3DTKA

Crystal structure of the irre protein, a central regulator of dna damage repair in deinococcaceae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
256
structure length
247
Chain Sequence
b'PTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALYALAERTAPPVIYAVCALSRAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRRE PROTEIN
publication title Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae
pubmed doi rcsb
source organism Deinococcus deserti
molecule tags Gene regulation
total genus 71
structure length 247
sequence length 256
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06114 Peptidase_M78 IrrE N-terminal-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1030 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dtkA02
3.30.450.130 Alpha Beta 2-Layer Sandwich Beta-Lactamase irre protein 3dtkA03
3.40.390.50 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dtkA01
3DTKA 3DTIA 3DTEA
chains in the Genus database with same CATH superfamily
1U2WA 4BBUA 5TISC 3H3UA 3H9WA 5A93A 4HP4A 3PQJA 2E1NA 2MZIA 2KDKA 3S8PA 2V1BA 2O61A 4QWOA 1SLMA 3WV3A 4R3BA 1LEAA 3B73A 3KCCA 1S9HA 3H5RA 4KIFA 2HR3A 1IEMA 1N78A 3TSGA 2H1KA 2OUMA 4UB8C 1SAUA 5F6FA 3VMAA 2Y6CA 2N8RA 1OCTC 5TRDA 1YQYA 1KGGA 3VP1A 3E4PA 1WFXA 3P9KA 3BWLA 2EFUA 3LQBA 4GOGA 3MQQA 3BG6A 2Z6DA 3BPVA 3J7YJ 3FXJA 3LUMA 4GB7A 2VT3A 3LSJA 4O6JA 4EJOA 2W13A 3T4KA 3JAMK 1D0XA 1H71P 3DBAA 5K7FA 1Q1VA 2DT6A 3A0RA 1SVMA 1XB4A 3M4OJ 5LRRA 2JUCA 4OAYA 3HRSA 1WPKA 2QKLB 3CCLI 3VOZA 5EM0A 3OYDA 5HX9A 3H0GJ 1AKLA 1KGFA 5G18A 3GYHX 4UXNA 2ZM8A 4KT5C 3TMOA 1D7EA 1TDLA 2W7NA 4CGZA 2E5ZA 1FPQA 3H82B 5IY5H 2E19A 5ILVA 2FJ1A 3LOCA 1L0GA 1ZKJA 2IS4A 1NRJA 4TV7A 4BQNA 4E4HA 5FEFA 4B09A 4CCKA 2R4GA 2XSJC 1UCRA 2ESHA 1U8RA 4MFEA 2MSYA 3J81Z 4PAUA 3CJNA 1HSTA 3CESA 1FT9A 3K2AA 2IA0A 4LG3A 2IGOA 4KG6A 3GFMA 4UUVA 5A2QZ 5HLTA 3PFIA 4JK1X 3FV7A 2LVSA 3QPSA 2Y2IA 1U5TA 4IF4A 1O0QA 3HY9A 5IT3A 3LJTA 1YJNI 2FD5A 4GR8A 2HKXA 1YS7A 4JPAA 1Z1DA 2K2NA 2VB6A 2HJ9C 3BZCA 4L5JA 4EVIA 4OP5A 4MN6A 3K6GA 5EGOB 4R0QA 4EEFG 1PFLA 1YFHA 2Y2NA 1MW7A 1QHGA 4GZBA 1XTAA 1G59A 1ETYA 3WU0A 1U78A 3QP2A 2JUGA 2MFZA 3B02A 2YB9A 2Y30A 4BXUA 4XBHA 4XMYA 2IPQX 2V1XA 1SEUA 2LY9A 2LY1A 4S05A 4G7ZF 3ZG0A 3FXRA 3HOXJ 5E2EA 1W0UA 4YNRA 1IADA 3R7WA 4D1QA 5B3SH 2IWCA 1ONVA 1IRXA 3IRQA 1Z9CA 2P5LC 2OCEA 5HAPA 2QVOA 4A3KJ 1EROA 5CX7A 2HPIA 2NNNA 4OVDA 4ENJA 3T0YA 1K56A 1MMPA 1D0YA 1W8QA 3RYPA 1GV5A 1ETXA 4R3AA 1MBFA 1BC8C 1RETA 1ORKA 2WAEA 1ONGA 5ILUA 3W2AA 1VQKI 2POJA 1GVJA 1NHAA 3CMYA 1LB2A 1W36C 3GWZA 4UVBA 1YM1A 3OL3A 5DDGA 4ZBEA 1XX2A 3MA2A 4R1HA 4ZYHA 4XRFA 1XCBA 4II7A 1EI5A 1NG7A 3DEEA 4XUZA 3WGIA 4QB8A 2GXGA 1LKXA 1SD7A 3C4PA 1HC8A 1A5JA 1FSYA 1A35A 1WE4A 2JKRI 2ZM0A 2H6CA 3CLOA 1ZH5A 4DW6A 5D6FA 3LA3A 4XLPF 4ESJA 1AOYA 4IJGA 4EWFA 1IO2A 3FM5A 4ETZA 2TRTA 3LWFA 3UKGA 4R70A 1HFCA 5F1RA 4WMCD 4HX3A 4RM3A 5DV5A 3S4XA 2LBFB 4I0AA 2I72A 5FB2A 5FI2A 2CYYA 1WI9A 2ZOIA 1RP5A 1ZN2A 1UHSA 1DP3A 1BBYA 2D2WA 1CI8A 2MH2A 3IH8A 1MZBA 3WTVC 3DTIA 4ZTKA 1E4DA 2QKPA 1O3TA 4QPQA 1TNSA 4XM7A 2XPUA 2VBYA 1RKTA 1H9TA 3NCKA 5AQBA 1EV7A 2Y55A 1Q2QA 3O64A 5IOYA 1ZTRA 1OT9A 3CCQI 4KA4A 4IEJA 4I02A 3D5RC 1IRFA 2PD7A 3J7ZI 1GSWA 1YRNB 3EUKL 1K57C 2FH5A 1FJLA 2HS5A 2VKSA 1NTCA 1CJFA 5DF9A 4GCVA 2IWDA 3HBRA 4MGRA 1H8YA 5LLQA 1MMGA 1I73A 1XJ3A 4ZJ2A 5I5LA 2CV0A 4S2IA 1L0FA 1PDNC 4WLAA 4WZ5A 4RX3A 2ZSIB 3BR1A 1DP9A 4PGGA 4GS9A 1FOKA 4HH3A 3RZOJ 3U1RA 1UG2A 4AIGA 3A02A 1EH7A 1BL0A 3JR9A 1YP1A 1JANA 1XFNA 4R8HA 4IRHA 3FWLA 3BYDA 3QOEA 1U9OA 5J8CA 3Q7VB 2XF5A 5D5UB 3DQVC 4IO9F 2L7KA 4QKZA 2BG1A 5GAHJ 4Y52J 5D5VB 4XOPA 1ZRDA 1ESIA 2DO7A 2LKPA 1NXYA 2V6CA 1S4RA 1XC5A 4C6YA 2HWVA 2R5YB 2V4BA 1OCRH 4HJ4A 3K4MA 3HYGA 3HKZA 2IGNA 2ADUA 1QQIA 1ZHFA 4IHYA 1WH5A 2P8TA 1XMXA 4XBFA 5FQMA 3NIAA 4MEXF 1JWZA 2J3TC 4L18B 1C3IA 3JW4A 1KQ8A 3M6BA 5D3OA 1E0EA 1AF0A 3P98A 2AIGP 3C5AA 2P0WA 3SYTA 2IRFG 4CHUA 2FNAA 2M5WA 2VT2A 2XGCA 1X58A 5GADJ 5F68A 4F3LB 5FD5A 5L3FA 4K0WA 3Q9SA 5BS6A 1R1JA 3IKVA 4XICA 1I1IP 1B59A 3BFDA 2M9HA 3GZNB 1JXSA 3V3SA 2HNHA 3NY4A 4HJ6A 1R5GA 2Z5UA 4NXEA 3H7WB 2WADA 2YSRA 1XGMA 3AGEA 4H6JA 2BTFP 3OBFA 3M2KA 2X71A 2LG4A 5L79A 4A5RA 4WF6A 3LQ0A 1OTAA 4D7MA 5H8XA 2A05A 1TWCJ 5EVLA 4JX5A 3IHBA 2ZMAA 4B44A 5EJCA 3DWKA 4U0WA 3IXHA 1YLTA 3B8ZA 2L02A 3TDUC 3P1VA 1WJEA 4K91A 3QYEA 1D06A 1YLWA 1WJDA 4HZFA 1Z6FA 5HWVA 1U3EM 1Z7LA 2LR8A 5EDNA 1TEMA 2LB5A 1DP7P 3M2JA 4CYCB 4M4XA 2DDYA 4BUPA 4ZAMA 2H0YA 2XB5A 3BQAA 5EGOA 1ZGWA 1G4KA 3BR2A 4OAZA 1XFWA 1V54H 1KVLA 4XRSG 3VFZA 3J7AY 1FMWA 3U21A 3HHGA 1Z6TA 3HPGA 2V9AA 2R78A 4IL6C 1CIZA 3K1NA 5K5RA 4BEHB 2MW8A 3WE2A 3OYGA 1JTDA 2GNXA 1XFUA 2HZTA 2XRLA 2QZ8A 4AFIA 1YLFA 4PSXA 4DGWB 5D5WB 2R7RA 1D3YA 1ZLJA 4IUWA 3KEJA 3OZHA 3UPNA 4IZZA 2VJ4A 4A5NA 3ULQB 5K5QA 3O8HA 1X1BA 4M6YA 3AL0C 2L0RA 1XJ4A 5KAFC 1TD5A 1FR6A 3HBVP 1UB9A 1DMTA 2V1NA 3EYIA 1ATLA 4JP4A 1BZSA 3T8RA 2A69F 4RA7A 2FZ0A 4CYDA 1RM8A 2HYGD 3I5UA 2FBIA 2H28A 3WG7H 2K27A 5F04A 2PDRA 1IN5A 4DDYA 3SZGA 4JGQA 1P92A 5HARA 5HDCA 1DJBA 3K70D 5HVQC 3WTWC 3COAC 4ZYGA 2UWXA 3QWLA 1YE9A 3LAJA 3BQZA 1S7EA 3DPEA 5LGNA 1VQ8I 1KE3A 1I50J 3ZQIA 3Q7ZA 4XSZF 3E4OA 2OAZA 4ZC3A 1FCMA 4P96A 3S3OA 5IP7J 3GZ5A 1ZGJA 5DF8A 3GDIA 4YRVA 1BR1A 2JZYA 4DBRA 1WVRA 1W63Q 4MDZA 1LSWA 2H09A 1P6RA 2LBFA 4PKQA 3AG4H 4B93A 4DJ2A 5DTDA 2OXZA 3BG5A 2INWA 3HEFA 5CRFA 4I01A 1A6QA 1D5VA 2HQRA 4HIAA 4EERA 4E70A 2PMZN 3F17A 3CC2I 2R5ZB 3C2WA 1SFXA 3RTRA 3G34A 5J1RA 1MMAA 3BCAA 4WUJA 1I5QA 2LOOA 3VDXA 1TQIA 1R36A 5GAEJ 2WA0A 1J09A 1F98A 4E7IA 3RJUA 4QHCA 5I3MA 3N4IA 4ZDXA 1MBGA 4IPAA 1YRNA 4DKIA 2W85A 1L3LA 1XAXA 4G9LA 5B1AH 1ZG6A 3G6EI 2CUJA 2A3UA 4G94A 2FEZA 4BQAA 4F55A 1K79A 4BBSJ 3PFYA 4Y33A 2M0MA 1JVJA 1HW1A 1BT5A 3ZGAB 2E36A 3SQNA 3PAEA 3I4MJ 3GFLA 2XGDA 5GLBA 2OWHA 3CUOA 1XFQA 5J40A 3TOAA 2AXTC 3HGGA 1I27A 3JSPA 5DUKA 1PWVA 3FC7A 2EZLA 5FFZA 5GL9A 4V2FA 3TKYA 3Q7VA 2V1AA 1TWGJ 1YI2I 3N4MA 2USNA 2Y2ZA 2STWA 3T4LA 1P4WA 4AIDA 3AGDA 4UA6A 4KQOA 3FPWA 4R38A 1FNNA 2W3HA 2R5YA 3M7GA 3PUFA 1ND1A 2P7JA 3LMMA 2X1CA 4YIFA 1PP8F 3B6AA 4I2OA 1AWIA 4AVZA 2J7VA 2OTJI 1G6NA 5DYMA 3UE1A 3JRCA 3BOQA 4KUKA 1YW9A 1ON2A 4R4RA 3F18A 3CUQC 2DJNA 2M87A 3ZQ5A 1PUFB 1O07A 1KU2A 2XRNA 1R54A 1Z21A 2Y2KA 4A0YA 3PO3J 2P5KA 2H10A 3UB6A 1J7KA 4LB6B 5I12A 2W1TB 1F9NA 4A2UA 2XEPA 5FAQA 1BKCA 5HD5A 4IVNA 2YUFA 2X6WA 2PQ8A 2FFYA 3OYEA 2DYRH 3IBJA 5E8IA 2EXBA 4RGRA 1IN7A 1MSFC 2W24A 2VQLA 3LR5A 5EE8A 3F1PB 1CEGA 4JLFA 1ERMA 3KP5A 3DP7A 4NDLA 5F1FA 5FASA 2LH9A 4BBVA 1MWSA 5A90A 2E7WA 1G5UA 4WBGA 3D1NI 5J1UA 3VOLA 2CO5A 4Y0OA 4WX9A 3H7WA 3AGFA 4U87A 1OMEA 5HDKA 1K6SA 2OW2A 4L0ZB 1LJ9A 4B3AA 1USNA 1LVKA 3NQOA 3DBRB 2DW4A 4CLCC 4JBAA 3V4GA 2JT1A 3HL9A 1Z91A 4RA2A 3REOA 3F72A 3KYLA 2JTVA 2R7TA 2JSDA 1QPMA 1JNUA 4HX4A 4KZ9A 2FSWA 2NS7A 4E3OA 4AC0A 1B3DA 3BTCA 3GV9A 5DJUA 3UN7A 3I53A 2CWEA 2JC7A 1T19A 1AKHB 4X0GA 2QWSA 1FOYA 3HRMA 3Q5FA 1YTYA 1QZZA 3RKWA 3ECHA 4Q48A 1TS0A 3HBLA 2DA1A 2EV0A 4AU7A 4XIDA 2QZ6A 1IF1A 3QU3A 4A0XA 3RFBA 3TE8A 3ZQCA 1RUNA 2PG4A 3T1SA 5FEGA 3GX4X 3FMRA 1DGWY 