3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRRE PROTEIN
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTEA 3DTIA 3DTKA
chains in the Genus database with same CATH superfamily
2K9SA 3WHBA 3LAPA 1GVDA 1PZPA 5KVRA 1HCRA 2BY0A 2ZFUA 2RVCA 9ANTA 4BJ6C 2Y2IA 1GHPA 1XFZA 3HDDA 5J4YA 4BBVA 3UPOA 4FVLA 1FBLA 4G12A 1XUDA 2ISZA 1J0RA 5C5KA 4F3QA 5HX9A 1N9BA 3J81Z 4A0ZA 1TLHB 1X19A 4R8HA 1FBSA 2OF7A 2M8GX 3HG9A 5LGTA 2OAZA 1YLJA 1A31A 3RXXA 4LG0A 2XAGA 3EWJA 3BECA 5DUIA 3PAGA 4ZYGA 3JVUA 1GA0A 2R5YA 5IYBJ 5L3DA 1H89C 4XRSA 3M8EA 3BQYA 3HLFA 3PQKA 5CEBA 1IADA 5G18A 3KCCA 2OZ6A 2BY2A 3F1OB 1IV8A 2W3FA 1FNNA 1ETKA 3ULFA 3MFDA 1EJ9A 1K54A 1X0OA 1XA7A 1L3LA 4S04A 3K7LA 1CK3A 1OYWA 4RX3A 1QNTA 2EJRA 3F0CA 3VP2A 4PM8A 3DXJF 4XXRA 2L7FP 1Z09A 1TNTA 4YEJA 3U1KA 3IWZA 4AVPA 5CEDA 5GLBA 3M8JA 5CGSA 2MC3A 4UUSA 5DM7F 3ZN0A 2AYKA 5I5LA 2ELKA 5CVVA 4ZDOA 4EJUA 2BEOA 2BY3A 4ME4A 5L3GA 2DMWA 2WV1A 2H28A 5HDDA 1IYSA 5FKLA 1W0UA 3RXWA 3C7UA 5EECA 1ZTUA 3SOIA 4RAZA 1RGYA 5GAGJ 3HOUJ 5FFXA 2P04A 2W1OA 4B88A 4Q4ZF 2DK5A 4HNBA 1OTIA 4E6WA 1HW5A 1JHFA 1VQ4I 2OJED 4IHTA 1MY8A 4X55A 4LB6B 3IUOA 2CU7A 1MWTA 2HP5A 1JT6A 2KZGA 2LK2A 1AYKA 4G0DA 2V6CA 2HPMA 1PYVA 2Z3YA 3S7QA 3T1RA 3S4XA 1B59A 3RKXA 3W2AA 3CP2A 5A93A 4D0PA 5J7EA 5FKOA 4FISA 3ZGAB 2BY1A 4AU7A 2YX4A 2JA8J 2QENA 1U8RA 4HJ6A 1JUPA 2DA3A 1I1SA 3FWLA 1PI4A 2K40A 3P01A 4X25A 1D1JA 2QCOA 4CH7A 2PMZA 2DLLA 1GLNA 1EI5A 2ID3A 3FMSA 4PFPA 5FAPA 4XBHA 5HARA 3CDIA 1I3QJ 3H35A 2FX0A 3IKVA 2VB6A 2VJWA 1KONA 3IH3A 1JI8A 3BCAA 5FRMA 2O8KA 3E7LA 3DAVA 2WO9A 4H8RA 1XCBA 3SS4A 2IWDA 1B72A 2R5ZB 4CTHA 4GRIA 3T4TA 1OKRA 3ZG9B 4U0XA 4PKRA 3LR5A 2DW1A 4UVCA 1YJNI 4WWCA 2RNJA 4FD8A 3WWXA 3TMOA 4HIAA 1X3ZB 4QTRA 3HGGA 2CV0A 4HNVA 3ERED 1LL9A 3FHNA 1DPUA 2P0WA 4PZJA 2RQPA 5CRFA 3G4PA 2WOAA 4S2JA 3NY4A 4GOGA 1G3TA 2KIFA 3S3NA 2JA2A 3PM1A 1JAPA 4UNOA 5J6XA 4NUBA 4I39A 1GUUA 3A4CA 4HA8A 1V4RA 3TOBA 2CV2A 2FJ1A 2WGWB 4I3JA 3M7GA 4N92A 1ZGWA 5CERA 2K2GA 4OINF 2W15A 1V5FA 3IWIA 3LJZA 3KO6A 2NRAC 2AVXA 3OBFA 2OY2A 1K0KA 5JLXA 3TEDA 4WYYA 3C38A 2VJ4A 3TSGA 5B5EC 3V4GA 2XB0X 2DA7A 1Z3JA 5LEJA 3HBVP 4F7ZA 1UHWA 3QU6A 5BOTA 3CUQA 1FPQA 3GECA 5HAIA 2WWYA 4HSRA 3LSTA 1I6XA 1Y54A 3W6KB 4OP8A 2H6CA 3JREA 4CZCA 3DFGA 1IUYA 3OC2A 5HNHA 2Y2KA 3T50A 4WXHA 3KSGA 5HZHA 3ZNYA 3DWBA 3BWGA 2WGIA 1XMAA 3H92A 4NHJA 2P7VB 2R5ZA 4XSXF 5FROA 2E2DA 2A6HF 1O07A 1GHCA 4DYRA 2Y0MA 1OT6A 3NI9A 4XICA 3RPUA 1NJ4A 3EUKL 5CVRA 2B5RA 3IH8A 1D5JA 3VOLA 3OYKA 1OCRH 4IZZA 2E19A 4YIIA 3ZG5A 2RAEA 3QP5A 5FA7A 2MFZA 1D8JA 5HDSA 5B66C 2BBYA 4ZJ1A 2WADA 1BI1A 4KZ7A 5BPDA 3CJTB 3T4JA 4LK1F 1O4XA 1T2KA 1ZH5A 4EW7A 1FM1A 3K4LA 3PR6A 2JE5A 1B9MA 1FYKA 3IS2A 5LHGA 3A0BC 5EGOB 2K3FA 1UMSA 3LK8A 2EXBA 4PK4A 1NLYA 2A6TA 2VT3A 3LUQA 3EUAA 2DPUA 1ULYA 4PKUA 4UHTA 3F8FA 4FQGA 1K7AA 3HM5A 1IYQA 1YSPA 4EESA 1HD8A 1T6SA 4NXEA 1WSUA 1T0FA 2G0EA 3WRTA 3OOPA 4FH4A 4XORA 4X68A 3IXDA 3BC8A 3GTOJ 3CDHA 1UMTA 3OOUA 3UE6A 3NQOA 4MN7A 4ASNA 1NZUA 3FMRA 4PKSA 1T08B 4PGGA 3NC8A 3IQAA 3HXLA 4CCJA 5LHHA 3OYCA 4S2IA 4II2A 2RL3A 3WV1A 1OM6A 1YW7A 3WRZA 1ONGA 3DV8A 4B4ZA 2NUPC 1R9TJ 4I3IA 1XFYA 4MLLA 5F27A 4G6QA 1N9OA 1LL8A 3M2KA 3T4OA 1NTCA 3GF2A 2K9LA 1YW9A 5GP9A 1W63M 4P6ZM 3KYZA 2E3XA 3GMWA 3UMEA 4S2KA 5IU1A 4P5OA 3BA0A 2LY2A 3VFZA 2LRDA 1O0QA 1Z91A 1T1AA 1X1CA 1V5EA 1R6RA 1A85A 5CJ9A 1R55A 3LOCA 2J3TD 3MZHA 2ZOIA 2CO5A 2XPUA 1X4PA 3KP5A 2XEPA 4XMYA 3H82B 4E3KA 3S2WA 3KYLA 1KGSA 4XUXA 3IAS2 3ZXHA 4XOPA 4ZDLA 4EJVA 4TV7A 2PBDP 3OPPA 4NXGA 2ELJA 3JSOA 2EH3A 4HYEA 2WAQA 2E5ZA 4DGWB 3WS1A 3PJRA 3Q81A 4B47A 3WV3A 4IF4A 1Z1DA 5DTDA 1Y56A 1W5SA 3WG9A 2LMDA 3P9IA 1DJCA 1Q1HA 5M18A 3D72A 1I73A 2BOLA 4QY5A 5M5XJ 1T95A 1CK7A 3KHIA 5ICCA 3HLCA 2VONA 2UWMA 2VQGA 3ZOBA 4QPOA 1HBXG 4IVIA 4RGUA 1LL5A 3LEZA 2OQRA 2Y69H 2G7UA 4LB5A 2H5SA 1A36A 2XIGA 2ETHA 3FKIJ 3ZG0A 4MEYF 2KIUA 4PM9A 4FX0A 2ZQ7A 1SVMA 3LE9A 3VOYA 1RIOH 4AIKA 3I7GA 3BPVA 1OLTA 1BLHA 1HZOA 3H82A 4ZJ3A 1DGWY 2IAIA 1UJ8A 3A01B 3PIOF 2W13A 3F18A 4GHIB 2W82A 1I1GA 2X71A 1YFHA 4EETB 1UAAA 2WAFA 3LI9A 4EMSA 3S32A 1QMEA 4X6TA 2W1TA 1NLZA 2DFHA 3I54A 3AG1H 3HZJA 4PFOA 4W1UA 2DTRA 4L5JA 4WM9A 3TKYA 1R5GA 2D1VA 4I0AA 1S72I 3QHYA 5CHJA 3KYQA 3NIAA 2W84A 3FM5A 2MJ6A 3PQJA 2XAJA 3LY4A 2E1OA 3BFCA 3JAMK 4BD0A 5LGUA 4CYCB 5TBMA 1YJ9I 5H20A 1SFEA 1R1IA 1GHIA 2VE9A 1ZXVA 2M0MA 2FOWA 1GSXA 1ESUA 1FWZA 1W7PB 3OYEA 4U88A 3IBJA 3GW2A 3L2VA 2R7XA 2MD5A 4BQMA 2EILH 2OSUA 3GVAA 3ZQCA 3KEYA 4L9TA 1TW2A 1K55C 2X01A 1ZHHB 1VB6A 4PSWA 5BOHA 3A01A 5GL9A 4I35A 1S8NA 3ZQLA 2AXTC 4QPRA 2CUZA 2FNAA 1IN4A 5E2EA 2RKHA 3GTCA 1WA9A 4I38A 3BG9A 3SDGA 1DU0A 1KDSA 3K4KA 3PBRA 3SDBA 3HLEA 2JTVA 1RUNA 4JOMA 2QPNA 3GFLA 3CI6A 3LSMA 1S6LA 3Q9VA 1ES3A 4WZVA 2OTJI 5F1GA 1OR7A 1WJBA 3BLYA 2LVSA 3WODF 5CXWA 2UUZA 2MZEA 1N78A 1NK2P 2H8RA 2JA5J 1YO5C 1XPBA 4P9UA 3GZ6A 4H2EA 2FMYA 5KZHA 5D8LB 1BKCA 4ZTJA 3FISA 4HP9A 4XKVA 4XNFA 3LIAA 2FRHA 4HNTA 1YQYA 2XSJC 3HSFA 1U78A 3H36A 4R38A 3ZVTA 2FZ0A 2Y0SA 3K4JA 2PX9A 3NECA 1IDZA 1I1IP 1R4NB 2WB1N 3K6GA 2V0WA 3CD6I 2F4OB 3DBLB 1K6OA 4AUOA 2V26A 3BLSA 2Y2ZA 1EH6A 2ZXJA 1O7EA 4L9FA 4L9EA 3LAJA 3P24A 3ZG7B 2YUFA 3F1PB 3EDIA 4H82A 2TCTA 3I3LA 2Y2PA 4Z2YA 4FETA 1DJAA 4L9JA 1KE0A 3L00A 4GNUA 2A68F 1O3TA 1K78A 2JRTA 1OFCX 3VYRB 3IWQA 3OPLA 4HOBA 1KGGA 3C2HA 1BI3A 4AXQA 4YIFA 4IUHA 4WUJA 1YW8A 3F21A 2JKTI 3MBZA 1T18A 3FPWA 2KLIA 1MGTA 1J3WA 4RA2A 5FKKA 1KDWA 5TRDA 4PM7A 3HIFA 2W14A 3BJOA 2EWVA 2Y48A 4HF1A 4NEED 2DQLA 3DLLF 4E7LA 2O9BA 4EBNA 3DEUA 2Q8KA 2GOMA 4P87A 3GO5A 5IT9K 3RJPA 1VQLI 1RCJA 2IBDA 4XSZF 1XJ2A 1E17A 1EWZA 2M7VA 3RI4A 2DYRH 4N9IA 4P1WA 1SFUA 3RQIA 1R1TA 2NVQJ 1MDMB 4D5CA 5BOXA 4RLFA 4M4XA 1MBGA 2PMUA 4FXYP 4XLCA 2K2NA 3Q2HA 1MNDA 3H1CA 1IN7A 3HUMA 1XX5A 2HJ9C 4WZ5C 1W5TA 3BR1A 1CI9A 3F1PA 5B5OA 4LD5A 1MMQA 2OUMA 1IRXA 4XUZA 1NRJA 2WKRA 3UR3C 1Z05A 3I59B 2Z9OA 4LCMA 1EF4A 2EWNA 1LFUP 3CAXA 3BTCA 4BBUA 4HESA 4JA1A 4KZ8A 1F43A 4IBXA 4KUKA 1K6RA 3O64A 1D1AA 3ZQQA 4AIJA 3B6CA 1SKFA 4MN5A 4IRGA 1QBJA 3CCYA 4GDFA 1FSEA 2J83A 3WTYC 1VQQA 4LENA 1JE8A 1PJRA 3CLQA 3F6OA 2VKSA 3BFGA 2OZRA 3DTKA 3QOEA 4X1MA 2VBYA 1YCMA 4IXAA 5J8XA 1CGLA 1K61A 2PRFA 4GS9A 4B93A 2XF3A 2V8CA 2DFEA 1HVBA 3K3DA 3IH9A 1MDMA 4PKQA 2X3AA 5F0CA 3SYTA 2XUBA 3LJGA 4EERA 4HEA2 2QM3A 2X0LA 1T1BA 1MW7A 2DMNA 3M3YJ 1QUAA 2H0TA 4Z9QA 4DMZA 2IGOA 3OOVA 2HOEA 2HQRA 3JRAA 2QLZA 1HTZA 1EROA 3IRRA 2OPTA 3K1PA 3G6OA 1NYYA 3M1EA 3ZQGA 4MFEA 3D1NI 3GZNB 4E04A 5HS9A 2LR8A 2ACJA 2DDAA 1XJ3A 3M07A 3BZKA 3I59A 2HYGD 4G6DA 4PAUA 3L2WA 2HOAA 2W4SA 1FYMA 2H09A 1FSWA 5HWTA 4Y33A 3ABKH 3RZOJ 5HODA 2WKPA 2VA0A 1W7FA 2QA4I 1BR4A 5FAOA 1WJEA 1N77A 1SFKA 3N4IA 4LV0A 4ZTFA 1ZELA 3GLLA 3T4KA 1IUFA 1LDDA 3I56I 2MSYA 1Z67A 3HLBA 1YLWA 2R7QA 3EWKA 2RQQA 1XURA 4I7HA 3ZVSA 3P5JA 3CO6C 4R79A 1MH4A 1X4OA 3J80K 1J9MA 2P81A 5HDCA 3BR3A 3OIOA 4BEHB 4M74A 2PJTA 3K4NA 4MFDA 3WTVC 4AC0A 1MWUA 3RPQA 3LY3A 3V8KA 3NWTA 1B6AA 5D3OA 1PWCA 2CW0F 5GAEJ 3BW6A 2M4GA 4F91B 3M8FA 4A12A 3ZXSA 4OU0A 5E1XA 1S1YA 5DYMA 1PWPA 3ABMH 4BU2A 4DNCA 1VTNC 1XDSA 5K7ZA 3DW0A 2M30A 2QKPA 3G2ZA 1IKIA 2E1NA 2KZVA 3FIWA 2MYSA 2Y2GA 2DK8A 3CCJI 4H6JB 4JPMA 1JAOA 1P7IA 1I27A 3CCQI 1ACIA 4OVDA 3MS6A 4XLNF 5K5QA 2USNA 3MF0A 4KQRA 3ABTA 2FV9A 4LMYA 2W00A 2JBFA 3J7YJ 1OISA 2X6XA 2Y2OA 2INWA 2ACGA 2PJRB 3CF2A 3OYFA 3LQRA 2DT6A 1QQIA 4PJNA 3ZHHA 3HOWJ 1CGPA 4CCNA 2MD0A 5IYDJ 1ZG1A 2DJIA 1R49A 1BJAA 2PG4A 1D8FA 1SAUA 2XF5A 3CPTB 5EOEA 4BEHA 5C4XJ 3CUEA 3LR3A 2ZQ8A 5E1ZB 3Q1FA 1WWXA 3WGHA 2WTEA 2XAFA 4HF0A 4RGSA 5JVTA 5E3MA 1W4MA 5CPRB 5HD3A 5EE8A 1DUXC 5DTTA 3KMEA 1G3WA 1BM6A 2EZHA 4WZ4A 5LGNA 3TW8A 1Z6RA 3VYTB 4FOFA 2GZAA 4XLEA 3CCUI 4XRFA 2M0CA 2TCLA 4YFNF 2ZFWA 4K0XA 3Q0UA 4CA0A 2JKTM 2G2UA 1P9RA 4I02A 1XX2A 2JKRI 4CLCD 4ZZDA 2HKOA 4A3KJ 1BLPA 4XKWA 4JKTA 1IRGA 4XM6A 2CQ7A 4OIQF 1JGSA 1P4AA 4ESFA 5FEGA 1XGIA 4JXWA 2SRTA 1R1UA 4BHPA 1PW1A 4OMZA 1KAPP 2OW0A 1BLCA 4S2NC 5JR3A 4E3MA 1TQMA 4E7SA 5CUHA 2O6GE 1G6OA 2KX6A 1MD0A 1LI0A 4NDLA 2Y30A 4DQ2A 3Q82A 2BHYA 4AYBN 2XDMA 1VEUB 2YSRA 2V4BA 3ZCOA 1SMYF 3PFIA 3HOZJ 1PWGA 1SMPA 4IQ4A 4DD8A 4EBPA 5DD8A 3HVFA 2LLKA 1YTYA 3FXJA 5J40A 3TGNA 1KBCA 2P9VB 5A2QK 3E98A 3ZUKA 1F2KA 4C2MJ 5JVGF 3F8MA 3P1VA 3BCBA 3B02A 3CMAI 4RVAA 1JK3A 2X6OA 5B1BH 2XV4S 2WKHA 3LGOA 3IRQA 2EX2A 2F5DA 1L0FA 2NS8A 5CTNA 2M7UA 4WEJA 4ZYDA 2GXBA 4DRTA 2EFQA 1T19A 3K69A 1HSJA 2ID6A 4NQWB 3ROUA 1K7IA 3KPHA 5I43A 5IP7J 