CGWA 3CQZJ 5D5WB 1E0EA 2ZC3B 3UB7A 1FC3A 2MLKA 3G71I 4JXSA 2HOSA 5D6EA 4HDUA 3ABMH 4OAZA 2QUFA 2ID6A 2X1CA 3V42A 3KLNA 2HPBA 2FRHA 2VGJA 3ZNTA 2X7MA 1D5JA 4XRSG 1R00A 1Q2QA 3QWLA 2FZ0A 4MFDA 2DA1A 1I3QJ 5B5EC 2A61A 3KP3A 1RETA 4BHPA 2OU2A 3DEUA 3DBLB 4AVZA 3B6AA 5HNHA 1TP4A 1BOAA 1W7PD 3CO7C 1KGGA 2Y2ZA 2WAQA 3K4NA 3LSKA 4W97A 3CP8A 4XMYA 3WGIA 3GTQJ 1FY7A 2H6BA 1XJ2A 4MN5A 5E2GA 2GX5A 1IYOA 2JCHA 2QBYA 5I5LA 4JX5A 4ZDXA 1U5TC 2UXNA 1YO5C 3SW1A 4H2EA 4IJOA 3GQZA 5FROA 1G4DA 1HOVA 3CP2A 4BBRJ 1Z77A 2WAFA 1DP9A 5HDNA 5IOZA 3B8ZA 2K3FA 1O3TA 2ERQA 4XN3A 5C4XJ 5EECA 1S4SA 4UVCA 3SH7A 1MBJA 4Q47A 1MKIA 1TS6A 3P24A 1RI7A 1X2NA 3BQAA 5HDSA 2HZTA 2L5QA 2CU7A 2KIUA 3QQAA 2O99A 3FPWA 1R9TJ 1TTYA 3IHBA 4R1GA 2HZ5A 3TT4A 3C7UA 1SLMA 1X4OA 4BJ6C 3IRQA 1FYMA 1JTGA 2FBHA 2KRFA 2A49A 3GDIA 4N9LA 2PJRB 1R54A 3ZVSA 1MZUA 1JIWP 2E1MC 2X48A 2OQGA 5DTDA 3VFHA 1XP4A 5A90A 3E0YA 2P7VB 5IP7J 2ECBA 4CZZA 4K08A 4Y7PA 1CIZA 1JKOC 2BG1A 4L0ZB 2FBIA 2M9HA 3T5XA 1FIKA 3BQZA 3WG7H 2ZC2A 1ZG5A 3KO6A 3Q7VA 1BYWA 4N0BA 2XK1A 2GOMA 4R3BA 3P09A 2OF7A 5E1ZB 2ADUA 2X4HA 3BP8A 1W63Q 3IWIA 1MMDA 5DCMA 1YKDA 3TSKA 2W25A 2M34A 3Q5FA 1ERQA 3MMHA 3QHYA 3T1QB 1TNTA 3SZPA 2W15A 2WO8A 3B92A 1HOMA 3H5RA 2D45A 5D5XB 3DPFA 2K9CA 3T1BA 5JHUA 5FLMJ 3CCYA 2K2GA 1VB6A 1ATLA 1K78A 1ON2A 1YG2A 2YUFA 1KUGA 1OJGA 3ZQ7A 4EERA 1HFSA 3PM1A 2R7OA 3TO6A 1PWWA 3EQVA 4S2OA 2HZDA 3AGDA 3KYEA 3G5CA 2ZJRF 5L7FA 3BG3A 2UXXA 4UHUA 3VOLA 2PU2A 3IX4A 5E20A 3CCVI 3S3MA 2Y2QA 2PD7A 1PP7U 1ETQA 2K86A 3K2NA 3ISGA 3ZVTA 2XC7A 2I5UA 1HDPA 2F4MB 3RKYA 3KE2A 4CYDA 2DYRH 5JFRA 2GQQA 2Q0OA 1A35A 2VLGA 3LQBA 1YJNI 3GTJJ 3EWJA 5FQQA 3S16J 2X1DA 2NRAC 1B9MA 3FM5A 4LRXC 4GJ4A 4OH0A 1SANA 4QLCU 4CJNA 1Z21A 4O7DA 5CJ9A 4EM2A 2OXWA 4IJAA 3ZRGA 3UB9A 2BE5F 3F72A 3I58A 4FHTA 2ELKA 2LNBA 4E4HA 2R92J 2AIGP 3ASOH 3ZXSA 5EGOA 2DPDA 4WXHA 2RQPA 5F08A 2DODA 3I7IA 1HKQA 2E7XA 3IXDA 4JF4A 3OL3A 3CMYA 3EDPA 1F9IA 4NNJA 3AYUA 4LLNA 4G12A 3F8CA 2EZIA 3M9AA 3E6MA 3FWEA 3G2ZA 3LICA 1O3SA 2VX8A 3RPUD 3BCBA 1V55H 3J7AO 3BW6A 2DW0A 3B2ZA 5C4JJ 3G4SI 4GFBA 1FLIA 4S04A 1RC9A 4K91A 4KZ7A 2MLSA 3HBVP 3I4NJ 3S7QA 4R4SA 2A6HF 3TP3A 1TWHJ 2HYFA 2QWWA 1G59A 4KG6A 5F04A 4I98B 3MSHA 2Y6CA 2D1HA 5LHHA 5FJ8J 1LHYA 1OPXA 2XASA 2K31A 3CJQB 5FSRA 2V9KA 2JA8J 2FBKA 3LSTA 1K25A 3FMRA 3GUDA 5AIPA 2OLUA 1GO7P 3MS6A 2EX6A 1ZLJA 3L7HA 3PUFA 4UAAA 5E8GA 2ZC6B 3OYFA 3U1KA 1I1SA 1EH7A 3B47A 3NOPC 2PR6A 3F23A 1YS7A 2X6XA 2HPMA 1DUXC 1EJ9A 4PFOA 1CQTA 1XFWA 1TQPA 5J4VA 3BG7A 2DMQA 4BQAA 4OIQF 1Y28A 2I72A 5K5RA 2DTZA 4EV4A 5D4SA 3KHIA 1QZZA 1YS6A 1ACIA 3T0YA 4HW0A 1WVRA 4WX9A 5EYRA 5FD5A 2EZHA 1TW2A 3TQNA 1OM6A 2OW0A 3BLYA 5EGOB 1YLYA 1CAQA 3TMOA 4CCMA 5KAFC 3L09A 3DSLA 3QU6A 9ANTA 4BYYA 1Y8RB 1KU3A 1DJAA 5TGFA 3CPTA 3LY4A 5J47A 2JZYA 2QVOA 1AWCA 4ON1A 2V6EA 5FRNA 5DKLA 2HVRA 2J80A 1Y4OA 2HR3A 4BGDA 3LUMA 4OOMA 2V1NA 2CUZA 4JF5A 4ZTKA 4LLOB 2EFNA 3NX7A 3TG9A 4YIIA 2VE9A 4MBFA 3MZ8A 2B95A 1XFVA 3WS1A 1RIOH 2ZFWA 4HRIA 4LB5A 1K4SA 5IY5H 3E6BA 4BQQA 2JUGA 4I3AA 2LF7A 1XN7A 3O2PE 3DU6A 1PDNC 1BSWA 4RM3A 5BQTA 4JXGA 1HV5A 1HD8A 3HM5A 2WZXA 3G2BA 4PSWA 3M8FA 5L2FA 3OOPA 2JRMA 2FMYA 4AIJA 5D4RA 1ZYRF 1XGIA 1MMAA 4S2JA 2BY3A 5J3WA 3DPLC 4J4MA 1OR7C 966CA 2Q8KA 3DF8A 4A3BJ 2BXZA 3HLGA 3LOCA 1R1UA 3C7JA 3DBRB 1TDLA 3KEYA 1PWCA 1DJBA 4IX7A 1QIBA 3TDUC 3K7AJ 1AKLA 3WTWC 1TS0A 1XFNA 3D1NI 1WHUA 1KAPP 4WK7A 2XA7S 4BL0B 4A3EJ 2VKSA 4WZ5C 2L3DA 1FBLA 1G4KA 1IEMA 3K7NA 4PKUA 1EH6A 3BR5A 3P9KA 3K0LA 4D5CA 1DP7P 3HOUJ 3IH3A 3SS5A 1R36A 1S67L 5GLCA 3U21A 1ULYA 3ZPLA 4PGHA 3EDGA 3V7CA 4AIDA 3BRMA 2GAUA 2EXBA 2E1NA 2XKOA 3V3RA 2LG4A 2VKDA 4LIVA 3UE1A 2MBFA 4XLPF 4HEA2 2ZQDA 3WS4A 5CUHA 1T18A 2NS0A 1SFXA 3MBZA 4ARZB 1UG0A 3I54A 2XFSA 2UV1A 1ETWA 4H4KC 2R7WA 3KX0X 3RJUA 2MJ6A 3SHFA 5EVIB 1P7JA 2DOEA 1NK3P 2XAFA 5HWTA 2JWTA 2VI6A 1VEUB 4V2GA 1BZAA 3MZHA 4L9NA 3LQRA 5JLWA 4RBOA 4HESA 2OCEA 2VT3A 4XKCA 2HP9A 3F18A 3MF0A 4GNUA 1NG6A 1NXYA 4KIBA 1T1BA 2HDSA 3KYQA 4F93B 5LFAA 2VKEA 1U8BA 5LHIA 4A93J 3H92A 4KZ3A 1LB2A 4BBTA 4CLCC 4R4RA 1ZKJA 1K38A 3KCCA 3U1DA 1Z05A 5C3EJ 3JRAA 3OPHA 3HUGA 5A92A 2DMTA 3ZXHA 1JAOA 4FUWA 4N9HA 5DCFA 2Y4AA 5LLQA 4M72A 3W6KB 3J7YJ 2F5DA 4BJPA 5D5UB 4UY8I 5FI7A 3L2QA 3HLDA 2Q2EB 1Y1VJ 3D5SC 4LG3A 4XOPA 1BIAA 2DQRA 2QKPA 5CVUA 1W8QA 3D9YA 4JXWA 2L0RA 5B5PA 3RXXA 2ISYA 1UAAA 1BA5A 3PO2J 4QPRA 4BQMA 3I53A 1JI8A 1XM5A 2VKVA 1WI9A 1O7FA 5HNFA 5CTMA 4LGWA 5TBMA 3MEXA 4RA2A 2BASA 1OM8A 2LYCA 4R38A 2PI0A 1OCOH 1R5HA 1XTAA 1Y8QB 2NVUB 5LGUA 1A0KA 1GA0A 2WV0A 2O9CA 1FJLA 1KU2A 3BFCA 3LIEA 2QLZA 1VQ8I 2J83A 2CQNA 4KQQA 3KYDB 4PM9A 3S7PA 4XM7A 3PAEA 2RDPA 1P9QC 4XRFA 1F4KA 4LRYC 1IYPA 3RCOA 2X1EA 4KG5A 2VV7A 4FH2A 2HDRA 3EUKL 2W1OA 4GYGA 3WWXA 4Z2YA 4KG2A 1WWXA 1CXVA 1X2MA 5IT5A 2H0YA 2M87A 1YLJA 2GXBA 1JIZA 1QICA 3HBLA 1SMPA 2HF6A 2TCLA 1Z3XA 1QHHD 4CCLA 4DW6A 2F2EA 3IH4A 4JGPA 1IYQA 3FDYA 5GADJ 1BR1A 1RNLA 1YLWA 3NY4A 1R4NB 1N9NA 2MSYA 4RLFA 1MMGA 3K4MA 4C9YA 4XLEA 1M6KA 3IH8A 4RM2A 5CZMA 4FE4A 1L0FA 3IH9A 1LEBA 1CQAA 3N05A 4GYIA 3KYLA 1SEUA 2PX9A 1QA6A 4C2UA 3S1MJ 1DP8A 2L4RA 2W82A 3K1PA 2GA2A 1IJWC 1JXSA 3MD2A 2EFXA 2H8RA 3NDGA 2HJEA 1S4RA 5LEKA 2HOEA 2DRWA 2V1BA 1K4EA 3PQKA 4DYCA 3M3YJ 3K4JA 5HDCA 3JSPA 4RMNA 5M5XJ 1DPUA 4IXAA 3A0SA 2B63J 1D0ZA 1DP3A 3D3OA 3PNTA 4N4OB 3LAJA 2CQ7A 4L19A 1XG1A 2B7EA 1WPKA 2M4KA 4MEZA 3UDFA 2M7UA 3E98A 4KZBA 3F8FA 1OCTC 4OU0A 4ETXA 3CDLA 2JA6J 1J0RA 1FR1A 1WI3A 1YLPA 4LCMA 3WHBA 4GR0A 2QWSA 4IHTA 3HUGB 1K6SA 5EVLA 1A31A 1T0FC 3C18A 2VKHA 3GVBA 1KYWA 2A2LA 4BBUA 2HP6A 3JCUC 3ECHA 3LIFA 4XCTA 1KGFA 4I0BA 4AYKA 2XGEA 2XUBA 1CGPA 2GDNA 2HQAA 4BE0A 3JRDA 1RGZA 1K0KA 3GFIA 2J7VA 1AF0A 1OYWA 4EQQA 1V5FA 1ZAOA 2XROA 1YM1A 3UY6A 3O8GA 5E2HA 2PU4A 1UMQA 5M3MJ 2W7NA 5BMZA 4Y17A 3IXGA 3CMZA 2HXIA 2R0QC 1ZC2A 2Y55A 4G7OF 4WMCA 1OCCH 2O36A 5CHJA 2O3EA 3ZCZA 3ZP5A 3KEKA 2VJ4A 1L0EA 3VYUB 2GZAA 2LY1A 3TSGA 4QB8A 4M6XA 5GHYA 4JPAA 1GHIA 2WGWA 4NC8A 3BLSA 5E43A 4BWIA 4HF1A 4M3FA 1BQQM 1G6OA 4G9YA 5HVQC 1BUVM 5EFWA 2M30A 4ZDOA 2P74A 3NC8A 3SZTA 2Y2MA 1BIWA 1FLSA 3KP4A 1HKSA 2OUMA 1BJZA 3HSEA 3FXOA 4MTEA 3R6SA 5F1JA 3ZVWA 4B4ZA 4KIFA 3IC7A 1XFYA 1YAXA 3H7WB 3CLOA 4WXDA 3SH8A 3TW8A 5MC7A 2VIXA 1XFZA 2EROA 2EINH 1MIJA 4GHIA 4KUKA 2HYJA 1FTZA 4P85A 4GDFA 3ULFA 4JBFA 4BD1A 2WK0A 1Q2PA 4C75A 2GBYA 2MH9A 1MMNA 1XX2A 2VGLM 4LB6B 4FXYP 2PLYA 4PJJA 1KE0A 3BG6A 2XDVA 2LH9A 4I76A 4EEFG 5ED4A 5K5QA 1U60A 5FA7A 1TWGJ 2XS4A 1FOWA 1XGSA 5E1WA 3C1DA 2USNA 1S3JA 2EX2A 2XAQA 4BEHA 3LSGA 1X1DA 2YS9A 4GRIA 2A24A 3UR3C 2KX6A 3Q2HA 3IAM2 2CMNA 5HAIA 4WZVA 1MJAA 4E3IA 5ILUA 3HOWJ 3DBAA 1QJIA 3FMQA 3A3IA 5LBQA 1K56A 