3DTMA 2WO8A 3ZMUA 3K4KA 3ZQGA 3EQUA 3A1YA 2AQFA 4ZYEA 3IWQA 3B42A 3RZDJ 1JKOC 5CQEA 4WMCA 3BW6A 3HSFA 3CF5F 2BHZA 2EIMH 4L9FA 3PBOA 1CQAA 1T6SA 3C4OA 4F7ZA 1JUPA 1MJBA 2KQRA 5C4XJ 3L00A 4MFDA 3TO9A 2ERPA 2Y59A 4PZJA 1X3WB 2RGVA 4Y17A 1P7JA 2MG4A 2CJJA 2OZRA 2RKHA 4A69C 3Q1FA 3NECA 2XGNA 1Z3JA 1S4BP 2PJRB 2TDXA 3ASNH 3NOTC 3VFFA 4K2EA 2FNPA 3JREA 4AM3A 1O4XA 1VQ9I 1FC3A 3DTKA 1F1ZA 2PN6A 2E35A 3KYCB 3M1CA 3CITA 3F6VA 3U1DA 2OZ6A 4BDZA 1UJ8A 1WH7A 3K7AJ 1VQPI 5E1XA 1R5ID 5CERA 3MSHA 2E5NA 2DT5A 3HLDA 2VGLM 5D1SA 5IPAA 3UDXA 2Z99A 1PWPA 1LVAA 4ESPA 5E3LA 3TO6A 1YLZA 2HDWA 4P6ZS 1BOBA 1CF0A 3ZG7B 3D0SA 1GLNA 3GVAA 1TTYA 1LEBA 4XCTA 1L2SA 5EEHA 4LFUA 2O9AA 4QD4A 3PHYA 5KSCA 1WHUA 4N9HA 1W4MA 1HW2A 4Y3IA 2G7UA 4YELA 1CEFA 3F6OA 3QPLA 1IYPA 2FUG2 3DF8A 4XM8A 1PWUA 1YPRA 4OONA 1WJ5A 4BXXJ 4I3AA 4NXGA 4EQIA 4JIJA 2EPFA 2QENA 2HOAA 2R5ZA 5K5OA 1IUFA 4I98B 3LIAA 1JKPC 1I6XA 1XFZA 1OJLA 3Q0VA 3SH9A 4L9EA 3ZCOA 1CQTA 2FV9A 3D4FA 2ACGA 2F5EA 5H2FC 1V55H 2XF3A 2NXNB 5AVFA 4EUVA 4Z9QA 5DM7F 5JHUA 4B4XA 3S17J 1XM5A 3ABMH 1OM6A 4NNJA 4E6KG 1PUEE 5FQIA 5BOTA 4O01A 1V5GA 4IRGA 3LILA 2WY7Q 1NZOA 3QNCA 5FSRA 4DYQA 1YX5A 2V2FF 4PKYA 4FISA 1JTYA 1QICA 4U0VA 1ACIA 2DOAA 5J3WA 4DZJA 1QJJA 3S7PA 1FBUA 1KU9A 3HRTA 1GE5A 2PFBA 1JIZA 3JRIA 4EESA 1SHVA 1STZA 2X85A 2W25A 1MY8A 2GM4A 3A3EA 1FP2A 1KUFA 2AVXA 1RGZA 4FQGA 1L0EA 1U60A 3LJGA 3GO5A 2HVRA 1SCWA 4XONA 2RAEA 3PNTA 3A3DA 1TT5B 2IA1A 1G9KA 4WKEA 2X6OA 3K3DA 3W4OA 1OMIA 3OOVA 4IHXA 2EWVA 4A6EA 4LV0A 4DN0A 3GTJJ 2FE3A 3C7VA 4ZRRA 4JA1A 3B2ZA 2JA6J 1HOVA 4KZ7A 1C7KA 2CKIA 2PYRA 3OSGA 4KITB 1PUFA 3CUEC 2WAFA 4JF4A 3E8RA 4PM7A 1SANA 2J9OA 2MLKA 3RPUA 3E2KA 2O9LA 3ZMZA 2QA4I 3DBLB 1ACFA 5EECA 3S7QA 3FXOA 2W1TA 1O3SA 5DFXA 3ZP5A 1D5JA 1ZLKA 1TWAJ 2VEAA 4HNVA 3K2ZA 4AUOA 3BTLA 5CVUA 1IDZA 1D8FA 4XUXA 2I47A 1ESUA 1FWZA 4X1EA 1FEXA 4A6DA 1X4OA 2YX4A 3F1PA 3PUBA 3LSPA 5E2FA 2HU9A 3IHUA 2OAP1 1JJ8C 3EUHC 2L4RA 4IVIA 4J19A 4LIVA 1HV5A 1TS6A 3UPOA 5I4OA 3BFGA 3BG7A 2R7ZJ 1VTNC 3E6DA 5FL3A 3RCOA 4HAMA 5CHMA 1XS9A 4RB3C 3MKLA 2GX5A 2MD0A 2COBA 5G4YA 3U1KA 2HPMA 4V19K 3MEXA 5EOOA 2K2GA 5EFWA 5A92A 5HSQA 4N0BA 2VJIA 4MLLA 4HY8A 4A3EJ 1ZC2A 1IZ1A 4DYRA 1VQ7I 1JUSA 1TW2A 2KJBA 1W79A 2I9VA 5KVRA 1EUBA 2RDPA 1Q3AA 2TCTA 4EFSA 2WKRA 4PKYG 3SS5A 4HNUA 1S0WA 1QNTA 4C9YA 5FDSA 4EQQA 2LTPA 1MBLA 1AKHA 5F0FA 2FFFB 3J80K 5AJGA 5M1AA 3BR5A 1K7AA 1X3UA 2ZFUA 4UV8A 4IXAA 4ZR5A 4IKFA 1A31A 1MPLA 3EOIA 4OLDA 3E5QA 1OM8A 4F52A 2DW1A 1OKRA 3I71A 4PKSA 3GECA 1WJFA 1SFUA 1VNDA 1MBJA 3JVVA 1VQNI 3E6CC 4HH2A 3QODA 5DTTA 1GXDA 5I2ZA 2BYVE 4A7BA 4LLOB 1WNIA 4JP0A 1PYYA 2XD1A 3BFEA 1HKTA 2WAQA 4MBFA 1Y4OA 3L7HA 3MZDA 3UB9A 2DW0A 2IGMA 2DFHA 4CCNA 4EEUA 4PKUA 1MBKA 1LFPA 2JKTM 3IQAA 1W5TA 3OYAA 4A93J 1MMBA 3T12B 1WGXA 1NY0A 5D8LB 2L54A 4F3QA 5JVTA 2PJRA 1IV6A 1TL8A 4XLHA 4QWQA 4EATA 3HDAP 5FDHA 3BQ8A 2M45A 3LQQA 3KO6A 2WC2A 3CMMA 3SZTA 2IBDA 2YX7A 3P9CA 3X2QH 3EUAA 5CEBA 2OW9A 2ELJA 3QP5A 2H6BA 2JA5J 1E3UA 3S16J 2L9SA 1IRZA 1D1JA 3J80Z 1F5TA 1Y1VJ 4RAFA 4BAYA 2V9KA 2IAIA 3V50A 1E3PA 3PSFA 3CP8A 1YW8A 4DE1A 3OR2C 4KZ6A 3Q3SA 1ETWA 2EWWA 2RQQA 3GTGJ 3GTPJ 2Z2SB 2IGKA 1HOMA 4EW7A 4JF5A 4BU2A 4DBQA 1IG7A 1BM9A 4UHTA 4CSWA 5K5BA 3FPVA 1KQ9A 3A0BC 2JHEA 5CLSA 4ARZB 3I4PA 2JK3A 2IS1A 4P85A 4NG2A 4RLQA 3HGYA 1F43A 3N8RA 4BGDA 2ZC6B 4IN9A 2E60A 2DK5A 1HA8A 3FHNA 2J3TD 2Q9MA 3CCEI 1XSDA 1R5HA 2PLYA 1SD6A 3HOUJ 1QIBA 3WS0A 1MWRA 4M3KA 3AG1H 4X69A 4Q0JA 5FAPA 5D1TA 5HODA 3OPRA 1XFYA 1LDJA 1TF1A 5KAIC 3TO7A 5F1GA 1J75A 4WL9A 3IX8A 4PFOA 4I5SA 2ZXIA 4EJWA 2O7OA 2HDDA 1MMRA 1G8XA 4QY5A 5AQAA 3MXQA 4UUSA 1ODVA 5JVGF 2XGXA 1D8MA 2R7DA 2PJTA 5C4JJ 5HAIA 3IX3A 3ZQHA 5E79C 1K7QA 3BC8A 5JYOA 1IV8A 3OCLA 1R71A 4H4KC 2XFSA 2BGCA 2ID6A 4KMFA 4HV6A 3AYUA 3VODA 4DZPA 1OTBA 1IN8A 3H5AA 3DL1A 2QLZA 4FX4A 3K3CA 4G6QA 2X48A 2M4GA 4UA9A 4HEA2 2M7AA 1O0TA 3IL2A 2KMUA 1K7GA 5K7HA 1JTXA 2QJ5A 1H88C 3LGPA 1KAPP 1R9TJ 3K69A 1K6OA 3W6KB 4GO1A 1T95A 1WYCA 4KZ4A 2OSUA 1OCZH 2HGCA 4P9FA 3ASOH 3QOPA 4L5IA 4RAGA 4CUGA 3D5LA 1MJ9A 3DKXA 3RQIA 4HF0A 3KHIA 3LEZA 4KUOA 1TVIA 1E2XA 4RAYA 3S2WA 2D1NA 4KUMA 2UXNA 5IT9K 4X55A 3SS4A 3LUNA 3VOYA 4E7KA 2F6CA 1OCOH 2LY2A 3VSLA 3N7WA 2XSDC 2J80A 2EA2A 2NVUB 5ICGA 2LC2A 3CG5A 2K5CA 3CI6A 4OPZA 4B47A 4ZH4F 3IUOA 2YPRA 4FSFA 4FX0A 4B88A 1XN7A 1G3SA 4PKTA 3R61A 1BJAA 2D1VA 5J3LA 2Y6DA 3OMYA 1KYZA 1WJCA 4M3BA 2NVQJ 1J9MA 4L7AA 3WTZA 2A6HF 1YLYA 4KIBA 1SD4A 3PBTA 1U6GA 3MXRA 3OL4A 2V20A 1K55A 2BY3A 2FV5A 3HUMA 5IT5A 4CLCE 4FH4A 2X0LA 2WO9A 3CCMI 2H8RA 3KMEA 4BHCA 1NK3P 4CCOA 3LICA 2EA9A 5TR7A 5EUAA 2R7UA 3F21A 3C2BA 1J59A 4UA7A 4YFKF 2E34A 3JPUA 3Q82A 3RIRA 2NS8A 4I3JA 4HQMA 5CECA 4OIRF 2XFTA 4LV1A 3LSMA 1D1BA 3H92A 1VFCA 5LRSA 4HX8A 3DPLC 3E1SA 1ZR4A 4X6AJ 2HYJA 4E6WA 2Q2EB 3H35A 3MWMA 2GDNA 5EVIB 2XIGA 3LJZA 3ZHHA 5ILSA 2LB9A 1C0WA 1TQPA 3EPZA 5IT9Z 3KEYA 3ZXHA 3LSRA 4FTXA 4ASNA 2M8EA 3G6OA 3PBSA 4M3FA 4EV4A 3R6SA 1FZPB 4KFCA 1XJ2A 3F8MA 1IABA 1RGYA 3JRFA 4BY7J 3ABUA 5DTKA 3RH8B 2QYOA 5TJJA 4HPQA 1JGSA 3RPQA 3ZXSA 1XD7A 1ZELA 2W3DA 4U0XA 3JRBA 2V1UA 1BI2A 4PJMA 3LFVA 4FXQA 2R7XA 4F91B 1QJIA 5B5EC 4O3MA 3WS4A 5MC7A 3BY8A 2G2UA 1S29A 2KZGA 2P74A 2ACJA 1OMJA 3E0YA 1I1GA 2VJWA 1LE8B 3HB9A 2CUZA 3W2VA 1JWVA 4IUHA 1XDSA 2STTA 2L9RA 4I09A 3QHYA 2DK8A 4CH7A 2I8DA 1W7FA 3KYEA 3DTEA 4RVAA 2RNJA 4BBRJ 3D3OA 4JKTA 1XMAA 3ZVWA 3RKQA 2C6YA 2YU3A 4LK1F 4M9XA 3W2ZA 2Y0SN 5DCFA 4XKCA 5B1BH 2CMNA 1B9NA 2P5VA 3ZYTA 1MWTA 3GR2A 2P6TA 3RYRA 5GLCA 5M3FJ 3U4LP 4GF1A 3C1DA 4FU4A 4K0XA 4WEJA 3MKWB 3MS6A 2HDQA 3TQNA 2XF6A 4HNBA 3KSGA 3SOIA 2HFHA 4X25A 4UB6C 2V1ZA 1ZTUA 4Y0TA 4KJZA 3FK7A 2HI3A 5E20A 4R4SA 1USSA 4OLGA 2PR6A 1BZAA 5LBRA 2HQAA 2B02A 3TG9A 2GOXB 1VETA 3G31A 4PHTA 4U88A 4F94A 3F15A 2PR5A 1RRJA 3RTYA 1K78B 3D9YA 1APLC 3A3FA 5D5XB 4YFMA 2X02A 4KQRA 2R0QC 1ROSA 2CRGA 2K31A 1ZHHB 1GVDA 3CJMA 4BJ5C 2M2EA 3BLYA 1IKIA 4ARZA 3KETA 1R4MB 4K08A 4L9TA 4KYWA 1POGA 1TWFJ 1SVLA 3RSNA 4C2MJ 4EJVA 2Q9NA 5L09A 3MN2A 2EFOA 1UHWA 1XPBA 2DBBA 2JRMA 4LGWA 2LREA 1P2FA 1B9MA 3DLAA 3EDGA 2HKOA 2HJEA 2EFXA 2VL8A 4M3GA 2P81A 1OM7A 5HWTA 2WOAA 2OI0A 3UB8A 3M1EA 4ZTJA 1YW7A 1I76A 4CZCA 2NAZA 3FHZA 1XA7A 1ZAOA 1ASTA 2WKHA 3HOZJ 1G12A 2NVTJ 1NRFA 3ICYA 3KLOA 2JA7J 2WZXA 4H1QA 1VQOI 2PRFA 1FBQA 2DMNA 3WTSC 3TGNA 2FU4A 4PJ0C 2L7FP 3EWJA 4MQVA 3DWZA 2K9SA 3HUOA 4HEFA 4GXOA 3G32A 2VBXA 5FGMA 3MFDA 3JTHA 1TDGA 5EM1A 1FBSA 1BSGA 1K54C 2F2EA 4ZDPA 2QQAA 5FI7A 3IS2B 1HVBA 3OPLA 2VXDA 2HYFA 3WU2C 2HZ5A 5F08A 3AL0B 2L9NA 1VB6A 4KT6A 1GCEA 5K1YA 3IAS2 1UELB 2DI3A 4PKWA 4BMWA 4HDVA 2QYBA 2L01A 4B48A 3EDZA 4J00A 2OY4A 3VI1A 2LSOA 3L2RA 1KGEA 4I38A 3ZVTA 5F27A 1BR4A 1N9LA 1TP4A 4H49A 4BDYA 3HDDA 4KICA 4OQIA 3NAUA 2JA2A 1OPXA 1ZG5A 1T38A 1JE8A 5AQ9A 2A49A 2E1CA 1YIJI 2OF7A 5DD8A 1ZVXA 1QHHD 4M3DA 4JXWA 3RXWA 2ZLYA 3GFJA 3IKTA 3CZDA 5JLWA 2MJ6A 2TCLA 4BH9A 1Z3YA 1AYKA 2JRTA 3L1PA 3LO7A 1W63M 3KP3A 3Q0WA 4UVCA 2DFIA 5TBMA 1ETKA 4E7JA 2PBIA 2F5FA 3N2UA 3HTSB 4XN0A 4H2EA 2DDAA 2L7MP 2BLSA 1EKEA 2HQNA 1TC3C 4G7HF 2CH0A 4CQHA 1ODDA 1XKZA 5FLXK 4GRIA 5FRMA 2N8GA 1W7PD 4ME4A 4GLQA 