3NEUA 4GN2A 2E2HJ 3K1NA 4K08A 1D06A 5F0FA 5D1SA 2L4MA 2HF6A 2P74A 3N6IA 3NAUA 3LR0A 3RKWA 1F36A 2ERPA 3IL2A 2JJ7A 3I55I 4BS9A 2XC7A 5DUKA 2Y59A 3IF6B 3N8SA 3D5RC 1QZZA 3DBRB 4FE7A 3KE2A 2GM4A 3MXSA 5EYRA 3ML6A 3PYPA 4BXFA 2JN7A 1WH7A 4LRZE 4OQIA 1FSYA 5GLAA 3UPPA 3RKYA 4YNRA 4F55A 3BWLA 1S66L 4KZ9A 2DA4A 4BQNA 3CZDA 3F23A 4OOIA 5FKNA 1L0OC 4LV3A 3D3OA 4MLOA 5KAFC 1VQKI 1Z7LA 2RNGA 2O9LA 3GSGA 2FBKA 3NDEA 1OO9A 3BJNA 3BQZA 5JFRA 4OLDA 3KEKA 4A3FJ 2E34A 2A3SA 1J2XA 2VXZA 3G6EI 5FRNA 5HPIA 2Y2LA 2FSWA 2ZQDA 3R7WA 1X3UA 5DEQA 1MBEA 4NETA 2KHMA 1MWRA 1X3WB 4Y13A 5CZMA 3HJKA 2OLVA 2HNHA 3BR2A 1KE4A 2OW1A 1CAQA 5K7FA 2WY8Q 4BE1A 4R6LA 5E2GA 4XIDA 1KGEA 3UY6A 3EUHA 4R1HA 3JRHA 2QPJA 4XQFA 3PAEA 3KFWX 1RUOA 4CLCC 4GLQA 5KAIC 3I4NJ 1ND1A 5K5OA 3E5UA 3ZG8B 2L9SA 1X58A 5FDSA 3ZMUA 4A3WA 1POGA 5D6EA 4FCYA 2NUTC 1FCNA 4H49A 2VIXA 3GTGJ 5C44J 1PW8A 3T8TA 1PYYA 3S8PA 3EHYA 2YUSA 5M5YJ 4FSFA 1X1AA 1QVUA 1VM1A 4Q8IA 2W3HA 2DFIA 1W36D 4EU0A 3V42A 1MJAA 3B33A 3O5YA 2Y55A 1V9YA 2ZD8A 4KN7X 4IVNA 3G4SI 5HLGA 1GO8P 4YFXF 3Q2GA 3SFZA 5KK1A 1I2WA 4C2UA 3BOQA 2ZM8A 4B48A 1BQQM 1L0GA 4GUYA 1B8YA 4V2FA 5DF8A 2XVCA 4JK1X 4PPRA 4JGQA 2VXDA 1OM7A 5TFQA 3WGIA 3ABUA 1RI7A 1KUFA 1FQGA 4NC6A 1TEMA 2XH9A 3SH8A 4D1QA 1ZR2A 1MBFA 5M5WJ 1HKSA 5A8BA 2P8TA 3BJAA 5CVJA 2BYVE 2LOOA 2DCFA 4OLGA 1Y8RB 4P96A 1S4RA 4BBRJ 2QYOA 2WK0A 1NG6A 3CCLI 3CLOA 1KQ0A 4ITVA 4BGDA 2E1MC 4F3LB 1A86A 3FV7A 5EPHA 3IH2A 3M4OJ 1OTDA 2HVSA 3UE3A 1XA1A 4M6VA 2YPRA 5DCMA 5CYVA 4ID4A 4DZJA 5F1RA 2B7EA 2ZXWH 3HUNA 3FXMA 3LSHA 5FO5A 3FX3A 2JC7A 4PJMA 4A3EJ 5DD4A 2PR6A 1SLMA 2R9WA 2CG4A 3K7AJ 4BENA 4DJ3A 5ICFA 5H2FC 4A6EA 4PKYG 3CG5A 4CGZA 4GYGA 2JKRM 3FKWA 1VZ0A 2JA7J 2CWEA 1NK3P 3LFKA 3EDHA 5J4VA 4B9OA 3PNYA 2F6CA 4LV1A 3S1MJ 3U2AA 1Z6FA 3DKYA 2ZQCA 4V2GA 1NZOA 2R78A 4ZBEA 2Q9NA 3SQNA 4HEFA 5HAPA 1W8YA 4BUPA 4U7BA 1LVAA 3VV4A 1I39A 1C0WA 4X56A 1YX5A 1ZLJA 4ZYEA 3BTJA 4JBAA 5FATA 1U60A 3C4OA 4UB6C 1ES2A 1CGEA 2X6YA 3VSLA 1MBLA 2L0WA 1OS2A 4F3LA 1VNDA 5BMZA 3HSRA 4HBLA 3CC7I 3VPRA 1QICA 4CCOA 4RB2C 1OTAA 4DJAA 3IHUA 3EEHA 2UZKA 5FQ9A 4G8XA 5GLCA 1OCTC 4X53A 2E8IA 4JPAA 3SFIA 3OYMA 2DA2A 2VKHA 2CMPA 4A6DA 2K5CA 3LGPA 1HQCA 4UUVA 3HRUA 3H3VK 3L7HA 2L0RA 2PQ8A 2V2FF 3JAMZ 3HLGA 3LSJA 2C6WB 3AGDA 2A49A 1WNIA 1JTXA 1T1CA 2FBHA 5D3CA 4A3GJ 1MKMA 3F8BA 4OOMA 3BG7A 3ZMVA 4GO1A 1IFQA 5A92A 2L7ZA 1LSWA 2UWXA 2XKPA 3GVBA 1APLC 1FMWA 1LFBA 3Q7VB 3V3SA 2XF6A 1DRMA 4A5MA 3O87A 1LPQA 3ITAA 1KUKA 1N75A 3F72A 4QSHA 2XFSA 4Y0TA 3LIEA 2P5KA 4ESBA 2DNSA 3WU0A 3NDGA 1T98A 3MJQA 2ZLYA 2DCEA 3W2WA 3NOUC 3DTIA 4A3CJ 1FEXA 4UA7A 2MC4A 4XT2A 1CXVA 1QJIA 3EETA 1ZRFA 4KIBA 2WBMA 3CCVI 1GA9A 3F1NB 3VOZA 3NULA 2W85A 4BBSJ 1Y93A 3TO9A 1BLSA 2XASA 3MZYA 1BUDA 5EF6A 4YRVA 4HP4A 1K54C 2HJEA 2LBFA 1SATA 2PD8A 3C5AA 5FQJA 2VBWA 4KA4A 5DJTA 4NC7A 3N8RA 5EV0A 3AGFA 1XM5A 3KZYA 3ZN1A 1OCPA 1R22A 4OWRB 2VGLS 1E0EA 2LB9A 3DU6A 5B3SH 3LSKA 1IXRC 1OT9A 2AO9A 4Y0UA 2EBIA 2WKEA 4MBKA 3GRJA 5EEGA 3KEJA 3BRMA 4IHSA 3CCMI 5GAHJ 1EA3A 3WTUC 5HLTA 2JNPA 1V55H 1B1BA 4MQ9F 4V19K 1KZHA 2PN6A 1BL0A 3ICYA 2E7WA 2LTPA 2MLGA 1XB4A 3VI1A 2W25A 4HPQA 5HL1A 2D01A 1FTZA 2A24A 3S17J 1W8QA 1UG0A 4A2UA 3K4MA 1YMXA 1KOUA 2EFXA 3DPUA 3VFFA 5E3NA 3TP0A 4CCLA 3I53A 2L9NA 2VOPA 1OJ5A 3KP3A 2IS1A 2VODA 4Y2FA 3ECOA 3CUOA 1ES4A 3ZP5A 1TS0A 4D2OA 4DE0A 2KJCA 2ERQA 2HOSA 1RM8A 4RDUA 4YFMA 2PMZN 4GD6A 3MKEA 2R3SA 5D4SA 1SLNA 1RC9A 2VV6A 4FASD 2JUCA 1IXSB 1TP4A 1OMIA 1EH7A 1CGFA 1U9OA 2HI3A 1I50J 1QPMA 5EG0A 1ETOA 2H0YA 3G32A 4B3AA 3T12B 4KMUX 2R0QC 1JKYA 2HVQA 4EATA 2EX6A 3G35A 3H9WA 3AKZA 5FQIA 5IT9Z 3UB7A 1KQ9A 1Z6TA 4H0EA 1AKHA 2H6BA 1SVLA 4HJ3A 2Y2HA 3C1DA 4MTDA 2XR0A 4C6YA 3TP3A 1OZ9A 3BYDA 2B0LA 2QQAA 2EB7A 1LHYA 4HDVA 5DKLA 1YQSA 2E35A 1YG2A 3P09A 5HVQC 4DYCA 4GW9A 1FOKA 4JX5A 2K27A 2VE8A 3HRSA 2L4AA 5AQ7A 2O0YA 4DF6A 4BQOA 5FL3A 2X02A 4IHYA 4N4NB 2WKQA 1P9WA 1XD7A 3FKJA 1ZHFA 1OYYA 4FH2A 1N9LA 1N25A 4S05A 1P7JA 4Y0OA 4PJJA 4A93J 1GKDA 1JKPC 2PYRA 3TQNA 1SAXA 5IHVA 1OCZH 3AG2H 1MKIA 4NG2A 4KG2A 1ZG6A 2Y31A 1IC8A 2ZKZA 1VQ9I 2HWVA 5HS8A 2O8XA 4Y7NJ 2NVYJ 1GDTA 4NK3A 1Z9CA 1UG2A 4QWQA 3MKFA 3A3EA 1CQRA 1XFNA 3DLAA 4BJPA 2KIQA 1TWCJ 4ARZB 3FXUA 4WCGA 3GLXA 2FMLA 5CHMA 1GXPA 2O7OA 3G1LA 4UV8A 5D4RA 2F2EA 2LKPA 4EXOA 2DA5A 2DDBA 3BROA 3FZCA 3KP6A 3Q0WA 1ZRDA 2ZJPF 1K83J 2JT5A 4BJ5C 2LC2A 4S0HB 2BXZA 3LQQA 1MZUA 1I3AA 4I01A 3K70C 1C8TA 5GTHC 1BZAA 3ZMDA 4O7DA 3AAFA 2DOAA 3FWEA 1YOUA 4WK8F 4CYDA 1BR2A 3E6DA 4ON0A 4E3LA 1UB9A 4EEFG 3D9YA 3VYUB 3LSPA 3HREA 4QY6A 2V79A 2JSDA 5JHFA 1G49A 4KG6A 3ZQIA 4G9LA 1MBKA 1O3QA 4B1RA 5ILUA 4A3JJ 2IT0A 5EFWA 2K85A 5DV5A 2Y2MA 3B73A 3IHBA 1X2NA 1K6YA 4FCFA 3E1SA 2HEOA 3LNQA 3HYIA 1UEAA 4L19A 3J80Z 1TWFJ 3A3FA 2BXYA 5EJCA 4ARZA 1DY6A 2M7AA 2Y9YA 4RA7A 5KMWA 1DP3A 3NWSA 4I2OA 4PKYA 2GDNA 5TR7A 3CF5F 2R4GA 3OYJA 4ZTKA 2LNBA 1IZ1A 1MJBA 2KOIA 3QPLA 3F15A 1WJCA 2HPBA 1G5UA 1F4KA 3ELKA 3ERMA 1OQYA 3HB2P 1WVRA 5IP6A 1GKCA 4MBFA 4R3AA 1TZLA 2WZZA 5TGFA 3EGXC 1IO2A 3DEEA 4LG3A 1XS9A 1H9TA 3U21A 4FXQA 2QKLB 2VKVA 1MWSA 2K9CA 4M73A 2JHEA 1ETWA 1Z0XA 2DMTA 4CCKA 1XTAA 1WYCA 4O01A 5MC7A 4HI4A 4E7KA 4EVIA 5LABA 4OQGA 3T4SA 1W79A 2CUEA 5BPIA 3GR2A 4WXDA 4I03A 3H5NA 2GJ3A 3GUDA 4BL2A 1BIWA 2LSOA 4U0YA 2ZCWA 1I5QA 3MCZA 3ECHA 3QP6A 4MNUA 2WAQN 2POJA 3LL7A 5J47A 2ADUA 1ZAOA 4B4XA 2YIGA 3L7WA 2DOEA 3E4QA 3A3DA 1S67L 1UMQA 1QMFA 1IELA 4EQ1A 2R7RA 4QIWN 2GA2A 4O0PA 3R61A 1YI2I 1LI9A 4DPEA 2ZMFA 2JZYA 2W0NA 1O0TA 1BUEA 2ZC5B 2E71A 1S4SA 2V4JC 1IF1A 3MZEA 3OYAA 5FD5A 2J9PA 1RRJA 1DP6A 5EVIB 2XQZA 1BC7C 1MBHA 1W7PD 4GJ4A 3ZR8X 2ME6A 3KP4A 4PKVA 2LF8A 1FOFA 1SD6A 5EDNA 2PLYA 1J7KA 3BPXA 1FX7A 4KQDA 3OYBA 2BLSA 2FQ4A 3N4MA 1LT0A 2FV5A 4N0BA 3H0GJ 2H1KA 3WGGA 3R60A 1C7KA 1ZLKA 5EOOA 1Y0VA 2DU9A 3U1DA 1Q2PA 4E70A 2WY7Q 2VQHA 3DKWA 4C3IJ 2PT7A 4DBQA 1ZP5A 3OYLA 1G59A 1JIWP 2Z2DA 5F0HA 1ETXA 2VJIA 1U5TB 2ZXIA 5DTKA 5L3BA 2D1OA 1MMSA 3HOXJ 5A2QZ 4NNJA 3BTIA 1GXQA 3E2LA 1KU9A 3TRCA 1DU6A 1J59A 2BVLA 1R1JA 1H71P 1U6GA 2XPVA 4E7JA 3JVVA 5EVIA 3SJMA 3PL8A 5HFOA 2J80A 2ICWG 2R7UA 1KUIA 2VLGA 3E97A 3GYHX 3R4KA 5KCMA 3F3XA 4C3HJ 3LILA 5H6RA 1BN5A 2DTZA 3LSRA 4ENMA 5HPFA 3BFDA 1JTYA 5FLMJ 2XF7A 3OZHA 1YKDA 3C18A 4GWNA 2ZC2A 3M6BA 3C3WA 4BKXA 4D9JA 1M6KA 3PNTA 2WKIA 1IABA 4XLAA 4J19A 2K7SA 3F1OA 1FR1A 2FH5A 2VUMJ 3MFKA 2HDUA 3BM6A 3SH7A 5FDHA 1ZRCA 3ZCZA 1VQMI 2DMUA 4FTHA 3B6AA 3RYPA 3OPHA 1ZARA 1XG1A 1L0EA 1R5ID 3LA7A 1U8BA 1F1ZA 2BTFP 2EZKA 4L5IA 4QHCA 3LUMA 2HDRA 1X2MA 5JLWA 2PDRA 3G31A 1MBJA 1V9ZA 2CH0A 2E1CA 4RAYA 2X1EA 1Y8JA 3FKVA 2GBYA 3HB9A 3E0JB 1U5TA 2HZTA 1D8KA 1CIZA 3TDUC 3FXLA 4JX6A 4BAYA 3O6BB 1JH1A 1RGZA 4E6KG 2AQFA 3HCYA 4MHGA 2PU2A 4L5EA 3G73A 3QU3A 2IA1A 3E6MA 2HXOA 4GKUA 2DAOA 3KYDB 2ZNYA 3L2RA 3IXHA 1OR7C 2M1BA 3TJZC 1Z3YA 3RH8B 4WF2A 1ZXCA 2NS0A 2ZSIB 4I5SA 3V5MA 3I64A 4LLOB 1TQPA 3IX4A 4HQMA 2A5WA 4U0TA 2CQKA 2XHKA 4EGYA 3OS1A 3EYIA 4OAZA 2Y6DA 4JIJA 3PO3J 3LEAA 4DV8A 2XGEA 3VOEA 3MMYB 5DFXA 3VSKA 2DT5A 2NS7A 3BR0A 3HOTA 2MGQA 2L2OA 1SC7A 2RREA 3J7AO 2L54A 4BQAA 2O36A 1PWVA 1NWZA 2JT1A 2L9VA 1W63Q 3T1BA 2K86A 4IEDA 2NOJB 3TS4A 2A05A 4IN9A 2F5CA 1D0XA 5C3EJ 2AXLA 3DWKA 1MC0A 2DODA 2L02A 3DCFA 2W3DA 1JHHA 2ZXHA 4RBOA 5FGMA 1DDNA 4WMCA 3TOIA 1WYBA 1BZSA 4YINA 4ABZA 2OWJA 2HXIA 2LG4A 2WUQA 1W1WE 2E2JJ 3CITA 4LLNA 1NYMA 2X9DA 2K9QA 2GWRA 5EVLA 3ELMA 3C30A 3AIGA 4EBLA 3IAM2 1PRQA 3H9QA 1V5GA 5I4OA 3IX8A 3H0DA 4OPYA 3GBOA 1G2HA 2IRFG 3K3CA 4GDNA 1L6JA 4IOAF 4L9VA 1BOAA 2W24A 4ZR5A 1UELB 5HSQA 3KLOA 2DXIA 2CRGA 2B95A 1XSVA 5FAQA 1LJ9A 4U87A 5HL6A 4CDGA 1D0ZA 1PWWA 2V8FA 3S1YA 2JRMA 5EVEA 2WGWA 4XN3A 3EGDC 4ZDPA 1ETVA 4Y4RA 4MGRA 4XL9A 1IN6A 5M3FJ 5CQGA 3A0VA 4OKPA 1H8ZA 5LEKA 2YKFA 1PIOA 3G3ZA 1G05A 1EUBA 2O03A 2FBIA 3QOPA 4XM7A 4LOCA 2KRHA 5FI6A 4OMYA 5F1FA 1USSA 1PUFB 4A7BA 3KX2A 1XP4A 2YR2A 2M4KA 3A03A 3K4CA 2VBXA 4RS8A 1PDNC 1YLFA 2M9HA 1VQ7I 3MMHA 1J5YA 4S2MA 3LQBA 3RTRA 1TS7A 4DDSA 1CEGA 3QNBA 4AIHA 3PUFA 2L1MA 1NRFA 4JQFA 3K1MA 3WTXC 3MFXA 2VC1A 1G6AA 3GQZA 4A0XA 2EV0A 2F4IA 4U0VA 3RTYA 3AL0B 4K2EA 4H4KC 1GXDA 2XK1A 3GFIA 1STZA 1O7LA 3M1CA 1FLSA 4B43A 2ZC4B 1Q2QA 3G2YA 4AYBA 4UY8I 4ZYAA 1XCVA 2ZJ2A 4HMAA 3HOSA 2Y75A 4OIPF 1ALQA 1O3SA 1S3JA 3PFYA 5D5VB 2N8GA 5CVUA 1WJDA 1R54A 4HX8A 2CC1A 4MBHA 5EGOA 3GTLJ 1RKWA 2BZTA 3S2DJ 3PBQA 2E60A 2UXNA 3KX0X 1XFVA 3OHLA 3O88A 2RJQA 2BG1A 1UHMA 1I6HJ 5E8IA 4IJOA 4DKIA 4CLCB 1HV5A 1PI5A 5JMYA 3O8HA 