1L0OC 2FEZA 5GAGJ 3H3VK 5G18A 5BNGA 4E7JA 1OCPA 2HXOA 5L79A 3SZGA 3OYBA 1G8XA 3RJPA 4CO8A 3HBRA 2DDBA 4BACA 2RNJA 2EA9A 1I27A 3NHQA 1EI5A 5DFYA 5IU1A 1XPBA 4XXRA 2R7ZJ 2NVQJ 2C5WB 4HX7A 4ME4A 1V9ZA 1IUFA 2RREA 3T8RA 1EWZA 3HOZJ 5DCMB 5GTHC 4AIKA 3OYCA 3HUMA 2QKLB 1BLPA 1VQPI 1JTDA 4R3JA 3OHOA 2EK5A 1S6LA 2HEOA 3SDGA 2HQ5A 2LLKA 4HEFA 4QKZA 1BM6A 4JK1X 4I3JA 1JVJA 3B3XA 3CCUI 1FIPA 3UB6A 4NK3A 1D8FA 1JUSA 2XF7A 2BLSA 1K57A 3OWTA 5F83A 2DW1A 1H8YA 3LFKA 1D5YA 2W14A 4I09A 2HFHA 2PBIA 2R5ZA 2G7UA 2O9AA 2BY0A 3EDHA 5KZHA 5CQEA 5BOXA 3MZFA 4IBRA 2MA3A 1ETOA 1ORKA 1MJBA 4GCZA 1T08B 4GB7A 3H0DA 5IT3A 1UHMA 4LV0A 2DDYA 3LKAA 2JVGA 2XAJA 1GLNA 2VB6A 3UO9A 3HLEA 1LKXA 3O86A 2ICWG 3G1LA 4FQGA 2E2JJ 3TGNA 1LE8A 4BY1J 4JBAA 2W1TA 3KWVC 4L9TA 3SDBA 4HA8A 4HAMA 2JN7A 4KZAA 3EDIA 2ACJA 2M8GX 4PM7A 2Z3YA 5IYBJ 3FK7A 2WY7Q 4XQFA 2P9VB 3FXQA 4H0EA 2RC4A 3GZ5A 1T8IA 4HV5A 1TVIA 5EZHA 3KYCB 1UFMA 3HOXJ 4L0YB 5E2FA 1NY0A 2CG4A 1XKZA 5TFQA 4PFPA 3ZMSA 3GO5A 1RPWA 2OAZA 4PKTA 3Q9SA 3SFIA 1F5TA 3EPZA 3QP6A 4UXNA 4E04A 4NUBA 3MKEA 1I73A 5AVEA 1TS8A 3BPVA 3WTXC 2GNXA 1AXBA 2ZXHA 3IAS2 4RAGA 3VB2A 1BLSA 3G35A 1BT5A 4NXBA 2FH5A 1I1IP 2XS3A 4CTHA 2ZC5B 1W5CC 4EM0B 3ERED 4CUGA 3OYAA 4KNYA 5FEFA 3K4BA 1J7NA 3QP1A 3OL4A 2QENA 4IVNA 2BEOA 3HHHA 5DV5A 5E3OA 2STTA 1O0QA 3HSFA 4LMYA 4PKYG 4ZRRA 3ZQFA 1IF1A 3RTSA 1USSA 3Q0VA 3NCKA 1B3DA 3UDXA 2CLTA 2IA0A 3TOAA 4OVDA 1SKOB 3W3CA 3HBUP 2NXNB 4Y7NJ 1ODVA 3QYEA 4GWMA 1BBYA 3OPRA 2OD5A 5AIQA 1P97A 1GV5A 5ICEA 3PAGA 2EIJH 5F68A 3HUNA 1VQOI 3P7NA 4RB1A 2VJWA 5A2QZ 1Y0NA 1RESA 1IRXA 4Q4ZF 2KHMA 3GZ6A 4H6JA 4PKYA 4WF0A 1B59A 4A6EA 5HD5A 2M1CA 2LTPA 5FFXA 2V2FF 3M2KA 4CH7A 4C2TA 1JGGA 1ESUA 4XLNF 3TW7A 1OTBA 2VBXA 1XCVA 3X2QH 3A0RA 5IT9K 2PYPA 3ZG5A 1W0TA 2JTVA 4MEXF 2DTRA 2KRCA 4OOIA 4MCWA 5DF7A 2V8FA 4DE0A 1S8NA 1IYSA 3OYEA 1GUUA 3WTUC 2E2HJ 4O8GA 1EA3A 3ELKA 3FKJA 5H20A 3JYIA 3IHAA 1EUBA 2XV4S 2JSPA 2QSHX 2IS4A 3HOSA 4ITVA 1MBGA 1PZPA 1ZK8A 4R70A 5EZGA 5HLGA 1MBFA 2QJ5A 1XS9A 2W27A 2Y2GA 1H5XA 5DUIA 3AAFA 1B8YA 3QODA 2XRNA 4ANJA 2LC2A 2BHZA 4YWZA 2DA7A 2HGCA 1J7KA 1NG7A 4GXOA 4PUSA 4ENMA 5B1BH 3CCLI 3CESA 1YIJI 4ASNA 1O4XA 2YKFA 1HTZA 5L3FA 3E4QA 4UA6A 1ONVA 2COBA 4S2MA 3LFUA 1Y6IA 2AHQA 2X6WA 5CVRA 2G2UA 3VOYA 4G9LA 3VYRB 1YPRA 4YOFA 5M1AA 1Z9CA 1F2KA 4KZ8A 5EF6A 3DFGA 2O7OA 3ZQLA 4JQFA 2R7DA 1H8AC 4R23A 1ZTUA 2JIHA 4OOYA 3WS0A 3R4KA 2KDZA 1PWQA 4GW9A 4OP8A 1J9MA 3DP7A 4AFIA 3DU5A 4ZYGA 3DKXA 1OS2A 3VFFA 5FKMA 4MDZA 1TS7A 1O57A 3HRTA 3F21A 3QAHA 5KNLA 2A68F 5J8XA 2X6YA 3M8JA 3I7GA 2HDQA 3QPTA 1YOUA 1FOYA 1P4XA 2H0TA 3IF5A 4OPZA 1YQAA 2DPUA 4C3QA 3BPXA 3AL0B 5DTTA 3HOVJ 3DV8A 1A86A 2XAHA 3V5MA 2DI3A 4ENJA 1GXQA 2IAIA 2IGKA 4EBNA 4CICA 3K70D 3JAMK 4BDYA 1HVBA 3T12B 2F5EA 1I6XA 3PNYA 5E1XA 1FX7A 2A69F 4XN0A 3DLLF 2V9PA 4NHJA 3J81K 3B42A 3QYFA 4R79A 1D06A 2Y0MA 4RYEA 5DF9A 1R6RA 3BTLA 1S7OA 3HYIA 4EU0A 2LD5A 1I3AA 5DM6F 1ZTRA 1TDGA 4Q0HA 2FD5A 4W1UA 2EWNA 4S0HB 4AD9A 2WAEA 4Q48A 2Y30A 1LL5A 4BJ5C 1F43A 2L7KA 3EGDC 4IHQA 2E8JA 3RYPA 1YSQA 3UE0A 1TEMA 1H3QA 5IPAA 4PAUA 4KN7X 5J1RA 4KZ9A 3BFGA 2WV1A 5H6QA 1AKHB 2ZXJA 4WYYA 2JKTI 2VBZA 3ERMA 4Y15A 4WN5A 2QYOA 4ETZA 2EB7A 5D3OA 2XPUA 5I43A 5D1SA 4FT8A 1S72I 2IPQX 1X19A 2WADA 2L9SA 3I59B 4RAFA 3T8TA 3W8KA 2FQ3A 3LR3A 4ESPA 4L63A 4LV1A 3WTZA 3ZCOA 3OS1A 3GW2A 2XRLA 3TW6A 4FSFA 4U0YA 4RQ9A 1JUPA 1QGPA 2RJQA 4XSZF 2NUPC 4NB5A 1DTHA 2E1OA 1K61A 1C7KA 5FQ9A 1X1CA 3BJAA 4V2FA 3CHWP 1MH3A 2Z2SB 3BFDA 1SVMA 2W1TB 1MPLA 4L5EA 5DKKA 1JJ6C 2Y2PA 1W4MA 4G3KA 3CCRI 1O7EA 4A0XA 3GWZA 3M7GA 2EX8A 1PWPA 4A3GJ 4YRVA 2LB9A 3N4IA 1R55A 4HP9A 3V96B 4U7DA 3C38A 3A3EA 1SD5A 2WOAA 3TOBA 3LJGA 2KDOA 2ZNYA 3M4OJ 5IHVA 4A5NA 3ZR8X 3OCLA 2KT0A 4OLGA 4UB6C 2Z6CA 3RFBA 4Q8IA 2QPNA 4I99C 2DA4A 3A02A 4GCVA 5KVRA 3ZQGA 4II3A 2H27A 2YPRA 4UVAA 2IS6A 1UGUA 3FC7A 3N2VA 1IRFA 1SMTA 3VI1A 1KYZA 2H6CA 2W48A 3P01A 3EQLF 3D0SA 5HWVA 1XSXA 5EVIA 3HOYJ 3EYYA 3M2JA 2OA4A 3S14J 1SVOA 1KOUA 2W84A 4FETA 4HNTA 3JRFA 1MC0A 3BZCA 3NJAA 5FQIA 2V4BA 2NUTC 4BDZA 3FX3A 2INWA 5F5YA 3J7ZI 1BR4A 3K2AA 4OAYA 3IF6A 2HDWA 3Q0WA 1FSHA 2MFZA 4EXOA 3R60A 3LNQA 1SKFA 2OTJI 3SS3A 3VP0A 2BZTA 1KU9A 3FXMA 2LP0A 4EGYA 1VETA 3DPEA 3CUQC 1ZR2A 4HF2A 2A5WA 2PAVP 1H88C 4A5MA 1UWNX 2Z16A 3K10A 3GXOA 4M9SA 5DD8A 3V7RA 2JA7J 2NAZA 3LIDA 1IV6A 2OBPA 4GN2A 4FX0A 5HDGA 2R7RA 2B18A 3E8RA 2ZQ9A 3IX8A 5AJGA 4HZFA 1VEUA 4G7HF 2JVHA 4V19K 3PBRA 2H28A 4N1HA 4I03A 4DN0A 1UJ8A 5GL9A 5I2ZA 1TWAJ 4GR3A 2W3FA 2HOAA 2Z5UA 5L10A 2OSUA 2XPVA 5IYDJ 5F0CA 3W6VA 3CF2A 4DYQA 3G31A 2CMPA 5FB2A 5D8KB 5FDHA 3CUOA 1ZREA 4CZCA 3IXBA 5B3SH 2CFXA 2W3HA 2KPMA 1CK7A 2J3WA 3KIOA 3Q9VA 1FNNA 2P5LC 3Q7VB 4IF4A 2V9VA 1G6AA 2RCXA 4QPQA 5CHUA 1OTEA 3K3CA 4XLHA 2ZM8A 3OC2A 1KUFA 1YT4A 1GVJA 5BPAA 3FHNA 3C2GA 1QZYA 4MLOA 5KHDA 1I6HJ 4R8HA 4KZ6A 1G6NA 4QY5A 2VQGA 5HOOA 2R9WA 3ZMDA 1UZCA 1XJ6A 1LSVA 1GE6A 1R22A 2VBWA 4OWRB 4HG2A 1XJ4A 3WRZA 5LABA 4AYBN 2QF7A 5M19A 3DLAA 3KP6A 1U0JA 4XKVA 4KISA 1GA9A 2PYRA 3ITBA 3T4SA 1IN5A 4ZR5A 5LEJA 2OW1A 3GBGA 4NEED 3C30A 5D1UA 3WGHA 3KMCA 1ZELA 2ZMEC 2V1AA 1ZRDA 2XPWA 4ON0A 1D0YA 4IQ4A 4RGXA 4HX3A 3WTYC 4M73A 2W00A 4B8XA 3O6BB 1IZ1A 2W3DA 3CG5A 4F55A 3CJMA 5L07A 3WTVC 4M4XA 1QUAA 1WJDA 3GTMJ 3PQJA 1YRNB 1U78A 4RB3C 4RVAA 1I5ZA 2P81A 1MBLA 4HOIA 4IHSA 1FCNA 5GHXA 4EW7A 1SATA 3WU2C 1CGFA 3MZYA 1LFUP 2WB1N 2BTFP 2A6EF 3O8HA 1APLC 3A0VA 5TR7A 1MMBA 2OZRA 2DO7A 3HKZN 2FUG2 3H3ZA 1TWFJ 2H10A 4FX4A 1LDDA 2HKXA 6PAXA 2ZL1B 1NRJA 1YW8A 4L5JA 3P9IA 4LOCA 2QJ7A 3DAVA 3VEPA 3D5RC 3PTEA 1JHHA 4EBLA 1ODDA 5L3EA 5GAEJ 1OQYA 5FASA 4WXCA 3BROA 3PBOA 4I38A 2OPTA 3S15J 3GFLA 2RVCA 5EV0A 3BECA 4LG0B 2DOFA 4BS9A 4NXFA 3HY9A 1BSGA 4E6KG 3GCMA 3HLBA 2ELJA 3MQOA 1IN4A 1XSDA 4UA7A 5HWWA 1JANA 5BS6A 3MKZA 2CYYA 2NOJB 2QZ8A 3FXLA 3DTKA 4F52A 4IEJA 2ZM2A 2CW0F 5F0HA 1YJ9I 1IAGA 4PKWA 2CWEA 2NNNA 5DVAA 4IJGA 1J2XA 4OPQA 1IC8A 4GGGA 3Q81A 4BHBA 2VXDA 3O87A 4ZBEA 3ZG7B 5E3LA 4BHCA 2HOTA 1FZPB 2FQ4A 2VGLS 4J19A 4UHTA 2GM4A 4E7ZA 2XAUA 2VA0A 3NI9A 3BR0A 2EFPA 3L7WA 5K1YA 1RKTA 3R7WA 1GE5A 2HJ9C 1G2HA 2EFUA 2PHYA 3Q1FA 1DJCA 2ZMEA 2C6WB 1WJEA 3R0JA 3OYNA 4ZYAA 4D5FA 3NULA 2FNPA 1IXRC 2ESNA 3LEQA 4F3QA 2M0MA 3U1RA 4LD5A 4C3IJ 1ZVXA 3OHLA 3CMEI 5DUKA 4L9JA 4F92B 2IA2A 2VLAA 1YFHA 3G32A 4KUOA 3UKGA 4IHYA 3ROUA 4BMWA 1ZRCA 3DL1A 1M40A 3GECA 2V7FA 2MG4A 2ID3A 3ABUA 3E3VA 4LJZF 2VOPA 3LA7A 3S93A 5TBMB 1K83J 1LSWA 2KIFA 3Q3SA 4UV9A 4N9KA 5HL6A 3RKWA 5L3BA 4M3EA 5FLVA 2F5FA 1X58A 3A2KA 2LK2A 4M3BA 3B73A 1RZ4A 4G8XA 4XL9A 3I56I 5TISC 3H0GJ 2VOOA 1SDEA 5D7WA 1G5UA 4CCJA 1S66L 1VQ6I 1XGMA 4G6QA 4L5IA 4P9UA 1PP8F 1UCRA 3UNGC 3S1RJ 1KU7A 