2CFOA 3HOWJ 4C2UA 1K25A 5J1YA 4XXRA 3TL4X 4MEZA 1HD8A 2VV8A 1V4RA 2C6WB 2IEKA 966CA 3TW6A 2M4KA 5DCMB 1Q2PA 4R23A 4D9JA 4MN5A 4AWXB 2DMUA 2GA2A 2K7LA 2GOMA 2Q2EA 3DV8A 4WM9A 2Y48A 1P7IA 4C3JJ 4B8XA 1Y8QB 3WRTA 1ES4A 2XV4S 4X53A 4IBRA 3QP1A 3NEUA 4GS9B 2A6EF 2ZQ8A 4X68A 2VQHA 1Y56A 3DPUA 3IF6C 1GKCA 2K4JA 3MKEA 2FMLA 1VZ0A 2E8JA 5GTIC 2HGVA 3O5YA 1OQYA 3MFXA 1P9RA 2L5QA 1USTA 4U0TA 5L10A 4DMZA 3OWTA 5FKNA 1Z6RA 1C8TA 3PO2J 1RIOH 3LSHA 4BWIA 2PU4A 2WKEA 3ERED 1BI0A 3BFCA 1JWPA 5HW3A 3K4BA 2B7EA 1K6YA 2M0CA 1D8JA 4LLNA 2D01A 1SMTA 2VODA 4G6TB 2OOLA 4LRXC 4A0ZA 4DJAA 1OISA 4V2GA 3ECOA 1OYIA 1XG1A 1H0MA 4B4CA 2E1MB 4II3A 5FLXZ 2ID3A 5D8KB 4D5FA 3G73A 1G4DA 2GQQA 1R1TA 4KNYA 1LE8A 1OJGA 2ZO4A 1CXVA 4Y15A 2KDOA 1A0KA 1GKDA 3A0HC 2YKFA 1ENHA 4E3MA 1LNWA 5D7WA 4CA0A 3V42A 3OOPA 3CUQB 5CGWA 1BW5A 3LIDA 3E2LA 2KRCA 3LCEA 2H27A 3CMZA 2RN7A 1FYMA 5J6XA 1MNDA 4EQ1A 1Z7UA 2DRWA 3IHAA 2BW3A 3FG8A 3RQ4A 4XNFA 3SDBA 4RDUA 4HSTA 1R23A 1KBCA 1REPC 4G8XA 3GQZA 3OYLA 3WU1B 3TRCA 5KHDA 5F64A 2Z16A 1IELA 3SS3A 4H6JB 5CTMA 1IXCA 4IBXA 3KP2A 2XF7A 3E5XA 4HMAA 1JT0A 4AXQA 2GA1A 3S1RJ 2W14A 1K78A 3KSIA 1OT6A 2G2WA 2WKIA 1YT4A 1UEAA 3O3KA 2KIFA 3HSEA 1AU7A 4XLNF 3OPPA 1R1VA 5GHZA 4CLCB 1DRMA 1YYVA 2M3AA 3AIGA 4P9UA 4BBTA 3DFGA 4BS9A 4YINA 3F8FA 1FOWA 1YS6A 3L2WA 2JN6A 3A2KA 1NLZA 2BV6A 4UNOA 4MHGA 3L2QA 1KU3A 1XCVA 1UG0A 1GE7A 5ERIA 5EOEA 3UNGC 3DKYA 4AYKA 3LIEA 1TS8A 3FK6A 2DU9A 3JAMZ 5J4VA 3E7LA 1PNEA 3HB2P 5JLXA 2ZC3B 3QPTA 4IHTA 4KIGA 2EZIA 2XAUA 4OQ0A 1N9OA 3BM6A 1V9YA 4LENA 2L0KA 2DTZA 3BP8A 3CKIA 4B3XA 5CJ9A 2CGPA 2DA5A 3S32A 2VONA 4ENMA 1JTGA 1N77A 5F5YA 1JHFA 3ELKA 1Y1WJ 3ZG8B 1L0OC 1D1CA 2O3EA 1AWCA 5IP6A 4ZTFA 3HG9A 2EWNA 2VX8A 1H8AC 1FLSA 3ZQFA 1WZ2A 2VKEA 4BD1A 2EV5A 3IC7A 1MMSA 3G35A 1NJ4A 1DQUA 1G3WA 3HPHA 2DLLA 5BNGA 3IS2A 1W7PB 2VI6A 3MZYA 3RTSA 3EWKA 1OCPA 1I2SA 1XGNA 3W8KA 1BKCI 2Q1ZB 4A3LJ 3KLNA 3BG3A 2XB0X 4I76A 5FQKA 4UHUA 3CP2A 3T4OA 5L2FA 2KKOA 3HTUA 5KK1A 3EGDC 1ONHA 4EGZA 3PIOF 1ZP5A 1S1YA 1MWUA 1U0JA 2QCOA 1FYLA 4UEYA 4UVAA 1UGUA 2XA7S 4A3CJ 4GDBA 2R7OA 2NOJB 3ZPLA 5FKMA 1DU0A 1OTDA 2IT0A 3NHQA 2Y9ZA 2L0WA 3VP4A 3MR0A 5C44J 2ME0A 5KSHA 5E1ZB 3UPPA 5FFXA 3I54A 3ZG9B 4HESA 4FHTA 2Y2QA 4IEDA 1QMFA 4HJ3A 2Q8KA 3NWSA 2IVMA 2V26A 1SKFA 3PL8A 4CPKA 4GD8A 2Z9OA 2XDVA 5GLDA 5CVRA 4BLMA 5KMWA 3S3NA 2QQBA 1J7NA 3DBHB 2O03A 1B72A 2CLTA 4WK7A 1IAGA 2OU2A 1Y28A 4UV9A 4L63A 2AO9A 1WSUA 3LK8A 4CCLA 3C2HA 5DF7A 1KA8A 3W2WA 3H9QA 1FSWA 1RI7A 5BPDA 4GW9A 5DCMA 1JIWP 3IWOA 1LLBA 2IW5A 1S6LA 2O9BA 4WXHA 4MTEA 2R3SA 1Z3XA 1VI0A 4RBOA 3UDIA 3I58A 2ISYA 4IJAA 3JRDA 2J3WA 1MDMB 4FT8A 2DJIA 2VZWA 4EBNA 3OYJA 1ZRCA 1FIAA 1KDWA 3ZCZA 3I9V2 4BE0A 4Y5FA 4ID4A 2WK0A 5CHUA 1F36A 1OLTA 3AG3H 2ZXWH 1J2XA 4XRSA 3FZVA 3BFFA 2OW0A 2K9LA 2P04A 2R9XA 2X1DA 3SFIA 3O6BB 2PJPA 4HG2A 3ZMSA 3H1CA 3CCSI 5K7ZA 3ZDJA 1FCNA 3T4SA 2XAQA 3F1NB 3GEZA 1BSWA 3A0SA 1YKDA 3F16A 1Z05A 3HKZN 1B4AA 3TOIA 2MBFA 1NK2P 3KWVC 4L5EA 4YEJA 5L7FA 2CQQA 3HOSA 5DS9A 5G4ZA 2M1BA 1SC7A 1DJCA 2JPCA 2UV0E 2Y2LA 3CJTB 5IU1A 1Y39A 1WCMJ 2KRJA 1QGPA 2CQ7A 4E3JA 1ULYA 1OR7C 4WZVA 2MA3A 1HW5A 3DW0A 4LG0B 2K9CA 1SD5A 3BJAA 3CUQA 2MZEA 2CQKA 1MC0A 4BYYA 2EIKH 3V8KA 3I64A 3LA7A 2OAQ1 2F5VA 4LPZA 1QZYA 4X1MA 1PWGA 4FOFA 1OO9A 1RKWA 2CV2A 3A01B 1SMPA 2AQEA 5KIZA 3FXMA 2JKGA 4BNCA 1K61A 2XKOA 5FLVA 1R7JA 1D7XA 3KP4A 2LYCA 3F0CA 2D02A 5FQ9A 1JKYA 2JWTA 3GTCA 1IXSB 3HREA 3O88A 1C3BA 4NXBA 4GJ4A 1R22A 2LLKA 1YJ9I 3A03A 1FSHA 1M1EB 1TBXA 3M9AA 3VP3A 1NLYA 3T5XA 1G68A 2VV7A 1GE6A 3TW7A 4EM0B 2O99A 3L09A 1R00A 1YLPA 2UWMA 4G0DA 2VOOA 4Q47A 2XS4A 1QBJA 4CLCA 3I7JA 4HF2A 3C38A 3LE9A 4QY6A 3GW2A 3FKIJ 3FM3A 2YS9A 4IHSA 3ZFZA 1D0ZA 2L7ZA 2O5RA 4OIQF 3FIWA 3DU6A 3OHLA 4AYBA 2CQXA 4UQIM 1QVTA 1WYBA 2KL4A 4FASD 1JAOA 3B47A 3D5SC 3LSKA 2A3SA 830CA 4EM2A 4HV5A 2ECBA 4II2A 3VE3A 3HOYJ 2QSGX 3CCRI 3ROUA 4ON1A 2JT6A 2QGUA 2J5OA 1VHMA 1ETQA 4C30A 2CU7A 3QYBA 2GAUA 5FKOA 3CCVI 1Z09A 4WYYA 4HNTA 2PT7A 2X4HA 1HLVA 5CTNA 4IQ4A 4I3IA 2BY2A 4EJUA 2V8CA 3SH7A 4PUSA 1OPCA 5CKTA 4I03A 4XN3A 4GWMA 2EZHA 3GLXA 5GHXA 5DM6F 2ZNYA 3L2VA 3PAGA 4L9JA 5ED4A 4QJGA 2QSFX 2DT7B 2CW7A 1O3QA 2JSCA 2E2HJ 4GUYA 4CO8A 1RCJA 4RB1A 1DPRA 1IYSA 5B5PA 1MNMC 4ZJ3A 1CAQA 2MLRA 3UE0A 3G71I 2RNGA 2DYSH 1IN6A 1T0FA 3EEHA 1W7PA 1T39A 2F4MB 3E6BA 4BENA 2VN2A 2B95A 2ZSHB 2VKDA 3KYQA 3GUDA 1EW0A 2W57A 1ZR2A 4JX4A 2LFBA 5E3MA 3L2CA 1WRJA 2H0TA 2DOEA 2HPBA 1V5FA 4GQLA 4S2NC 5HFOA 6PAXA 2V4JC 3LSGA 1SLNA 2WB1A 1UHMA 2O36A 3T4TA 2KLOA 2Q0OA 3G4SI 3M3YJ 3WTXC 2WTEA 3H5NA 1GHIA 3KSFA 2BZTA 2ZQ7A 3PQKA 1CF7B 4XK4A 1D5YA 3NDEA 4I99C 2DFEA 3G2ZA 2PHYA 4BL2A 2Y9YA 4RLFA 1SDEA 3SW1A 2X6YA 2KOIA 2R93J 4H30A 3I4NJ 3BRMA 2BASA 2LDUA 4Y3OA 1GSXA 4U3TA 1A6IA 4YFNF 5CEDA 1MBHA 2F4IA 1PJRA 3ZQLA 3EHYA 3GFIA 3OIQA 4PKVA 2XQZA 4OH0A 1N25A 2BEOA 1ZTQA 3BTJA 1LFUP 2MLSA 2Z2MB 1X2NA 4Q0HA 3OS0A 5HS7A 2MD5A 2DQRA 2DMWA 1ZS0A 4KDPA 1R58A 1QUAA 4NC8A 3T1RA 1I3QJ 1O7EA 1MKIA 3KP7A 1FP1D 3G5CA 3A4CA 4JQGA 1MDMA 1PI5A 3VFHA 1HCRA 1EJ9A 2ZJ9A 4R6LA 2OA4A 2A2LA 3WGHA 3SJMA 3BCBA 4I7HA 4JOMA 1CGLA 2XH9A 4BHPA 1LSVA 3CPTB 3ISGA 2GXAA 2VGLS 5JHFA 1MBEA 3MD2A 3V96B 1MJAA 1X2MA 3KECA 1K4SA 3BPXA 4E3NA 4WCGA 3ABTA 1HF0A 2WGWA 1XA1A 2QQ8A 4NHJA 1CQRA 2EILH 1DU6A 1RPWA 4IOCF 2VXZA 4BQQA 3V7RA 5ICCA 2XPVA 1L0DA 1XSVA 4GDFA 4N4NB 1XFVA 2HTSA 5L8MA 2KZVA 3P09A 2GIZA 3F1NA 1BR2A 3A3JA 5JR3A 2R7QA 3MZ8A 1X19A 4S2PA 5L3GA 3KP6A 4HBTA 1ES3A 1ZARA 4MQ9F 1HDPA 2JKTI 2HTJA 2ZC2A 3KE2A 2MC4A 2AYKA 1CI9A 4E7ZA 4MTDA 3K7NA 3ZGKA 4HQAA 5F0HA 1A85A 4PM9A 2ME6A 4R3JA 1ETVA 1W5CC 3J81K 1GHMA 3IF5A 1TZLA 4LG0A 3M6HA 1JAPA 2OCCH 1SFEA 3WE3A 3JYIA 1BJZA 2ZMFA 4C2TA 1LQ1A 3N2VA 3P01A 1HBXG 4FUWA 3G2YA 1W0TA 1RESA 3CUEA 5A2QK 2ZXHA 3LFUA 1JKQC 2BOLA 3K4JA 4N92A 4E7HA 2FBKA 5LGTA 4WXDA 5EPHA 2ZMVA 3A01A 3NJAA 1PVEA 1QU3A 4P5OA 1UWNX 3VSKA 1S6RA 3WG9A 3T8TA 2FQ3A 3CO7C 1HQCA 5LHIA 3VYTB 3EUHA 3IX4A 3DXJF 5EYRA 1PW1A 1CGEA 2OQRA 3EHXA 2ZMEB 1IAEA 2MLGA 3E4QA 4HX7A 2A5WA 1YJWI 3CDHA 2Z2DA 4BKXA 2VKHA 4DNCA 4YIRX 2BHYA 4Z1WA 3CCJI 2W12A 2P7VB 2G0EA 3VEPA 5EZGA 4CCMA 1VQLI 2KPMA 2HOTA 1EB6A 3IH4A 2PMUA 1OS2A 3JCUC 4DYCA 2XK1A 4LRZE 1FYKA 4XT2B 1ES5A 1NYYA 2OBPA 1G3YA 2OTLI 1BIAA 2WWYA 2VC0A 5LGUA 3LL7A 3CC7I 4W1UA 2MABA 2DXIA 4HSRA 3E3VA 4A3GJ 1XPXA 4EUZA 3LNQA 3ZMTA 1XMKA 2J5PA 3SHIA 3OHOA 3F3XA 3LR0A 2A6TA 3OSFA 3BTIA 1TVFA 1LFBA 2ZXJA 3GF2A 2QF7A 2D1OA 3ISPA 5HL1A 4XR6A 5E2HA 3KSHA 5HLIA 1SAXA 2X3AA 2HF6A 4GDNA 2K9MA 3BZKA 3GTQJ 3FYZA 4MBKA 3M8FA 1IAWA 4A3JJ 5BOYA 3RKXA 2V8FA 1J3WA 4A3FJ 3BY9A 5FQJA 2RJQA 2RV8A 4BE2A 3FF5A 2QMIA 3HLEA 3HOTA 1GXPA 4E3IA 3TJZC 5KZHA 1XGSA 3NI9A 2X01A 4S0HB 2QPJA 3Q2HA 3VWBA 1IDYA 4PJLA 3H3VK 2HU6A 4A12A 2UXXA 4ANJA 4HP9A 2XAFA 2ZJRF 3FDYA 4WXCA 4M9SA 5F82A 3H0DA 3BY6A 4HHDA 1XUCA 1RNLA 3BR6A 1N75A 4LITA 2PU2A 1IKGA 3V3RA 3IH3A 3OLOA 3EYYA 2H5SA 2VV6A 4KMUX 3S22A 1V9ZA 4R79A 1F9IA 3QRFF 5CXAA 1FCOA 3IBRA 2L2OA 1CK3A 3BT9A 4L9VA 3HUGA 5IYCJ 4KZ3A 4EETB 1BIWA 3S14J 2EX8A 3NBLA 1OJ5A 1CF7A 2XS3A 2KDZA 4ENKA 1XX5A 3SHFA 5GLAA 2LKXA 2OW1A 2D45A 1S3JA 4ETSA 2HP6A 1FSEA 