3OYGA 5HDGA 1M1EB 1ZGAA 2IGMA 5AIPA 3V39A 5M19A 4P55A 1B8IB 1K57A 3HSEA 1W5DA 3WHCA 3F22A 1Y28A 5DM6F 2M8EA 4J01A 3H3ZA 4F92B 3QWLA 4HJ4A 4MMNA 3HUGB 1BKCE 3OHOA 3OMYA 3QAHA 1VFCA 1KVLA 2LYCA 1YS6A 1BI2A 2DDFA 1S0WA 3HPGA 3A3JA 4HG2A 1FOYA 5HLIA 3OYNA 2FOKA 2Z5UA 4LIVA 1FY7A 1N9NA 4IL6C 1TT0A 4JXGA 3FBIB 3VE4A 1PWQA 5ED4A 1BTLA 1XAXA 1MH3A 1OPCA 3RFBA 4RX2A 3WG7H 2R7WA 3QRFF 3OS0A 3ISGA 1G9KA 2OVXA 3E2KA 3MD2A 3QYFA 4UQIM 1RNLA 3IH4A 1YM1A 1YX3A 4Y3OA 4EFSA 3HRMA 3NARA 5DF9A 1SD4A 1FCOA 1Q3AA 5J3LA 5F1JA 3E5XA 4I09A 3S14J 3N97A 3DWLE 4AVZA 3HHHA 3T4LA 2KL4A 3T4QA 3GMEA 2H10A 3QODA 3RYRA 1YAXA 4C9YA 3NRVA 2E1MB 1ONHA 1FSHA 1B8IA 2DI3A 1H0MA 3E5QA 2BHZA 2TRTA 2QEXI 3GTQJ 4KZBA 4HQAA 4BXUA 2A07F 2QBYB 4PJLA 2JT6A 2ZBKA 3DPTA 1NH3A 1IKGA 1P6RA 2PFBA 3IXGA 1TT5B 4OQHA 4XKBA 4OONA 3HUGA 1J09A 1M40A 2CQQA 2OD5A 5A91A 3T5XA 2FFFB 4ANJA 4GDBA 4EV0A 5FQKA 3S16J 3GDIA 3MVPA 1SRPA 3CUEC 3EDZA 4DF9A 1FIAA 2M3AA 4LGWA 4P6ZS 4RB0A 4U0WA 2DJNA 2WYXA 4L9GA 5GTIC 4M6XA 3LIFA 3L2CA 2OAQ1 3UPNA 2XAHA 3G30A 1VETB 2QWWA 3LIBA 2J7VA 2VV7A 4IUWA 1JUMA 2IPQX 2K9NA 2V1BA 2CSOA 1FCMA 2DMQA 1MMRA 3E6CC 3HKZA 4ESPA 1S29A 2J3TC 2IA2A 5CHUA 4MEZA 4GHIA 4S2LA 2RDPA 1P92A 3DF8A 2Q9MA 5D1UA 4CXFA 3OYHA 2NVUB 1P2FA 2JA6J 4MN6A 1VI0A 2QHKA 1O3RA 4QPQA 3GWZA 3HBRA 3E4PA 5E18F 2M5WA 2P6TA 1F98A 1BSWA 1LVKA 2Q2EB 2LY1A 3O86A 2X3BA 3EDPA 1LLBA 3D5LA 1OTBA 2Z2SB 5AIQA 4Q47A 4BY1J 4K0WA 3N05A 4RB3C 3RZDJ 5CTMA 1G8XA 4CYCA 1B4AA 2G7HA 2EA4A 4Z1WA 1L2SA 2X7MA 4A3MJ 1XFQA 1W7PA 1RR8C 1YSQA 4GYIA 2PR5A 5FI7A 2GOXB 2HQNA 3PSIA 5H6QA 3WS4A 4XRMA 1ZKJA 2LY9A 4GR3A 3OCNA 2HGVA 5LRSA 4ENKA 2GXAA 3ZGKA 3K2NA 5LRRA 3TE8A 1B3DA 4R0QA 3DPLC 3C4PA 3VYSB 3L2QA 4HX3A 4Z6YA 2G9WA 1ACFA 4R23A 1MZBA 2Y91A 3KLNA 3NOPC 3L2UA 2HDDA 1ZKGA 2EROA 1KQ8A 2WV0A 2PHYA 1YJWI 1FBUA 2A3UA 4QKZA 3RTSA 2HQ5A 5IP9J 3BEBA 4UQIS 5D7WA 3QPHA 1KYWA 2IGKA 4LJZF 3Q0VA 4LG0B 5I0LA 1YP1A 1FYLA 4D60A 2VI6A 2DDYA 2QQBA 3MN2A 2DA1A 2QSHX 1FTTA 3BG3A 2Q2EA 4K91A 3B2ZA 3FC7A 3VP0A 5FLXK 1G12A 3QYBA 2P08A 5CGWA 4KNYA 3JR9A 1E3UA 2R9XA 1P0ZA 3AG4H 3QYEA 2V1ZA 5KNLA 1IJWC 4RAGA 4RQ9A 4XN0A 4M3BA 3N2UA 1R00A 1R36A 5EUAA 2W1RA 3S1NJ 3PBTA 1U0JA 3LWFA 3P7NA 3UDXA 5F6FA 4UUSB 2LKXA 3S7OA 1H9GA 2QSFX 5IYCJ 3E0YA 3UO9A 1P9QC 2OLUA 1FMVA 2QF7A 4HDUA 4FX4A 3PBSA 3TW6A 4IHWA 4ZRRA 1ZTRA 2XS3A 1JJ6C 2STWA 3HTUA 2HU9A 1HF0A 4GD8A 5EZHA 2XAUA 4BQQA 3S22A 5LFAA 4EM2A 3LICA 3KEQA 2MZIA 1H88C 4HLYA 1XMKA 3I5UA 1BUVM 1QU3A 4BMWA 1HY7A 3EUHC 2FQ3A 2W27A 4JGRA 2QSGX 3R0JA 3OCLA 1D5YA 2IS4A 1G6NA 4GR0A 1XDUA 3IF6C 1VHMA 1JJ9A 1QVTA 1PP8F 2MABA 3OS2A 3SS5A 3N2VA 4EV4A 4LLLA 4XM8A 3GTKJ 1TWGJ 1HOVA 3LQ0A 2XSDC 1QZYA 2R7ZJ 3PBNA 2GX5A 1WKMA 2F5FA 4PHTA 2X51A 1ZYRF 2RC4A 4KIFA 1S7EA 2JKGA 1ORKA 3KYCB 3PSFA 4YG2F 3JRGA 3RCOA 3PXPA 1BKCI 5L3CA 3MSHA 1TL8A 2X1CA 4LFUA 1WJAA 3CP8A 1XC5A 1YRNB 2JPCA 2YU3A 3RKQA 3TSKA 4WK7A 3CMEI 4CHUA 2DW2A 1S7AA 3BZCA 3N8LA 4J4MA 2CMNA 5AVFA 5L7FA 5AVEA 3FXQA 2OAP1 4GR8A 1IRFA 2EFNA 2FNPA 2H94A 4HZFA 3A0HC 1Y8QB 4KYWA 1B72B 5GHZA 4ZH4F 1DQUA 3E3VA 5CQEA 1ZVXA 2CFOA 2X4HA 2J0TA 4HAMA 3GXOA 3PBOA 1FIKA 3HY7A 4BDZA 4Y52J 3DPEA 4EQQA 5FSRA 4I98B 3IXBA 5L2FA 1RPWA 5M3MJ 3M2JA 1P4WA 2M45A 1AOYA 2XGCA 2QKMB 3CMYA 2KQRA 4KG5A 2OOLA 2WGVA 1IGNA 2AS5F 2ZC6B 2ZMEB 4KMFA 2PD7A 1OPXA 4KDPA 2IP2A 4PJ0C 5L3FA 2XRNA 3ZNTA 3LA3A 2HP6A 3VTGA 4U7DA 3BY9A 2JMWA 1F5TA 2FF4A 5D6FA 3A0RA 1ZTQA 5BPAA 1Z3XA 4D7NA 2OCEA 4JQGA 4AWXB 4G7HF 3CUQB 3CWFA 2FXAA 4M9ZA 1MNMC 2P7CB 1YRNA 3DU5A 3SXYA 3H7WB 3AYKA 4R4SA 1WZ2A 3JRDA 5KHDA 3TW7A 4EEUA 2K4BA 1KUHA 1QJJA 3V67A 5BOYA 2VLAA 1JAQA 2KRFA 1BW5A 2ZM0A 2WAEA 4JX4A 2WO8A 1FIPA 3KZIC 3P98A 3VP3A 2EX9A 3F1AA 3OSFA 3E4OA 4B3XA 1IXCA 3CJNA 2ZL1B 3V96B 3I4PA 5K1YA 2HS5A 3L9FA 1I5ZA 2VOOA 4ZAMA 1GSVA 2KRJA 4CUGA 4YELA 3M9AA 5L10A 4L18B 4OOLA 2FEZA 4S2OA 4XLHA 2ZJRF 2ZM2A 5M1AA 1TVFA 2LD5A 2CQXA 3B47A 2X1DA 4BY7J 3GFMA 5FQQA 1MNEA 1K4SA 1Y0NA 3OYIA 1BW6A 3LFVA 4RB1A 2ZMEA 1KU2A 3R6SA 2COMA 2VX8A 2Z2MB 2V9KA 2F5VA 3KP7A 3NX7A 3HOVJ 2Y6CA 2E36A 2QUFA 3IS2B 2EA9A 3JRCA 2L01A 1USTA 5CVIA 4OP5A 1G4DA 3HL9A 1Q1VA 3F8NA 1IAGA 1O7FA 1AHDP 4LLGF 3KRYA 2VPLA 1DPRA 1BI0A 2EV6A 3QQAA 1MMDA 4MTEA 1A6IA 5F68A 3A02A 3DTMA 3V7SA 3L9KA 1GHMA 3TVCA 3CTAA 3H7WA 5F5YA 2XD5A 2V9PA 4L0LA 2LFBA 3I58A 3ZQ7A 4ILWD 1RP5A 1NY0A 3LA2A 5LBRA 4HHDA 2D1NA 3BFFA 2HZDA 3S1QJ 4UA6A 3WE3A 5DFYA 2ZL1A 2I9VA 4CQHA 1FJLA 1KU3A 1LEAA 3K9TA 4IQJA 4X6AJ 3F17A 1TDGA 4E3NA 2ZC7A 4WELA 1HW1A 3DKXA 4HH2A 3CJRB 3BR6A 3VE3A 3MKYB 2D45A 3MQ0A 4H6JA 5CECA 1UTZA 3Q07A 4L9NA 2KRCA 2V1NA 2KKOA 2JQ7A 1OTEA 4EUZA 1YE9A 4CJNA 2FFYA 2VQCA 4D7MA 1WH5A 1KE3A 2EZIA 1LFPA 2OVZA 3KP2A 1JKOC 3S3OA 2PJRA 3MXQA 1T8IA 1XSXA 2ESNA 1VQ5I 3DBAA 4R1GA 3EDGA 3ZQHA 3OYDA 4HQEA 2IW5A 3CPTA 4C30A 1TBXA 1K6SA 2ZMVA 4B09A 3WU1B 4C3JJ 3H9GA 2V1UA 2R7SA 4II3A 3SEZA 2DRWA 2PU4A 2M87A 3G34A 4QB8A 1OYIA 2W48A 2L4RA 5E2FA 1MSFC 1MPLA 2VC0A 1MIJA 2QYBA 3OSGA 5JYOA 4DOZA 3KYEA 1YLPA 1ODVA 4OOYA 4DBRA 1ITYA 4CPKA 1U3EM 3H9JA 1FT9A 3KIOA 1XGSA 5HDKA 3GX4X 4A69C 2XB5A 2X6WA 3HLWA 2UV0E 1K4TA 1PWDA 1H8YA 3BT9A 3UB6A 3QP4A 1REPC 5CXAA 3RIRA 1G68A 2GNXA 4L0YB 3OWTA 1FZPB 1HTDA 2OBPA 2IWBA 4GFBA 3GBGA 2F48A 2EPFA 3ZQ5A 2VKDA 1XGNA 4BACA 1JNUA 4EJWA 4WKIA 3VWBA 1LEBA 4PDKA 1XUCA 3W4OA 3DBHB 4ETXA 1YS7A 3UE0A 4G6TB 4GZBA 1RZ4A 1VEUA 2QMIA 4XK4A 1R5HA 2ZQAA 3L1PA 4E3JA 4ZYHA 2JSCA 4Y3IA 4IVKA 5D5UB 3QNCA 2EFUA 4KISA 2GIVA 2RN7A 2P9VA 3JW4A 2QZ8A 5HOOA 4B4CA 5IT3A 2D5VA 3CC2I 2B18A 1P97A 2CS3A 2W1TB 4KJZA 2HDQA 3JRBA 1BSGA 1K7QA 1Y4OA 1GE6A 4L0ZB 2CQNA 5EZGA 2JK3A 2L7MP 3NCKA 2XGXA 4IKFA 2LF7A 2XSSA 2A69F 4FUWA 3ZMZA 1ATLA 5KSCA 4EGZA 4NQWA 2C5WB 1XGMA 3ZMSA 1IACA 1BR1A 5TBMB 5AJGA 3IP4B 3TDZC 4KICA 5DCFA 1OCOH 1F9NA 1JVJA 3FYZA 2P4WA 1ON2A 1TD5A 1HFCA 1A35A 4RLQA 3IF6A 2L3DA 5GPCA 3CQZJ 2DO7A 2GXGA 3GTJJ 4CICA 4BXXJ 3AYUA 3SHFA 2ECBA 5KIZA 2FU4A 2B63J 4E7HA 1P4XA 1Z7UA 4DE1A 4X1EA 3EYYA 5EEHA 2AHQA 5D5WB 4JYKA 1J7NA 3LI8A 1E3PA 2EIJH 3NOTC 1FOWA 3MA2A 5CX7A 3MAJA 3CMZA 2XGNA 3KMCA 3SEQA 4M6YA 2CV1A 3B8ZA 1X1DA 2LB5A 4EJOA 1MMAA 2B02A 3EPZA 3IWFA 2QVOA 5BQTA 1WFXA 3W2ZA 4B44A 3HOYJ 3BTLA 1ERMA 1E3HA 2Y2QA 3UKGA 4R3VA 4KUMA 4WLAA 4X69A 1S4BP 1JWZA 1Y39A 1Z21A 1LQ1A 2MBFA 3REOA 2A5YB 1QO0D 2N8RA 3C2GA 5F64A 1LB2A 3CJQB 1R4MB 5J1UA 3S1RJ 4XKCA 2CYYA 5DJUA 1PFLA 4YWZA 2DW4A 3IWOA 2ELHA 3BQ8A 1IG7A 3FZVA 3FXRA 3CZ6A 1WCMJ 2NOGA 4LPZA 3T1QB 1CJFA 4C2TA 2V20A 5L07A 2XKOA 1ZC2A 3I4MJ 4QD4A 1S7OA 1J9IA 3G2BA 3CCEI 3OR2C 4DIQA 3KETA 4MEXF 3CJMA 2XAQA 3DP7A 2CKIA 2PJPA 4G7OF 3UDIA 3AFHA 2ZOHA 2WC2A 1BC8C 3JTHA 4G7ZF 3QP2A 1HLUP 4N1XA 5I3MA 1K4FA 1ZQ3P 1OS9A 4DXCA 5LLQA 1TS6A 2GLOA 1SZVA 3D4FA 1YIOA 2ZQ9A 1ENHA 3DEWA 1S9HA 3OIPA 2ISYA 3I9V2 3L09A 2DW0A 5EVID 3AG3H 3BP8A 2I8DA 4LRYC 1ROSA 1IYOA 2IGNA 4ENJA 1K78B 2MH9A 4PKWA 3LMCA 2Y9ZA 2FD5A 4H1QA 1TWAJ 2M2EA 2DQRA 5L79A 3CCRI 4RYEA 5HS7A 1FILA 3O2PE 4JF6A 4OQ0A 5IS1A 4A5NA 2GZWA 2DT7B 3SZGA 3LFUA 3IT9A 2AIGP 2VPRA 4EM0B 4DW6A 2TDXA 5HWVA 1JIZA 3IC7A 5DKKA 4RM3A 1YLYA 3DSLA 4JLFA 4ETZA 1IAEA 2VT2A 4S2PA 4GXOA 1GT0C 5G4ZA 3BG5A 1KU7A 3RTTA 2A61A 1MMNA 1YHQI 4ON1A 3VMAA 2CW7A 2V1XA 1HLVA 3L0VA 2KJBA 3SHIA 1FLIA 2JIHA 4CCMA 3QP8A 4QJGA 5EEAA 2EQRA 2K4JA 1I2SA 2STTA 4XBFA 1N4OA 1R1VA 2O61A 3Q9SA 3LIKA 2DN0A 4HOIA 3T0YA 2V9VA 4HV6A 1KVMA 1C3BA 1W36C 3WV2A 3V8LA 2PEXA 4OAYA 2K3PA 3KEOA 1ZG4A 1I76A 4M9XA 3LIDA 5EM0A 2L0KA 4YOFA 1T56A 1EH8A 1VQ6I 1IN8A 4C3QA 1XGOA 5E43A 4HW0A 4HBUA 4BL3A 1BBYA 4OPZA 4XM3A 1E3OC 3C8CA 3X2QH 3GZ5A 2A6EF 4L63A 2FUG2 2QGUA 2R7VA 1EW0A 4PCQA 3ZQFA 1QRYA 3LCEA 4AUXA 2VBZA 1RETA 4I3AA 4MDZA 4MCWA 4GS9B 1EB6A 3B92A 4H76A 4KITB 1D8MA 2VK3A 1HDDC 1GV5A 3A0SA 5AQ9A 2HOTA 2F4MB 2PI0A 1DP8A 2HPIA 2Y8HA 4KQQA 4WN5A 2IVMA 4II7A 4EJTA 2OXZA 3TO7A 3S2HJ 4U3TA 2HKXA 1BJZA 5I12A 3VFHA 1PUEE 1ZG3A 1MMBA 4WMCD 3ASOH 4KIGA 2A2LA 4UV9A 2ZBBA 3T1XA 3SZPA 1HFSA 1VQPI 1EAKA 3W2VA 2OA4A 3FXOA 3HGYA 2XD1A 2K02A 1SANA 2MW8A 2ZJQF 4KQOA 1YYVA 4PMAA 2IXSA 3Q7VA 4RGRA 4H30A 2R92J 4W97A 2RCXA 5EVIC 2R7OA 1GE5A 4PM6A 4GWMA 4XLPF 4G3KA 4HH3A 4AYKA 3P9KA 4A3IJ 3RDIA 2VZWA 4IPAA 4P0MA 2MZHA 1ESIA 5HNFA 5C4JJ 2E2IJ 1ODDA 4A5RA 2VL8A 3T1SA 4N1HA 3MZDA 2Y4AA 4LITA 3CESA 3S7PA 2Z99A 2Q1ZB 3FF5A 2HR3A 4OIRF 3ISPA 1ZS0A 4UXNA 3K4BA 5HAQA 3F1NA 1SDEA 4HLXA 1JKRC 2V6EA 1V54H 5E1WA 4KFCA 1OJLA 2EXAA 1XGJA 5J8FA 5K7HA 5FLXZ 1EV7A 3LMMA 5DS9A 1ERQA 2M34A 