1E4DA 1GHMA 5FATA 3HKZA 2HU9A 2XSJC 1D7EA 1J59A 1BTLA 2WKIA 3ZQ5A 4ABZA 4CA0A 2MLRA 3RH8B 2WAQN 456CA 2WKEA 2XKPA 2LBFB 4MLLA 1HXDA 2Z33A 5J40A 5KMWA 4S2KA 4P9FA 4BNCA 3BYDA 1RMZA 2W12A 3OIOA 2GXAA 4OQGA 3AYKA 4EMSA 4HBTA 1LEAA 2EZLA 3H3UA 3LJZA 3FKVA 2EBIA 2Y0SA 2DDFA 1JWZA 4S2IA 1MMPA 2RQQA 1HW2A 3LR4A 1A85A 2OW2A 2WO9A 4XUXA 4QTRA 2O5RA 3VE3A 3I55I 1BLHA 3JREA 4Y0OA 3HLWA 1MH4A 4X1LA 3E1SA 4BXUA 4DDYA 1HW5A 3MQ0A 5D8LB 5BOYA 2BBYA 2QSFX 2WWYA 1D5VA 4PKSA 5IP6A 4A3DJ 1EW0A 2KJBA 2VXZA 3IL2A 4E7KA 1IUYA 3DW0A 4LRZE 5EOEA 1G3YA 4ARZA 4P55A 2VEAA 1FMWA 3L2RA 1O07A 2LDUA 2PBYA 4L9FA 4RA7A 1E3OC 5GLAA 5HD3A 4ZJ2A 5IS1A 4ZH4F 1G05A 5B66C 1BUEA 1ESIA 2DN0A 1GHCA 2XF6A 4C3HJ 4IOCF 5HZHA 1IOUA 2P04A 4QWQA 4AIGA 3F15A 1BQOA 1J3WA 3SS4A 4IRHA 3G1OA 3SQNA 2OC6A 1VQLI 1ES3A 4H8RA 2MC3A 4XM8A 3OS2A 3BEBA 2DK5A 4DKIA 3TEDA 1VHMA 5TRDA 1VQ5I 2IJLA 4P96A 3OY9A 1ETVA 4OLDA 2CSOA 2ZC7A 1IN6A 3N8LA 1S9HA 1N9OA 1VQQA 2K2NA 3EGXC 4G3VA 3BR1A 2ZB9A 1W7PB 1POGA 1YX5A 3M6BA 4S2NA 2OLVA 4KMUX 1FCOA 1NZUA 5EG0B 2H1KA 4I3IA 3ZYTA 1MWRA 2JN6A 3DWLE 2DXIA 2P6SA 2M2EA 2K40A 2V6CA 1SZVA 4ENKA 2CJJA 3S1QJ 2QQ8A 1UWPX 2JT6A 3MFDA 4BE2A 2VJJA 2FF4A 1P4AA 1U9OA 3F3XA 1JKPC 3K6GA 4CHUA 4JF6A 3E5QA 5I12A 5U47A 2L7FP 2R7QA 2YU9J 2DT6A 4D9JA 1W8YA 2PFBA 3FIWA 3LIBA 4DD8A 3CZ6A 1H71P 4A3FJ 4GQLA 1O0TA 2O3FA 3BFEA 2B5RA 1Z1DA 4I01A 1X4PA 3LL7A 4RS8A 3OR1C 1MNDA 1IDZA 2WYXA 1JWVA 3HJKA 3G6EI 1DPRA 4HOBA 2KIQA 5HARA 3IS2A 4E7HA 5KK1A 1OMJA 3CCQI 1K7AA 1ZQ3P 2FE3A 4RLQA 1W79A 5D1TA 4BQOA 2R5YA 3OYDA 3K3DA 2JKTM 1BKCA 3H35A 2UV0E 5ILSA 3GV9A 4O6JA 1JAPA 2ISZA 3EEHA 1U9NA 5EUAA 4H30A 2HWVA 1B1BA 2YX4A 2P9VA 1D1AA 1UMTA 2IA1A 4YIFA 2LBFA 1WZ2A 4Y33A 1C3IA 1IN7A 1PWGA 4WELA 4I35A 3R61A 4IZZA 4Z9QA 3HRSA 1HF0A 1BJAA 4XNFA 3AGFA 3BWLA 5A93A 3E7LA 4D0PA 3IV5A 2EWWA 2W57A 1YSPA 3BJOA 1W0UA 4E6WA 1NYYA 2KDKA 3R7WB 2OW9A 2ME6A 1V9YA 2J0TA 1IW7F 3C3WA 4U0VA 2H1LA 1VQNI 2D01A 2L0WA 4Z1WA 4N1XA 2MABA 4GS9A 1KE3A 3VP4A 1VI0A 2AVXA 2MZEA 1T56A 3I64A 4HNUA 1XJ3A 5FI2A 1NWZA 2VODA 3JPUA 1OS9A 1DGRM 5DDGA 1YLZA 4ZZLA 1GCEA 1LNWA 2EA2A 2QQ9A 2RGVA 3HRUA 2KZVA 3IBJA 3KMEA 1XFUA 3GRJA 2YX7A 4KIGA 2Y6DA 3FXRA 2O9LA 2OY2A 5D5VB 4UNOA 4CXFA 2CRGA 5J1UA 3HGYA 2X85A 4CLCB 2RNGA 3CJRB 1G3WA 5J8CA 2EWVA 4DYRA 1ZP5A 1H9TA 3AIGA 2MD0A 3BY9A 3A0BC 3HTSB 1VF9A 5CHMA 1RM8A 5M5WJ 4XLCA 3F1NB 3BZKA 4IHWA 1BI2A 1F9NA 4WF2A 1W5SA 5DEQA 2JKFA 1FR6A 3E5UA 3V4GA 4CDGA 2D5VA 2HNHA 3F1AA 3S4XA 4B88A 5E79C 4KT5C 1F98A 4L9EA 4C3JJ 2LMDA 4C6YA 4FISA 3F16A 2VC1A 1OT6A 1YW9A 2M3AA 3LSIA 1WYBA 1TBXA 3E6CC 3RPUA 1GE7A 4XKBA 1NYMA 1PJRA 3FF5A 4UUTA 3RKQA 1HKTA 5HS7A 4GWNA 3LO7A 3TS4A 4IVKA 3IF6C 2E19A 1FBUA 4DJAA 3J80K 1PUFA 1QBJA 2L2OA 4FCYA 1ES5A 3QP8A 4KQOA 4OQ0A 5I4OA 1K6RA 3ZG8B 2EV6A 3QPHA 2P7CB 1JKQC 1G68A 4NBQA 3FHZA 1B72A 1ON1A 1N78A 1WE4A 2MD5A 1K55A 1Z0XA 2YR2A 4S2LA 1ZRFA 4QD4A 3O64A 4WUJA 3DWZA 1BM9A 2K4JA 4XM3A 2K7SA 3VP3A 1FSWA 4UQIS 4X1MA 4E3NA 1FIAA 2CUEA 4X53A 4B44A 4DXCA 1HDDC 1X3WB 4WM9A 5K5BA 4G6TB 3F1NA 2J9OA 3S22A 1N25A 4KZ5A 3HB9A 3OIQA 3WV2A 5B1AH 1IGNA 3ASNH 3JRHA 1ZG6A 3LI8A 4B47A 1JKRC 3WG9A 4AIHA 1KUIA 4Y5FA 1OISA 3RXWA 1XPXA 1V5EA 2UUZA 3BG9A 4AU7A 2LKXA 2OXUA 3TL4X 2CW8A 3A1YA 3JAMZ 1TW3A 2E2DA 2YB9A 3DKWA 3KETA 1OYYA 1PI4A 1KDSA 3L2CA 1XFQA 5GHZA 4CQHA 2IWDA 2XGXA 2O8XA 3NOUC 1H8ZA 3OOUA 2PDRA 3Q2GA 4UB8C 4I0AA 3B33A 2ZNZA 4BL2A 3GTOJ 4UQIM 1B6AA 3CC7I 2IGNA 5CLSA 1TWCJ 2JC7A 1PNEA 4PM6A 2NVXJ 3O5YA 2OY4A 2IWBA 3KRYA 3F6VA 1YP1A 2ZXIA 3V8JA 1GO8P 1KONA 3KSIA 4AM3A 5HDKA 1RRJA 4GOGA 3TRCA 2VONA 2HYGD 5EVID 4Y52J 1KQ9A 4U87A 5ERIA 3WU0A 3T1RA 3KEOA 3C8CA 5FGMA 2E2IJ 1FM1A 3OLOA 1HSJA 4BY7J 2FNAA 3NWSA 1OPCA 2X3CA 3BA0A 4XBHA 3Q07A 2CH0A 3ZG0A 1O7LA 1QHGA 4BEHB 1P7IA 4JP0A 4G0DA 4ILWD 1XAXA 4IBXA 4O3MA 1RKWA 4HYEA 2A3UA 1S5LC 1JH1A 4L9VA 4LCLA 1FMVA 4HY8A 1VZ0A 4LG0A 3G73A 1TD5A 1LFBA 1WFXA 1WH5A 1BLCA 5GLDA 4BE1A 3LIRA 4FOFA 4XRMA 3PHYA 4PKQA 3DBHB 2HTJA 4R3AA 4IPAA 4DE1A 2W24A 1CI8A 3HEFA 1CF7A 4JLFA 4E3JA 1K55C 4ZTJA 4FD8A 3L0VA 4PJMA 2QBYB 3A3JA 1F36A 3DPTA 2VQLA 3SEZA 3JRIA 4WCGA 2PJRA 1JNUA 1MZBA 1D1BA 1Q3AA 4A3IJ 3V50A 1TF1A 2UWXA 5FFZA 4GD6A 4GDBA 4F91B 3VYSB 1ETKA 2LRDA 3GX4X 2J3TC 1T33A 2UWMA 1DMTA 4D60A 2EIMH 4XK4A 2ME0A 4FASD 1VQ7I 4DNCA 1LPQA 2QMIA 3BC8A 3LMCA 4EQ1A 4M3DA 3RKXA 3USNA 1V3FA 4D7MA 4X0GA 1YX3A 1MMRA 4X6AJ 2JPBA 4XM6A 3JW4A 1NZOA 4WWCA 4DJ2A 5FD6A 1AYKA 1TNSA 3CCSI 3C7VA 4IUKA 1LVAA 3EUAA 3OYHA 1K57C 4HI4A 3UPPA 5FAQA 5M5YJ 3HL9A 2POJA 2GA1A 2YKHA 3WV3A 1A36A
chains in the Genus database with same CATH topology
1USNA 1WJBA 1K7QA 2Z2DA 3G42A 3RPUD 3BCBA 5I43A 2BOLA 3OMYA 4PKWA 2E5ZA 2DW0A 3LEAA 1QJJA 4DGWB 3B2ZA 5TGTA 4GR8A 5D1SA 2MLSA 1PWVA 3I9V2 3HBVP 1X19A 2VL8A 2VJ5A 2ZFUA 2WADA 2L9SA 4XLAA 2RJPA 4H76A 1MW7A 1G59A 4L63A 2Y6CA 3ZCOA 3OS1A 2OW9A 3DNGA 3SYTA 2RJQA 2WY8Q 2D1NA 3HOTA 1DTHA 4XLFA 3CJQB 1C7KA 2V9KA 1EB6A 2PJTA 1X1CA 1Y93A 2Z2SB 3LE9A 1GO7P 4B43A 3AL0C 4BU2A 1BZSA 3OYFA 1PWPA 3K4CA 4YRVA 2X6XA 2HPMA 1R55A 1XFWA 3LGPA 4PFOA 3OYKA 4L6TA 5LABA 2DJIA 2MYSA 3ELMA 4GUYA 3V96B 3BG7A 2ZSIB 2WOAA 4CCNA 3LJGA 2CFOA 3ZUKA 2KDOA 3KHIA 1CQRA 2K9MA 2QKMB 3M1CA 3ZR8X 4HSRA 4II3A 4D1QA 2IS6A 3N2VA 1OM6A 1YQYA 2OW0A 3VI1A 1ERDA 3RSNA 3FBNB 3BLYA 1CAQA 4GF1A 2R7UA 3TMOA 4CCMA 4L7AA 4WKEA 4WF6A 2HU6A 3DSLA 2KQRA 3ONQA 1D1CA 3D5LA 4FETA 4HNTA 4ON1A 4PJNA 2V4BA 2V6EA 5FRNA 4BDZA 2HVRA 3DWBA 3LUMA 4BGDA 1BR4A 4OAYA 2HDWA 2V1NA 2CUZA 2MFZA 3MMYB 3NX7A 5H8XA 3HY7A 3PL8A 4ZTFA 1W36D 3DPEA 3PNVA 1XFVA 2D1OA 5D2BA 4HRIA 2A5WA 4BQQA 2JUGA 1G9KA 3ZGKA 2Z16A 3K10A 3DU6A 1BSWA 3HL2A 4JA1A 4RM3A 1HV5A 1XUCA 2XF5A 3H5NA 4NC7A 3G2BA 4PSWA 2R7RA 1ZXCA 3E8RA 4I03A 2M4GA 2JVHA 1MMAA 5I2ZA 3DPLC 5CPRB 4J4MA 1OR7C 4GR3A 966CA 4DOZA 1HA8A 3LIKA 3LMMA 3KEYA 1YCMA 4IX7A 3CF2A 5CQGA 1QIBA 2CMPA 1K7IA 1AKLA 3H9GA 3VSLA 3LSHA 4CZCA 1KAPP 1OO9A 4BL0B 4WK7A 2VJIA 1G4KA 3K7NA 2KPMA 1FBLA 1CK7A 1KBCA 4PKUA 4P1WA 1AA7A 2HPIA 2IS2A 4LITA 2ERPA 4JQGA 1Y0VA 4QPQA 4XLHA 4AUOA 1KUFA 2HVQA 3U21A 5BPAA 3FHNA 3C2GA 3EDGA 4MLOA 5KHDA 1SFKA 3IP4B 1UTTA 5CXAA 4JIJA 2VQGA 5HOOA 2LG4A 2JSDA 2VKDA 4LIVA 1GE6A 3TT4A 4HEA2 4OWRB 4HG2A 5CUHA 2MC4A 3IUOA 4YELA 3DLAA 1MNEA 1U0JA 1LVKA 4XKVA 3TBIA 1UG0A 2F6CA 4KISA 2W13A 2UV1A 4KITB 4BJTA 2DW2A 4H4KC 2R7WA 4ZR5A 3RTRA 4AXQA 2KP6A 3DKYA 3FBIB 3H5AA 4XOTA 3GBGA 2KRJA 3S3OA 3PSFA 3L2VA 5D1UA 1XURA 3KMCA 3F9KA 1ZELA 3VDXA 5LD2C 3DEEA 4HPQA 3F18A 4XKCA 4DBQA 4XORA 4H82A 4CCOA 2JT5A 1D0YA 1Z7LA 1BR2A 1NG6A 4IQ4A 1DGWY 4HX3A 2W00A 4F93B 3HPHA 5LFAA 1WNIA 2CKIA 4F55A 4J00A 1QUAA 1WJDA 1DQUA 3KECA 4B48A 3UVCA 3QOEA 