4LD5A 4DXBA 1IW7F 2CC1A 3PNVA 3L9KA 2XC7A 1KQ0A 4JGPA 2YR2A 4OPQA 456CA 3K4NA 2VUMJ 2ZJQF 2K3FA 2R7FA 3DAVA 5DJTA 1R1HA 5L3DA 1O57A 3S1MJ 3T4JA 3E6MA 2WV0A 3HZJA 2JMWA 3GXOA 3HJEA 4A3IJ 1UTTA 2E3XA 1DY6A 5FAOA 2O8KA 3RI4A 4UUSB 2PD8A 1TNTA 1IACA 4R1GA 1J9IA 3UDFA 3LFKA 3ZRGA 3CJRB 3KYDB 3PIPF 3I59A 4WELA 2K9NA 1X1AA 2FA5A 4LOCA 1JKRC 4JXGA 3G2BA 4EU0A 4LV2A 5AVEA 1YCMA 1FIKA 1O7FA 2VKVA 3CPTA 3BA0A 2Z2LB 4BJTA 3SZPA 2XD5A 4M6XA 2ESNA 2VLGA 1ZXCA 4MN7A 3CWFA 1FOFA 3S7OA 1GA9A 5EVIC 4AD9A 1LT0A 4G3KA 1MGTA 4DJ3A 4YFXF 5HLHA 4YIIA 2OV7A 1MH3A 4D2OA 1E25A 1YIOA 3SEQA 4OPRA 1R6RA 3C2GA 3R0JA 1FIPA 2IS2A 3VV4A 3IWIA 2Z6CA 3HY7A 4UAAA 2GZWA 3MFKA 2W82A 3WTYC 2ZB9A 3ZOBA 4GHIA 4Q1LA 1JHHA 2XAHA 2XVCA 4DE2A 4BACA 3TVCA 4HI4A 1W5DA 5HNFA 2LF8A 2OC6A 4XLEA 3IWFA 3V39A 4HW0A 3JRAA 2PBYA 2ETHA 5LFAA 3LAPA 3OIOA 2JIHA 3GMWA 2LD5A 1GUUA 2CQNA 2DQLA 1OTIA 1MNEA 4OOMA 2P6SA 3NOUC 2QBYB 4Q5SF 4KG2A 1DTHA 1DP6A 1KYWA 3WHCA 4N1XA 2Y79A 3L2UA 1YQSA 4S2MA 1IRGA 5EV0A 2RVCA 4YWZA 3HDBA 2M8GX 4JF6A 2F5DA 2Y8HA 1ZK8A 2Y75A 4O0PA 2ZMEA 4C3IJ 4WF0A 5FD6A 5D3CA 5IS1A 3MZHA 4AIHA 2ZJPF 1BM6A 2MYSA 3ML6A 3C30A 4WN5A 4KG5A 4XSXF 3EDPA 3FWEA 1K0KA 3RJPA 2HP5A 2HVQA 5HOOA 5FI6A 2OPTA 4I0BA 5CQGA 2WUQA 5E1WA 4Y2FA 1MXOA 2A8HA 4QSHA 1I5ZA 4GWNA 4JXSA 1PZOA 5CXWA 5DTSA 4KN7X 3V7SA 1R55A 3OPHA 4FTHA 1L6JA 3H82A 4EBPA 4XT2A 3RXXA 1JK3A 4EBLA 3N97A 1IJWC 2VIXA 1BUEA 4RX2A 2FOKA 2ISZA 2DDBA 4AIJA 2Y2PA 4GKUA 1U5TC 2JCHA 4PDKA 5FATA 1KUHA 2V9PA 3HUNA 4EJTA 3LIKA 1HLUP 3IF6B 4MLOA 2HV1A 1G49A 2HZDA 4NC6A 2OQGA 2MZHA 3L0TA 1ZG3A 3RPUD 4JPMA 3E98A 2WAQN 3DEWA 3E5UA 5CYVA 2UZKA 5M3MJ 2Z1DA 3W6VA 1IXRC 2QUFA 4WKIA 5HPIA 4LCMA 1JT6A 2COMA 5GTHC 3GMEA 2OXUA 3WHBA 2OXWA 5C3EJ 4CZZA 3VP2A 2ZBKA 4KQQA 3Q9VA 2JPBA 4FH2A 3G3ZA 1WI3A 1XGIA 2H94A 2XA7M 2EB7A 3HVFA 2NOGA 2BVMA 2YKHA 1QO0D 3CCYA 3S1NJ 1HY7A 2CMPA 1XSXA 3S1QJ 3A3IA 1WA9A 3PBNA 4X1LA 4E6XA 2CUEA 1S5LC 2EV6A 2ZKZA 5M5XJ 3TDZC 1B8IB 3T1BA 3MQOA 4IOAF 1BLPA 1UWPX 2DMTA 3PXPA 4G6DA 1K6RA 1EAKA 2K7SA 1P4XA 2BY0A 3B33A 3KFWX 5LHHA 3L9FA 2M1CA 2NYXA 1EH6A 2DPUA 5A91A 3UB5P 1HXDA 1ITYA 4HBUA 1OS9A 3DWLE 3MVPA 1H8MA 5M19A 3GTKJ 1YG2A 3TP0A 3MMYB 4EEPA 4GYIA 3MKFA 1VETB 3ESWB 1EA3A 1FQGA 4GR0A 3BECA 2QWWA 1BYWA 1ZG4A 2OWJA 4G12A 1KZHA 3JTGA 3EDHA 3F1OB 4XL9A 3PBQA 2X9DA 2K9QA 4IX7A 2K85A 3LI8A 2KT0A 5HPFA 1QMEA 4KZBA 1T1AA 1BOAA 2Z3YA 3B3XA 5CGSA 1S4SA 4DXCA 5EEAA 2NVYJ 4MCWA 3R4KA 3CJQB 1O3RA 2IWBA 2KISA 4GD6A 1KE0A 2EROA 3T4QA 1MNCA 3F1AA 3W4QA 4OINF 4QIWN 5IYDJ 3UNWA 1SU3A 3F8NA 3UMEA 3B6CA 2E8IA 2HOEA 2IJLA 4BD0A 1MSEC 2JQ7A 4HF1A 5LHGA 2EFWA 2X3BA 1BN5A 2Y0MA 3DSLA 3QP4A 3OY9A 2L1MA 3BR3A 3MKZA 4LCLA 4OOIA 1GHPA 4DOZA 3BQYA 2XAGA 5JFRA 2HDSA 3WGGA 4XM6A 1KUKA 1ETOA 4RB2C 5F0CA 3TOBA 3W6JB 1AXBA 2ZCWA 4BE1A 2EFNA 2EJRA 1SKOB 1P9QC 2PMHA 2ZQAA 1SATA 2YIGA 2ZC7A 4N4OB 2LK2A 2PMZA 5IYBJ 2KHMA 3W3CA 3IT9A 3RTTA 3S1YA 5ICEA 3UMDA 2XROA 5L3BA 2AS5F 1AHDP 5BMZA 5LABA 3NULA 3TT4A 1D1AA 4HLXA 3P5JA 2V0WA 3OYCA 4RAZA 2FOWA 2IXSA 2V0UA 4PPRA 2JKFA 3WTTC 4JGOA 3HC7A 3EEAA 2FF4A 4Y13A 2JE5A 5I94A 4GYGA 2A5YB 2NVXJ 2PI0A 3WRZA 1Y8RB 5CVJA 1R49A 3KZIC 1E3UD 5FROA 4WZ5C 5DD4A 3PTEA 4YOFA 3KZYA 3UVCA 1K54A 1VM1A 1KDSA 3FXQA 4KISA 1WKMA 5FKKA 1SDNA 3P7NA 4I6ZA 2EFQA 2KP6A 1K4TA 3BJ6A 3LIRA 3SFZA 1HTDA 3FBIB 1JJ9A 4C3QA 2XAJA 4IHWA 4S2KA 1PWQA 2V6EA 3F22A 4XKBA 4LK0F 4M3EA 5M5YJ 2DTRA 3T1QB 2A61A 5LEKA 5E18F 4KZ5A 3JRHA 2VQGA 2L9VA 4S2JA 2R7WA 2G9WA 1HSJA 4XKWA 1VF9A 3ZVSA 1MZUA 4JGRA 3A0VA 1K7IA 3W4PA 2W4SA 1H3QA 3MMHA 4GFBA 4MNRA 2E1MC 2WZZA 1QZEA 2PBDP 2KLIA 1BW6A 1PWCA 5TBMB 3QU6A 2QBYA 1N4OA 5AONA 1LPQA 1T2KA 3WTUC 2Y31A 3BROA 2EXAA 4XLCA 4DQ2A 4ILWD 3OV8A 4N1HA 3IH9A 3MKYB 2JBFA 1YITI 5DUIA 3K0LA 5B5OA 1JAQA 1XUDA 3DKWA 1Z77A 2JKRM 2J9PA 2R92J 4DPEA 3OR1C 1W5SA 4Q4ZF 4FVLA 5C5KA 4ZDLA 2GLOA 3PM1A 3IAM2 5HDSA 2A24B 2OV5A 2E2DA 4F3LA 2X7MA 4H84A 1P4AA 4M73A 2DA7A 2BBYA 1F5MA 2JVGA 2DW2A 5IOZA 2ZFWA 3GTLJ 4PSWA 4WEKA 4E7SA 3LMCA 3WS1A 1T1BA 5CGXA 3LR4A 1CK7A 4OOLA 2O3FA 1EWZA 1ALQA 4H0EA 4A3MJ 3LY3A 1G2HA 4ENNA 1YO5C 2JSPA 4ZYAA 3J7AO 1YOVB 4LMYA 1UFMA 3E0JB 2DDFA 2DMQA 3FKJA 1DPUA 1VQ4I 1BUVM 2FRHA 4LV3A 2O0YA 3ONQA 4D5CA 2QHKA 3JRGA 1P0ZA 3IF6A 4S04A 2ELKA 2WGIA 4WWCA 3FKVA 1S7AA 1LL8A 4M71A 2XDMA 2RQPA 3H36A 4IJOA 3ZN0A 1A04A 1LHYA 4L0YB 3N8SA 3N8LA 4CYCA 2W84A 5J4EA 5D4SA 2VLAA 3DPTA 1GDTA 1VQMI 3CC4I 2Y2GA 3V8JA 1FOXA 1BULA 2P9VB 2EIJH 4MO7A 4IHQA 4M9ZA 3CLQA 2H8WA 1JI8A 3FZCA 1B6AA 3IXBA 2CV1A 2MC3A 3HCYA 4PGHA 3V7CA 4RMNA 4FCYA 3P9IA 1U9NA 4BEHA 3H9JA 2QKMB 4OU0A 1H89C 3S7NA 3SXYA 4X56A 1B8IA 4A5MA 2DCEA 1DJAA 2RJPA 3BEBA 2W3EA 1DP8A 3SH8A 3CCUI 4DE0A 2E1OA 3GVBA 4NBQA 5JI6A 3VP0A 1F4KA 1ES2A 4PKRA 2BW3B 4HA8A 2VQCA 1SVOA 2NS0A 1N9BA 5M5WJ 5CPRB 2HP9A 2F48A 3IXDA 1S72I 1T0FC 3OS1A 3I7GA 4E04A 1PIOA 4NQWB 1BTLA 2IA2A 1DUXC 1KUIA 3V67A 1BI1A 1NH3A 2H1LA 3IRRA 1PI4A 2NNYA 5HAQA 4GN2A 3IWZA 1PWDA 1IFQA 4XLAA 2CSOA 3F1OA 4H76A 1Y6IA 3I3LA 4G7OF 2W00A 2K4BA 4S2LA 2D5VA 3Q0UA 2PX9A 1T08B 3O2PE 4F92B 4XM3A 1YAXA 1B1BA 4RGSA 1VQQA 4IHVA 4P1WA 3I0TA 3LUQA 3NDGA 4XORA 2JN7A 4HRIA 3F19A 5HLGA 3OYBA 2O8XA 2ELHA 3BJNA 4NB5A 4ZZDA 1X1PA 4DDSA 3NARA 1Y0VA 4L9NA 1M40A 2UV1A 1RR7A 5HZHA 2VPRA 3O2XA 4PJJA 5FKLA 4AUXA 1OYWA 4B43A 4E3LA 1ERDA 3F23A 1MIJA 1V3FA 5H6QA 4ZDOA 5KNLA 1LSXA 3HLCA 4FE4A 3EQVA 4BQMA 3WWXA 3L7WA 4ABZA 4P6BA 3P24A 4P87A 1YSPA 3OYFA 1SKOA 4NUBA 3PJRA 1VQ6I 3TSKA 5IP9J 1Z67A 3WODF 2ZD8A 5HS8A 1VEUB 2ZC4B 1K83J 3KMCA 3WS2A 3DLLF 1LI9A 2HOSA 4Z6YA 3GRJA 3V8LA 3MJQA 4MEYF 4OP8A 3Q07A 3ERMA 3I55I 1DDNA 3VYUB 4C75A 1FILA 1QRYA 2EBIA 4DRTA 2XR0A 3EQLF 1S8NA 4HYEA 1ZXVA 1GO8P 3CMEI 5GAGJ 1SMYF 2Y2OA 5HNHA 4B4ZA 1ON1A 4IUKA 4XQFA 4D60A 4Y4RA 5DKLA 1NG6A 5CHJA 3K10A 2VBZA 3ELMA 3ULFA 1T33A 1SRPA 2OLVA 2PEXA 3MBZA 1XURA 1MMNA 4CDGA 3I56I 3CQZJ 1ZQ3P 4OWRB 4JXVA 2JA8J 3G1MA 4N9IA 1G6OA 4L9GA 5M18A 2YU9J 2EK5A 4L0LA 5LBQA 5BOXA 2G7HA 3HLBA 1PYVA 3FXKA 1S67L 1FTZA 1JH1A 3UR3C 3UE6A 2HDUA 2KRHA 5CVVA 2M7BA 1T18A 4Q0IA 4F93B 1MMDA 1OCCH 5I0LA 1BC7C 4BL0B 1Y54A 4N9LA 1H9GA 2OY2A 1KGSA 3C18A 1K38A 1T1CA 4AVPA 4H8RA 4EM1A 1FBLA 4RQ9A 4BHBA 2FMYA 2GIVA 4NETA 2FQ4A 3BZ6A 5U47A 2VASA 3M8JA 3KX2A 3H9GA 2VOPA 2MH9A 4Y7NJ 2R7VA 5GHYA 4NKPA 3O86A 3MCZA 3OS2A 1XGJA 2XASA 2Y69H 4H82A 2PAVP 4ON0A 4JQFA 2CUFA 5BPIA 2WV1A 3AG2H 1B72B 4P0MA 5JMYA 1LDDA 4DE3A 1RR8C 4FCFA 3OC2A 4FETA 3QQAA 1K4FA 2A24A 2EINH 2B0LA 2KIMA 5FRNA 4DF9A 4HBLA 2ICWG 3AKZA 1MD0A 3GSGA 2V1DA 4IRIA 3LR3A 1LUJB 2CW0F 3HLGA 5J7EA 5BOHA 3M8EA 2KIQA 2PYPA 1T98A 1BUDA 1K57A 4U7BA 5LD2C 3R60A 2ZOHA 3PSIA 2EQRA 1YMSA 1XDUA 3VTGA 2L4MA 5CZMA 1R1IA 2ZQ9A 1OTEA 3KIOA 5DFYA 4D7NA 3BWGA 3K2NA 3ZNTA 2KFDA 2BVLA 2W1OA 1QPIA 5EG0B 1G3TA 2IS6A 2W15A 5TFQA 5D4RA 3CD6I 1W36D 3QYFA 1S66L 3AAFA 2ZM2A 3IH2A 1WWXA 3OYKA 2DA2A 1YOUA 2IP2A 1BA5A 1IYQA 4CJNA 2HEOA 3KEKA 3S15J 4D0PA 3FKWA 4MBHA 2VJJA 1EF4A 4QLCU 1I6HJ 3F8CA 4O8GA 2VC1A 4QTRA 4UY8I 2P9VA 5HWWA 5B66C 1P97A 2E2JJ 1XP4A 3G1LA 3QPHA 2V9VA 4P6ZM 1YLJA 3NC8A 2QJ7A 5E3NA 1J0RA 4WK8F 5AQ7A 3NOPC 1W1WE 3OIPA 1XJ6A 3CZ6A 