3NBLA 4I6ZA 3ZMTA 4L6TA 1LE8B 1IAAA 3D0SA 3CCSI 4AFIA 4ZJ2A 2W0DA 4HRIA 2WZXA 2O9CA 2XLNA 1U5TC 1K38A 3NJAA 1SFOJ 1KGFA 2I10A 4DXBA 1HXDA 1TF1A 3G1MA 4LIUA 4G94A 3NHQA 3K2ZA 5BNGA 2DPDA 2IS2A 5F6AA 4DYQA 1G3YA 5D8KB 1VQNI 3K0LA 5J4EA 3ZFZA 4YIRX 4G3WA 2KFDA 4R3JA 2X48A 3F16A 5GHYA 3TG9A 1SD5A 2MLSA 5D5XB 4Q5SF 3JTGA 1YLTA 1FC3A 3FM3A 1D7XA 1CI8A 3WE2A 1T39A 2VKEA 3PIPF 2Y79A 2OU2A 4E7ZA 4DDYA 2LKSA 4A3LJ 1WI9A 2DA6A 4M9SA 1XJ6A 3Q7ZA 1VQ8I 3ULQB 3FPVA 3GFJA 4O5VA 3F9KA 3C2BA 3S3MA 3W6VA 4BYYA 3I0TA 3JPUA 3HRTA 3S93A 1LE8A 1VF9A 4UEYA 3KECA 1WJFA 4KENB 456CA 3ZRGA 5KSHA 1SDNA 3MKWB 1AKLA 3DPFA 3HL2A 3LR4A 4DZPA 5DVAA 2JN6A 4L7AA 1ASTA 2P5VA 1FOXA 2VJ5A 5L3EA 3LKAA 2IJLA 2DMPA 1YITI 2CUJA 3MR0A 2I72A 4HV5A 1LKXA 3F19A 3FK7A 2KPMA 1TNSA 1K56D 4EEPA 2V1AA 4JGOA 3CO7C 1A6QA 2HP9A 2JKFA 2QQ9A 2GQQA 1IW7F 5J8CA 4NBQA 5LBQA 3WS2A 2C6YA 1DJBA 4IRHA 1IDYA 4BE2A 1SCWA 4D5FA 2R7TA 5LHIA 1TTYA 2YX7A 2J5PA 4I99C 1GVJA 3D5SC 2HDSA 1ZR4A 2VQLA 3LEQA 4FHTA 1S1ZA 1JT0A 2NYXA 1YLZA 2HYJA 1K55A 3SW1A 3J81K 4JGPA 5K5RA 2Z16A 2KP6A 3A2KA 2UV1A 3CMMA 5F04A 3V7CA 1D1BA 3U2RA 3F8CA 3T8RA 1T38A 1BA5A 4Y5FA 5GPAA 2P6SA 4HX7A 4PUSA 1IAWA 1S6RA 3BQAA 2VGJA 2R7FA 1CF0A 5AQBA 1MMPA 4RMNA 3FG8A 4MO7A 1BULA 3VDXA 3H5AA 1ZK8A 4WKEA 2HV1A 1Y6IA 4M3FA 5IOYA 2RGVA 2L5QA 3OR1C 2NVTJ 2XA7M 2CFXA 3MQQA 2ECCA 1XMXA 3QPSA 1XJ4A 3OIQA 2W57A 1IEMA 5K5BA 2W3EA 3HY9A 1BOBA 3VP1A 4G9YA 2QWSA 2O9AA 2LP0A 1MXOA 3DWZA 1H8MA 5FQMA 4AIDA 1TS8A 3SH9A 2XFTA 2YKHA 2O3FA 5L09A 1TDLA 2H8WA 1CQAA 3MXRA 3FK6A 2J9OA 3EEAA 4KZ6A 4N9HA 5ICGA 5F82A 4KZAA 2OV5A 2WA0A 5E20A 1AU7A 2BW3B 3BY6A 966CA 1T33A 3COAC 3E8RA 2H1LA 5D2BA 1QIAA 5ILVA 2D2WA 2EFPA 5TISC 1LDJA 3R7WB 4FT8A 2VGKA 3BY8A 4H84A 3UVCA 4FE4A 3FMQA 4BH9A 2F5EA 2NVXJ 3TT4A 2WB1A 1OMEA 2OXUA 1PVEA 4F93B 4XOTA 1J75A 3ASNH 1OMJA 3LYXA 5CKTA 3WU2C 1E25A 1K57C 3AGEA 2D02A 2E8JA 1TW3A 3ZPLA 4E3IA 1AWCA 4O8GA 1UFMA 2V0UA 4NKPA 3TBIA 1ZGJA 4IJAA 5F83A 1LDKB 3AL0C 1SFXA 5ERIA 2CJJA 3PNVA 4WXCA 3BR5A 4ENNA 3VEPA 4GCZA 5FLVA 4ZJZA 3OY9A 4AD9A 5D1TA 1NXYA 3CDLA 2BW3A 3PTEA 4IRIA 1PNEA 1OJGA 4R70A 2VV8A 1R1HA 3ZVWA 4HF2A 3G42A 1WPKA 4RGXA 1JTDA 1A04A 3RJUA 2YB9A 5J1YA 4N4OB 1G3SA 1R23A 4WZ5A 2XS4A 4N9LA 1FP2A 1HDPA 5B1AH 4XLFA 2M1CA 2PAVP 3LSGA 5I2ZA 2OWHA 2MG4A 5I94A 2OI0A 3G1OA 2KDZA 1VQOI 2VEAA 2HZ5A 5HLHA 1YPRA 3HLDA 3HBLA 1TC3C 1FR6A 2IEKA 4WEKA 1F5MA 2HDCA 1E3UD 3W3CA 3Q5FA 3V8JA 1QHGA 2LH9A 2B9SA 4XCTA 1Y1WJ 2XA7S 5DCMB 4BHCA 2OY4A 1ERDA 2ZO4A 3IBRA 3BZ6A 4RM2A 2M7BA 4WL9A 3BLMA 4F52A 5JHUA 2V9AA 2KIMA 5ICEA 3V50A 4N9KA 3SZTA 2Y2NA 4QWOA 1YQAA 4OPQA 1YIJI 3HKZN 4DJ2A 1XFUA 3HBUP 4PM5A 4LRXC 4LCLA 3G71I 4NB5A 4A3BJ 1UZCA 2I47A 4E7IA 2OV7A 4CO8A 4X1LA 3I7JA 1E4DA 3V3RA 1FBQA 5FI2A 1AXBA 1TVIA 3MZFA 4CSWA 3W4PA 2BGCA 1DMTA 2YS9A 3LUNA 3W6JB 2DOFA 1QA6A 5B5PA 3HC7A 1K4EA 3OL3A 1CQTA 1LUJB 3G5CA 3MWMA 3U4LP 4BL0B 4NXBA 3F6VA 3MKZA 2G2WA 2O3EA 2RV8A 2OTLI 5EM1A 1AF0A 4H3XA 3J7AY 1GCEA 3KSIA 1ES5A 3BFEA 1BIBA 4KZ4A 2XPWA 1Y1VJ 1IN5A 2UXXA 4A0YA 1A0KA 4JF4A 1A5JA 2JUGA 3HEFA 2VGLM 4Y15A 1XPXA 5FB2A 4Y7PA 2OC6A 3FXKA 2XRLA 3GEZA 4WF6A 3EQLF 3DNGA 5FEFA 2Y0SN 1D0YA 4GCVA 5DDGA 5J1RA 4IHXA 3JYIA 1UHSA 4R3BA 3SS3A 2IWCA 5AQAA 1SU3A 1U9NA 2W3GA 3VODA 4KZ3A 5GADJ 3HYGA 1YOVB 4BE0A 1U2WA 3VP4A 1UTTA 1CEFA 1R7JA 2NNNA 1DP9A 2DBBA 4FU4A 4E4HA 4JP4A 3KZZA 1JUSA 4ZDXA 3QPTA 4GQLA 4BLMA 4KT6A 4HSTA 5FKMA 1F9IA 2FA5A 2ZJ9A 3UNGC 3HHGA 3JCUC 1TQIA 3USNA 1SEUA 5TJJA 3UN7A 3QP1A 5GHXA 3UE1A 2V1DA 4XT2B 1JWVA 2IA0A 3H3UA 1JKQC 4IHQA 3BG6A 1AA7A 4Q0JA 3JRFA 4MNRA 2YU9J 1WQ2A 1ZG5A 1QIBA 2Z1DA 3UB9A 3UB5P 2JWTA 2O5RA 4IHVA 3R0AA 5LD2C 3WS0A 2JVHA 3I71A 2LBFB 3WTTC 4JP0A 2HU6A 1KUGA 2EFOA 2W12A 4UHUA 3HJEA 4GF1A 5JI6A 4DN0A 2VN2A 4BJTA 2PMHA 1JTGA 1H3QA 3N7WA 4I76A 5HD5A 1DTHA 3UMDA 3CC4I 5HDNA 1PP7U 4BD1A 1ZREA 4OPRA 2KMUA 1NHAA 1BYWA 3B42A 1LSXA 1DP7P 3B3XA 2EK5A 5A90A 4IOCF 2X85A 4UB8C 1FP1D 2H27A 1QGPA 5E17F 4EQIA 1QHHD 1WGXA 2QQ8A 2EZLA 3HPHA 2CUFA 4IEJA 4JXSA 3H5RA 1K7GA 4XRSG 5HW3A 4CLCE 1HKQA 3FBNB 2A24B 1SMTA 2HQAA 2CLTA 3IKTA 1BM9A 3MQOA 4PKTA 4UUTA 3FHZA 2JSPA 4XR6A 4WBGA 1SHVA 3I7IA 1QPIA 4JBFA 5FFZA 4S2NA 3M6HA 1HKTA 2XROA 3ESWB 2BVMA 2EFWA 5BS6A 4Q1LA 4YFKF 4JF5A 5HWWA 4UAAA 4LV2A 1S5LC 4P9FA 1O57A 2K7LA 1JXSA 1WRJA 4ETSA 4MQVA 4HBTA 3LSIA 5FASA 3S7NA 3LO7A 3WTWC 1KA8A 1IV6A 3CHWP 3Q3SA 5IY5H 3WTZA 5H8XA 3VB2A 2BE5F 1G4KA 1HOMA 3BDDA 3EQVA 3GCMA 4Y17A 2P5LC 2IS6A 2ZC3B 5EG0B 1PZOA 1LNWA 2EX8A 2NNYA 5AONA 2HGCA 5IOZA 1RMZA 3DTEA 2HYFA 1X1PA 4OIOF 3C7VA 5E3LA 2Z6CA 1R58A 4KN4X 4DE2A 3P9CA 1AKHB 1K79A 4EUVA 1RR7A 3OV8A 2W7NA 3HDBA 1IYPA 2KLOA 5E79C 4XONA 3E6BA 2HTSA 3TO6A 1GO7P 3RPUD 4HY8A 4E3OA 2HDWA 3GTMJ 3K70D 2PYPA 2J5OA 3A3IA 1RESA 4LK0F 3JSPA 3DQVC 2KDOA 3LJTA 3MKLA 2K9MA 1PUFA 5IT5A 2ZB9A 4EM1A 1YT4A 1YMSA 3WTSC 3HJIA 2QZ6A 1ONVA 5J3WA 2MLKA 1JANA 4PGHA 4Q48A 3K7NA 2BV6A 4HX4A 4IO9F 3O3KA 5DF7A 4BHBA 2V7FA 1RKTA 3ZDJA 5ILSA 3CKIA 1AWIA 3HUOA 2JCHA 2EV5A 3UB8A 1K56A 4M72A 1SKOB 2Z6DA 3O3VA 4R4RA 1WI3A 4M71A 4IBRA 1E2XA 3ABLH 4HNUA 3ONQA 1X1BA 2J3WA 4BNCA 4C75A 4MIMA 1GSWA 1Y0UA 4QLCU 2EWWA 3UDFA 4QU3A 4WF0A 4M3KA 5E3OA 4WX9A 2K31A 2E7XA 2EIKH 5IPAA 3L0TA 6PAXA 1C3IA 4G3VA 5E8GA 2GAUA 2GA1A 1MJ9A 2VJJA 4Q0HA 2R7DA 1PWUA 2EIMH 2Z2LB 3J7ZI 1XKZA 1WE4A 3EQUA 5FJ8J 1CF7B 3ITBA 2ME0A 1NG7A 1TWHJ 2HVRA 1QZEA 4IUKA 3IHAA 4BWIA 3PHYA 5TGTA 4PSXA 5FD6A 2BASA 2ZMAA 3K2AA 4UVBA 3IF5A 2P7JA 4CLCA 2KT0A 1OCCH 2PBYA 3KSHA 1BT5A 2OW2A 4CZZA 2NXNB 4IX7A 4Q0IA 4GGGA 1SD7A 1WHUA 2OCCH 2X3CA 2DFFA 2I5UA 2ZMEC 5G4YA 2AQEA 2OXWA 1Z77A 4AM3A 3EOIA 1L0DA 2FE3A 2LDUA 3O8GA 1SKOA 2Y2JA 5L8MA 3KWVC 2RJPA 4O3MA 2DYSH 3KSFA 5JYPA 4BBTA 2MLRA 1W5CC 4DE3A 3MZ8A 3TOAA 2QJ7A 1LSVA 3HDAP 1XSDA 1SVOA 2HFHA 3DL1A 3CUQC 4OH0A 2A8HA 2Z33A 1WJ5A 2OQGA 2COBA 4ZZLA 3IX3A 2EA2A 2XGDA 3U1RA 4O6JA 1D5VA 2PBIA 1JGGA 2GIZA 1B9NA 1ETYA 4M3EA 1IRZA 1USNA 5F69A 1ZN2A 1CF7A 3HTSB 1GE7A 1MSEC 3OLOA 4NC8A 3ZYTA 3UNWA 3MEXA 2OW9A 3PUBA 2OZUA 3GV9A 3W8KA 1HC8A 4BDYA 3S15J 2R93J 1G28A 1UWNX 3RQ4A 3JRIA 1K25A 4AIGA 1MMGA 4NXFA 5CGXA 3U9GA 1D7EA 4J00A 1HA8A 3PO2J 1BQOA 1D3YA 2QBYA 1H5XA 3A1YA 4UA9A 1IOUA 3WS5A 4FTXA 2J8YA 1ETQA 2O99A 4KZ5A 4IJGA 2QJ5A 2VASA 5GLDA 1UWPX 4UVAA 3K10A 2MH2A 2ZNZA 4M3DA 4JXVA 1GV2A 1T0FC 1EKEA 3OL4A 4X0GA 3RSNA 1R71A 5F08A 2LREA 3LIRA 2KISA 2ESHA 1OM8A 3C2WA 2L7KA 1BIAA 1VETA 1XFWA 3BJ6A 1D1CA 4I0BA 1HSTA 4P6BA 2Q0OA 2MA3A 5U47A 2ZSHB 2XDVA 4E6XA 1DGRM 3O2XA 4ESJA 3FDYA 1KYZA 3GTPJ 2CW8A 2JPBA 1JWPA 2NAZA 1XFXA 3C7JA 1W0TA 1MNCA 1UGUA 3IV5A 1HW2A 2KDKA 4F94A 1UCRA 3W4QA 2L9RA 4EWFA 2JVGA 5DTSA 2E5NA 4RAFA 2D1HA 1JJ8C 2R5YB 5CLSA 1H8AC 4GB7A 3V7RA 3OPRA 3EHXA 4M3GA 1XN7A 4ZC3A 4P85A 3TL4X 4B8XA 2EINH 1XXMA 1V3FA 4A3DJ 1ON1A 4KUOA 2CGPA 5E2HA 830CA 4KT5C 2HTJA
chains in the Genus database with same CATH topology
1CGEA 2Z16A 1CGLA 1JANA 3DU5A 4PJJA 4DBQA 1ZP5A 3LUNA 4CZCA 2X6YA 3OYLA 1ATLA 3VSLA 3K7NA 1G59A 1JIWP 2X7MA 2KP6A 5HNHA 2ZFUA 1GKDA 5B5PA 3AYKA 3A2KA 1OS2A 2Z2DA 2UV1A 3CMMA 3HC7A 3LQBA 2VJIA 1D1BA 3RTRA 2ZXIA 1IACA 3OL3A 1R1IA 1ZXVA 3DWBA 5BOYA 5KHDA 1BR1A 2M0MA 2D1OA 2V7FA 1QICA 3G5CA 4PKQA 1EB6A 3CKIA 1KUHA 3B92A 1QJJA 2X3AA 4NQWB 4CCOA 4BL0B 2VLAA 4BJ6C 3OYEA 1K7IA 4DJAA 2GOXB 4H76A 4NNJA 3SYTA 5FROA 1JAQA 3PSIA 3LJGA 2E2DA 3IP4B 4JQFA 3MKZA 2WAEA 4HEA2 3L2VA 4KITB 2R7XA 1XFZA 2O3EA 2WO8A 1MW7A 4PUSA 1D8MA 4GR3A 2F4IA 5I43A 1AF0A 2BVLA 1FBLA 1R1JA 4FVLA 1QUAA 4H3XA 1H71P 1XUDA 3F1AA 3J7AY 3AL0B 4JPAA 4H4KC 3OYMA 1GXDA 5D1SA 4E7JA 3ZGKA 3ONQA 4B3XA 4HNUA 2IGOA 3V96B 1B3DA 1HFCA 1MMPA 2VKHA 3M1CA 1X1BA 2CMPA 4RMNA 3EUKL 4F3QA 1FLSA 3KEYA 2K5CA 4RLQA 4B43A 3PL8A 3LGPA 2HPIA 1D5JA 3DPLC 3VDXA 3H5AA 3OYKA 4IZZA 2ERPA 3VYSB 3L2QA 1CQRA 4HX3A 4WKEA 2R7UA 1KUIA 2L0RA 4AYBA 3DLAA 2OXZA 4ZYAA 4BS9A 2XC7A 2JUGA 4CUGA 2KRJA 5I12A 1Y6IA 4YELA 5KCMA 3D5RC 1X19A 3L2UA 3LILA 2MFZA 4PSWA 2L5QA 3OR1C 1MMBA 4HMAA 3AYUA 2EROA 4XLHA 3HOSA 1WNIA 4I35A 3HG9A 4BXFA 2WADA 4QKZA 3RTSA 2OC6A 2X1DA 3PFYA 4E7HA 3OIQA 2CUZA 1HFSA 5D3CA 3L0TA 4WF6A 1EAKA 3DNGA 3W2VA 1C3IA 3BG7A 1D0YA 2XF7A 5D7WA 1FM1A 1WJDA 3L2WA 4F55A 1R54A 2IGKA 3K4LA 1MNEA 2VJJA 1J7NA 3EWJA 3HY9A 1BOBA 4GWNA 3OYIA 1PWUA 5I0LA 2W4SA 4BQNA 1YP1A 4Y33A 4D9JA 2IXSA 3MA2A 2V9KA 2F5VA 3PNTA 2DDYA 3NX7A 1FMWA 4MLOA 3K4KA 1UMSA 2Y6CA 3LK8A 2JT5A 1SU3A 1IABA 4XLAA 4H30A 1Z7LA 4PK4A 2RNGA 4BJ5C 1NG7A 2A6TA 1BR4A 2E60A 