2OV7A 3SEQA 1SATA 3LK8A 2FV9A 4ZJZA 1JAOA 3ZXHA 1CGFA 1D0XA 4ZC3A 1MMBA 1I76A 1SLNA 3L2UA 2OZRA 2FUG2 3HC7A 3AKZA 2R7VA 1JKYA 2CV2A 3L2QA 2Q2EB 3H9QA 3D5SC 3D5RC 4LG3A 1IADA 1GKCA 4XOPA 3L0TA 2IXSA 1K6YA 1IABA 3EDZA 4FVLA 4FXQA 1G12A 2X3AA 2L0RA 5B5PA 1OM7A 1UAAA 3W2AA 4XKWA 3PFYA 3QYBA 1JI8A 1PWUA 5HNFA 4BS9A 4DBRA 1CGEA 1OM8A 3NWTA 1ASTA 4E6KG 3HY9A 1D7XA 2ELJA 1JANA 3F17A 2LYCA 3OS0A 2I47A 4P5OA 3MKZA 1Y8JA 2NOJB 4F52A 3DTKA 1IAGA 1BOBA 2F4IA 2J83A 4XM7A 2HVSA 1KUHA 3BCAA 2LOOA 1P9QC 3K70C 3LQ0A 4H3XA 1TZLA 2IGOA 2VXDA 4DPEA 2KLOA 2X1EA 3RCOA 2V4JC 3OYLA 1OLTA 3EUKL 3OR2C 4PJLA 2W1OA 1EAKA 1T95A 1V5GA 1MMQA 2JNPA 3RTTA 4E7ZA 2XAUA 1CXVA 3HDBA 5HLTA 1UTZA 1JIZA 1QICA 1GE5A 1SMPA 1Z3XA 1QHHD 4CCLA 1WJEA 3FDYA 1BR1A 3LSMA 4KJZA 4N4NB 4ZYAA 3OYNA 1ND1A 4RLFA 1MMGA 1N75A 3K4MA 2KL4A 4C9YA 4F3QA 4DF9A 2DT7B 2M0MA 4XLEA 3U1RA 1ZVXA 3OHLA 4RM2A 2CV0A 5CZMA 2VLAA 4F92B 1W36C 1ZTQA 3N05A 4C2UA 3KYLA 2AYKA 2OXZA 830CA 3DL1A 2R7XA 1XFXA 2W82A 2V7FA 2P0WA 3MD2A 1GXDA 3S93A 3VWBA 3CKIA 2CW7A 3DPUA 3MA2A 2BVMA 3K4JA 2M7BA 2JA2A 3A2KA 3HXLA 4BQNA 4RMNA 4XL9A 1JJ9A 5D7WA 2Z1DA 2IS1A 2KMUA 1HFCA 1DP3A 1D0ZA 2N8RA 3PNTA 4N4OB 4CCJA 4CCKA 4DV8A 3UNGC 4Y3OA 4L19A 4HMAA 4A7BA 2XSJC 2HU9A 2M4KA 3HKZA 1HTDA 3HG9A 4CA0A 2MLRA 2LBFB 2W12A 1RMZA 3S3NA 3AYKA 2WBMA 2MZIA 1MNCA 3LJZA 4GR0A 2Y0SA 3HUGB 2R7SA 1T0FC 2DDFA 2VKHA 1JK3A 1J09A 5I3MA 1MMPA 2RQQA 1A85A 2OW2A 2WO9A 4XCTA 2O5RA 4AYKA 3KX2A 2L9NA 3E1SA 1C8TA 2HQAA 4BE0A 3OYGA 1R1JA 4H49A 1WJAA 5BOYA 4PKSA 1AF0A 4IUWA 1V5FA 1UEAA 2E3XA 2VXZA 4E7KA 5BOTA 2R7TA 2W7NA 3WV1A 1FMWA 3L2RA 4IQJA 1BKCE 1G05A 3E0JB 3OYJA 2O36A 2O3EA 4E7IA 2XF6A 4U7BA 2VJ4A 3KEKA 3VSKA 4AIGA 3VYUB 3ZQQA 2E1MB 2K5CA 2LY1A 5KCMA 1BQOA 1D8MA 3F15A 3LUNA 1Z3YA 2K3PA 3N2UA 4JPAA 2OC6A 4NC8A 1BKCI 1BQQM 4XM8A 3OS2A 2DOAA 5HVQC 1BUVM 2MZHA 2LY2A 4ZDOA 1BUDA 1BIWA 1FLSA 3OY9A 3H9JA 2OUMA 2BW3B 4NQWB 1S9HA 1XFYA 4PKVA 4H1QA 2QPJA 2VIXA 1YX5A 3AFHA 5CKTA 1XFZA 2EROA 1GKDA 3LJTA 4JP4A 2X7MA 4WKIA 3F19A 1Y56A 2WB1A 3PUBA 1CGLA 2I8DA 1MMNA 3DWLE 2DXIA 4FXYP 2E5NA 3OIPA 4PJJA 3BG6A 2XDVA 2LH9A 3PSIA 4II2A 4CSWA 2OVXA 3OYIA 2XS4A 4C30A 2JT6A 1HY7A 2USNA 4PK4A 2VJJA 4BE2A 4BEHA 3LSGA 3K6GA 1X1DA 4GRIA 3UR3C 3Q2HA 3IAM2 3RQ4A 4B3XA 3GBOA 4WZVA 456CA 1QJIA 5I12A 2R7QA 2DT6A 2ZSHB 3W2VA 4D9JA 4PKRA 4DD8A 3CZ6A 3W2WA 1H71P 4GQLA 1O0TA 3SHIA 4E7JA 3EUHC 3S32A 2CUJA 1X4PA 3LL7A 3OR1C 1MNDA 3SZGA 1G8XA 3OYBA 1UMSA 5L79A 4BACA 4R3VA 4E7HA 2BVLA 4RLQA 5D1TA 2VQHA 1YE9A 4BQOA 2Q1ZB 2RREA 3OYDA 3H35A 1BKCA 1JAPA 4H30A 3OYCA 1ZS0A 1WJFA 1UMTA 2QKLB 1D1AA 4BXFA 3MKYB 3OHOA 2LBFA 2X51A 4Y33A 4QKZA 1C3IA 1BM6A 1WJ5A 4QPOA 4I35A 3DTEA 4IZZA 4EFSA 4XNFA 1D8FA 2XF7A 2GOXB 3OWTA 4KT6A 2DW1A 1XUDA 3VYTB 2J0TA 2W14A 1ROSA 3EHYA 3EDHA 5CQEA 2CS3A 2MABA 1K7GA 1LDKB 2MZEA 2FV5A 3H0DA 2W4SA 2AQEA 4HNUA 1G49A 2DDYA 3HYGA 3LKAA 2JVGA 3DQVC 4J01A 1OS9A 1GLNA 1JAQA 1DGRM 2VB6A 1IAEA 1LKXA 3KMEA 2KZVA 3OYMA 3KEJA 1IAAA 3KWVC 3SDBA 1XFUA 3A4CA 2Y6DA 3EDIA 3C2HA 2W0DA 2OY2A 4IKFA 3HB2P 2KRHA 2X85A 2WY7Q 4XQFA 4A3WA 2RNGA 3CJRB 1KUKA 1ZP5A 3AIGA 2YIGA 3LILA 2MD0A 4EATA 1S4BP 2F5VA 2VPLA 3VTGA 1RM8A 4PFPA 4XLCA 4IN9A 3K4LA 2LREA 4PKTA 3P1VA 3EPZA 4LIUA 4NUBA 4BUPA 5JHFA 2HNHA 2E60A 2IGMA 4ZDLA 5FRMA 1LFPA 1I73A 3F1AA 1X1BA 4XR6A 3F16A 2ZXHA 3IAS2 4PSXA 2XS3A 2M3AA 1I1IP 2OVZA 2OXUA 4CTHA 4Y4RA 3J7AY 4CUGA 3OYAA 3LSIA 1J7NA 3K4BA 1GE7A 3HPGA 4XKBA 1PJRA 3OL4A 1ZXVA 2X3BA 3TS4A 5JMYA 4GWNA 4H84A 1O0QA 1WJCA 1E0EA 1R1IA 2A8HA 4DJAA 3RTSA 2L2OA 5I4OA 1B3DA 4OAZA 3V42A 2CLTA 2X1CA 3PJRA 3W3CA 3HBUP 4GWMA 1N78A 1D5JA 3QYEA 3L2WA 4AYBA 1OMJA 3O64A 4Q1LA 4XM3A 1IRXA 4AVZA 2KHMA 5HNHA 2TCLA 3HDAP 2WAQA 1TT0A 3K4NA 3LSKA 3CP8A 4XMYA 3O2XA 4B44A 5B5OA 4CH7A 3K4KA 4C2TA 4G6TB 3OIQA 4H2EA 1SU3A 3WV2A 4IJOA 5FROA 2KRCA 1HOVA 3CP2A 2WAFA 5I0LA 2VASA 4B47A 1KUIA 3OYEA 3B8ZA 1V5EA 2UUZA 4YEJA 4AU7A 4E7LA 2ERQA 2OI0A 1EA3A 3FKJA 2CW8A 2PMZA 3A1YA 3TL4X 4XN3A 1N77A 2E2DA 2YB9A 1EUBA 2JSPA 2IS4A 3HOSA 4ITVA 3P24A 2A6TA 2OW1A 2L5QA 3OOUA 3Q2GA 5D3CA 1B8YA 3QODA 4ANJA 1SLMA 1X4OA 2LC2A 4BJ6C 1L6JA 1X1AA 3DTIA 1R54A 3ZVSA 2IGNA 4PUSA 1NG7A 2PJRB 2OY4A 3CESA 1JIWP 2E1MC 3KRYA 1YP1A 2ZXIA 3S8PA 1GO8P 1KONA 3LFUA 1Y6IA 1CIZA 2DCEA 2X6WA 4G9LA 3VYRB 4U87A 1FM1A 3I3LA 3TVCA 2GOMA 4JQFA 3NWSA 2X3CA 4XBHA 3BA0A 4E7SA 1R1HA 2CH0A 2JIHA 4ILWD 1QHGA 1MMDA 4BEHB 4G0DA 3TSKA 1PWQA 2BW3A 2WA0A 1JH1A 2W15A 2WO8A 3B92A 3DU5A 1SRPA 1FMVA 3H5RA 1VZ0A 2K9LA 2M7AA 3DKXA 1OS2A 3DPFA 2K9CA 3EHXA 2YUFA 2K2GA 5KNLA 1ATLA 1WFXA 2X6YA 3M8JA 1Z3JA 3I7GA 4BE1A 1KUGA 4ZDPA 1YOUA 1HFSA 3LIRA 2R7OA 1QU3A 1PWWA 4PKQA 2HZDA 3G5CA 3AL0B 5L7FA 4HSTA 4ZTJA 3L0VA 4PJMA 3MKWB 3S3MA 3K7LA 3DPTA 2VQLA 3SEZA 2AQFA 1A86A 2PJRA 1Q3AA 1D1BA 2XC7A 4JOMA 2IGKA 4DIQA 1UELB 3LQBA 3K70D 2R4GA 4BDYA 4F91B 3VYSB 2LRDA 3EWJA 2X1DA 3PNYA 1PYVA 1SAUA 2UWMA 1DMTA 4XN0A 4FASD 1Z21A 2V26A 3QYFA 3BC8A 4R79A 3ZRGA 2OXWA 3LMCA 2CV1A 4E4HA 1R6RA 2AIGP 3USNA 3ZXSA 3CMMA 4X0GA 1QIAA 1YX3A 1MMRA 4FU4A 4XM6A 3I7IA 3OL3A 4XONA 1AYKA 2WAEA 4NNJA 3AYUA 2VQCA 4BJ5C 2L7KA 3EUAA 3OYHA 2SRTA 2POJA 1IACA 3WV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTE A;  3DTK A;  3DTI A; 
#chains in the Genus database with same CATH topology
 1USN A;  1K7Q A;  2VBY A;  5J1Y A;  3LQQ A;  3M1E A;  1YIT I;  5CVV A;  3U4L P;  3JVU A;  3S1Y A;  3OMY A;  2E5Z A;  2ZMV A;  3KYZ A;  1NH3 A;  3LY3 A;  3MXS A;  4DGW B;  3LEA A;  3TO9 A;  3MXR A;  3QOP A;  3I9V 2;  2V1Z A;  2VL8 A;  2VJ5 A;  4XLA A;  4L9G A;  3V3S A;  1SDN A;  3LEZ A;  4H76 A;  2MW8 A;  3RDI A;  2G0E A;  4KMF A;  4N9I A;  2HGV A;  3LAP A;  4P6Z S;  2WY8 Q;  3EWK A;  2D1N A;  4XLF A;  5EVI C;  3ZMZ A;  1P4W A;  2P5K A;  4R6L A;  2CQQ A;  3LE9 A;  3WTS C;  4B43 A;  2O6G E;  3GTP J;  3AG4 H;  3LGO A;  4BU2 A;  4ESJ A;  2E8I A;  1KQ0 A;  4P87 A;  1BZS A;  5DD4 A;  4XBF A;  2F5C A;  5HAP A;  2Y48 A;  1MGT A;  2LF8 A;  3LGP A;  1E3H A;  2G9W A;  2NYX A;  4L6T A;  2DJI A;  1S6R A;  5JVG F;  1IEL A;  3HJE A;  5HOD A;  4PPR A;  5DTS A;  3ELM A;  4GUY A;  1WYC A;  2OV5 A;  4LFU A;  2ZSI B;  1Y0U A;  5DM7 F;  1WSU A;  3G2Y A;  5F6F A;  4X25 A;  3UDI A;  3ZUK A;  2DA2 A;  5BPD A;  3OV8 A;  3PR6 A;  1MSF C;  2L01 A;  1X3U A;  4XIC A;  2ZJ9 A;  1IG7 A;  1O3R A;  2IEK A;  2W85 A;  3GTC A;  2XB0 X;  4D1Q A;  3EYI A;  1YQY A;  5FQM A;  3PIP F;  2Z9O A;  3I0T A;  4K0X A;  2H94 A;  2E71 A;  4JX4 A;  2XGN A;  5F69 A;  4TV7 A;  2FML A;  2R7U A;  3E2L A;  4U88 A;  5GAH J;  2K9N A;  3P5J A;  3LR0 A;  3MKF A;  2RAE A;  1ETY A;  2L54 A;  2HU6 A;  4WF6 A;  5AQA A;  2KQR A;  