2DPDA 4QPRA 1LDKB 1PWWA 4O7DA 2LRDA 2B18A 2KJCA 2GWRA 2J83A 1FLIA 1OR7A 3KEOA 2JNPA 4M6VA 3KRYA 2Y2MA 3ITAA 3K9TA 2NUPC 1A86A 2W0DA 5E3OA 3EGXC 4ETXA 1N9NA 3GBGA 1FR1A 3K7LA 5I43A 1X1CA 2JJ7A 2ZL1B 4I35A 2M7UA 4NQWA 3HLFA 3NRVA 3UB7A 3HRUA 1CGFA 5J8FA 4A3BJ 2V79A 1OFCX 4I39A 1BQQM 1SFOJ 1FX7A 3K1PA 2Y91A 2D1HA 2OD5A 1IUYA 5EVID 2HQ5A 3CDIA 1TS7A 3MXSA 3HLWA 2QM3A 2K02A 2YUSA 5J47A 1S1ZA 4RM2A 1Y8JA 2BY1A 1XXMA 4PM5A 4L19A 4OQGA 3VOEA 5GPAA 4MIMA 5F83A 4LJZF 2OZUA 3G30A 2I5UA 3MF0A 2BXYA 4XLFA 3H3ZA 2Y2JA 5D2BA 3MQ0A 1BLCA 3CMAI 1KOUA 3BLSA 1B8YA 2EH3A 3LY4A 3PBRA 4J01A 3N05A 2B9SA 3FMSA 1E3OC 5A8BA 1DGRM 2ZQDA 3GCMA 1SZVA 4BXFA 4OQHA 5EF6A 2QPNA 4BQOA 2FXAA 2QSHX 2EX6A 1RZ4A 3BR0A 2K40A 3HBUP 2ZC5B 4E3KA 2OVXA 4C3HJ 3TEDA 3ZNYA 1T8IA 2GBYA 2O9CA 3QNBA 3KYZA 3DNGA 4XOTA 5GPCA 3OOUA 4PJNA 1VEUA 5FLMJ 4XRMA 2ZNZA 3CAXA 2Z33A 4R3VA 2CS3A 3HIFA 1WJAA 2DA6A 4BJPA 1YHQI 3RKYA 2AHQA 2W3GA 1VQ5I 2V7FA 1ZKGA 3VB2A 1X3ZB 3KZZA 1IC8A 2CW8A 4PM8A 4PFPA 4P55A 2W0NA 1E3HA 4OIOF 1IAAA 3MZFA 5DEQA 4LRYC 3PYPA 3K1MA 4LB5A 3KPHA 1CGPA 1ZG1A 5E43A 5HDGA 2I10A 4UQIS 3F9KA 2FBHA 3FXLA 4GR3A 5HDDA 2M7VA 4X6TA 4MNUA 1UMQA 5KCMA 4Y0UA 5FJ8J 2B63J 2NRAC 1SFKA 1TT0A 1UMSA 1S7OA 4KZ8A 3WV2A 3CF2A 2WY8Q 1BIBA 1IOUA 4S2NA 2RL3A 2HXOA 1G28A 5H6RA 1QA6A 4RS8A 2NUTC 3QP8A 4RYEA 2VK3A 4NC7A 3LIBA 2ZBBA 3HL2A 2BXZA 4YG2F 1RMZA 5JYPA 4ITVA 2QQ9A 1A36A 3DU5A 3M07A 4Y7PA 5FQQA 2R7SA 2E7XA 4IVKA 4E7LA 2M34A 5E8GA 3HJKA 3QP6A 4NEED 2F5CA 1GV2A 4LLGF 5HDNA 2ECCA 1GO7P 3HYIA 2J0TA 1I1SA 9ANTA 2X51A 2KIUA 5L07A 3CO6C 1OYYA 3C3WA 2K3PA 1D8KA 3D72A 3C7UA 3JSOA 1PZPA 4B9OA 3S3MA 2E2IJ 5IHVA 1BQOA 1TWHJ 4RGUA 4CTHA 3FISA 2L4AA 4U0YA 2WKQA 2O6GE 2R9WA 2VE8A 3GLLA 1K56D 2DFFA 4HOBA 2HDCA 4FE7A 1U8BA 1GSVA 2RCXA 3E97A 1Y93A 2ZMEC 1E17A 2L3DA 4PMAA 3DWBA 4Q8IA 4OPYA 3BLMA 5LEJA 2UUZA 2JVHA 4PM6A 4ZJ1A 2WGWB 5EG0A 1UTZA 2A07F 4JBFA 4PCQA 3FMQA 3MAJA 3IP4B 1KU7A 3UO9A 2B5RA 4HOIA 4A3DJ 4MMNA 5BPAA 3O87A 2VGKA 3HSRA 1HDDC 1G6AA 3FXUA 3RDIA 3K70C 1TLHB 1UZCA 3K4CA 4DD8A 1EH8A 5HL6A 4OKPA 1G05A 1YX3A 3G1OA 5HS9A 4GNUA 3I7IA 5E2GA 2DA4A 2J8YA 3WS5A 5H20A 3IV5A 4G3VA 2E71A 4ZJZA 3V5MA 3S93A 4HQEA 3NX7A 1KE4A 1ZGAA 4OOYA 2M30A 2XSSA 1P9WA 5DKKA 2ERQA 4G3WA 3HJIA 2A68F 1GHCA 1W8YA 2VBWA 3ABLH 2SRTA 3ZN1A 3B92A 4XKVA 1FTTA 3LKAA 1HFSA 1KONA 2FX0A 2JT5A 2EFPA 2ZL1A 3C7JA 3DPFA 3S2HJ 4NXFA 2DODA 1QIAA 1LL9A 3CDLA 1FM1A 2X1EA 2Y2HA 5F6AA 1GT0C 4KZAA 3CHWP 3VYSB 3UY6A 2AXLA 2VPLA 4NK3A 5FA7A 2OLUA 5D1UA 3HM5A 1MKMA 3HOVJ 4RGXA 4JX6A 1X0OA 2Y0SA 4N9KA 1HTZA 1H8ZA 2XKPA 4AIKA 3LIFA 4WZ4A 5ICFA 5BQTA 2GZAA 1KVMA 1JJ6C 1O7LA 1QVUA 1Z0XA 1NZUA 4M74A 2LNBA 3O3VA 1FMVA 3VE4A 3U2RA 2CG4A 3N6IA 4AYBN 3USNA 1FY7A 3O8GA 4BL3A 4ESFA 2K86A 3KX0X 2GXBA 2XPWA 2QEXI 2XLNA 1XFXA 1HZOA 5F1JA 1T56A 1TW3A 2VE9A 1JGGA 4BJ6C 1BLHA 1OZ9A 4G9YA 2DAOA 1NYMA 3LA2A 4KENB 4WF2A 5GP9A 2EX9A 3G4PA 4JYKA 3EDIA 1U5TB 4DF6A 4OMZA 5CVIA 1ZRFA 2DA3A 2DCFA 3WV1A 2VJ5A 3T50A 4FD8A 3GTMJ 4EV0A 2EX2A 3FX3A 4B1RA 3ITBA 3T1XA 2RC4A 2W48A 3F8BA 1J5YA 1K4EA 4UUTA 5AIPA 4LLLA 4J4MA 2CFXA 3QAHA 3GBOA 3TS4A 4QU3A 5EVEA 1Y0UA 3TP3A 3OYIA 1WJBA 5TGFA 3C8CA 4ZZLA 5L3CA 4FXYP 4HLYA 3G42A 5E17F 1I3AA 3BJOA 3VPRA 5F69A 3ZQ7A 3EETA 4M72A 4LIUA 2XGEA 1HKSA 2C5WB 1I2WA 1IGNA 3HHHA 1RC9A 3GTOJ 3CTAA 1UAAA 4BY1J 3R7WB 1KUGA 3OCNA 5AIQA 2DN0A 4EMSA 1R4NB 4W97A 3K4LA 1RUOA 3SEZA 3FBNB 3OYHA 1ZYRF 2BE5F 5EEGA 4KQDA 2F4OB 3ZMDA 1XGOA 3LQRA 3ZUKA 1X1DA 2WB1N 2LF7A 1GXQA 2WYXA 4CLCD 1WQ2A 4DIQA 3UE3A 2MGQA 1BLSA 3LSIA 3Q81A 3HUGB 5EZHA 4ZYDA 1V5EA 1BKCE 1LL5A 2ZJ2A 2WGVA 3JVUA 2VGJA 4IQJA 1R1UA 1ERQA 5L3EA 3LEQA 1NWZA 4GGGA 1PW8A 1UMTA 2LMDA 3OYMA 1YSQA 2WBMA 5DVAA 1IN4A 2LKSA 2W3FA 3Q2GA 2LP0A 3VYRB 1MMQA 3PR6A 5J4YA 3IXGA 1M6KA 5FO5A 4O5VA 3ZG5A 3L0VA 2P08A 2W27A 3U2AA 3OYNA 3R0AA 1YQAA 4ESBA 4Z2YA 4H3XA 2EA4A 4PK4A 3ZQQA 4OMYA 3AYKA 2KRFA 2Y4AA 3AFHA 1YMXA 1MH4A 1AA7A 2EZKA 2XHKA 4DV8A 1K55C 3BG9A 4U7DA 2GJ3A 3ABKH 1H5XA 3ZMVA 4CXFA 1X4PA 3LGOA 1GA0A 1PRQA 4OIPF 5HD3A 2XUBA 2HXIA 2ZQCA 1LI0A 1BI3A 2RREA 3I59B 4GCZA 4CCJA 1Q1HA 2P7CB 4EGYA 1I39A 1PP7U 3LI9A 3U9GA 1IYOA 1ZREA 3ZR8X 3S2DJ 3HXLA 2HDRA 3DCFA 2DMPA 1JUMA 4HDUA 3LSTA 1F2KA 2DNSA 3PNYA 2W1RA 3BDDA 5J8XA 2KX6A 2OVZA 5D6EA 3SDGA 3KEQA 3TW8A 4KN4X 3LEAA 4CICA 4EXOA 2P4WA 2X6XA 3LYXA 1Y0NA 2VA0A 4S2OA 4A3WA 2OJED 4L6TA 3MZEA 2WKPA 2DOFA 5EVIA 3GZ6A 1HKQA 3DEUA 2X3CA 3NWTA 4QPOA 5TGTA 1TQMA 4GHIB 2HVSA 3TBIA 4RB0A 5CUHA
chains in the Genus database with same CATH topology
4FVLA 2OVXA 4HSTA 3BG7A 4ZDLA 4PKVA 1KBCA 1BSWA 4AU7A 3OYLA 3DTIA 3RCOA 3IAM2 2MZHA 1ZTQA 3F16A 3L0TA 3SZGA 2VL8A 3D5LA 4CUGA 5KHDA 4H84A 2Y0SA 3RPUD 2MZIA 3S8PA 1OM7A 2MLSA 2E2DA 3DKXA 2X7MA 3DNGA 2Z16A 4XOTA 4QPQA 3OS0A 1SLMA 3OOUA 4R79A 2WOAA 3KWVC 1PYVA 4XM7A 3WV3A 2OI0A 4PJNA 3K70D 3KHIA 1ZS0A 2Z1DA 4YEJA 2D1NA 1QUAA 4WKIA 5L7FA 2MD0A 2XF7A 4NC8A 3HOSA 5HVQC 1S9HA 1JH1A 3UR3C 3H5RA 4ZTJA 5CXAA 1I76A 4R3VA 2CS3A 3O64A 1WJAA 4CZCA 2OXUA 2KRHA 2HPMA 1N78A 2OXWA 4HMAA 1YE9A 2JVGA 2M7BA 1ASTA 2DW2A 2L2OA 2OUMA 4AXQA 3LUNA 1DGWY 3G5CA 3A4CA 4JQGA 4F93B 4E7KA 1MMDA 2F6CA 2WO8A 1G12A 5I0LA 2K2GA 1FMVA 3D5RC 4BL0B 2W14A 3K4KA 2LY2A 4PSWA 2OY2A 3DPEA 3VSLA 1SAUA 4E7SA 3LMCA 3A1YA 2VJIA 3BCBA 4JOMA 1BIWA 2AQFA 2KRJA 2LC2A 1CGLA 2K5CA 3EUKL 1UEAA 4H1QA 4B47A 2BVMA 1FBLA 5JHFA 2N8RA 2Y6CA 3USNA 3IUOA 1OR7C 3MD2A 1YQYA 1CK7A 2XS3A 4WZVA 3V96B 5CQEA 1HY7A 2CMPA 3KECA 1WFXA 1EUBA 4ZC3A 2OW1A 3LQBA 2K9CA 2V7FA 2VASA 3M8JA 3KX2A 3H9GA 3BG6A 1Q3AA 3EWJA 2M3AA 4PKTA 1MMGA 3S3OA 2R7VA 2MZEA 1I73A 3AIGA 2Y6DA 3OMYA 2JSPA 4ZYAA 4EFSA 1XFXA 1WJCA 2CW8A 3E0JB 4BS9A 4HNUA 3LUMA 1CQRA 4C9YA 2DDFA 3PNVA 2KQRA 4YRVA 4PFPA 1BR1A 3FKJA 1EAKA 2XC7A 3OS2A 4DBRA 1BUVM 2ERPA 2VXZA 3L2WA 2F5VA 4H82A 3A2KA 2W13A 2LBFA 2CV0A 4PKQA 4BQQA 4L7AA 3ONQA 456CA 4JQFA 1IAAA 4BJ6C 3K4NA 3L2QA 4ZDPA 2ZSIB 4N4NB 2OZRA 1XFVA 2OXZA 5JMYA 3OL4A 1OO9A 1D0XA 1H71P 2ZFUA 1UG0A 1GE7A 2CV2A 2VXDA 1Z3JA 2KZVA 1S4BP 4ZR5A 1SMPA 2FV5A 2PJRB 4IKFA 2DT6A 2AQEA 4FETA 1R1HA 3F9KA 3UNGC 3AL0B 4GR3A 3U1RA 2L9NA 3EDIA 3DKYA 4AYKA 4AIGA 4KT6A 4IJOA 1BR2A 1YP1A 4OAYA 3IAS2 1OM8A 1OS9A 1JANA 2QKLB 2WO9A 3F17A 4F52A 1D7XA 3HB2P 2R7QA 2DW1A 3KMEA 3DWLE 5KCMA 3OYDA 3WV1A 2VJ5A 3QOEA 1X19A 5FRNA 3DTKA 3RTRA 1UELB 4CCOA 4PKSA 4DF9A 2XF5A 2LYCA 1UTTA 4PKWA 1SFKA 3MMYB 2E3XA 1AKLA 1MMAA 3BCAA 3DQVC 3M1CA 1TT0A 2LOOA 1WJFA 3AKZA 1UMSA 3VDXA 2L7KA 4QKZA 2XAUA 1JKYA 1IACA 2R7UA 1EA3A 2VLAA 4B48A 4BDZA 3DPTA 3EDZA 4J00A 3ZRGA 2MC4A 4XOPA 2OY4A 3CJRB 4GR0A 3VI1A 3L2RA 3WV2A 2AYKA 2WA0A 3CF2A 1J09A 2WY8Q 4E7ZA 3TMOA 1BUDA 3QODA 4J4MA 3EDHA 1X1AA 1BR4A 4E7IA 3ZGKA 4U7BA 2W7NA 5LD2C 2E5NA 1GXDA 3K7NA 5I2ZA 3GBOA 4XL9A 2E5ZA 3G2BA 4H49A 3TS4A 5D1SA 5I3MA 1A85A 1JI8A 4A7BA 4BDYA 4IX7A 1WNIA 3CKIA 4B3XA 3PSIA 3OYIA 1PWPA 1YCMA 2V4BA 3LSMA 1D1BA 1WJBA 1GE6A 3K4MA 4NC7A 2JA2A 2CV1A 3HYGA 3S32A 3HKZA 3HL2A 3BA0A 2IGNA 2HDWA 4G9LA 2UWMA 3DPLC 3E1SA 4G0DA 4BJTA 2IS4A 1N77A 1TZLA 2CUJA 4BQNA 4ITVA 1RMZA 2WAQA 2XS4A 1BOBA 4E4HA 4FXYP 3VTGA 5CZMA 1R1IA 1JAPA 1ZVXA 1GLNA 3G42A 