3SDBA 2HVRA 2LC2A 1WJEA 3EUAA 1N77A 3SEQA 3KMCA 1OO9A 1SFKA 2XF6A 2CV1A 2R7OA 1XFVA 3B8ZA 1IADA 1X1DA 3K70C 4ZTFA 3B2ZA 1ZELA 1GE5A 1C8TA 3OHLA 4PKUA 5TGTA 3KEKA 1MMAA 4PSXA 4GWMA 3HYGA 2RJQA 1KUKA 1N75A 1G12A 4AYKA 2DOAA 3EPZA 1IAGA 4BE0A 1WFXA 3KRYA 2VXZA 3QYBA 2WA0A 4JOMA 4B44A 2VPLA 2MZHA 1UTTA 2R7QA 1XURA 2RQQA 1YOUA 3K7LA 3LSMA 5HNFA 2BW3B 1BR2A 966CA 2VL8A 4FU4A 3ZVSA 5FRNA 4E4HA 4JP4A 4XORA 4IJOA 4R3VA 4R79A 3QYEA 4LITA 3BC8A 1MMDA 3CESA 2DCEA 3W2WA 1S4BP 1X4OA 2OW2A 3LUMA 4WZVA 3VYUB 4GQLA 1WJBA 2Q1ZB 3OOUA 1Z21A 4YEJA 5KNLA 1UMTA 1HV5A 3E8RA 3BLYA 4XN0A 5JMYA 4KT6A 3OYGA 4IX7A 4HSTA 4BEHB 4PKSA 5D2BA 3TVCA 3N2UA 2UUZA 2MZEA 1N78A 2CH0A 1QIAA 2PJTA 3K4NA 2JSDA 5JHFA 3UNGC 2IGMA 1ZS0A 2X3CA 2X1EA 1Y8JA 1G49A 3DTIA 2N8RA 3USNA 3C2GA 3K4BA 2KHMA 2MC4A 3E0JB 3HXLA 4G9LA 3M8JA 1U0JA 3NWTA 4CCJA 3OYCA 1CXVA 1QJIA 4II2A 1CIZA 2AYKA 5CZMA 3CJQB 2V6EA 2AQEA 2WBMA 2OXWA 4ILWD 3WV1A 1OM6A 2M4GA 2HNHA 4J01A 4H2EA 4H84A 4F92B 4F91B 1JH1A 2OW1A 4XKCA 1CAQA 3UVCA 1Y93A 4ZDOA 4E6KG 3BG6A 1AA7A 1BKCA 3ZXSA 4ZTJA 2D1NA 3KWVC 2AQFA 1K6YA 2HZDA 1XFYA 3HUGB 2WY8Q 4BE1A 2RJPA 4XKVA 4XNFA 1BKCE 1BUDA 3TT4A 3LMMA 1P9QC 2WB1A 3E1SA 3OHOA 4YRVA 1PWPA 3CZ6A 2OXUA 2QPJA 1QIBA 2LBFA 2Z1DA 3OMYA 4XQFA 4XOTA 4HNTA 4F93B 1YQYA 2O5RA 2MLRA 1UEAA 5LD2C 2XSJC 2LYCA 4BU2A 4C2TA 1SATA 4L6TA 2JVHA 4L19A 4IQJA 3F17A 3L2RA 1FMVA 2LBFB 2K9LA 1ND1A 3HDAP 2HU6A 1KUGA 1OMJA 1IAAA 3DL1A 4NC7A 2L9SA 2Y0SA 1OR7C 3HPGA 2DDFA 3K4JA 2W12A 2A8HA 4HG2A 5CKTA 2E3XA 4A3WA 3DKXA 2M7AA 3CJRB 4GF1A 2W1OA 2XS3A 3G2BA 3OR2C 1WJ5A 4DIQA 3OYNA 1I1IP 1Z3YA 4P5OA 3MKYB 1DP3A 4H49A 3K6GA 4LIVA 4BJTA 3BA0A 2HU9A 2KZVA 4HRIA 2VIXA 2W0DA 4OWRB 1TT0A 2LY2A 3FBIB 3NWSA 1ZXCA 2LRDA 2ZSIB 1PWQA 1UTZA 1O0QA 3U1RA 2MYSA 1E0EA 4AUOA 2V26A 3S8PA 3DU6A 3EHYA 3LSKA 2KRCA 2XAUA 2CKIA 4EFSA 2V1NA 1DTHA 4BQQA 1X1CA 2R4GA 3OYJA 5LFAA 1V5EA 1R6RA 1A85A 1JAOA 1X1AA 4LIUA 3TBIA 2R7WA 3IUOA 2MZIA 1R55A 3AFHA 1YE9A 3F15A 3KEJA 1USNA 3P24A 3OS0A 1WJCA 1W36D 2A5WA 3V42A 2VQCA 1AYKA 1LDKB 1BUVM 1EA3A 3OS1A 3AL0C 2YUFA 4G0DA 2IS2A 2HPMA 1QU3A 1G9KA 1GE7A 2OVXA 5HLTA 1X4PA 3HB2P 1PYVA 4NC8A 1HY7A 2JNPA 3EUHC 3PNVA 2USNA 1GKCA 2KMUA 3MD2A 2OW9A 3QYFA 2FV9A 4OAZA 4XMYA 3PUBA 1OS9A 2Y6DA 3LEAA 1GO8P 3EDIA 4H82A 4JIJA 4DV8A 3I3LA 2W00A 1LFPA 3KYLA 2OVZA 3MMYB 1TZLA 3W2AA 3S3OA 1YX3A 2X6XA 4FETA 4Y3OA 2PJRA 2IS4A 3IAS2 4ZJZA 3VSKA 3Q2GA 3CP2A 3OY9A 3ZXHA 4XOPA 4BDYA 4ZDLA 3HOTA 3DEEA 1Q3AA 4LG3A 4GR0A 2X85A 2L2OA 1JJ9A 3F16A 2PJRB 2RREA 5D1TA 1S9HA 3CF2A 3RQ4A 3OYFA 1QHHD 3OIPA 3EDGA 2MABA 3HPHA 2DT6A 3DWLE 3I9V2 4PJNA 4C2UA 2DW0A 4AIGA 3U21A 4FXQA 3OYDA 2BW3A 3QOEA 1MMGA 2QKLB 4AU7A 4AVZA 3OS2A 2MLSA 2KL4A 3VYRB 3VI1A 4HPQA 3N2VA 4CCNA 2O36A 4B48A 2I8DA 2MD0A 1BQQM 2K9CA 2ELJA 3QODA 1D7XA 1PWVA 4C30A 1B8YA 1ROSA 4GUYA 2IGNA 4XM8A 1YCMA 2DJIA 3C2HA 4AXQA 1D8FA 3H5RA 1SAUA 1K7GA 2XF5A 1HOVA 4CCKA 2WAQA 1UG0A 2E5ZA 4BEHA 3K4MA 4C9YA 1R1HA 4DGWB 3LQ0A 2VXDA 4J00A 3LMCA 2NOJB 3FBNB 1OM7A 2E1MB 1HA8A 3TS4A 3H9GA 4IN9A 3G42A 2R7SA 1D0XA 3DPUA 4E7KA 4H1QA 4CCLA 3PJRA 1BQOA 4II3A 4B47A 5LABA 3WV3A 2HQAA 3SEZA 4CH7A 1KUFA 2X51A 5L79A 2L9NA 2PMZA 3A1YA 2CLTA 1Y56A 5CPRB 4I03A 3H5NA 4D1QA 4PKTA 2IS1A 4E7ZA 1GLNA 1BIWA 4PJLA 2YB9A 2ZXHA 2JT6A 2W14A 2JSPA 3DPTA 4XR6A 4N4OB 3KMEA 1BM6A 4DOZA 1I73A 3I7IA 2BOLA 2DT7B 2XS4A 4XKBA 4PFPA 3SZGA 3LFUA 4E7LA 3PSFA 4XBHA 3VYTB 1T95A 2VASA 1J09A 4DBRA 2AIGP 2POJA 2LOOA 2ERQA 2GOMA 3RCOA 1BKCI 3LL7A 4XLEA 3H35A 2BVMA 1BZSA 1CK7A 1RM8A 3F9KA 3KHIA 3S3MA 1JIZA 3H9JA 2YIGA 2VB6A 2LG4A 2X1CA 4Q1LA 3K10A 1WJAA 4RM3A 4XLFA 2UWMA 2TCLA 1KONA 1NG6A 3DSLA 3CP8A 3S93A 2VQGA 3LSGA 4ANJA 1JI8A 5I2ZA 3BCAA 4QPOA 5FRMA 1IAEA 3TSKA 1T0FC 4CA0A 4P1WA 4WK7A 3OL4A 2OI0A 3KECA 1WJFA 4ITVA 4BGDA 2E1MC 1SLNA 4X0GA 456CA 3ZRGA 3ELMA 2X6WA 2DW2A 1A86A 3RSNA 4FASD 2WO9A 4J4MA 2R7RA 1SRPA 3AIGA 2LREA 3MKWB 3LSIA 1AKLA 3DPFA 3LIRA 3EDZA 4DF9A 3RTTA 3IAM2 5L7FA 1MMNA 2M3AA 3H9QA 3HL2A 1V5GA 2HVSA 5I4OA 1OM8A 4GR8A 4CTHA 4GRIA 4ON1A 4L7AA 3W3CA 1ASTA 4XKWA 4RLFA 2CW7A 4DPEA 3H0DA 1QHGA 2LH9A 1CGFA 2L7KA 2VJ5A 3L0VA 4PKRA 3SHIA 5CXAA 4XCTA 3GBOA 1XFWA 4XM6A 2JIHA 4CCMA 1D1CA 4FXYP 4XLCA 1O0TA 5H8XA 2DW1A 1DQUA 1G4KA 3Q2HA 1MNDA 5CQEA 1JKYA 1ZVXA 2HVQA 2CFOA 2V4JC 2ZSHB 3LSHA 3OWTA 4EATA 2IS6A 2XDVA 1HTDA 1DGRM 3TMOA 1L6JA 3LE9A 2J0TA 3O2XA 3OYAA 2SRTA 2OY4A 3AKZA 4IUWA 2CV0A 1KAPP 4PJMA 2CUJA 3FDYA 2OW0A 4ZR5A 1ERDA 1UELB 3HY7A 3LIKA 3GBGA 3I7GA 1OLTA 3FHNA 4E7SA 4BDZA 2P0WA 1MMRA 3DPEA 2VKDA 5CUHA 1SLMA 2CW8A 3ZR8X 4BACA 3DTEA 1RMZA 3HKZA 2DXIA 4RM2A 2WOAA 4WKIA 2M7BA 3VWBA 3LKAA 5B5OA 1XUCA 4PKVA 1DGWY 1MMQA 4U87A 1XFXA 1W36C 3WV2A 3S3NA 2OUMA 1LKXA 1IRXA 4G6TB 1MNCA 4F52A 2W7NA 3F19A 1D0ZA 3HDBA 1PWWA 4OAYA 2K3PA 1VZ0A 2JA2A 2KLOA 2KPMA 3UR3C 1JAPA 4XONA 5D1UA 2W13A 3F18A 2QKMB 2KQRA 2W82A 1I76A 4PKWA 4NUBA 3OYHA 4XN3A 2V4BA 3ZCOA 3A4CA 3EDHA 3OYBA 1GO7P 3RPUD 3PNYA 4ZDPA 1XFUA 1UAAA 2WAFA 4Y4RA 2CV2A 4IQ4A 1SMPA 2JVGA 2FV5A 3HBUP 2F6CA 2HDWA 4DD8A 4XL9A 4KISA 2E5NA 5CQGA 3K70D 3DKYA 2K2GA 3S32A 4QPQA 2W15A 5HOOA 4JA1A 1V5FA 5HVQC 3LJZA 2I47A 4BE2A 2R7TA 1KBCA 4E7IA 2OY2A 3O64A 2OV7A 1D1AA 1G05A 1BSWA 3ZQQA 1LVKA 3EHXA 2CS3A 1EUBA 2Q2EB 4PFOA 3DQVC 5I3MA 2LY1A 4XM3A 4KJZA 2VJ4A 1C7KA 3ZUKA 4ZC3A 3VTGA 2KDOA 1Y0VA 3TL4X 3D5SC 3LJTA 2K9MA 2X3BA 1Z3JA 4BUPA 4BQOA 4U7BA 4L63A 4XM7A 1K7QA 3P1VA 2FUG2 4N4NB 1GE6A 3D5LA 2KRHA 3HBVP 3BCBA 4CSWA 1ZTQA 5BPAA 1JK3A 1Z3XA 2J83A 2WY7Q 2R7VA 1YX5A 5BOTA 2VQLA 2VQHA 4JQGA 2Z2SB 4A7BA 3FKJA 3KX2A 1PJRA 3N05A 830CA 4HSRA 1DMTA 2OZRA 4IKFA 3DTKA 1G8XA 2M4KA 3K4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTE A;  3DTI A;  3DTK A; 
#chains in the Genus database with same CATH topology
 2K9S A;  3WHB A;  3LAP A;  1GVD A;  1PZP A;  5KVR A;  1HCR A;  2BY0 A;  2ZFU A;  2RVC A;  9ANT A;  4BJ6 C;  2Y2I A;  1GHP A;  1XFZ A;  3HDD A;  5J4Y A;  4BBV A;  3UPO A;  4FVL A;  1FBL A;  4G12 A;  1XUD A;  2ISZ A;  1J0R A;  5C5K A;  4F3Q A;  5HX9 A;  1N9B A;  3J81 Z;  4A0Z A;  1TLH B;  1X19 A;  4R8H A;  1FBS A;  2OF7 A;  2M8G X;  3HG9 A;  5LGT A;  2OAZ A;  1YLJ A;  1A31 A;  3RXX A;  4LG0 A;  2XAG A;  3EWJ A;  3BEC A;  5DUI A;  3PAG A;  4ZYG A;  3JVU A;  1GA0 A;  2R5Y A;  5IYB J;  5L3D A;  1H89 C;  4XRS A;  3M8E A;  3BQY A;  3HLF A;  3PQK A;  5CEB A;  1IAD A;  5G18 A;  3KCC A;  2OZ6 A;  2BY2 A;  3F1O B;  1IV8 A;  2W3F A;  1FNN A;  1ETK A;  3ULF A;  3MFD A;  1EJ9 A;  1K54 A;  1X0O A;  1XA7 A;  1L3L A;  4S04 A;  3K7L A;  1CK3 A;  1OYW A;  4RX3 A;  1QNT A;  2EJR A;  3F0C A;  3VP2 A;  4PM8 A;  3DXJ F;  4XXR A;  2L7F P;  1Z09 A;  1TNT A;  4YEJ A;  3U1K A;  3IWZ A;  4AVP A;  5CED A;  5GLB A;  3M8J A;  5CGS A;  2MC3 A;  4UUS A;  5DM7 F;  3ZN0 A;  2AYK A;  5I5L A;  2ELK A;  5CVV A;  4ZDO A;  4EJU A;  2BEO A;  2BY3 A;  4ME4 A;  5L3G A;  2DMW A;  2WV1 A;  2H28 A;  5HDD A;  1IYS A;  5FKL A;  1W0U A;  3RXW A;  3C7U A;  5EEC A;  1ZTU A;  3SOI A;  4RAZ A;  1RGY A;  5GAG J;  3HOU J;  5FFX A;  2P04 A;  2W1O A;  4B88 A;  4Q4Z F;  2DK5 A;  4HNB A;  1OTI A;  4E6W A;  1HW5 A;  1JHF A;  1VQ4 I;  2OJE D;  4IHT A;  1MY8 A;  4X55 A;  4LB6 B;  3IUO A;  2CU7 A;  1MWT A;  2HP5 A;  1JT6 A;  2KZG A;  2LK2 A;  1AYK A;  4G0D A;  2V6C A;  2HPM A;  1PYV A;  2Z3Y A;  3S7Q A;  3T1R A;  3S4X A;  1B59 A;  3RKX A;  3W2A A;  3CP2 A;  5A93 A;  4D0P A;  5J7E A;  5FKO A;  4FIS A;  3ZGA B;  2BY1 A;  4AU7 A;  2YX4 A;  2JA8 J;  2QEN A;  1U8R A;  4HJ6 A;  1JUP A;  2DA3 A;  1I1S A;  3FWL A;  1PI4 A;  2K40 A;  3P01 A;  4X25 A;  1D1J A;  2QCO A;  4CH7 A;  2PMZ A;  2DLL A;  1GLN A;  1EI5 A;  2ID3 A;  3FMS A;  4PFP A;  5FAP A;  4XBH A;  5HAR A;  3CDI A;  1I3Q J;  3H35 A;  2FX0 A;  3IKV A;  2VB6 A;  2VJW A;  1KON A;  3IH3 A;  1JI8 A;  3BCA A;  5FRM A;  2O8K A;  3E7L A;  3DAV A;  2WO9 A;  4H8R A;  1XCB A;  3SS4 A;  2IWD A;  1B72 A;  2R5Z B;  4CTH A;  4GRI A;  3T4T A;  1OKR A;  3ZG9 B;  4U0X A;  4PKR A;  3LR5 A;  2DW1 A;  4UVC A;  1YJN I;  4WWC A;  2RNJ A;  4FD8 A;  3WWX A;  3TMO A;  4HIA A;  1X3Z B;  4QTR A;  3HGG A;  2CV0 A;  4HNV A;  3ERE D;  1LL9 A;  3FHN A;  1DPU A;  2P0W A;  4PZJ A;  2RQP A;  5CRF A;  3G4P A;  2WOA A;  4S2J A;  3NY4 A;  4GOG A;  1G3T A;  2KIF A;  3S3N A;  2JA2 A;  3PM1 A;  1JAP A;  4UNO A;  5J6X A;  4NUB A;  4I39 A;  1GUU A;  3A4C A;  4HA8 A;  1V4R A;  3TOB A;  2CV2 A;  2FJ1 A;  2WGW B;  4I3J A;  3M7G