2ETH A;  3ONQ A;  4M6Y A;  4RGS A;  5GTI C;  2X6O A;  3HSR A;  2O8K A;  3C5A A;  4RB0 A;  4AWX B;  3F8N A;  4KN4 X;  5HPF A;  5FI6 A;  3OPP A;  5H8X A;  2A5Y B;  2J5O A;  5DS9 A;  5LGT A;  3V7S A;  3HY7 A;  4CLC D;  3PL8 A;  1W36 D;  1QZE A;  1MY8 A;  3EET A;  2ZJQ F;  1MBH A;  2JPC A;  3BR2 A;  2D1O A;  5D2B A;  3A3D A;  3EEA A;  4EET B;  3UE6 A;  3ZGK A;  1Y39 A;  1Z67 A;  3LIA A;  3HTU A;  4E3K A;  4OIR F;  1XUC A;  2XF5 A;  3H5N A;  2H8W A;  2P4W A;  4NC7 A;  5EDN A;  1ZXC A;  1SAX A;  4O5V A;  3U9G A;  4RGR A;  1MWT A;  5CPR B;  5LHG A;  1ES4 A;  4DOZ A;  1HA8 A;  4FTX A;  4MNR A;  1Z7U A;  5A91 A;  5HDD A;  3LMM A;  2O61 A;  1I2S A;  3TJZ C;  1YCM A;  3FM3 A;  3BJN A;  1K7I A;  4F3L A;  3G6O A;  2FU4 A;  3WTT C;  2FOW A;  3L00 A;  1V4R A;  3VSL A;  1ZG3 A;  2VJI A;  3T4K A;  3P9C A;  1KBC A;  1GV2 A;  1PFL A;  1AA7 A;  2HPI A;  4JQG A;  1S29 A;  4EV0 A;  1Y0V A;  2KLI A;  4XT2 B;  4AUO A;  2HVQ A;  4QY6 A;  1JJ9 A;  3EUH A;  2LSO A;  3CCJ I;  3OPL A;  5CX7 A;  4A5R A;  1JUM A;  4IHV A;  2LFB A;  3IP4 B;  1UTT A;  4AUX A;  2V1U A;  1BUL A;  2XLN A;  4JIJ A;  4UUS A;  1DU0 A;  2JSD A;  3MZE A;  5KIZ A;  3VE4 A;  3UB8 A;  3I4P A;  2QEX I;  3IUO A;  1ONG A;  3RIR A;  3TBI A;  1MNE A;  1GSX A;  1SHV A;  3H82 B;  3VOZ A;  1T2K A;  3T50 A;  1J9I A;  3JTG A;  1V54 H;  2OCC H;  1OFC X;  2GXG A;  3MKL A;  4BJT A;  2R5Y B;  3RTR A;  2GLO A;  1Q1H A;  2K9Q A;  3DKY A;  5FAO A;  1HLU P;  4YNR A;  1OKR A;  1Z6F A;  5EOO A;  4U0W A;  5KAI C;  4I5S A;  3C4O A;  3CUE A;  3S3O A;  3L2V A;  1JTX A;  2P5V A;  3BLM A;  2AXT C;  1IAW A;  1XUR A;  3BZ6 A;  3W6J B;  5LD2 C;  1Y1W J;  2FFY A;  2OWJ A;  3DEE A;  4HPQ A;  1XXM A;  2OWH A;  1QVT A;  3MFX A;  4LPZ A;  4WBG A;  5HAQ A;  4H82 A;  2DAO A;  1Z7L A;  1BR2 A;  2KFD A;  1KVM A;  1DGW Y;  2CKI A;  2Y2H A;  1YI2 I;  4F3L B;  4PM8 A;  3BOQ A;  1DQU A;  1VTN C;  2F48 A;  4B48 A;  3G30 A;  3QOE A;  3SEQ A;  3KEC A;  3M6H A;  1YYV A;  3E97 A;  1OYI A;  1MJ9 A;  1SD7 A;  4ZJZ A;  1HBX G;  3LI9 A;  4F7Z A;  4JKT A;  4FE7 A;  1D0X A;  4ZC3 A;  3REO A;  2VUM J;  5DTK A;  1SLN A;  3AG2 H;  2Y9Z A;  1CF7 B;  3HC7 A;  3AKZ A;  1JKY A;  2CV2 A;  3OZH A;  1FYK A;  3GF2 A;  1GKC A;  4FVL A;  1IAB A;  1GVD A;  5AQ7 A;  4FXQ A;  3QRF F;  4EJV A;  3CF5 F;  2EV5 A;  3T1X A;  2ZM0 A;  1CK3 A;  2X3A A;  1YOV B;  3LUQ A;  5A8B A;  1ENH A;  3W2A A;  1J75 A;  3QNC A;  2BYV E;  4XKW A;  3PFY A;  3QYB A;  3PBT A;  1SFO J;  1PWU A;  1T98 A;  4EJU A;  4DBR A;  3LWF A;  3CC4 I;  4EBP A;  1CGE A;  3NWT A;  1AST A;  3MQQ A;  1OZ9 A;  3F17 A;  2DCF A;  2V8C A;  3ZHH A;  2I47 A;  1T0F A;  4P5O A;  2QM3 A;  1Y8J A;  1R5I D;  2Z99 A;  2DFI A;  2Q9M A;  1BOB A;  1S0W A;  2VGK A;  3NDE A;  4YFX F;  2E1C A;  1R7J A;  1BC7 C;  2CO5 A;  2WZZ A;  5BOH A;  4DPE A;  4H3X A;  1TZL A;  2KLO A;  4HX4 A;  1W63 M;  2OOL A;  2OZ6 A;  1B72 B;  4P6B A;  1W7P A;  4A2U A;  1OLT A;  3OR2 C;  4PJL A;  1H89 C;  4JX6 A;  3FZV A;  1T95 A;  3PYP A;  3NAR A;  2JQ7 A;  3RTT A;  4HHD A;  4I7H A;  1QME A;  3HDB A;  1KZH A;  5HLT A;  5E18 F;  2L4M A;  3H36 A;  2DLL A;  3BG5 A;  1BI1 A;  1QPI A;  1KGE A;  1MSE C;  4PM5 A;  1HLV A;  3W4O A;  3G3Z A;  3MZD A;  1XMK A;  1ZHH B;  4N4N B;  4KJZ A;  5ICG A;  4ZJ3 A;  2Q9N A;  1OT9 A;  1N75 A;  4HJ6 A;  2KL4 A;  2K7L A;  2DT7 B;  4WK8 F;  1UB9 A;  4U0T A;  3VMA A;  2QQA A;  1X0O A;  4GDN A;  1ZTQ A;  1W36 C;  2WKP A;  830C A;  4KUM A;  3H7W A;  4YFM A;  4DDS A;  1E3U D;  2JKG A;  1MNM C;  4EEU A;  2BHY A;  3B02 A;  1GXD A;  1I1G A;  1XMX A;  3CKI A;  3DPU A;  3MA2 A;  4I39 A;  2M7B A;  4MFE A;  4O0P A;  3HXL A;  2R3S A;  3FKW A;  5C44 J;  2HV1 A;  1A04 A;  2Z1D A;  3MAJ A;  4FTH A;  3EQU A;  4LK0 F;  3ZNY A;  4HF0 A;  4A6D A;  3F8M A;  1P9W A;  1EV7 A;  4IO9 F;  1LT0 A;  4CCK A;  4FH4 A;  2EIL H;  4I2O A;  4QSH A;  4LEN A;  3BFF A;  2JRT A;  4A7B A;  1B4A A;  4HLX A;  1ZGA A;  1HTD A;  5HW3 A;  2Y31 A;  3HG9 A;  1SD6 A;  1NLY A;  3QP2 A;  1FCM A;  3I59 A;  3LA2 A;  1MD0 A;  2EH3 A;  5E3N A;  4B93 A;  4BBV A;  5CER A;  1FP1 D;  3F1P B;  2WBM A;  3CMA I;  1E2X A;  1MNC A;  2MZI A;  3MFK A;  3CJN A;  3S1N J;  3HUO A;  3CCE I;  3FV7 A;  5I3M A;  2CGP A;  2ZQC A;  3F8B A;  2RL3 A;  1WCM J;  4DJ3 A;  4BXX J;  4NG2 A;  4KIC A;  1IKI A;  3ZGA B;  3KX2 A;  4EJT A;  3A0H C;  2L9N A;  2Y59 A;  4OON A;  1R1J A;  2O03 A;  3OYG A;  3RPQ A;  1NLZ A;  4BH9 A;  3ICY A;  4M3K A;  3DCF A;  4MN7 A;  3VP1 A;  2O9B A;  4R0Q A;  5HLH A;  2R7T A;  1D8J A;  1S7E A;  4CGZ A;  1OME A;  3RYR A;  2L7M P;  3CUQ A;  5D6F A;  4IQJ A;  3WHC A;  4E7I A;  3BWG A;  3ML6 A;  3SFZ A;  2KOI A;  2LR8 A;  4U7B A;  2ZQ8 A;  3W4P A;  3VSK A;  3E4P A;  3ZQQ A;  2K5C A;  5KCM A;  2V1X A;  3N2U A;  2KIS A;  2K27 A;  3MN2 A;  3VFZ A;  3LSR A;  1OJ5 A;  4KEN B;  4LK1 F;  4YFK F;  2FXA A;  1TC3 C;  1OTA A;  3ABT A;  2DOA A;  2R7F A;  2PR5 A;  2MZH A;  4DZJ A;  2C6Y A;  1YHQ I;  4CLC A;  2A07 F;  2EJR A;  4ZYH A;  2BW3 B;  3QPL A;  4OOL A;  1D1J A;  3FIS A;  2E36 A;  3QPS A;  5CXW A;  4G94 A;  4HNB A;  4H1Q A;  5EE8 A;  3LJT A;  4L18 B;  1GKD A;  5TJJ A;  4ID4 A;  4KFC A;  1R1V A;  2WB1 A;  3TE8 A;  3GTK J;  2I8D A;  3OSG A;  1GDT A;  3CIT A;  1IRZ A;  2E5N A;  5L3G A;  3V39 A;  3OIP A;  2XD1 A;  1LE8 B;  5E8I A;  2EPF A;  3OYI A;  2ZO4 A;  1FOX A;  4KQD A;  5HLI A;  4PJ0 C;  1TT5 B;  3AG3 H;  1W5T A;  2HDU A;  3QP5 A;  4PK4 A;  1HY7 A;  3NEU A;  2V79 A;  2XR0 A;  5CED A;  1P9R A;  2FA5 A;  1KE4 A;  5L3C A;  3GBO A;  2B9S A;  3HVF A;  2V20 A;  3UMD A;  2ZSH B;  3W2V A;  5DJU A;  4CLC E;  3ZQH A;  4X68 A;  4E70 A;  3VV4 A;  5HFO A;  3UPO A;  1G3T A;  4JXV A;  1S1Z A;  2IT0 A;  5EM1 A;  1Y54 A;  2BGC A;  3FMS A;  3JRC A;  4RAY A;  2HDC A;  2WGV A;  4WL9 A;  2XGD A;  3AGE A;  1TQI A;  4R3V A;  3BY6 A;  2WTE A;  3RQI A;  2ZME B;  5J8F A;  2JJ7 A;  4UEY A;  1UST A;  1YIO A;  3KP7 A;  4EEP A;  1MWU A;  4IED A;  3ZQC A;  5EEG A;  3NQO A;  1U2W A;  3IH2 A;  4I6Z A;  1ZS0 A;  1I5Q A;  2JKR M;  4BXF A;  1BW6 A;  2ZL1 A;  2M7V A;  2X01 A;  2HTS A;  3NAU A;  1WJ5 A;  2JMW A;  4QJG A;  4HBL A;  3DTE A;  2FJ1 A;  2DU9 A;  3HZJ A;  4A3L J;  5AVF A;  3Q0U A;  2O0Y A;  4MHG A;  3J80 Z;  1EF4 A;  3KP5 A;  3WU1 B;  2GOX B;  5CYV A;  1T39 A;  2ZKZ A;  4KT6 A;  1YQS A;  2Y0S N;  4HQA A;  3T1S A;  1XUD A;  2Y8H A;  4HJ3 A;  3ULQ B;  1FWZ A;  3V8L A;  4JPM A;  1FTT A;  1QVU A;  2PQ8 A;  2CS3 A;  5GLB A;  4DQ2 A;  4DE2 A;  2VN2 A;  1O3Q A;  1FBQ A;  1RGY A;  2MGQ A;  1K7G A;  1K6O A;  2EZK A;  2W4S A;  2AQE A;  2FSW A;  