1QHHD 4RMNA 2DW0A 2Q2EB 4BEHA 3H9JA 4XCTA 1D1CA 2IGMA 2QKMB 3H35A 4CCNA 3CJQB 3DU5A 4CCKA 4F55A 2O3EA 4C2TA 2R4GA 4PKUA 3N2VA 2XSJC 2BVLA 3PFYA 1ZXCA 4ZTFA 3HG9A 4Y33A 2W1OA 2R7SA 1LFPA 2EROA 2M0MA 3LE9A 4E7LA 2DCEA 2TCLA 2RJPA 4LIUA 1MNCA 1Z3YA 2ZXHA 2IS6A 1C3IA 2W15A 1AYKA 3LJZA 3F1AA 3LFUA 1E0EA 1AF0A 1FLSA 2BOLA 3OYAA 3CESA 3EPZA 3K4JA 1MMBA 1D0ZA 1UAAA 2O5RA 4LG3A 1GO7P 2AIGP 3KEYA 1KUGA 2IGOA 1SU3A 3ZXHA 1DQUA 3HPHA 3DU6A 4YELA 4E7HA 4E7JA 2J0TA 1W36D 3QYFA 3OHLA 2P0WA 4AYBA 4PKRA 2BW3B 3SYTA 2VQCA 3N2UA 2X51A 4XN0A 2KL4A 2OV7A 4F3QA 4H2EA 2FUG2 4FASD 4XM8A 3RTSA 1PWUA 5HLTA 1QU3A 1JAOA 3K4LA 2PJRA 3OYKA 2K3PA 3SEZA 4P5OA 4XLHA 3FBNB 5CPRB 4EATA 3OYHA 1WJ5A 3SEQA 3VSKA 2CH0A 1YOUA 3HDAP 1T0FC 1BKCI 2X3BA 3OS1A 3D5SC 3I7GA 2Q1ZB 1R6RA 3C2GA 3LSKA 2IS2A 1PWVA 3DSLA 4JIJA 1O0QA 4NQWB 830CA 4GRIA 3OY9A 3HY9A 3MKZA 3CMMA 5FRMA 4II2A 3LJTA 1IABA 1KUIA 3ZUKA 1X1DA 3S3MA 4GR8A 5CUHA 3HY7A 3KEKA 3VYTB 2CFOA 3CP2A 1R1JA 4JPAA 1BQOA 4ON1A 4HPQA 3EUAA 2JT6A 4DOZA 1XFZA 4C2UA 1I1IP 2VJJA 2VB6A 3ZXSA 2USNA 2W82A 3TL4X 4C30A 4DIQA 2OW9A 2ELJA 4CTHA 1ZELA 3QYBA 3LSIA 3ZCOA 4XM6A 1KUKA 1CGEA 2FV9A 3K6GA 3EHXA 4XLAA 3HUGB 2HNHA 1IAEA 4Q1LA 4BE1A 1MW7A 1QHGA 4HNTA 4BACA 1V5EA 1Y6IA 2L9SA 3I3LA 4PJMA 1P9QC 1ZP5A 4H76A 3TVCA 4IQ4A 2A5WA 1G59A 1BKCE 966CA 1U0JA 5HNFA 2Z2DA 1SATA 2JUGA 2W00A 2V9KA 2R7XA 4FXQA 1Y93A 4IQJA 2YIGA 4N4OB 2M4KA 4PUSA 3DWBA 2MFZA 3PSFA 2PMZA 5CKTA 4F91B 2VKHA 2KHMA 3W3CA 2OC6A 4XLEA 4D9JA 1ND1A 3CP8A 1UMTA 2YB9A 4XN3A 4I03A 3RTTA 3OYMA 1QJIA 2WADA 3LMMA 4GWMA 2WBMA 3OR2C 2X1CA 4NNJA 4E6KG 1OM6A 2UUZA 5BOTA 2R7OA 2NOJB 5LFAA 1V5GA 4XM3A 4F92B 4XBHA 4XMYA 2W12A 3LILA 4AVZA 2JIHA 3Q2GA 2LG4A 2WY7Q 3L2VA 5L79A 3OIPA 2GOMA 5LABA 4P1WA 2JVHA 5I4OA 3VYRB 3TT4A 2LY1A 1D1AA 4CCMA 3CZ6A 2RQQA 1MMQA 2DT7B 1LDKB 4XORA 2CW7A 1PWWA 4WF6A 3LQ0A 1OMJA 3OYCA 1MNEA 2LRDA 2IGKA 2KPMA 2Z2SB 4HRIA 1EB6A 2IXSA 1UTZA 5H8XA 1YX5A 4GUYA 3F18A 3F19A 3L0VA 2J83A 3OYBA 2CUZA 5B5PA 1OS2A 3HC7A 4BU2A 4DBQA 1QICA 3W2VA 3OYNA 2JNPA 2DOAA 1CAQA 4B44A 2MLRA 3KRYA 1IADA 1DTHA 3IP4B 4H3XA 4PK4A 1R54A 1Z21A 3ZQQA 4D1QA 1QJJA 3AYKA 2RNGA 4CSWA 4CH7A 1Y0VA 3B8ZA 2I8DA 1A86A 2W0DA 5I12A 5BPAA 2UV1A 3DTEA 3LL7A 1IRXA 1WJEA 3AFHA 5FROA 3EDGA 3P1VA 2VQHA 3QYEA 1GE5A 2MABA 3NWSA 2DXIA 3GBGA 1AA7A 4HSRA 1JIZA 2V26A 1WJDA 2IS1A 3K7LA 3UVCA 1X1CA 1Y56A 4DV8A 5I43A 3DPUA 1GKCA 4RLQA 1BKCA 3PL8A 2X6WA 2YUFA 3O2XA 4I35A 2X85A 4PJJA 3L2UA 2ZSHB 3OYEA 3K70C 1VZ0A 4KISA 2VKDA 2HPIA 4XKCA 4B43A 1Z7LA 2XDVA 1ERDA 4BGDA 1KUFA 1MMPA 4IN9A 2E60A 1CGFA 2VQLA 3K4CA 1D0YA 4ZDOA 3SHIA 1HA8A 3OHOA 5KNLA 3FHNA 2KP6A 2L5QA 1X4PA 4DD8A 2DDYA 4BUPA 3LIRA 2A6TA 3HDBA 3S3NA 3LJGA 1HTDA 3OWTA 1J7NA 2HVRA 3FBIB 1JJ9A 4FU4A 2CLTA 4GF1A 1BQQM 4WK7A 1G05A 1PWQA 1QIBA 1IAGA 3MKWB 2V6EA 1YX3A 1C8TA 4XONA 2RREA 2WAEA 3PNTA 3P24A 4L63A 2LH9A 4XKBA 3LSHA 4CCJA 2XF6A 5D3CA 3LK8A 1G4KA 4CCLA 1G9KA 2D1OA 3C2HA 3W2AA 3OYFA 4WKEA 5D1TA 3K4BA 4OAZA 1XFWA 4XR6A 2POJA 1W36C 1K6YA 3W2WA 1V5FA 4NUBA 4RM2A 3H9QA 3J7AY 1XFYA 1Y8JA 3PJRA 3I7IA 4KJZA 4L19A 3TSKA 2X3AA 1FMWA 4GQLA 3U21A 2MYSA 1BM6A 3ZR8X 3OL3A 3HPGA 2K9MA 4G6TB 4U87A 3HXLA 1JIWP 4DJAA 3MA2A 2VQGA 1CIZA 4PFOA 2V4JC 3LSGA 2ZXIA 2R7WA 3KMCA 1SLNA 2HQAA 1MMRA 5BOYA 1G8XA 2HVQA 5HOOA 2WB1A 4ZJZA 4BEHB 1Z3XA 2E1MB 2OW2A 3S93A 2GOXB 4XKWA 3PNYA 3ZVSA 5CQGA 4II3A 1NG7A 3DEEA 1K7IA 2O36A 3OYGA 2KLOA 2A8HA 1XFUA 4GWNA 3NX7A 2W4SA 1USNA 4JA1A 1LVKA 3F15A 4XLFA 3B2ZA 5D2BA 1HOVA 1LKXA 4PSXA 4DGWB 2E1MC 3VYUB 2R7RA 2DJIA 2RJQA 1R55A 1C7KA 1D8MA 4BE2A 2PJTA 2CKIA 2OVZA 2ERQA 1CXVA 3OYJA 3H5NA 2KDOA 4KITB 1K7QA 1L6JA 1B8YA 1ROSA 2WAFA 1GKDA 4IUWA 3BC8A 3E8RA 3I9V2 4BE0A 3KEJA 3KYLA 3HOTA 4J01A 3LEAA 2SRTA 3B92A 2R7TA 2JSDA 4H4KC 4XKVA 3N05A 1JK3A 4IZZA 2X6XA 3LKAA 1HFSA 1ZXVA 2VJ4A 4BJ5C 1GO8P 3BLYA 1OLTA 1KONA 3AYUA 5D7WA 4A3WA 4CA0A 3V42A 2JT5A 3H5AA 1DGRM 1B3DA 4RLFA 2VIXA 3DL1A 4XLCA 4L6TA 1D5JA 2QPJA 3Q2HA 4BXFA 3VWBA 2X6YA 5HNHA 3DPFA 4PJLA 4H30A 1X1BA 4BQOA 1QIAA 2M4GA 4AUOA 4HEA2 4ILWD 1FM1A 2M7AA 1O0TA 4Y3OA 4XQFA 3AL0C 2X1EA 4Y4RA 3MKYB 2KRCA 1D8FA 1HFCA 2HU6A 3RSNA 2KMUA 2I47A 1NG6A 2L0RA 4HX3A 2OW0A 3K10A 4ANJA 4RM3A 2K9LA 1K7GA 2LBFB 1X4OA 3ELMA 4X0GA 3FDYA 3VYSB 2X1DA 1KUHA 1SRPA 3PUBA 3H0DA 3HBVP 5B5OA 3LGPA 1MNDA 1JAQA 1KAPP 1XUDA 1DMTA 3LIKA 2V1NA 1ATLA 4JP4A 2VPLA 2F4IA 2HU9A 3NWTA 4HG2A 2X3CA 4QPOA 3HBUP 3EUHC 1PJRA 5TGTA 2BW3A 1BZSA 4MLOA 1XURA 3EHYA 1XUCA 1T95A 1HV5A 1MMNA 4LIVA 3RQ4A 4DPEA 1DP3A 3OR1C 4XNFA 3SDBA 5D1UA 2HVSA 4OWRB 1G49A 3TBIA 2LREA 1N75A 4LITA 1RM8A 3DLAA 3OIQA 2HZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTK A;  3DTI A;  3DTE A; 
#chains in the Genus database with same CATH topology
 1U2W A;  4BBU A;  5TIS C;  3H3U A;  3H9W A;  5A93 A;  4HP4 A;  3PQJ A;  2E1N A;  2MZI A;  2KDK A;  3S8P A;  2V1B A;  2O61 A;  4QWO A;  1SLM A;  3WV3 A;  4R3B A;  1LEA A;  3B73 A;  3KCC A;  1S9H A;  3H5R A;  4KIF A;  2HR3 A;  1IEM A;  1N78 A;  3TSG A;  2H1K A;  2OUM A;  4UB8 C;  1SAU A;  5F6F A;  3VMA A;  2Y6C A;  2N8R A;  1OCT C;  5TRD A;  1YQY A;  1KGG A;  3VP1 A;  3E4P A;  1WFX A;  3P9K A;  3BWL A;  2EFU A;  3LQB A;  4GOG A;  3MQQ A;  3BG6 A;  2Z6D A;  3BPV A;  3J7Y J;  3FXJ A;  3LUM A;  4GB7 A;  2VT3 A;  3LSJ A;  4O6J A;  4EJO A;  2W13 A;  3T4K A;  3JAM K;  1D0X A;  1H71 P;  3DBA A;  5K7F A;  1Q1V A;  2DT6 A;  3A0R A;  1SVM A;  1XB4 A;  3M4O J;  5LRR A;  2JUC A;  4OAY A;  3HRS A;  1WPK A;  2QKL B;  3CCL I;  3VOZ A;  5EM0 A;  3OYD A;  5HX9 A;  3H0G J;  1AKL A;  1KGF A;  5G18 A;  3GYH X;  4UXN A;  2ZM8 A;  4KT5 C;  3TMO A;  1D7E A;  1TDL A;  2W7N A;  4CGZ A;  2E5Z A;  1FPQ A;  3H82 B;  5IY5 H;  2E19 A;  5ILV A;  2FJ1 A;  3LOC A;  1L0G A;  1ZKJ A;  2IS4 A;  1NRJ A;  4TV7 A;  4BQN A;  4E4H A;  5FEF A;  4B09 A;  4CCK A;  2R4G A;  2XSJ C;  1UCR A;  2ESH A;  1U8R A;  4MFE A;  2MSY A;  3J81 Z;  4PAU A;  3CJN A;  1HST A;  3CES A;  1FT9 A;  3K2A A;  2IA0 A;  4LG3 A;  2IGO A;  4KG6 A;  3GFM A;  4UUV A;  5A2Q Z;  5HLT A;  3PFI A;  4JK1 X;  3FV7 A;  2LVS A;  3QPS A;  2Y2I A;  1U5T A;  4IF4 A;  1O0Q A;  3HY9 A;  5IT3 A;  3LJT A;  1YJN I;  2FD5 A;  4GR8 A;  2HKX A;  1YS7 A;  4JPA A;  1Z1D A;  2K2N A;  2VB6 A;  2HJ9 C;  3BZC A;  4L5J A;  4EVI A;  4OP5 A;  4MN6 A;  3K6G A;  5EGO B;  4R0Q A;  4EEF G;  1PFL A;  1YFH A;  2Y2N A;  1MW7 A;  1QHG A;  4GZB A;  1XTA A;  1G59 A;  1ETY A;  3WU0 A;  1U78 A;  3QP2 A;  2JUG A;  2MFZ A;  3B02 A;  2YB9 A;  2Y30 A;  4BXU A;  4XBH A;  4XMY A;  2IPQ X;  2V1X A;  1SEU A;  2LY9 A;  2LY1 A;  4S05 A;  4G7Z F;  3ZG0 A;  3FXR A;  3HOX J;  5E2E A;  1W0U A;  4YNR A;  1IAD A;  3R7W A;  4D1Q A;  5B3S H;  2IWC A;  1ONV A;  1IRX A;  3IRQ A;  1Z9C A;  2P5L C;  2OCE A;  5HAP A;  2QVO A;  4A3K J;  1ERO A;  5CX7 A;  2HPI A;  2NNN A;  4OVD A;  4ENJ A;  3T0Y A;  1K56 A;  1MMP A;  1D0Y A;  1W8Q A;  3RYP A;  1GV5 A;  1ETX A;  4R3A A;  1MBF A;  1BC8 C;  1RET A;  1ORK A;  2WAE A;  1ONG A;  5ILU A;  3W2A A;  1VQK I;  2POJ A;  1GVJ A;  1NHA A;  3CMY A;  1LB2 A;  1W36 C;  3GWZ A;  4UVB A;  1YM1 A;  