A;  4N92 A;  1ZGW A;  5CER A;  2K2G A;  4OIN F;  2W15 A;  1V5F A;  3IWI A;  3LJZ A;  3KO6 A;  2NRA C;  2AVX A;  3OBF A;  2OY2 A;  1K0K A;  5JLX A;  3TED A;  4WYY A;  3C38 A;  2VJ4 A;  3TSG A;  5B5E C;  3V4G A;  2XB0 X;  2DA7 A;  1Z3J A;  5LEJ A;  3HBV P;  4F7Z A;  1UHW A;  3QU6 A;  5BOT A;  3CUQ A;  1FPQ A;  3GEC A;  5HAI A;  2WWY A;  4HSR A;  3LST A;  1I6X A;  1Y54 A;  3W6K B;  4OP8 A;  2H6C A;  3JRE A;  4CZC A;  3DFG A;  1IUY A;  3OC2 A;  5HNH A;  2Y2K A;  3T50 A;  4WXH A;  3KSG A;  5HZH A;  3ZNY A;  3DWB A;  3BWG A;  2WGI A;  1XMA A;  3H92 A;  4NHJ A;  2P7V B;  2R5Z A;  4XSX F;  5FRO A;  2E2D A;  2A6H F;  1O07 A;  1GHC A;  4DYR A;  2Y0M A;  1OT6 A;  3NI9 A;  4XIC A;  3RPU A;  1NJ4 A;  3EUK L;  5CVR A;  2B5R A;  3IH8 A;  1D5J A;  3VOL A;  3OYK A;  1OCR H;  4IZZ A;  2E19 A;  4YII A;  3ZG5 A;  2RAE A;  3QP5 A;  5FA7 A;  2MFZ A;  1D8J A;  5HDS A;  5B66 C;  2BBY A;  4ZJ1 A;  2WAD A;  1BI1 A;  4KZ7 A;  5BPD A;  3CJT B;  3T4J A;  4LK1 F;  1O4X A;  1T2K A;  1ZH5 A;  4EW7 A;  1FM1 A;  3K4L A;  3PR6 A;  2JE5 A;  1B9M A;  1FYK A;  3IS2 A;  5LHG A;  3A0B C;  5EGO B;  2K3F A;  1UMS A;  3LK8 A;  2EXB A;  4PK4 A;  1NLY A;  2A6T A;  2VT3 A;  3LUQ A;  3EUA A;  2DPU A;  1ULY A;  4PKU A;  4UHT A;  3F8F A;  4FQG A;  1K7A A;  3HM5 A;  1IYQ A;  1YSP A;  4EES A;  1HD8 A;  1T6S A;  4NXE A;  1WSU A;  1T0F A;  2G0E A;  3WRT A;  3OOP A;  4FH4 A;  4XOR A;  4X68 A;  3IXD A;  3BC8 A;  3GTO J;  3CDH A;  1UMT A;  3OOU A;  3UE6 A;  3NQO A;  4MN7 A;  4ASN A;  1NZU A;  3FMR A;  4PKS A;  1T08 B;  4PGG A;  3NC8 A;  3IQA A;  3HXL A;  4CCJ A;  5LHH A;  3OYC A;  4S2I A;  4II2 A;  2RL3 A;  3WV1 A;  1OM6 A;  1YW7 A;  3WRZ A;  1ONG A;  3DV8 A;  4B4Z A;  2NUP C;  1R9T J;  4I3I A;  1XFY A;  4MLL A;  5F27 A;  4G6Q A;  1N9O A;  1LL8 A;  3M2K A;  3T4O A;  1NTC A;  3GF2 A;  2K9L A;  1YW9 A;  5GP9 A;  1W63 M;  4P6Z M;  3KYZ A;  2E3X A;  3GMW A;  3UME A;  4S2K A;  5IU1 A;  4P5O A;  3BA0 A;  2LY2 A;  3VFZ A;  2LRD A;  1O0Q A;  1Z91 A;  1T1A A;  1X1C A;  1V5E A;  1R6R A;  1A85 A;  5CJ9 A;  1R55 A;  3LOC A;  2J3T D;  3MZH A;  2ZOI A;  2CO5 A;  2XPU A;  1X4P A;  3KP5 A;  2XEP A;  4XMY A;  3H82 B;  4E3K A;  3S2W A;  3KYL A;  1KGS A;  4XUX A;  3IAS 2;  3ZXH A;  4XOP A;  4ZDL A;  4EJV A;  4TV7 A;  2PBD P;  3OPP A;  4NXG A;  2ELJ A;  3JSO A;  2EH3 A;  4HYE A;  2WAQ A;  2E5Z A;  4DGW B;  3WS1 A;  3PJR A;  3Q81 A;  4B47 A;  3WV3 A;  4IF4 A;  1Z1D A;  5DTD A;  1Y56 A;  1W5S A;  3WG9 A;  2LMD A;  3P9I A;  1DJC A;  1Q1H A;  5M18 A;  3D72 A;  1I73 A;  2BOL A;  4QY5 A;  5M5X J;  1T95 A;  1CK7 A;  3KHI A;  5ICC A;  3HLC A;  2VON A;  2UWM A;  2VQG A;  3ZOB A;  4QPO A;  1HBX G;  4IVI A;  4RGU A;  1LL5 A;  3LEZ A;  2OQR A;  2Y69 H;  2G7U A;  4LB5 A;  2H5S A;  1A36 A;  2XIG A;  2ETH A;  3FKI J;  3ZG0 A;  4MEY F;  2KIU A;  4PM9 A;  4FX0 A;  2ZQ7 A;  1SVM A;  3LE9 A;  3VOY A;  1RIO H;  4AIK A;  3I7G A;  3BPV A;  1OLT A;  1BLH A;  1HZO A;  3H82 A;  4ZJ3 A;  1DGW Y;  2IAI A;  1UJ8 A;  3A01 B;  3PIO F;  2W13 A;  3F18 A;  4GHI B;  2W82 A;  1I1G A;  2X71 A;  1YFH A;  4EET B;  1UAA A;  2WAF A;  3LI9 A;  4EMS A;  3S32 A;  1QME A;  4X6T A;  2W1T A;  1NLZ A;  2DFH A;  3I54 A;  3AG1 H;  3HZJ A;  4PFO A;  4W1U A;  2DTR A;  4L5J A;  4WM9 A;  3TKY A;  1R5G A;  2D1V A;  4I0A A;  1S72 I;  3QHY A;  5CHJ A;  3KYQ A;  3NIA A;  2W84 A;  3FM5 A;  2MJ6 A;  3PQJ A;  2XAJ A;  3LY4 A;  2E1O A;  3BFC A;  3JAM K;  4BD0 A;  5LGU A;  4CYC B;  5TBM A;  1YJ9 I;  5H20 A;  1SFE A;  1R1I A;  1GHI A;  2VE9 A;  1ZXV A;  2M0M A;  2FOW A;  1GSX A;  1ESU A;  1FWZ A;  1W7P B;  3OYE A;  4U88 A;  3IBJ A;  3GW2 A;  3L2V A;  2R7X A;  2MD5 A;  4BQM A;  2EIL H;  2OSU A;  3GVA A;  3ZQC A;  3KEY A;  4L9T A;  1TW2 A;  1K55 C;  2X01 A;  1ZHH B;  1VB6 A;  4PSW A;  5BOH A;  3A01 A;  5GL9 A;  4I35 A;  1S8N A;  3ZQL A;  2AXT C;  4QPR A;  2CUZ A;  2FNA A;  1IN4 A;  5E2E A;  2RKH A;  3GTC A;  1WA9 A;  4I38 A;  3BG9 A;  3SDG A;  1DU0 A;  1KDS A;  3K4K A;  3PBR A;  3SDB A;  3HLE A;  2JTV A;  1RUN A;  4JOM A;  2QPN A;  3GFL A;  3CI6 A;  3LSM A;  1S6L A;  3Q9V A;  1ES3 A;  4WZV A;  2OTJ I;  5F1G A;  1OR7 A;  1WJB A;  3BLY A;  2LVS A;  3WOD F;  5CXW A;  2UUZ A;  2MZE A;  1N78 A;  1NK2 P;  2H8R A;  2JA5 J;  1YO5 C;  1XPB A;  4P9U A;  3GZ6 A;  4H2E A;  2FMY A;  5KZH A;  5D8L B;  1BKC A;  4ZTJ A;  3FIS A;  4HP9 A;  4XKV A;  4XNF A;  3LIA A;  2FRH A;  4HNT A;  1YQY A;  2XSJ C;  3HSF A;  1U78 A;  3H36 A;  4R38 A;  3ZVT A;  2FZ0 A;  2Y0S A;  3K4J A;  2PX9 A;  3NEC A;  1IDZ A;  1I1I P;  1R4N B;  2WB1 N;  3K6G A;  2V0W A;  3CD6 I;  2F4O B;  3DBL B;  1K6O A;  4AUO A;  2V26 A;  3BLS A;  2Y2Z A;  1EH6 A;  2ZXJ A;  1O7E A;  4L9F A;  4L9E A;  3LAJ A;  3P24 A;  3ZG7 B;  2YUF A;  3F1P B;  3EDI A;  4H82 A;  2TCT A;  3I3L A;  2Y2P A;  4Z2Y A;  4FET A;  1DJA A;  4L9J A;  1KE0 A;  3L00 A;  4GNU A;  2A68 F;  1O3T A;  1K78 A;  2JRT A;  1OFC X;  3VYR B;  3IWQ A;  3OPL A;  4HOB A;  1KGG A;  3C2H A;  1BI3 A;  4AXQ A;  4YIF A;  4IUH A;  4WUJ A;  1YW8 A;  3F21 A;  2JKT I;  3MBZ A;  1T18 A;  3FPW A;  2KLI A;  1MGT A;  1J3W A;  4RA2 A;  5FKK A;  1KDW A;  5TRD A;  4PM7 A;  3HIF A;  2W14 A;  3BJO A;  2EWV A;  2Y48 A;  4HF1 A;  4NEE D;  2DQL A;  3DLL F;  4E7L A;  2O9B A;  4EBN A;  3DEU A;  2Q8K A;  2GOM A;  4P87 A;  3GO5 A;  5IT9 K;  3RJP A;  1VQL I;  1RCJ A;  2IBD A;  4XSZ F;  1XJ2 A;  1E17 A;  1EWZ A;  2M7V A;  3RI4 A;  2DYR H;  4N9I A;  4P1W A;  1SFU A;  3RQI A;  1R1T A;  2NVQ J;  1MDM B;  4D5C A;  5BOX A;  4RLF A;  4M4X A;  1MBG A;  2PMU A;  4FXY P;  4XLC A;  2K2N A;  3Q2H A;  1MND A;  3H1C A;  1IN7 A;  3HUM A;  1XX5 A;  2HJ9 C;  4WZ5 C;  1W5T A;  3BR1 A;  1CI9 A;  3F1P A;  5B5O A;  4LD5 A;  1MMQ A;  2OUM A;  1IRX A;  4XUZ A;  1NRJ A;  2WKR A;  3UR3 C;  1Z05 A;  3I59 B;  2Z9O A;  4LCM A;  1EF4 A;  2EWN A;  1LFU P;  3CAX A;  3BTC A;  4BBU A;  4HES A;  4JA1 A;  4KZ8 A;  1F43 A;  4IBX A;  4KUK A;  1K6R A;  3O64 A;  1D1A A;  3ZQQ A;  4AIJ A;  3B6C A;  1SKF A;  4MN5 A;  4IRG A;  1QBJ A;  3CCY A;  4GDF A;  1FSE A;  2J83 A;  3WTY C;  1VQQ A;  4LEN A;  1JE8 A;  1PJR A;  3CLQ A;  3F6O A;  2VKS A;  3BFG A;  2OZR A;  3DTK A;  3QOE A;  4X1M A;  2VBY A;  1YCM A;  4IXA A;  5J8X A;  1CGL A;  1K61 A;  2PRF A;  4GS9 A;  4B93 A;  2XF3 A;  2V8C A;  2DFE A;  1HVB A;  3K3D A;  3IH9 A;  1MDM A;  4PKQ A;  2X3A A;  5F0C A;  3SYT A;  2XUB A;  3LJG A;  4EER A;  4HEA 2;  2QM3 A;  2X0L A;  1T1B A;  1MW7 A;  2DMN A;  3M3Y J;  1QUA A;  2H0T A;  4Z9Q A;  4DMZ A;  2IGO A;  3OOV A;  2HOE A;  2HQR A;  3JRA A;  2QLZ A;  1HTZ A;  1ERO A;  3IRR A;  2OPT A;  3K1P A;  3G6O A;  1NYY A;  3M1E A;  3ZQG A;  4MFE A;  3D1N I;  3GZN B;  4E04 A;  5HS9 A;  2LR8 A;  2ACJ A;  2DDA A;  1XJ3 A;  3M07 A;  3BZK A;  3I59 A;  2HYG D;  4G6D A;  4PAU A;  3L2W A;  2HOA A;  2W4S A;  1FYM A;  2H09 A;  1FSW A;  5HWT A;  4Y33 A;  3ABK H;  3RZO J;  5HOD A;  2WKP A;  2VA0 A;  1W7F A;  2QA4 I;  1BR4 A;  5FAO A;  1WJE A;  1N77 A;  1SFK A;  3N4I A;  4LV0 A;  4ZTF A;  1ZEL A;  3GLL A;  3T4K A;  1IUF A;  1LDD A;  3I56 I;  2MSY A;  1Z67 A;  3HLB A;  1YLW A;  2R7Q A;  3EWK A;  2RQQ A;  1XUR A;  4I7H A;  3ZVS A;  3P5J A;  3CO6 C;  4R79 A;  1MH4 A;  1X4O A;  3J80 K;  1J9M A;  2P81 A;  5HDC A;  3BR3 A;  3OIO A;  4BEH B;  4M74 A;  2PJT A;  3K4N A;  4MFD A;  3WTV C;  4AC0 A;  1MWU A;  3RPQ A;  3LY3 A;  3V8K A;  3NWT A;  1B6A A;  5D3O A;  1PWC A;  2CW0 F;  5GAE J;  3BW6 A;  2M4G A;  4F91 B;  3M8F A;  4A12 A;  3ZXS A;  4OU0 A;  5E1X A;  1S1Y A;  5DYM A;  1PWP A;  3ABM H;  4BU2 A;  4DNC A;  1VTN C;  1XDS A;  5K7Z A;  3DW0 A;  2M30 A;  2QKP A;  3G2Z A;  1IKI A;  2E1N A;  2KZV A;  3FIW A;  2MYS A;  2Y2G A;  2DK8 A;  3CCJ I;  4H6J B;  4JPM A;  1JAO A;  1P7I A;  1I27 A;  3CCQ I;  1ACI A;  4OVD A;  3MS6 A;  4XLN F;  5K5Q A;  2USN A;  3MF0 A;  4KQR A;  3ABT A;  2FV9 A;  4LMY A;  2W00 A;  2JBF A;  3J7Y J;  1OIS A;  2X6X A;  2Y2O A;  2INW A;  2ACG A;  2PJR B;  3CF2 A;  3OYF A;  3LQR A;  2DT6 A;  1QQI A;  4PJN A;  3ZHH A;  3HOW J;  1CGP A;  4CCN A;  2MD0 A;  5IYD J;  1ZG1 A;  2DJI A;  1R49 A;  1BJA A;  2PG4 A;  1D8F A;  1SAU A;  2XF5 A;  3CPT B;  5EOE A;  4BEH A;  5C4X J;  3CUE A;  3LR3 A;  2ZQ8 A;  5E1Z B;  3Q1F A;  1WWX A;  3WGH A;  2WTE A;  2XAF A;  4HF0 A;  4RGS A;  5JVT A;  5E3M A;  1W4M A;  5CPR B;  5HD3 A;  5EE8 A;  1DUX C;  5DTT A;  3KME