1G49 A;  3HYG A;  3DQV C;  1F5M A;  1TL8 A;  1JTY A;  4EQI A;  2HQN A;  3FK6 A;  3MCZ A;  4HX8 A;  3KSG A;  4MEY F;  3OYM A;  4OIO F;  2XIG A;  4EWF A;  2PBD P;  3C2H A;  5F0F A;  4IKF A;  1GSV A;  3HB2 P;  4A3M J;  4PCQ A;  2BV6 A;  4WZ5 A;  4EUZ A;  4A3W A;  2HQR A;  2YIG A;  2X71 A;  4RX2 A;  3WS2 A;  3O3K A;  2L9R A;  4MN6 A;  2XSD C;  1S4B P;  4ZYE A;  3SOI A;  1STZ A;  2WKH A;  3VTG A;  3IF6 B;  3CUQ B;  2P08 A;  4IN9 A;  3K4L A;  2LRE A;  2Q2E A;  3QU3 A;  1DDN A;  1A5J A;  3N7W A;  3P1V A;  4LIU A;  5DJT A;  3K1M A;  5JHF A;  1ETX A;  2P7J A;  2IGM A;  4ZDL A;  1FYL A;  1LFP A;  2VC0 A;  2JE5 A;  2R93 J;  4XR6 A;  2EFQ A;  2PG4 A;  2ACG A;  5FKL A;  1E3U A;  1E3P A;  1PVE A;  2AXL A;  4BAY A;  3C2B A;  1NK2 P;  2OVZ A;  3KZY A;  5DFX A;  3J7A Y;  1YLF A;  3HIF A;  1W7F A;  3JR9 A;  5AQB A;  1ZXV A;  1Z09 A;  4OP5 A;  3NBL A;  2HI3 A;  2L0K A;  3FPV A;  1WJC A;  5HSQ A;  1R1I A;  2A8H A;  1EH8 A;  4H84 A;  3BJ6 A;  3LSJ A;  2LVS A;  5EEA A;  1LUJ B;  1IFQ A;  1R23 A;  3E5X A;  2ZMA A;  4U0X A;  3ZOB A;  2DMP A;  4OIN F;  4IVI A;  4WZ4 A;  1FT9 A;  1SD4 A;  2W1R A;  3PJR A;  3PBN A;  4MBK A;  1XDS A;  2EQR A;  3KEQ A;  2JKR I;  2R9X A;  4CPK A;  2PEX A;  3GFJ A;  3F0C A;  1TLH B;  4AYB A;  3L2W A;  2VV6 A;  1K78 B;  3CDI A;  4E6X A;  1P92 A;  4Q1L A;  2NS7 A;  4OQI A;  3UPN A;  3GFM A;  1LSX A;  2GIZ A;  3L9F A;  1ERM A;  1KVL A;  3HDA P;  1TT0 A;  2OZU A;  2M0C A;  5J6X A;  3O2X A;  5B5O A;  5HX9 A;  4RDU A;  3F1O A;  4E3O A;  2YSR A;  3K4K A;  5ICC A;  2JHE A;  4WMC D;  5F82 A;  2Y2J A;  1N4O A;  3RTY A;  3S7O A;  1SU3 A;  5JYO A;  1T6S A;  2AS5 F;  2RN7 A;  3OSF A;  2WKQ A;  3H82 A;  5I0L A;  2VAS A;  3IKV A;  5CVJ A;  1IDY A;  2UZK A;  3CLQ A;  3GTG J;  1MDM A;  2PRF A;  4PDK A;  4YEJ A;  2J8Y A;  4E7L A;  3FKI J;  2OI0 A;  1I50 J;  2PMZ A;  1N77 A;  2I10 A;  1CI9 A;  2Z2L B;  1U5T A;  1BI3 A;  2GJ3 A;  5DYM A;  1PI5 A;  2L7Z A;  2A6T A;  5FO5 A;  1Z91 A;  4OQH A;  4YIN A;  4OMY A;  3GEZ A;  5LRR A;  3UN7 A;  1JWP A;  2J3T D;  2PMH A;  1XB4 A;  2DW4 A;  4R1H A;  4A0Z A;  3ZMT A;  3I4M J;  2XDM A;  1T38 A;  1L6J A;  5D3C A;  1X1A A;  2A3S A;  2Y9Y A;  3DTI A;  3MWM A;  2Y2O A;  4BEN A;  5HS9 A;  2D1V A;  1VND A;  3UNW A;  2OAP 1;  3JVV A;  3ZN1 A;  3HCY A;  3ITA A;  3MVP A;  1OCZ H;  3S8P A;  1R4M B;  2DK8 A;  4ZJ1 A;  1YMS A;  1BW5 A;  3TOI A;  1GSW A;  3Q7Z A;  1IV8 A;  2DCE A;  1L0D A;  2QHK A;  1JT0 A;  1TQM A;  2PMZ N;  2R78 A;  2XEP A;  4X56 A;  2M5W A;  1FSE A;  3I3L A;  3S7N A;  3TVC A;  4EJW A;  2M8E A;  1N9L A;  4OMZ A;  2ZLY A;  4E7S A;  1R1H A;  1SVL A;  2DMU A;  2FFF B;  3ZDJ A;  2BW3 A;  2WA0 A;  5FKO A;  1XGJ A;  1RP5 A;  1SRP A;  2EX9 A;  3EHX A;  2JT1 A;  2K9L A;  2M7A A;  3BTJ A;  4C2M J;  3D4F A;  4FCF A;  4GHI B;  2DMW A;  2VPR A;  2LKS A;  4DE3 A;  4S2N C;  1Z3J A;  4ZDP A;  1VET B;  2DJN A;  4GO1 A;  4M6V A;  4A3C J;  1QU3 A;  3E6D A;  4HST A;  2PT7 A;  2W0N A;  5FLX Z;  3C4P A;  4JGR A;  1Z6T A;  3MKW B;  4IOA F;  3IBR A;  3K7L A;  4LV3 A;  2DA5 A;  1VQ4 I;  1XD7 A;  2AQF A;  1PUF B;  4Y3I A;  3TDZ C;  1AU7 A;  1U3E M;  3O88 A;  5KSH A;  4IRG A;  2HS5 A;  2ZQ7 A;  1MXO A;  2NOG A;  4JOM A;  4RAZ A;  4DIQ A;  1VQM I;  1UEL B;  1E25 A;  2K4B A;  1SC7 A;  4HLY A;  3DWK A;  1MWS A;  2R4G A;  4HQE A;  3CDH A;  2XHK A;  3T4Q A;  1T1C A;  1PYV A;  1SAU A;  1VFC A;  5F1F A;  4PHT A;  4A0Y A;  2V26 A;  4AC0 A;  1L2S A;  1FP2 A;  4WLA A;  4ZYD A;  5LBR A;  2CV1 A;  4CYC B;  5K7Z A;  2NS8 A;  3CMM A;  1QIA A;  3KFW X;  2M1B A;  3FXK A;  4AVP A;  4FU4 A;  3FXJ A;  1XC5 A;  3I7J A;  4XON A;  1XMA A;  2TCT A;  5LRS A;  3FXU A;  1GXP A;  2VQC A;  2SRT A;  1N9B A;  4UVB A;  1RR7 A;  1U6G A;  4ZAM A;  4WEJ A;  1B9N A;  2YU3 A;  1IAC A;  3W2Z A;  1WJB A;  3GTL J;  2EFW A;  2Z2D A;  5HL1 A;  4S2P A;  3G42 A;  1IXC A;  1WRJ A;  2QQB A;  4DXB A;  3RZD J;  4EJO A;  3NEC A;  2BOL A;  3BTI A;  3A03 A;  3HGG A;  5JI6 A;  2ZQA A;  3CWF A;  2Y2K A;  4WEK A;  5AQ9 A;  1QJJ A;  5TGT A;  3CD6 I;  1PWV A;  4GR8 A;  3VOE A;  1IKG A;  4GZB A;  2ZFU A;  4D7N A;  3N8S A;  5G4Z A;  2RJP A;  2KKO A;  1MW7 A;  1REP C;  1CJF A;  3C2W A;  3EOI A;  1RCJ A;  3DNG A;  3SYT A;  5EJC A;  3HOT A;  1C0W A;  4MGR A;  1EB6 A;  5F1R A;  2PJT A;  1Y93 A;  2ELH A;  4ENN A;  2OVX A;  3WGG A;  3ABL H;  3JTH A;  3AL0 C;  1G28 A;  2ZXW H;  1OTI A;  2CUF A;  2H09 A;  5L3D A;  2IW5 A;  3Q82 A;  5CEC A;  1NTC A;  1PW1 A;  1IO2 A;  3MR0 A;  3K4C A;  2F4O B;  1FBS A;  3OYK A;  2MYS A;  2NVY J;  3T4L A;  1AOY A;  2OQR A;  1FOK A;  1BKC I;  3U2A A;  4ESF A;  4CCN A;  1NRF A;  1SMY F;  2CFO A;  3KSF A;  1HST A;  2KZG A;  1DY6 A;  5FL3 A;  1CQR A;  2B02 A;  2K9M A;  3L9K A;  2QKM B;  3M1C A;  2Y75 A;  2ZOH A;  2DMN A;  4ZZD A;  1ES2 A;  5J7E A;  2X02 A;  2XVC A;  2ZMF A;  3S2W A;  1RUO A;  1SFU A;  4HSR A;  2CC1 A;  2N8G A;  5F64 A;  4Y2F A;  2L02 A;  1FPQ A;  1ERD A;  1K4F A;  2VT2 A;  3RSN A;  3FBN B;  2KIM A;  3RI4 A;  4Z6Y A;  4Q5S F;  1QMF A;  4GF1 A;  4WKE A;  4L7A A;  2OJE D;  3S2D J;  2XF3 A;  2E7W A;  1VM1 A;  1D1C A;  3D5L A;  3BQ8 A;  4PMA A;  4PJN A;  3DWB A;  1OTD A;  2Y79 A;  3FWL A;  4NKP A;  1PZO A;  3MMY B;  2IWC A;  2OAQ 1;  1KGS A;  2XGC A;  1LLB A;  4DF6 A;  1FOF A;  1XX5 A;  4HIA A;  4ZTF A;  4BD0 A;  1JT6 A;  2ZJ2 A;  3PNV A;  3JSO A;  2DFH A;  1LDJ A;  3V67 A;  2G2W A;  1WGX A;  4ETS A;  1H8M A;  4DRT A;  1TVF A;  1K56 D;  2E34 A;  1G9K A;  3PIO F;  1JE8 A;  2DBB A;  5GP9 A;  2PJP A;  3HL2 A;  2DNS A;  2ZC4 B;  5BPI A;  5A2Q K;  4M9Z A;  3NIA A;  4NXE A;  4JA1 A;  1AWI A;  4A12 A;  2DT5 A;  2YUS A;  3ABK H;  3CO6 C;  5FLX K;  5F1G A;  4BLM A;  2EFO A;  2M4G A;  2HDD A;  5G4Y A;  4E3M A;  1PUE E;  2K9S A;  3G4P A;  4HNV A;  3LIK A;  1C3B A;  1D8K A;  5ILV A;  2G7H A;  3GMW A;  3HDD A;  2DYS H;  1P6R A;  5CQG A;  1HC8 A;  1XA1 A;  2V0W A;  3ISP A;  3H9G A;  2FX0 A;  4QWO A;  3LSH A;  1ONH A;  3K2Z A;  2L1M A;  1OO9 A;  3LCE A;  2COM A;  1L3L A;  5I94 A;  4P1W A;  2IS2 A;  4Q0I A;  1KA8 A;  4LIT A;  2ERP A;  2EIK H;  2NNY A;  3SH9 A;  3UME A;  2Z6D A;  3OOV A;  4K2E A;  5F6A A;  2V1D A;  1SFK A;  1LI9 A;  5CXA A;  1PIO A;  2IP2 A;  1I2W A;  4ESB A;  3WE3 A;  2NVT J;  1U8R A;  4Y0T A;  2L4A A;  3SXY A;  4QIW N;  1S7A A;  2MC4 A;  4NET A;  4YEL A;  1HQC A;  3DXJ F;  4P0M A;  2W13 A;  1LVK A;  1DRM A;  4RX3 A;  2F6C A;  3VPR A;  3A01 B;  4X1E A;  3ZQI A;  4KIT B;  2DW2 A;  4AXQ A;  3IWQ A;  2KP6 A;  3FBI B;  3H5A A;  4XOT A;  2VE8 A;  2XFT A;  2KRJ A;  1HCR A;  1U5T B;  5E17 F;  