3OL3 A;  5DDG A;  4ZBE A;  1XX2 A;  3MA2 A;  4R1H A;  4ZYH A;  4XRF A;  1XCB A;  4II7 A;  1EI5 A;  1NG7 A;  3DEE A;  4XUZ A;  3WGI A;  4QB8 A;  2GXG A;  1LKX A;  1SD7 A;  3C4P A;  1HC8 A;  1A5J A;  1FSY A;  1A35 A;  1WE4 A;  2JKR I;  2ZM0 A;  2H6C A;  3CLO A;  1ZH5 A;  4DW6 A;  5D6F A;  3LA3 A;  4XLP F;  4ESJ A;  1AOY A;  4IJG A;  4EWF A;  1IO2 A;  3FM5 A;  4ETZ A;  2TRT A;  3LWF A;  3UKG A;  4R70 A;  1HFC A;  5F1R A;  4WMC D;  4HX3 A;  4RM3 A;  5DV5 A;  3S4X A;  2LBF B;  4I0A A;  2I72 A;  5FB2 A;  5FI2 A;  2CYY A;  1WI9 A;  2ZOI A;  1RP5 A;  1ZN2 A;  1UHS A;  1DP3 A;  1BBY A;  2D2W A;  1CI8 A;  2MH2 A;  3IH8 A;  1MZB A;  3WTV C;  3DTI A;  4ZTK A;  1E4D A;  2QKP A;  1O3T A;  4QPQ A;  1TNS A;  4XM7 A;  2XPU A;  2VBY A;  1RKT A;  1H9T A;  3NCK A;  5AQB A;  1EV7 A;  2Y55 A;  1Q2Q A;  3O64 A;  5IOY A;  1ZTR A;  1OT9 A;  3CCQ I;  4KA4 A;  4IEJ A;  4I02 A;  3D5R C;  1IRF A;  2PD7 A;  3J7Z I;  1GSW A;  1YRN B;  3EUK L;  1K57 C;  2FH5 A;  1FJL A;  2HS5 A;  2VKS A;  1NTC A;  1CJF A;  5DF9 A;  4GCV A;  2IWD A;  3HBR A;  4MGR A;  1H8Y A;  5LLQ A;  1MMG A;  1I73 A;  1XJ3 A;  4ZJ2 A;  5I5L A;  2CV0 A;  4S2I A;  1L0F A;  1PDN C;  4WLA A;  4WZ5 A;  4RX3 A;  2ZSI B;  3BR1 A;  1DP9 A;  4PGG A;  4GS9 A;  1FOK A;  4HH3 A;  3RZO J;  3U1R A;  1UG2 A;  4AIG A;  3A02 A;  1EH7 A;  1BL0 A;  3JR9 A;  1YP1 A;  1JAN A;  1XFN A;  4R8H A;  4IRH A;  3FWL A;  3BYD A;  3QOE A;  1U9O A;  5J8C A;  3Q7V B;  2XF5 A;  5D5U B;  3DQV C;  4IO9 F;  2L7K A;  4QKZ A;  2BG1 A;  5GAH J;  4Y52 J;  5D5V B;  4XOP A;  1ZRD A;  1ESI A;  2DO7 A;  2LKP A;  1NXY A;  2V6C A;  1S4R A;  1XC5 A;  4C6Y A;  2HWV A;  2R5Y B;  2V4B A;  1OCR H;  4HJ4 A;  3K4M A;  3HYG A;  3HKZ A;  2IGN A;  2ADU A;  1QQI A;  1ZHF A;  4IHY A;  1WH5 A;  2P8T A;  1XMX A;  4XBF A;  5FQM A;  3NIA A;  4MEX F;  1JWZ A;  2J3T C;  4L18 B;  1C3I A;  3JW4 A;  1KQ8 A;  3M6B A;  5D3O A;  1E0E A;  1AF0 A;  3P98 A;  2AIG P;  3C5A A;  2P0W A;  3SYT A;  2IRF G;  4CHU A;  2FNA A;  2M5W A;  2VT2 A;  2XGC A;  1X58 A;  5GAD J;  5F68 A;  4F3L B;  5FD5 A;  5L3F A;  4K0W A;  3Q9S A;  5BS6 A;  1R1J A;  3IKV A;  4XIC A;  1I1I P;  1B59 A;  3BFD A;  2M9H A;  3GZN B;  1JXS A;  3V3S A;  2HNH A;  3NY4 A;  4HJ6 A;  1R5G A;  2Z5U A;  4NXE A;  3H7W B;  2WAD A;  2YSR A;  1XGM A;  3AGE A;  4H6J A;  2BTF P;  3OBF A;  3M2K A;  2X71 A;  2LG4 A;  5L79 A;  4A5R A;  4WF6 A;  3LQ0 A;  1OTA A;  4D7M A;  5H8X A;  2A05 A;  1TWC J;  5EVL A;  4JX5 A;  3IHB A;  2ZMA A;  4B44 A;  5EJC A;  3DWK A;  4U0W A;  3IXH A;  1YLT A;  3B8Z A;  2L02 A;  3TDU C;  3P1V A;  1WJE A;  4K91 A;  3QYE A;  1D06 A;  1YLW A;  1WJD A;  4HZF A;  1Z6F A;  5HWV A;  1U3E M;  1Z7L A;  2LR8 A;  5EDN A;  1TEM A;  2LB5 A;  1DP7 P;  3M2J A;  4CYC B;  4M4X A;  2DDY A;  4BUP A;  4ZAM A;  2H0Y A;  2XB5 A;  3BQA A;  5EGO A;  1ZGW A;  1G4K A;  3BR2 A;  4OAZ A;  1XFW A;  1V54 H;  1KVL A;  4XRS G;  3VFZ A;  3J7A Y;  1FMW A;  3U21 A;  3HHG A;  1Z6T A;  3HPG A;  2V9A A;  2R78 A;  4IL6 C;  1CIZ A;  3K1N A;  5K5R A;  4BEH B;  2MW8 A;  3WE2 A;  3OYG A;  1JTD A;  2GNX A;  1XFU A;  2HZT A;  2XRL A;  2QZ8 A;  4AFI A;  1YLF A;  4PSX A;  4DGW B;  5D5W B;  2R7R A;  1D3Y A;  1ZLJ A;  4IUW A;  3KEJ A;  3OZH A;  3UPN A;  4IZZ A;  2VJ4 A;  4A5N A;  3ULQ B;  5K5Q A;  3O8H A;  1X1B A;  4M6Y A;  3AL0 C;  2L0R A;  1XJ4 A;  5KAF C;  1TD5 A;  1FR6 A;  3HBV P;  1UB9 A;  1DMT A;  2V1N A;  3EYI A;  1ATL A;  4JP4 A;  1BZS A;  3T8R A;  2A69 F;  4RA7 A;  2FZ0 A;  4CYD A;  1RM8 A;  2HYG D;  3I5U A;  2FBI A;  2H28 A;  3WG7 H;  2K27 A;  5F04 A;  2PDR A;  1IN5 A;  4DDY A;  3SZG A;  4JGQ A;  1P92 A;  5HAR A;  5HDC A;  1DJB A;  3K70 D;  5HVQ C;  3WTW C;  3COA C;  4ZYG A;  2UWX A;  3QWL A;  1YE9 A;  3LAJ A;  3BQZ A;  1S7E A;  3DPE A;  5LGN A;  1VQ8 I;  1KE3 A;  1I50 J;  3ZQI A;  3Q7Z A;  4XSZ F;  3E4O A;  2OAZ A;  4ZC3 A;  1FCM A;  4P96 A;  3S3O A;  5IP7 J;  3GZ5 A;  1ZGJ A;  5DF8 A;  3GDI A;  4YRV A;  1BR1 A;  2JZY A;  4DBR A;  1WVR A;  1W63 Q;  4MDZ A;  1LSW A;  2H09 A;  1P6R A;  2LBF A;  4PKQ A;  3AG4 H;  4B93 A;  4DJ2 A;  5DTD A;  2OXZ A;  3BG5 A;  2INW A;  3HEF A;  5CRF A;  4I01 A;  1A6Q A;  1D5V A;  2HQR A;  4HIA A;  4EER A;  4E70 A;  2PMZ N;  3F17 A;  3CC2 I;  2R5Z B;  3C2W A;  1SFX A;  3RTR A;  3G34 A;  5J1R A;  1MMA A;  3BCA A;  4WUJ A;  1I5Q A;  2LOO A;  3VDX A;  1TQI A;  1R36 A;  5GAE J;  2WA0 A;  1J09 A;  1F98 A;  4E7I A;  3RJU A;  4QHC A;  5I3M A;  3N4I A;  4ZDX A;  1MBG A;  4IPA A;  1YRN A;  4DKI A;  2W85 A;  1L3L A;  1XAX A;  4G9L A;  5B1A H;  1ZG6 A;  3G6E I;  2CUJ A;  2A3U A;  4G94 A;  2FEZ A;  4BQA A;  4F55 A;  1K79 A;  4BBS J;  3PFY A;  4Y33 A;  2M0M A;  1JVJ A;  1HW1 A;  1BT5 A;  3ZGA B;  2E36 A;  3SQN A;  3PAE A;  3I4M J;  3GFL A;  2XGD A;  5GLB A;  2OWH A;  3CUO A;  1XFQ A;  5J40 A;  3TOA A;  2AXT C;  3HGG A;  1I27 A;  3JSP A;  5DUK A;  1PWV A;  3FC7 A;  2EZL A;  5FFZ A;  5GL9 A;  4V2F A;  3TKY A;  3Q7V A;  2V1A A;  1TWG J;  1YI2 I;  3N4M A;  2USN A;  2Y2Z A;  2STW A;  3T4L A;  1P4W A;  4AID A;  3AGD A;  4UA6 A;  4KQO A;  3FPW A;  4R38 A;  1FNN A;  2W3H A;  2R5Y A;  3M7G A;  3PUF A;  1ND1 A;  2P7J A;  3LMM A;  2X1C A;  4YIF A;  1PP8 F;  3B6A A;  4I2O A;  1AWI A;  4AVZ A;  2J7V A;  2OTJ I;  1G6N A;  5DYM A;  3UE1 A;  3JRC A;  3BOQ A;  4KUK A;  1YW9 A;  1ON2 A;  4R4R A;  3F18 A;  3CUQ C;  2DJN A;  2M87 A;  3ZQ5 A;  1PUF B;  1O07 A;  1KU2 A;  2XRN A;  1R54 A;  1Z21 A;  2Y2K A;  4A0Y A;  3PO3 J;  2P5K A;  2H10 A;  3UB6 A;  1J7K A;  4LB6 B;  5I12 A;  2W1T B;  1F9N A;  4A2U A;  2XEP A;  5FAQ A;  1BKC A;  5HD5 A;  4IVN A;  2YUF A;  2X6W A;  2PQ8 A;  2FFY A;  3OYE A;  2DYR H;  3IBJ A;  5E8I A;  2EXB A;  4RGR A;  1IN7 A;  1MSF C;  2W24 A;  2VQL A;  3LR5 A;  5EE8 A;  3F1P B;  1CEG A;  4JLF A;  1ERM A;  3KP5 A;  3DP7 A;  4NDL A;  5F1F A;  5FAS A;  2LH9 A;  4BBV A;  1MWS A;  5A90 A;  2E7W A;  1G5U A;  4WBG A;  3D1N I;  5J1U A;  3VOL A;  2CO5 A;  4Y0O A;  4WX9 A;  3H7W A;  3AGF A;  4U87 A;  1OME A;  5HDK A;  1K6S A;  2OW2 A;  4L0Z B;  1LJ9 A;  4B3A A;  1USN A;  1LVK A;  3NQO A;  3DBR B;  2DW4 A;  4CLC C;  4JBA A;  3V4G A;  2JT1 A;  3HL9 A;  1Z91 A;  4RA2 A;  3REO A;  3F72 A;  3KYL A;  2JTV A;  2R7T A;  2JSD A;  1QPM A;  1JNU A;  4HX4 A;  4KZ9 A;  2FSW A;  2NS7 A;  4E3O A;  4AC0 A;  1B3D A;  3BTC A;  3GV9 A;  5DJU A;  3UN7 A;  3I53 A;  2CWE A;  2JC7 A;  1T19 A;  1AKH B;  4X0G A;  2QWS A;  1FOY A;  3HRM A;  3Q5F A;  1YTY A;  1QZZ A;  3RKW A;  3ECH A;  4Q48 A;  1TS0 A;  3HBL A;  2DA1 A;  2EV0 A;  4AU7 A;  4XID A;  2QZ6 A;  1IF1 A;  3QU3 A;  4A0X A;  3RFB A;  3TE8 A;  3ZQC A;  1RUN A;  2PG4 A;  3T1S A;  5FEG A;  3GX4 X;  3FMR A;  1DGW Y;  3DTM A;  2WO8 A;  3ZMU A;  3K4K A;  3ZQG A;  3EQU A;  3A1Y A;  2AQF A;  4ZYE A;  3IWQ A;  3B42 A;  3RZD J;  1JKO C;  5CQE A;  4WMC A;  3BW6 A;  3HSF A;  3CF5 F;  2BHZ A;  2EIM H;  4L9F A;  3PBO A;  1CQA A;  1T6S A;  3C4O A;  4F7Z A;  1JUP A;  1MJB A;  2KQR A;  5C4X J;  3L00 A;  4MFD A;  3TO9 A;  2ERP A;  2Y59 A;  4PZJ A;  1X3W B;  2RGV A;  4Y17 A;  