A;  1G3W A;  1BM6 A;  2EZH A;  4WZ4 A;  5LGN A;  3TW8 A;  1Z6R A;  3VYT B;  4FOF A;  2GZA A;  4XLE A;  3CCU I;  4XRF A;  2M0C A;  2TCL A;  4YFN F;  2ZFW A;  4K0X A;  3Q0U A;  4CA0 A;  2JKT M;  2G2U A;  1P9R A;  4I02 A;  1XX2 A;  2JKR I;  4CLC D;  4ZZD A;  2HKO A;  4A3K J;  1BLP A;  4XKW A;  4JKT A;  1IRG A;  4XM6 A;  2CQ7 A;  4OIQ F;  1JGS A;  1P4A A;  4ESF A;  5FEG A;  1XGI A;  4JXW A;  2SRT A;  1R1U A;  4BHP A;  1PW1 A;  4OMZ A;  1KAP P;  2OW0 A;  1BLC A;  4S2N C;  5JR3 A;  4E3M A;  1TQM A;  4E7S A;  5CUH A;  2O6G E;  1G6O A;  2KX6 A;  1MD0 A;  1LI0 A;  4NDL A;  2Y30 A;  4DQ2 A;  3Q82 A;  2BHY A;  4AYB N;  2XDM A;  1VEU B;  2YSR A;  2V4B A;  3ZCO A;  1SMY F;  3PFI A;  3HOZ J;  1PWG A;  1SMP A;  4IQ4 A;  4DD8 A;  4EBP A;  5DD8 A;  3HVF A;  2LLK A;  1YTY A;  3FXJ A;  5J40 A;  3TGN A;  1KBC A;  2P9V B;  5A2Q K;  3E98 A;  3ZUK A;  1F2K A;  4C2M J;  5JVG F;  3F8M A;  3P1V A;  3BCB A;  3B02 A;  3CMA I;  4RVA A;  1JK3 A;  2X6O A;  5B1B H;  2XV4 S;  2WKH A;  3LGO A;  3IRQ A;  2EX2 A;  2F5D A;  1L0F A;  2NS8 A;  5CTN A;  2M7U A;  4WEJ A;  4ZYD A;  2GXB A;  4DRT A;  2EFQ A;  1T19 A;  3K69 A;  1HSJ A;  2ID6 A;  4NQW B;  3ROU A;  1K7I A;  3KPH A;  5I43 A;  5IP7 J;  3NEU A;  4GN2 A;  2E2H J;  3K1N A;  4K08 A;  1D06 A;  5F0F A;  5D1S A;  2L4M A;  2HF6 A;  2P74 A;  3N6I A;  3NAU A;  3LR0 A;  3RKW A;  1F36 A;  2ERP A;  3IL2 A;  2JJ7 A;  3I55 I;  4BS9 A;  2XC7 A;  5DUK A;  2Y59 A;  3IF6 B;  3N8S A;  3D5R C;  1QZZ A;  3DBR B;  4FE7 A;  3KE2 A;  2GM4 A;  3MXS A;  5EYR A;  3ML6 A;  3PYP A;  4BXF A;  2JN7 A;  1WH7 A;  4LRZ E;  4OQI A;  1FSY A;  5GLA A;  3UPP A;  3RKY A;  4YNR A;  4F55 A;  3BWL A;  1S66 L;  4KZ9 A;  2DA4 A;  4BQN A;  3CZD A;  3F23 A;  4OOI A;  5FKN A;  1L0O C;  4LV3 A;  3D3O A;  4MLO A;  5KAF C;  1VQK I;  1Z7L A;  2RNG A;  2O9L A;  3GSG A;  2FBK A;  3NDE A;  1OO9 A;  3BJN A;  3BQZ A;  5JFR A;  4OLD A;  3KEK A;  4A3F J;  2E34 A;  2A3S A;  1J2X A;  2VXZ A;  3G6E I;  5FRN A;  5HPI A;  2Y2L A;  2FSW A;  2ZQD A;  3R7W A;  1X3U A;  5DEQ A;  1MBE A;  4NET A;  2KHM A;  1MWR A;  1X3W B;  4Y13 A;  5CZM A;  3HJK A;  2OLV A;  2HNH A;  3BR2 A;  1KE4 A;  2OW1 A;  1CAQ A;  5K7F A;  2WY8 Q;  4BE1 A;  4R6L A;  5E2G A;  4XID A;  1KGE A;  3UY6 A;  3EUH A;  4R1H A;  3JRH A;  2QPJ A;  4XQF A;  3PAE A;  3KFW X;  1RUO A;  4CLC C;  4GLQ A;  5KAI C;  3I4N J;  1ND1 A;  5K5O A;  3E5U A;  3ZG8 B;  2L9S A;  1X58 A;  5FDS A;  3ZMU A;  4A3W A;  1POG A;  5D6E A;  4FCY A;  2NUT C;  1FCN A;  4H49 A;  2VIX A;  3GTG J;  5C44 J;  1PW8 A;  3T8T A;  1PYY A;  3S8P A;  3EHY A;  2YUS A;  5M5Y J;  4FSF A;  1X1A A;  1QVU A;  1VM1 A;  4Q8I A;  2W3H A;  2DFI A;  1W36 D;  4EU0 A;  3V42 A;  1MJA A;  3B33 A;  3O5Y A;  2Y55 A;  1V9Y A;  2ZD8 A;  4KN7 X;  4IVN A;  3G4S I;  5HLG A;  1GO8 P;  4YFX F;  3Q2G A;  3SFZ A;  5KK1 A;  1I2W A;  4C2U A;  3BOQ A;  2ZM8 A;  4B48 A;  1BQQ M;  1L0G A;  4GUY A;  1B8Y A;  4V2F A;  5DF8 A;  2XVC A;  4JK1 X;  4PPR A;  4JGQ A;  2VXD A;  1OM7 A;  5TFQ A;  3WGI A;  3ABU A;  1RI7 A;  1KUF A;  1FQG A;  4NC6 A;  1TEM A;  2XH9 A;  3SH8 A;  4D1Q A;  1ZR2 A;  1MBF A;  5M5W J;  1HKS A;  5A8B A;  2P8T A;  3BJA A;  5CVJ A;  2BYV E;  2LOO A;  2DCF A;  4OLG A;  1Y8R B;  4P96 A;  1S4R A;  4BBR J;  2QYO A;  2WK0 A;  1NG6 A;  3CCL I;  3CLO A;  1KQ0 A;  4ITV A;  4BGD A;  2E1M C;  4F3L B;  1A86 A;  3FV7 A;  5EPH A;  3IH2 A;  3M4O J;  1OTD A;  2HVS A;  3UE3 A;  1XA1 A;  4M6V A;  2YPR A;  5DCM A;  5CYV A;  4ID4 A;  4DZJ A;  5F1R A;  2B7E A;  2ZXW H;  3HUN A;  3FXM A;  3LSH A;  5FO5 A;  3FX3 A;  2JC7 A;  4PJM A;  4A3E J;  5DD4 A;  2PR6 A;  1SLM A;  2R9W A;  2CG4 A;  3K7A J;  4BEN A;  4DJ3 A;  5ICF A;  5H2F C;  4A6E A;  4PKY G;  3CG5 A;  4CGZ A;  4GYG A;  2JKR M;  3FKW A;  1VZ0 A;  2JA7 J;  2CWE A;  1NK3 P;  3LFK A;  3EDH A;  5J4V A;  4B9O A;  3PNY A;  2F6C A;  4LV1 A;  3S1M J;  3U2A A;  1Z6F A;  3DKY A;  2ZQC A;  4V2G A;  1NZO A;  2R78 A;  4ZBE A;  2Q9N A;  3SQN A;  4HEF A;  5HAP A;  1W8Y A;  4BUP A;  4U7B A;  1LVA A;  3VV4 A;  1I39 A;  1C0W A;  4X56 A;  1YX5 A;  1ZLJ A;  4ZYE A;  3BTJ A;  4JBA A;  5FAT A;  1U60 A;  3C4O A;  4UB6 C;  1ES2 A;  1CGE A;  2X6Y A;  3VSL A;  1MBL A;  2L0W A;  1OS2 A;  4F3L A;  1VND A;  5BMZ A;  3HSR A;  4HBL A;  3CC7 I;  3VPR A;  1QIC A;  4CCO A;  4RB2 C;  1OTA A;  4DJA A;  3IHU A;  3EEH A;  2UZK A;  5FQ9 A;  4G8X A;  5GLC A;  1OCT C;  4X53 A;  2E8I A;  4JPA A;  3SFI A;  3OYM A;  2DA2 A;  2VKH A;  2CMP A;  4A6D A;  2K5C A;  3LGP A;  1HQC A;  4UUV A;  3HRU A;  3H3V K;  3L7H A;  2L0R A;  2PQ8 A;  2V2F F;  3JAM Z;  3HLG A;  3LSJ A;  2C6W B;  3AGD A;  2A49 A;  1WNI A;  1JTX A;  1T1C A;  2FBH A;  5D3C A;  4A3G J;  1MKM A;  3F8B A;  4OOM A;  3BG7 A;  3ZMV A;  4GO1 A;  1IFQ A;  5A92 A;  2L7Z A;  1LSW A;  2UWX A;  2XKP A;  3GVB A;  1APL C;  1FMW A;  1LFB A;  3Q7V B;  3V3S A;  2XF6 A;  1DRM A;  4A5M A;  3O87 A;  1LPQ A;  3ITA A;  1KUK A;  1N75 A;  3F72 A;  4QSH A;  2XFS A;  4Y0T A;  3LIE A;  2P5K A;  4ESB A;  2DNS A;  3WU0 A;  3NDG A;  1T98 A;  3MJQ A;  2ZLY A;  2DCE A;  3W2W A;  3NOU C;  3DTI A;  4A3C J;  1FEX A;  4UA7 A;  2MC4 A;  4XT2 A;  1CXV A;  1QJI A;  3EET A;  1ZRF A;  4KIB A;  2WBM A;  3CCV I;  1GA9 A;  3F1N B;  3VOZ A;  3NUL A;  2W85 A;  4BBS J;  1Y93 A;  3TO9 A;  1BLS A;  2XAS A;  3MZY A;  1BUD A;  5EF6 A;  4YRV A;  4HP4 A;  1K54 C;  2HJE A;  2LBF A;  1SAT A;  2PD8 A;  3C5A A;  5FQJ A;  2VBW A;  4KA4 A;  5DJT A;  4NC7 A;  3N8R A;  5EV0 A;  3AGF A;  1XM5 A;  3KZY A;  3ZN1 A;  1OCP A;  1R22 A;  4OWR B;  2VGL S;  1E0E A;  2LB9 A;  3DU6 A;  5B3S H;  3LSK A;  1IXR C;  1OT9 A;  2AO9 A;  4Y0U A;  2EBI A;  2WKE A;  4MBK A;  3GRJ A;  5EEG A;  3KEJ A;  3BRM A;  4IHS A;  3CCM I;  5GAH J;  1EA3 A;  3WTU C;  5HLT A;  2JNP A;  1V55 H;  1B1B A;  4MQ9 F;  4V19 K;  1KZH A;  2PN6 A;  1BL0 A;  3ICY A;  2E7W A;  2LTP A;  2MLG A;  1XB4 A;  3VI1 A;  2W25 A;  4HPQ A;  5HL1 A;  2D01 A;  1FTZ A;  2A24 A;  3S17 J;  1W8Q A;  1UG0 A;  4A2U A;  3K4M A;  1YMX A;  1KOU A;  2EFX A;  3DPU A;  3VFF A;  5E3N A;  3TP0 A;  4CCL A;  3I53 A;  2L9N A;  2VOP A;  1OJ5 A;  3KP3 A;  2IS1 A;  2VOD A;  4Y2F A;  3ECO A;  3CUO A;  1ES4 A;  3ZP5 A;  1TS0 A;  4D2O A;  4DE0 A;  2KJC A;  2ERQ A;  2HOS A;  1RM8 A;  4RDU A;  4YFM A;  2PMZ N;  4GD6 A;  3MKE A;  2R3S A;  5D4S A;  1SLN A;  1RC9 A;  2VV6 A;  4FAS D;  2JUC A;  1IXS B;  1TP4 A;  1OMI A;  1EH7 A;  1CGF A;  1U9O A;  2HI3 A;  1I50 J;  1QPM A;  5EG0 A;  1ETO A;  2H0Y A;  3G32 A;  4B3A A;  3T12 B;  4KMU X;  2R0Q C;  1JKY A;  2HVQ A;  4EAT A;  2EX6 A;  3G35 A;  3H9W A;  3AKZ A;  5FQI A;  5IT9 Z;  3UB7 A;  1KQ9 A;  1Z6T A;  4H0E A;  1AKH A;  2H6B A;  1SVL A;  4HJ3 A;  2Y2H A;  3C1D A;  4MTD A;  2XR0 A;  4C6Y A;  3TP3 A;  1OZ9 A;  3BYD A;  2B0L A;  2QQA A;  2EB7 A;  1LHY A;  4HDV A;  5DKL A;  1YQS A;  2E35 A;  1YG2 A;  3P09 A;  5HVQ C;  4DYC A;  4GW9 A;  1FOK A;  4JX5 A;  2K27 A;  2VE8 A;  3HRS A;  2L4A A;  5AQ7 A;  2O0Y A;  4DF6 A;  4BQO A;  5FL3 A;  2X02 A;  4IHY A;  4N4N B;  2WKQ A;  1P9W A;  1XD7 A;  3FKJ A;  1ZHF A;  1OYY A;  4FH2 A;  1N9L A;  1N25 A;  4S05 A;  1P7J A;  4Y0O A;  4PJJ A;  4A93 J;  1GKD A;  1JKP C;  2PYR A;  3TQN A;  1SAX A;  5IHV A;  1OCZ H;  3AG2 H;  1MKI A;  4NG2 A;  4KG2 A;  1ZG6 A;  2Y31 A;  1IC8 A;  2ZKZ A;  1VQ9 I;  2HWV A;  5HS8 A;  2O8X A;  4Y7N J;  2NVY J;  1GDT A;  4NK3 A;  1Z9C A;  1UG2 A;  4QWQ A;  3MKF A;  3A3E A;  1CQR A;  1XFN A;  3DLA A;  4BJP A;  2KIQ A;  1TWC J;  4ARZ B;  3FXU A;  4WCG A;  3GLX A;  2FML A;  5CHM A;  1GXP A;  2O7O A;  3G1L A;  4UV8 A;  5D4R A;  2F2E A;  2LKP A;  4EXO A;  2DA5 A;  2DDB A;  3BRO A;  3FZC A;  3KP6 A;  3Q0W A;  1ZRD A;  2ZJP F;  1K83 J;  2JT5 A;  4BJ5 C;  2LC2 A;  4S0H B;  2BXZ A;  3LQQ A;  1MZU A;  1I3A A;  4I01 A;  3K70 C;  1C8T A;  5GTH C;  1BZA A;  3ZMD A;  4O7D A;  3AAF A;  2DOA A;  3FWE A;  1YOU A;  4WK8 F;  4CYD A;  1BR2 A;  3E6D A;  4ON0 A;  4E3L A;  1UB9 A;  4EEF G;  3D9Y A;  3VYU B;  3LSP A;  3HRE A;  4QY6 A;  2V79 A;  2JSD A;  5JHF A;  1G49 A;  4KG6 A;  3ZQI A;  4G9L A;  1MBK A;  1O3Q A;  4B1R A;  5ILU A;  4A3J J;  2IT0 A;  5EFW A;  2K85 A;  5DV5 A;  2Y2M A;  3B73 A;  3IHB A;  1X2N A;  1K6Y A;  4FCF A;  3E1S A;  2HEO A;  3LNQ A;  3HYI A;  1UEA A;  4L19 A;  3J80 Z;  1TWF J;  3A3F A;  2BXY A;  5EJC A;  4ARZ A;  1DY6 A;  2M7A A;  2Y9Y A;  4RA7 