1YLT A;  3PSF A;  5EM0 A;  1R5G A;  3F9K A;  4MO7 A;  3VDX A;  2VZW A;  4IUH A;  4K0W A;  1QQI A;  2ZD8 A;  4DBQ A;  4XOR A;  3S17 J;  3K69 A;  4CCO A;  4YFN F;  3FG8 A;  2JT5 A;  4RGU A;  1OJL A;  1IRG A;  1SCW A;  1D3Y A;  4NXG A;  3R0A A;  3HPH A;  1R1T A;  4JYK A;  4YIR X;  1L0G A;  1WNI A;  4J00 A;  2V9A A;  3PBQ A;  4X6T A;  1BC8 C;  1UEA A;  3UVC A;  3IS2 B;  2WUQ A;  2OV7 A;  4NC6 A;  3LK8 A;  2A05 A;  2XH9 A;  2FV9 A;  3MXQ A;  2IVM A;  2K85 A;  3HRM A;  3H1C A;  3KLO A;  2QYB A;  4Y0U A;  3VOD A;  3UB5 P;  5E3M A;  4KQR A;  5FQJ A;  2FOK A;  1I76 A;  4B09 A;  3L2U A;  2P6T A;  1K79 A;  3JRG A;  1MKM A;  2R7V A;  4CYC A;  1ZG1 A;  4UV8 A;  4NQW A;  3H9Q A;  5J4E A;  1A6Q A;  1CEG A;  4S05 A;  1IAD A;  5M3F J;  3IXH A;  3L0T A;  2IXS A;  1K6Y A;  3EDZ A;  3V8K A;  1LJ9 A;  1I39 A;  2J9P A;  4O01 A;  3S2H J;  5CGX A;  4E3L A;  1G12 A;  1PYY A;  1OM7 A;  1ZH5 A;  4A3K J;  5FKN A;  3L1P A;  3ESW B;  3KP2 A;  3H9W A;  5CEB A;  3ZMU A;  3FYZ A;  3IQA A;  2L9V A;  1GT0 C;  1D7X A;  5J4Y A;  4II7 A;  3CCM I;  3OS0 A;  2CQX A;  1CF0 A;  2WGW B;  3IWZ A;  2W3E A;  3F6O A;  1BN5 A;  1X1P A;  2DQL A;  1JHF A;  4MBH A;  2F4I A;  2E35 A;  2TRT A;  2HVS A;  1KUH A;  3BDD A;  3BCA A;  5K7F A;  4UUV A;  2LOO A;  3FZC A;  3K70 C;  3LQ0 A;  3KZZ A;  2IGO A;  4F94 A;  2V4J C;  3OYL A;  4MNU A;  1KQ8 A;  1UG2 A;  1ZGJ A;  5L8M A;  4LLG F;  1EAK A;  1V5G A;  1MMQ A;  2JNP A;  2TDX A;  1A6I A;  4KA4 A;  2PN6 A;  3G1M A;  1OMI A;  1UTZ A;  5AON A;  3F1P A;  2LKP A;  5IOY A;  1Z6R A;  3IKT A;  3CZD A;  2XA7 M;  3O3V A;  1ZN2 A;  2Z2M B;  4MMN A;  1H0M A;  1J5Y A;  3LSM A;  1PRQ A;  2Y2N A;  4GS9 B;  5H2F C;  4KZ4 A;  3T4T A;  3HLC A;  1ND1 A;  3BTC A;  3G34 A;  2AO9 A;  1YW7 A;  4DF9 A;  3GLL A;  4G3W A;  2QCO A;  5ICF A;  1YJW I;  3IT9 A;  2CV0 A;  3CPT B;  2OXZ A;  2GZW A;  4NDL A;  3ZN0 A;  3F22 A;  4BKX A;  2R7X A;  1XA7 A;  1XFX A;  1K4T A;  2XB5 A;  2K02 A;  5M18 A;  2QA4 I;  1R58 A;  2P0W A;  5LGN A;  3VWB A;  3A01 A;  3JRB A;  2IBD A;  3HRE A;  4OKP A;  3GSG A;  2CW7 A;  3GVA A;  4I02 A;  2BVM A;  2J5P A;  2JA2 A;  4PZJ A;  3COA C;  1KDW A;  4BQN A;  2XD5 A;  4GD8 A;  4B4C A;  2IS1 A;  1HFC A;  2KMU A;  4KDP A;  2WGI A;  2N8R A;  4M74 A;  2R5Z B;  4DV8 A;  5FKK A;  1K54 C;  1T19 A;  4Y3O A;  3PXP A;  4HMA A;  1NJ4 A;  2DFE A;  1LI0 A;  2JUC A;  5CVI A;  5FDS A;  3K1N A;  3WE2 A;  4UUS B;  4EGZ A;  4IRI A;  3CAX A;  2RV8 A;  2XQZ A;  2EXA A;  2BY2 A;  2VK3 A;  5FQK A;  4BL3 A;  2GWR A;  3PO3 J;  4X69 A;  1QRY A;  2QSG X;  1MDM B;  2Y69 H;  3S3N A;  3PBS A;  2P8T A;  2EV0 A;  5K5O A;  2D2W A;  2ZBB A;  2R7S A;  3BM6 A;  5DF8 A;  3IWO A;  1JK3 A;  1J09 A;  4QHC A;  2RKH A;  4A69 C;  1P2F A;  3BQY A;  4OIP F;  2JBF A;  1MBE A;  2JSC A;  2PD8 A;  4GLQ A;  2V0U A;  2HP5 A;  1C8T A;  4H49 A;  1SFE A;  3ZMV A;  1WJA A;  2BXY A;  3IWF A;  3GYH X;  4IUW A;  2E3X A;  3I5U A;  5BOT A;  1R49 A;  5E2E A;  5J3L A;  3WV1 A;  4MQ9 F;  1BKC E;  3QP4 A;  4M3G A;  4L0L A;  3E0J B;  5JR3 A;  2XAG A;  3OYJ A;  3N8R A;  3K9T A;  5C5K A;  3M8E A;  5CTN A;  1DP6 A;  1H9G A;  3AG1 H;  2E1M B;  5JYP A;  3LUN A;  5JLX A;  1D8M A;  1PWD A;  4H6J B;  1XDU A;  1Z3Y A;  2K3P A;  2B0L A;  1VQK I;  3B6C A;  2H5S A;  3TP0 A;  2GIV A;  4Q0J A;  4DMZ A;  3WOD F;  2LY9 A;  1VQ9 I;  2LY2 A;  2MH2 A;  2Y2I A;  1QO0 D;  1X3Z B;  1BUD A;  3H9J A;  3GLX A;  1YTY A;  1BIB A;  1ITY A;  1ERO A;  2JA5 J;  4NQW B;  1MBK A;  2WKR A;  2XSS A;  4U3T A;  1FQG A;  4P6Z M;  4XT2 A;  4PKV A;  3LSP A;  2DDA A;  3IHU A;  2QPJ A;  3AFH A;  5CKT A;  4JP4 A;  3KZI C;  3PFI A;  3MJQ A;  4HJ4 A;  2HKO A;  4BBS J;  4WKI A;  3F19 A;  1Y56 A;  3PUB A;  4A3J J;  3HHG A;  4MIM A;  1CGL A;  1BL0 A;  4HP4 A;  1ZR4 A;  3SJM A;  1AHD P;  3T4O A;  4CSW A;  4II2 A;  2DA3 A;  3PSI A;  1QPM A;  1WKM A;  1ZKG A;  3LYX A;  4HH3 A;  4UA9 A;  1QNT A;  3DEW A;  1YRN A;  1RUN A;  4C30 A;  2MLG A;  3DTM A;  1Q1V A;  2I9V A;  1IXS B;  5GPC A;  3N4M A;  1FSY A;  1RR8 C;  5EEH A;  2ZJP F;  1B8I B;  5CRF A;  3VP2 A;  2EA4 A;  3CTA A;  2AYK A;  2IRF G;  3RQ4 A;  4B3X A;  5JVT A;  2STW A;  5FEG A;  3UE3 A;  4PKR A;  3NOT C;  4HQM A;  1P0Z A;  1UHS A;  3M07 A;  4PGG A;  3W2W A;  3BT9 A;  3KSH A;  4B4X A;  4XSX F;  4EUV A;  3SHI A;  4IHX A;  2W3G A;  3EUH C;  2CQK A;  2CUJ A;  4G6D A;  3S32 A;  1UMS A;  3LR5 A;  3D72 A;  1WQ2 A;  4XID A;  5F27 A;  3HLF A;  1WA9 A;  2PMU A;  3I71 A;  4N92 A;  2QGU A;  2ESH A;  5HS8 A;  2BVL A;  1FIL A;  4X55 A;  1XSV A;  1MMS A;  2VQH A;  1YE9 A;  2Q1Z B;  1HW1 A;  1ALQ A;  4HDV A;  4HV6 A;  1WJF A;  1E17 A;  3WRT A;  3MKY B;  1OR7 A;  2X51 A;  3ZG9 B;  1FEX A;  1F1Z A;  1ACF A;  3GR2 A;  4M71 A;  4LV2 A;  5FAP A;  4QPO A;  1XCB A;  3IRR A;  4HH2 A;  4M9X A;  5IP9 J;  3N97 A;  2OTL I;  4JGO A;  1JJ8 C;  4EFS A;  1LQ1 A;  2M45 A;  1AKH A;  3U2R A;  1NHA A;  1WH7 A;  3TO7 A;  2BY1 A;  3CJT B;  1ZLK A;  4XUZ A;  1XGN A;  3OBF A;  2Y91 A;  3VYT B;  1M1E B;  1ZG4 A;  1ROS A;  2A24 B;  3RZO J;  3EHY A;  2KJC A;  3J81 Z;  1DU6 A;  5IYC J;  3OCN A;  1K54 A;  1UHW A;  5CGS A;  2WC2 A;  5H6R A;  4EM1 A;  4MTD A;  5KSC A;  2X9D A;  4YG2 F;  4D2O A;  1LDK B;  2FV5 A;  4JGQ A;  3QNB A;  2DA6 A;  3E2K A;  1W5D A;  1LL8 A;  4J01 A;  1OCR H;  2ZCW A;  1LL9 A;  3GZN B;  2D02 A;  2QZ6 A;  2ZOI A;  5EPH A;  1JAQ A;  1IAE A;  3P98 A;  3ECO A;  4OPY A;  1GHP A;  3HJI A;  3T4J A;  3LA3 A;  3KEJ A;  3CI6 A;  1IAA A;  5IT9 Z;  2X0L A;  1YMX A;  3A4C A;  3GME A;  4KYW A;  1SKO A;  4MQV A;  3N6I A;  5L09 A;  2W0D A;  1T1A A;  4G7Z F;  1S1Y A;  2Y2L A;  4DZP A;  2JK3 A;  1B8I A;  2KRH A;  3WS5 A;  4B3A A;  3BR6 A;  4Y13 A;  1ZGW A;  1KUK A;  3LIL A;  3E4O A;  3BR3 A;  1HZO A;  4EAT A;  3W4Q A;  1BI0 A;  2F5V A;  1ZHF A;  2VPL A;  4EVI A;  3F1O B;  5EG0 A;  5EVE A;  2DFF A;  5GPA A;  2ECC A;  4OPR A;  4B1R A;  1JGS A;  4B9O A;  4RB2 C;  4EES A;  5HPI A;  4IL6 C;  3BY8 A;  4HBU A;  1IN8 A;  1G3S A;  4BUP A;  5K7H A;  4LLL A;  1CEF A;  2E60 A;  5FRM A;  3IX3 A;  4QU3 A;  3TKY A;  2ZBK A;  1X1B A;  1XGO A;  1EKE A;  1ZAR A;  3NRV A;  4PSX A;  3A3F A;  2LB5 A;  2VV8 A;  3LFV A;  4GKU A;  3ZFZ A;  1R71 A;  4Y4R A;  3CC2 I;  1PW8 A;  3CUE C;  1W1W E;  4XRS A;  3KPH A;  2X3B A;  3HPG A;  5JMY A;  5CGW A;  3CQZ J;  5D5W B;  1E0E A;  2ZC3 B;  3UB7 A;  1FC3 A;  2MLK A;  3G71 I;  4JXS A;  2HOS A;  5D6E A;  4HDU A;  3ABM H;  4OAZ A;  2QUF A;  2ID6 A;  2X1C A;  3V42 A;  3KLN A;  2HPB A;  2FRH A;  2VGJ A;  3ZNT A;  2X7M A;  1D5J A;  4XRS G;  1R00 A;  1Q2Q A;  3QWL A;  