A;  5KMW A;  1DP3 A;  3NWS A;  4I2O A;  4PKY A;  2GDN A;  5TR7 A;  3CF5 F;  2R4G A;  3OYJ A;  4ZTK A;  2LNB A;  1IZ1 A;  1MJB A;  2KOI A;  3QPL A;  3F15 A;  1WJC A;  2HPB A;  1G5U A;  1F4K A;  3ELK A;  3ERM A;  1OQY A;  3HB2 P;  1WVR A;  5IP6 A;  1GKC A;  4MBF A;  4R3A A;  1TZL A;  2WZZ A;  5TGF A;  3EGX C;  1IO2 A;  3DEE A;  4LG3 A;  1XS9 A;  1H9T A;  3U21 A;  4FXQ A;  2QKL B;  2VKV A;  1MWS A;  2K9C A;  4M73 A;  2JHE A;  1ETW A;  1Z0X A;  2DMT A;  4CCK A;  1XTA A;  1WYC A;  4O01 A;  5MC7 A;  4HI4 A;  4E7K A;  4EVI A;  5LAB A;  4OQG A;  3T4S A;  1W79 A;  2CUE A;  5BPI A;  3GR2 A;  4WXD A;  4I03 A;  3H5N A;  2GJ3 A;  3GUD A;  4BL2 A;  1BIW A;  2LSO A;  4U0Y A;  2ZCW A;  1I5Q A;  3MCZ A;  3ECH A;  3QP6 A;  4MNU A;  2WAQ N;  2POJ A;  3LL7 A;  5J47 A;  2ADU A;  1ZAO A;  4B4X A;  2YIG A;  3L7W A;  2DOE A;  3E4Q A;  3A3D A;  1S67 L;  1UMQ A;  1QMF A;  1IEL A;  4EQ1 A;  2R7R A;  4QIW N;  2GA2 A;  4O0P A;  3R61 A;  1YI2 I;  1LI9 A;  4DPE A;  2ZMF A;  2JZY A;  2W0N A;  1O0T A;  1BUE A;  2ZC5 B;  2E71 A;  1S4S A;  2V4J C;  1IF1 A;  3MZE A;  3OYA A;  5FD5 A;  2J9P A;  1RRJ A;  1DP6 A;  5EVI B;  2XQZ A;  1BC7 C;  1MBH A;  1W7P D;  4GJ4 A;  3ZR8 X;  2ME6 A;  3KP4 A;  4PKV A;  2LF8 A;  1FOF A;  1SD6 A;  5EDN A;  2PLY A;  1J7K A;  3BPX A;  1FX7 A;  4KQD A;  3OYB A;  2BLS A;  2FQ4 A;  3N4M A;  1LT0 A;  2FV5 A;  4N0B A;  3H0G J;  2H1K A;  3WGG A;  3R60 A;  1C7K A;  1ZLK A;  5EOO A;  1Y0V A;  2DU9 A;  3U1D A;  1Q2P A;  4E70 A;  2WY7 Q;  2VQH A;  3DKW A;  4C3I J;  2PT7 A;  4DBQ A;  1ZP5 A;  3OYL A;  1G59 A;  1JIW P;  2Z2D A;  5F0H A;  1ETX A;  2VJI A;  1U5T B;  2ZXI A;  5DTK A;  5L3B A;  2D1O A;  1MMS A;  3HOX J;  5A2Q Z;  4NNJ A;  3BTI A;  1GXQ A;  3E2L A;  1KU9 A;  3TRC A;  1DU6 A;  1J59 A;  2BVL A;  1R1J A;  1H71 P;  1U6G A;  2XPV A;  4E7J A;  3JVV A;  5EVI A;  3SJM A;  3PL8 A;  5HFO A;  2J80 A;  2ICW G;  2R7U A;  1KUI A;  2VLG A;  3E97 A;  3GYH X;  3R4K A;  5KCM A;  3F3X A;  4C3H J;  3LIL A;  5H6R A;  1BN5 A;  2DTZ A;  3LSR A;  4ENM A;  5HPF A;  3BFD A;  1JTY A;  5FLM J;  2XF7 A;  3OZH A;  1YKD A;  3C18 A;  4GWN A;  2ZC2 A;  3M6B A;  3C3W A;  4BKX A;  4D9J A;  1M6K A;  3PNT A;  2WKI A;  1IAB A;  4XLA A;  4J19 A;  2K7S A;  3F1O A;  1FR1 A;  2FH5 A;  2VUM J;  3MFK A;  2HDU A;  3BM6 A;  3SH7 A;  5FDH A;  1ZRC A;  3ZCZ A;  1VQM I;  2DMU A;  4FTH A;  3B6A A;  3RYP A;  3OPH A;  1ZAR A;  1XG1 A;  1L0E A;  1R5I D;  3LA7 A;  1U8B A;  1F1Z A;  2BTF P;  2EZK A;  4L5I A;  4QHC A;  3LUM A;  2HDR A;  1X2M A;  5JLW A;  2PDR A;  3G31 A;  1MBJ A;  1V9Z A;  2CH0 A;  2E1C A;  4RAY A;  2X1E A;  1Y8J A;  3FKV A;  2GBY A;  3HB9 A;  3E0J B;  1U5T A;  2HZT A;  1D8K A;  1CIZ A;  3TDU C;  3FXL A;  4JX6 A;  4BAY A;  3O6B B;  1JH1 A;  1RGZ A;  4E6K G;  2AQF A;  3HCY A;  4MHG A;  2PU2 A;  4L5E A;  3G73 A;  3QU3 A;  2IA1 A;  3E6M A;  2HXO A;  4GKU A;  2DAO A;  3KYD B;  2ZNY A;  3L2R A;  3IXH A;  1OR7 C;  2M1B A;  3TJZ C;  1Z3Y A;  3RH8 B;  4WF2 A;  1ZXC A;  2NS0 A;  2ZSI B;  4I5S A;  3V5M A;  3I64 A;  4LLO B;  1TQP A;  3IX4 A;  4HQM A;  2A5W A;  4U0T A;  2CQK A;  2XHK A;  4EGY A;  3OS1 A;  3EYI A;  4OAZ A;  2Y6D A;  4JIJ A;  3PO3 J;  3LEA A;  4DV8 A;  2XGE A;  3VOE A;  3MMY B;  5DFX A;  3VSK A;  2DT5 A;  2NS7 A;  3BR0 A;  3HOT A;  2MGQ A;  2L2O A;  1SC7 A;  2RRE A;  3J7A O;  2L54 A;  4BQA A;  2O36 A;  1PWV A;  1NWZ A;  2JT1 A;  2L9V A;  1W63 Q;  3T1B A;  2K86 A;  4IED A;  2NOJ B;  3TS4 A;  2A05 A;  4IN9 A;  2F5C A;  1D0X A;  5C3E J;  2AXL A;  3DWK A;  1MC0 A;  2DOD A;  2L02 A;  3DCF A;  2W3D A;  1JHH A;  2ZXH A;  4RBO A;  5FGM A;  1DDN A;  4WMC A;  3TOI A;  1WYB A;  1BZS A;  4YIN A;  4ABZ A;  2OWJ A;  2HXI A;  2LG4 A;  2WUQ A;  1W1W E;  2E2J J;  3CIT A;  4LLN A;  1NYM A;  2X9D A;  2K9Q A;  2GWR A;  5EVL A;  3ELM A;  3C30 A;  3AIG A;  4EBL A;  3IAM 2;  1PRQ A;  3H9Q A;  1V5G A;  5I4O A;  3IX8 A;  3H0D A;  4OPY A;  3GBO A;  1G2H A;  2IRF G;  3K3C A;  4GDN A;  1L6J A;  4IOA F;  4L9V A;  1BOA A;  2W24 A;  4ZR5 A;  1UEL B;  5HSQ A;  3KLO A;  2DXI A;  2CRG A;  2B95 A;  1XSV A;  5FAQ A;  1LJ9 A;  4U87 A;  5HL6 A;  4CDG A;  1D0Z A;  1PWW A;  2V8F A;  3S1Y A;  2JRM A;  5EVE A;  2WGW A;  4XN3 A;  3EGD C;  4ZDP A;  1ETV A;  4Y4R A;  4MGR A;  4XL9 A;  1IN6 A;  5M3F J;  5CQG A;  3A0V A;  4OKP A;  1H8Z A;  5LEK A;  2YKF A;  1PIO A;  3G3Z A;  1G05 A;  1EUB A;  2O03 A;  2FBI A;  3QOP A;  4XM7 A;  4LOC A;  2KRH A;  5FI6 A;  4OMY A;  5F1F A;  1USS A;  1PUF B;  4A7B A;  3KX2 A;  1XP4 A;  2YR2 A;  2M4K A;  3A03 A;  3K4C A;  2VBX A;  4RS8 A;  1PDN C;  1YLF A;  2M9H A;  1VQ7 I;  3MMH A;  1J5Y A;  4S2M A;  3LQB A;  3RTR A;  1TS7 A;  4DDS A;  1CEG A;  3QNB A;  4AIH A;  3PUF A;  2L1M A;  1NRF A;  4JQF A;  3K1M A;  3WTX C;  3MFX A;  2VC1 A;  1G6A A;  3GQZ A;  4A0X A;  2EV0 A;  2F4I A;  4U0V A;  3RTY A;  3AL0 B;  4K2E A;  4H4K C;  1GXD A;  2XK1 A;  3GFI A;  1STZ A;  1O7L A;  3M1C A;  1FLS A;  4B43 A;  2ZC4 B;  1Q2Q A;  3G2Y A;  4AYB A;  4UY8 I;  4ZYA A;  1XCV A;  2ZJ2 A;  4HMA A;  3HOS A;  2Y75 A;  4OIP F;  1ALQ A;  1O3S A;  1S3J A;  3PFY A;  5D5V B;  2N8G A;  5CVU A;  1WJD A;  1R54 A;  4HX8 A;  2CC1 A;  4MBH A;  5EGO A;  3GTL J;  1RKW A;  2BZT A;  3S2D J;  3PBQ A;  2E60 A;  2UXN A;  3KX0 X;  1XFV A;  3OHL A;  3O88 A;  2RJQ A;  2BG1 A;  1UHM A;  1I6H J;  5E8I A;  4IJO A;  4DKI A;  4CLC B;  1HV5 A;  1PI5 A;  5JMY A;  3O8H A;  3OYG A;  5HDG A;  1M1E B;  1ZGA A;  2IGM A;  5AIP A;  3V39 A;  5M19 A;  4P55 A;  1B8I B;  1K57 A;  3HSE A;  1W5D A;  3WHC A;  3F22 A;  1Y28 A;  5DM6 F;  2M8E A;  4J01 A;  3H3Z A;  4F92 B;  3QWL A;  4HJ4 A;  4MMN A;  3HUG B;  1BKC E;  3OHO A;  3OMY A;  3QAH A;  1VFC A;  1KVL A;  2LYC A;  1YS6 A;  1BI2 A;  2DDF A;  1S0W A;  3HPG A;  3A3J A;  4HG2 A;  1FOY A;  5HLI A;  3OYN A;  2FOK A;  2Z5U A;  4LIV A;  1FY7 A;  1N9N A;  4IL6 C;  1TT0 A;  4JXG A;  3FBI B;  3VE4 A;  1PWQ A;  5ED4 A;  1BTL A;  1XAX A;  1MH3 A;  1OPC A;  3RFB A;  4RX2 A;  3WG7 H;  2R7W A;  3QRF F;  3OS0 A;  3ISG A;  1G9K A;  2OVX A;  3E2K A;  3MD2 A;  3QYF A;  4UQI M;  1RNL A;  3IH4 A;  1YM1 A;  1YX3 A;  4Y3O A;  4EFS A;  3HRM A;  3NAR A;  5DF9 A;  1SD4 A;  1FCO A;  1Q3A A;  5J3L A;  5F1J A;  3E5X A;  4I09 A;  3S14 J;  3N97 A;  3DWL E;  4AVZ A;  3HHH A;  3T4L A;  2KL4 A;  3T4Q A;  3GME A;  2H10 A;  3QOD A;  3RYR A;  1YAX A;  4C9Y A;  3NRV A;  2E1M B;  1ONH A;  1FSH A;  1B8I A;  2DI3 A;  1H0M A;  3E5Q A;  2BHZ A;  2TRT A;  2QEX I;  3GTQ J;  4KZB A;  4HQA A;  4BXU A;  2A07 F;  2QBY B;  4PJL A;  2JT6 A;  2ZBK A;  3DPT A;  1NH3 A;  1IKG A;  1P6R A;  2PFB A;  3IXG A;  1TT5 B;  4OQH A;  4XKB A;  4OON A;  3HUG A;  1J09 A;  1M40 A;  2CQQ A;  2OD5 A;  5A91 A;  3T5X A;  2FFF B;  4ANJ A;  4GDB A;  4EV0 A;  5FQK A;  3S16 J;  3GDI A;  3MVP A;  1SRP A;  3CUE C;  3EDZ A;  4DF9 A;  1FIA A;  2M3A A;  4LGW A;  4P6Z S;  4RB0 A;  4U0W A;  2DJN A;  2WYX A;  4L9G A;  5GTI C;  4M6X A;  3LIF A;  3L2C A;  2OAQ 1;  3UPN A;  2XAH A;  3G30 A;  1VET B;  2QWW A;  3LIB A;  2J7V A;  2VV7 A;  4IUW A;  1JUM A;  2IPQ X;  2K9N A;  2V1B A;  2CSO A;  1FCM A;  2DMQ A;  1MMR A;  3E6C C;  3HKZ A;  4ESP A;  1S29 A;  2J3T C;  2IA2 A;  5CHU A;  4MEZ A;  4GHI A;  4S2L A;  2RDP A;  1P92 A;  3DF8 A;  2Q9M A;  5D1U A;  4CXF A;  3OYH A;  2NVU B;  1P2F A;  2JA6 J;  4MN6 A;  1VI0 A;  2QHK A;  1O3R A;  4QPQ A;  3GWZ A;  3HBR A;  3E4P A;  5E18 F;  2M5W A;  2P6T A;  1F98 A;  1BSW A;  1LVK A;  2Q2E B;  2LY1 A;  3O86 A;  2X3B A;  3EDP A;  1LLB A;  3D5L A;  1OTB A;  2Z2S B;  5AIQ A;  4Q47 A;  4BY1 J;  4K0W A;  3N05 A;  4RB3 C;  3RZD J;  5CTM A;  1G8X A;  4CYC A;  1B4A A;  2G7H A;  2EA4 A;  4Z1W A;  1L2S A;  2X7M A;  4A3M J;  1XFQ A;  1W7P A;  1RR8 C;  1YSQ A;  4GYI A;  2PR5 A;  5FI7 A;  2GOX B;  2HQN A;  3PSI A;  5H6Q A;  3WS4 A;  4XRM A;  1ZKJ A;  2LY9 A;  4GR3 A;  3OCN A;  2HGV A;  5LRS A;  4ENK A;  2GXA A;  3ZGK A;  3K2N A;  5LRR A;  3TE8 A;  1B3D A;  4R0Q A;  3DPL C;  3C4P A;  3VYS B;  3L2Q A;  4HX3 A;  4Z6Y A;  2G9W A;  1ACF A;  4R23 A;  1MZB A;  2Y91 A;  3KLN A;  3NOP C;  3L2U A;  2HDD A;  1ZKG A;  2ERO A;  1KQ8 A;  2WV0 A;  2PHY A;  1YJW I;  1FBU A;  2A3U A;  4QKZ A;  3RTS A;  2HQ5 A;  5IP9 J;  3BEB A;  4UQI S;  5D7W A;  3QPH A;  1KYW A;  2IGK A;  4LJZ F;  3Q0V A;  4LG0 B;  5I0L A;  1YP1 A;  1FYL A;  4D60 A;  2VI6 A;  2DDY A;  2QQB A;  3MN2