2FZ0 A;  4MFD A;  2DA1 A;  1I3Q J;  5B5E C;  2A61 A;  3KP3 A;  1RET A;  4BHP A;  2OU2 A;  3DEU A;  3DBL B;  4AVZ A;  3B6A A;  5HNH A;  1TP4 A;  1BOA A;  1W7P D;  3CO7 C;  1KGG A;  2Y2Z A;  2WAQ A;  3K4N A;  3LSK A;  4W97 A;  3CP8 A;  4XMY A;  3WGI A;  3GTQ J;  1FY7 A;  2H6B A;  1XJ2 A;  4MN5 A;  5E2G A;  2GX5 A;  1IYO A;  2JCH A;  2QBY A;  5I5L A;  4JX5 A;  4ZDX A;  1U5T C;  2UXN A;  1YO5 C;  3SW1 A;  4H2E A;  4IJO A;  3GQZ A;  5FRO A;  1G4D A;  1HOV A;  3CP2 A;  4BBR J;  1Z77 A;  2WAF A;  1DP9 A;  5HDN A;  5IOZ A;  3B8Z A;  2K3F A;  1O3T A;  2ERQ A;  4XN3 A;  5C4X J;  5EEC A;  1S4S A;  4UVC A;  3SH7 A;  1MBJ A;  4Q47 A;  1MKI A;  1TS6 A;  3P24 A;  1RI7 A;  1X2N A;  3BQA A;  5HDS A;  2HZT A;  2L5Q A;  2CU7 A;  2KIU A;  3QQA A;  2O99 A;  3FPW A;  1R9T J;  1TTY A;  3IHB A;  4R1G A;  2HZ5 A;  3TT4 A;  3C7U A;  1SLM A;  1X4O A;  4BJ6 C;  3IRQ A;  1FYM A;  1JTG A;  2FBH A;  2KRF A;  2A49 A;  3GDI A;  4N9L A;  2PJR B;  1R54 A;  3ZVS A;  1MZU A;  1JIW P;  2E1M C;  2X48 A;  2OQG A;  5DTD A;  3VFH A;  1XP4 A;  5A90 A;  3E0Y A;  2P7V B;  5IP7 J;  2ECB A;  4CZZ A;  4K08 A;  4Y7P A;  1CIZ A;  1JKO C;  2BG1 A;  4L0Z B;  2FBI A;  2M9H A;  3T5X A;  1FIK A;  3BQZ A;  3WG7 H;  2ZC2 A;  1ZG5 A;  3KO6 A;  3Q7V A;  1BYW A;  4N0B A;  2XK1 A;  2GOM A;  4R3B A;  3P09 A;  2OF7 A;  5E1Z B;  2ADU A;  2X4H A;  3BP8 A;  1W63 Q;  3IWI A;  1MMD A;  5DCM A;  1YKD A;  3TSK A;  2W25 A;  2M34 A;  3Q5F A;  1ERQ A;  3MMH A;  3QHY A;  3T1Q B;  1TNT A;  3SZP A;  2W15 A;  2WO8 A;  3B92 A;  1HOM A;  3H5R A;  2D45 A;  5D5X B;  3DPF A;  2K9C A;  3T1B A;  5JHU A;  5FLM J;  3CCY A;  2K2G A;  1VB6 A;  1ATL A;  1K78 A;  1ON2 A;  1YG2 A;  2YUF A;  1KUG A;  1OJG A;  3ZQ7 A;  4EER A;  1HFS A;  3PM1 A;  2R7O A;  3TO6 A;  1PWW A;  3EQV A;  4S2O A;  2HZD A;  3AGD A;  3KYE A;  3G5C A;  2ZJR F;  5L7F A;  3BG3 A;  2UXX A;  4UHU A;  3VOL A;  2PU2 A;  3IX4 A;  5E20 A;  3CCV I;  3S3M A;  2Y2Q A;  2PD7 A;  1PP7 U;  1ETQ A;  2K86 A;  3K2N A;  3ISG A;  3ZVT A;  2XC7 A;  2I5U A;  1HDP A;  2F4M B;  3RKY A;  3KE2 A;  4CYD A;  2DYR H;  5JFR A;  2GQQ A;  2Q0O A;  1A35 A;  2VLG A;  3LQB A;  1YJN I;  3GTJ J;  3EWJ A;  5FQQ A;  3S16 J;  2X1D A;  2NRA C;  1B9M A;  3FM5 A;  4LRX C;  4GJ4 A;  4OH0 A;  1SAN A;  4QLC U;  4CJN A;  1Z21 A;  4O7D A;  5CJ9 A;  4EM2 A;  2OXW A;  4IJA A;  3ZRG A;  3UB9 A;  2BE5 F;  3F72 A;  3I58 A;  4FHT A;  2ELK A;  2LNB A;  4E4H A;  2R92 J;  2AIG P;  3ASO H;  3ZXS A;  5EGO A;  2DPD A;  4WXH A;  2RQP A;  5F08 A;  2DOD A;  3I7I A;  1HKQ A;  2E7X A;  3IXD A;  4JF4 A;  3OL3 A;  3CMY A;  3EDP A;  1F9I A;  4NNJ A;  3AYU A;  4LLN A;  4G12 A;  3F8C A;  2EZI A;  3M9A A;  3E6M A;  3FWE A;  3G2Z A;  3LIC A;  1O3S A;  2VX8 A;  3RPU D;  3BCB A;  1V55 H;  3J7A O;  3BW6 A;  2DW0 A;  3B2Z A;  5C4J J;  3G4S I;  4GFB A;  1FLI A;  4S04 A;  1RC9 A;  4K91 A;  4KZ7 A;  2MLS A;  3HBV P;  3I4N J;  3S7Q A;  4R4S A;  2A6H F;  3TP3 A;  1TWH J;  2HYF A;  2QWW A;  1G59 A;  4KG6 A;  5F04 A;  4I98 B;  3MSH A;  2Y6C A;  2D1H A;  5LHH A;  5FJ8 J;  1LHY A;  1OPX A;  2XAS A;  2K31 A;  3CJQ B;  5FSR A;  2V9K A;  2JA8 J;  2FBK A;  3LST A;  1K25 A;  3FMR A;  3GUD A;  5AIP A;  2OLU A;  1GO7 P;  3MS6 A;  2EX6 A;  1ZLJ A;  3L7H A;  3PUF A;  4UAA A;  5E8G A;  2ZC6 B;  3OYF A;  3U1K A;  1I1S A;  1EH7 A;  3B47 A;  3NOP C;  2PR6 A;  3F23 A;  1YS7 A;  2X6X A;  2HPM A;  1DUX C;  1EJ9 A;  4PFO A;  1CQT A;  1XFW A;  1TQP A;  5J4V A;  3BG7 A;  2DMQ A;  4BQA A;  4OIQ F;  1Y28 A;  2I72 A;  5K5R A;  2DTZ A;  4EV4 A;  5D4S A;  3KHI A;  1QZZ A;  1YS6 A;  1ACI A;  3T0Y A;  4HW0 A;  1WVR A;  4WX9 A;  5EYR A;  5FD5 A;  2EZH A;  1TW2 A;  3TQN A;  1OM6 A;  2OW0 A;  3BLY A;  5EGO B;  1YLY A;  1CAQ A;  3TMO A;  4CCM A;  5KAF C;  3L09 A;  3DSL A;  3QU6 A;  9ANT A;  4BYY A;  1Y8R B;  1KU3 A;  1DJA A;  5TGF A;  3CPT A;  3LY4 A;  5J47 A;  2JZY A;  2QVO A;  1AWC A;  4ON1 A;  2V6E A;  5FRN A;  5DKL A;  2HVR A;  2J80 A;  1Y4O A;  2HR3 A;  4BGD A;  3LUM A;  4OOM A;  2V1N A;  2CUZ A;  4JF5 A;  4ZTK A;  4LLO B;  2EFN A;  3NX7 A;  3TG9 A;  4YII A;  2VE9 A;  4MBF A;  3MZ8 A;  2B95 A;  1XFV A;  3WS1 A;  1RIO H;  2ZFW A;  4HRI A;  4LB5 A;  1K4S A;  5IY5 H;  3E6B A;  4BQQ A;  2JUG A;  4I3A A;  2LF7 A;  1XN7 A;  3O2P E;  3DU6 A;  1PDN C;  1BSW A;  4RM3 A;  5BQT A;  4JXG A;  1HV5 A;  1HD8 A;  3HM5 A;  2WZX A;  3G2B A;  4PSW A;  3M8F A;  5L2F A;  3OOP A;  2JRM A;  2FMY A;  4AIJ A;  5D4R A;  1ZYR F;  1XGI A;  1MMA A;  4S2J A;  2BY3 A;  5J3W A;  3DPL C;  4J4M A;  1OR7 C;  966C A;  2Q8K A;  3DF8 A;  4A3B J;  2BXZ A;  3HLG A;  3LOC A;  1R1U A;  3C7J A;  3DBR B;  1TDL A;  3KEY A;  1PWC A;  1DJB A;  4IX7 A;  1QIB A;  3TDU C;  3K7A J;  1AKL A;  3WTW C;  1TS0 A;  1XFN A;  3D1N I;  1WHU A;  1KAP P;  4WK7 A;  2XA7 S;  4BL0 B;  4A3E J;  2VKS A;  4WZ5 C;  2L3D A;  1FBL A;  1G4K A;  1IEM A;  3K7N A;  4PKU A;  1EH6 A;  3BR5 A;  3P9K A;  3K0L A;  4D5C A;  1DP7 P;  3HOU J;  3IH3 A;  3SS5 A;  1R36 A;  1S67 L;  5GLC A;  3U21 A;  1ULY A;  3ZPL A;  4PGH A;  3EDG A;  3V7C A;  4AID A;  3BRM A;  2GAU A;  2EXB A;  2E1N A;  2XKO A;  3V3R A;  2LG4 A;  2VKD A;  4LIV A;  3UE1 A;  2MBF A;  4XLP F;  4HEA 2;  2ZQD A;  3WS4 A;  5CUH A;  1T18 A;  2NS0 A;  1SFX A;  3MBZ A;  4ARZ B;  1UG0 A;  3I54 A;  2XFS A;  2UV1 A;  1ETW A;  4H4K C;  2R7W A;  3KX0 X;  3RJU A;  2MJ6 A;  3SHF A;  5EVI B;  1P7J A;  2DOE A;  1NK3 P;  2XAF A;  5HWT A;  2JWT A;  2VI6 A;  1VEU B;  4V2G A;  1BZA A;  3MZH A;  4L9N A;  3LQR A;  5JLW A;  4RBO A;  4HES A;  2OCE A;  2VT3 A;  4XKC A;  2HP9 A;  3F18 A;  3MF0 A;  4GNU A;  1NG6 A;  1NXY A;  4KIB A;  1T1B A;  2HDS A;  3KYQ A;  4F93 B;  5LFA A;  2VKE A;  1U8B A;  5LHI A;  4A93 J;  3H92 A;  4KZ3 A;  1LB2 A;  4BBT A;  4CLC C;  4R4R A;  1ZKJ A;  1K38 A;  3KCC A;  3U1D A;  1Z05 A;  5C3E J;  3JRA A;  3OPH A;  3HUG A;  5A92 A;  2DMT A;  3ZXH A;  1JAO A;  4FUW A;  4N9H A;  5DCF A;  2Y4A A;  5LLQ A;  4M72 A;  3W6K B;  3J7Y J;  2F5D A;  4BJP A;  5D5U B;  4UY8 I;  5FI7 A;  3L2Q A;  3HLD A;  2Q2E B;  1Y1V J;  3D5S C;  4LG3 A;  4XOP A;  1BIA A;  2DQR A;  2QKP A;  5CVU A;  1W8Q A;  3D9Y A;  4JXW A;  2L0R A;  5B5P A;  3RXX A;  2ISY A;  1UAA A;  1BA5 A;  3PO2 J;  4QPR A;  4BQM A;  3I53 A;  1JI8 A;  1XM5 A;  2VKV A;  1WI9 A;  1O7F A;  5HNF A;  5CTM A;  4LGW A;  5TBM A;  3MEX A;  4RA2 A;  2BAS A;  1OM8 A;  2LYC A;  4R38 A;  2PI0 A;  1OCO H;  1R5H A;  1XTA A;  1Y8Q B;  2NVU B;  5LGU A;  1A0K A;  1GA0 A;  2WV0 A;  2O9C A;  1FJL A;  1KU2 A;  3BFC A;  3LIE A;  2QLZ A;  1VQ8 I;  2J83 A;  2CQN A;  4KQQ A;  3KYD B;  4PM9 A;