1P7J A;  2MG4 A;  2CJJ A;  2OZR A;  2RKH A;  4A69 C;  3Q1F A;  3NEC A;  2XGN A;  1Z3J A;  1S4B P;  2PJR B;  2TDX A;  3ASN H;  3NOT C;  3VFF A;  4K2E A;  2FNP A;  3JRE A;  4AM3 A;  1O4X A;  1VQ9 I;  1FC3 A;  3DTK A;  1F1Z A;  2PN6 A;  2E35 A;  3KYC B;  3M1C A;  3CIT A;  3F6V A;  3U1D A;  2OZ6 A;  4BDZ A;  1UJ8 A;  1WH7 A;  3K7A J;  1VQP I;  5E1X A;  1R5I D;  5CER A;  3MSH A;  2E5N A;  2DT5 A;  3HLD A;  2VGL M;  5D1S A;  5IPA A;  3UDX A;  2Z99 A;  1PWP A;  1LVA A;  4ESP A;  5E3L A;  3TO6 A;  1YLZ A;  2HDW A;  4P6Z S;  1BOB A;  1CF0 A;  3ZG7 B;  3D0S A;  1GLN A;  3GVA A;  1TTY A;  1LEB A;  4XCT A;  1L2S A;  5EEH A;  4LFU A;  2O9A A;  4QD4 A;  3PHY A;  5KSC A;  1WHU A;  4N9H A;  1W4M A;  1HW2 A;  4Y3I A;  2G7U A;  4YEL A;  1CEF A;  3F6O A;  3QPL A;  1IYP A;  2FUG 2;  3DF8 A;  4XM8 A;  1PWU A;  1YPR A;  4OON A;  1WJ5 A;  4BXX J;  4I3A A;  4NXG A;  4EQI A;  4JIJ A;  2EPF A;  2QEN A;  2HOA A;  2R5Z A;  5K5O A;  1IUF A;  4I98 B;  3LIA A;  1JKP C;  1I6X A;  1XFZ A;  1OJL A;  3Q0V A;  3SH9 A;  4L9E A;  3ZCO A;  1CQT A;  2FV9 A;  3D4F A;  2ACG A;  2F5E A;  5H2F C;  1V55 H;  2XF3 A;  2NXN B;  5AVF A;  4EUV A;  4Z9Q A;  5DM7 F;  5JHU A;  4B4X A;  3S17 J;  1XM5 A;  3ABM H;  1OM6 A;  4NNJ A;  4E6K G;  1PUE E;  5FQI A;  5BOT A;  4O01 A;  1V5G A;  4IRG A;  3LIL A;  2WY7 Q;  1NZO A;  3QNC A;  5FSR A;  4DYQ A;  1YX5 A;  2V2F F;  4PKY A;  4FIS A;  1JTY A;  1QIC A;  4U0V A;  1ACI A;  2DOA A;  5J3W A;  4DZJ A;  1QJJ A;  3S7P A;  1FBU A;  1KU9 A;  3HRT A;  1GE5 A;  2PFB A;  1JIZ A;  3JRI A;  4EES A;  1SHV A;  1STZ A;  2X85 A;  2W25 A;  1MY8 A;  2GM4 A;  3A3E A;  1FP2 A;  1KUF A;  2AVX A;  1RGZ A;  4FQG A;  1L0E A;  1U60 A;  3LJG A;  3GO5 A;  2HVR A;  1SCW A;  4XON A;  2RAE A;  3PNT A;  3A3D A;  1TT5 B;  2IA1 A;  1G9K A;  4WKE A;  2X6O A;  3K3D A;  3W4O A;  1OMI A;  3OOV A;  4IHX A;  2EWV A;  4A6E A;  4LV0 A;  4DN0 A;  3GTJ J;  2FE3 A;  3C7V A;  4ZRR A;  4JA1 A;  3B2Z A;  2JA6 J;  1HOV A;  4KZ7 A;  1C7K A;  2CKI A;  2PYR A;  3OSG A;  4KIT B;  1PUF A;  3CUE C;  2WAF A;  4JF4 A;  3E8R A;  4PM7 A;  1SAN A;  2J9O A;  2MLK A;  3RPU A;  3E2K A;  2O9L A;  3ZMZ A;  2QA4 I;  3DBL B;  1ACF A;  5EEC A;  3S7Q A;  3FXO A;  2W1T A;  1O3S A;  5DFX A;  3ZP5 A;  1D5J A;  1ZLK A;  1TWA J;  2VEA A;  4HNV A;  3K2Z A;  4AUO A;  3BTL A;  5CVU A;  1IDZ A;  1D8F A;  4XUX A;  2I47 A;  1ESU A;  1FWZ A;  4X1E A;  1FEX A;  4A6D A;  1X4O A;  2YX4 A;  3F1P A;  3PUB A;  3LSP A;  5E2F A;  2HU9 A;  3IHU A;  2OAP 1;  1JJ8 C;  3EUH C;  2L4R A;  4IVI A;  4J19 A;  4LIV A;  1HV5 A;  1TS6 A;  3UPO A;  5I4O A;  3BFG A;  3BG7 A;  2R7Z J;  1VTN C;  3E6D A;  5FL3 A;  3RCO A;  4HAM A;  5CHM A;  1XS9 A;  4RB3 C;  3MKL A;  2GX5 A;  2MD0 A;  2COB A;  5G4Y A;  3U1K A;  2HPM A;  4V19 K;  3MEX A;  5EOO A;  2K2G A;  5EFW A;  5A92 A;  5HSQ A;  4N0B A;  2VJI A;  4MLL A;  4HY8 A;  4A3E J;  1ZC2 A;  1IZ1 A;  4DYR A;  1VQ7 I;  1JUS A;  1TW2 A;  2KJB A;  1W79 A;  2I9V A;  5KVR A;  1EUB A;  2RDP A;  1Q3A A;  2TCT A;  4EFS A;  2WKR A;  4PKY G;  3SS5 A;  4HNU A;  1S0W A;  1QNT A;  4C9Y A;  5FDS A;  4EQQ A;  2LTP A;  1MBL A;  1AKH A;  5F0F A;  2FFF B;  3J80 K;  5AJG A;  5M1A A;  3BR5 A;  1K7A A;  1X3U A;  2ZFU A;  4UV8 A;  4IXA A;  4ZR5 A;  4IKF A;  1A31 A;  1MPL A;  3EOI A;  4OLD A;  3E5Q A;  1OM8 A;  4F52 A;  2DW1 A;  1OKR A;  3I71 A;  4PKS A;  3GEC A;  1WJF A;  1SFU A;  1VND A;  1MBJ A;  3JVV A;  1VQN I;  3E6C C;  4HH2 A;  3QOD A;  5DTT A;  1GXD A;  5I2Z A;  2BYV E;  4A7B A;  4LLO B;  1WNI A;  4JP0 A;  1PYY A;  2XD1 A;  3BFE A;  1HKT A;  2WAQ A;  4MBF A;  1Y4O A;  3L7H A;  3MZD A;  3UB9 A;  2DW0 A;  2IGM A;  2DFH A;  4CCN A;  4EEU A;  4PKU A;  1MBK A;  1LFP A;  2JKT M;  3IQA A;  1W5T A;  3OYA A;  4A93 J;  1MMB A;  3T12 B;  1WGX A;  1NY0 A;  5D8L B;  2L54 A;  4F3Q A;  5JVT A;  2PJR A;  1IV6 A;  1TL8 A;  4XLH A;  4QWQ A;  4EAT A;  3HDA P;  5FDH A;  3BQ8 A;  2M45 A;  3LQQ A;  3KO6 A;  2WC2 A;  3CMM A;  3SZT A;  2IBD A;  2YX7 A;  3P9C A;  3X2Q H;  3EUA A;  5CEB A;  2OW9 A;  2ELJ A;  3QP5 A;  2H6B A;  2JA5 J;  1E3U A;  3S16 J;  2L9S A;  1IRZ A;  1D1J A;  3J80 Z;  1F5T A;  1Y1V J;  4RAF A;  4BAY A;  2V9K A;  2IAI A;  3V50 A;  1E3P A;  3PSF A;  3CP8 A;  1YW8 A;  4DE1 A;  3OR2 C;  4KZ6 A;  3Q3S A;  1ETW A;  2EWW A;  2RQQ A;  3GTG J;  3GTP J;  2Z2S B;  2IGK A;  1HOM A;  4EW7 A;  4JF5 A;  4BU2 A;  4DBQ A;  1IG7 A;  1BM9 A;  4UHT A;  4CSW A;  5K5B A;  3FPV A;  1KQ9 A;  3A0B C;  2JHE A;  5CLS A;  4ARZ B;  3I4P A;  2JK3 A;  2IS1 A;  4P85 A;  4NG2 A;  4RLQ A;  3HGY A;  1F43 A;  3N8R A;  4BGD A;  2ZC6 B;  4IN9 A;  2E60 A;  2DK5 A;  1HA8 A;  3FHN A;  2J3T D;  2Q9M A;  3CCE I;  1XSD A;  1R5H A;  2PLY A;  1SD6 A;  3HOU J;  1QIB A;  3WS0 A;  1MWR A;  4M3K A;  3AG1 H;  4X69 A;  4Q0J A;  5FAP A;  5D1T A;  5HOD A;  3OPR A;  1XFY A;  1LDJ A;  1TF1 A;  5KAI C;  3TO7 A;  5F1G A;  1J75 A;  4WL9 A;  3IX8 A;  4PFO A;  4I5S A;  2ZXI A;  4EJW A;  2O7O A;  2HDD A;  1MMR A;  1G8X A;  4QY5 A;  5AQA A;  3MXQ A;  4UUS A;  1ODV A;  5JVG F;  2XGX A;  1D8M A;  2R7D A;  2PJT A;  5C4J J;  5HAI A;  3IX3 A;  3ZQH A;  5E79 C;  1K7Q A;  3BC8 A;  5JYO A;  1IV8 A;  3OCL A;  1R71 A;  4H4K C;  2XFS A;  2BGC A;  2ID6 A;  4KMF A;  4HV6 A;  3AYU A;  3VOD A;  4DZP A;  1OTB A;  1IN8 A;  3H5A A;  3DL1 A;  2QLZ A;  4FX4 A;  3K3C A;  4G6Q A;  2X48 A;  2M4G A;  4UA9 A;  4HEA 2;  2M7A A;  1O0T A;  3IL2 A;  2KMU A;  1K7G A;  5K7H A;  1JTX A;  2QJ5 A;  1H88 C;  3LGP A;  1KAP P;  1R9T J;  3K69 A;  1K6O A;  3W6K B;  4GO1 A;  1T95 A;  1WYC A;  4KZ4 A;  2OSU A;  1OCZ H;  2HGC A;  4P9F A;  3ASO H;  3QOP A;  4L5I A;  4RAG A;  4CUG A;  3D5L A;  1MJ9 A;  3DKX A;  3RQI A;  4HF0 A;  3KHI A;  3LEZ A;  4KUO A;  1TVI A;  1E2X A;  4RAY A;  3S2W A;  2D1N A;  4KUM A;  2UXN A;  5IT9 K;  4X55 A;  3SS4 A;  3LUN A;  3VOY A;  4E7K A;  2F6C A;  1OCO H;  2LY2 A;  3VSL A;  3N7W A;  2XSD C;  2J80 A;  2EA2 A;  2NVU B;  5ICG A;  2LC2 A;  3CG5 A;  2K5C A;  3CI6 A;  4OPZ A;  4B47 A;  4ZH4 F;  3IUO A;  2YPR A;  4FSF A;  4FX0 A;  4B88 A;  1XN7 A;  1G3S A;  4PKT A;  3R61 A;  1BJA A;  2D1V A;  5J3L A;  2Y6D A;  3OMY A;  1KYZ A;  1WJC A;  4M3B A;  2NVQ J;  1J9M A;  4L7A A;  3WTZ A;  2A6H F;  1YLY A;  4KIB A;  1SD4 A;  3PBT A;  1U6G A;  3MXR A;  3OL4 A;  2V20 A;  1K55 A;  2BY3 A;  2FV5 A;  3HUM A;  5IT5 A;  4CLC E;  4FH4 A;  2X0L A;  2WO9 A;  3CCM I;  2H8R A;  3KME A;  4BHC A;  1NK3 P;  4CCO A;  3LIC A;  2EA9 A;  5TR7 A;  5EUA A;  2R7U A;  3F21 A;  3C2B A;  1J59 A;  4UA7 A;  4YFK F;  2E34 A;  3JPU A;  3Q82 A;  3RIR A;  2NS8 A;  4I3J A;  4HQM A;  5CEC A;  4OIR F;  2XFT A;  4LV1 A;  3LSM A;  1D1B A;  3H92 A;  1VFC A;  5LRS A;  4HX8 A;  3DPL C;  3E1S A;  1ZR4 A;  4X6A J;  2HYJ A;  4E6W A;  2Q2E B;  3H35 A;  3MWM A;  2GDN A;  5EVI B;  2XIG A;  3LJZ A;  3ZHH A;  5ILS A;  2LB9 A;  1C0W A;  1TQP A;  3EPZ A;  5IT9 Z;  3KEY A;  3ZXH A;  3LSR A;  4FTX A;  4ASN A;  2M8E A;  3G6O A;  3PBS A;  4M3F A;  4EV4 A;  3R6S A;  1FZP B;  4KFC A;  1XJ2 A;  3F8M A;  1IAB A;  1RGY A;  3JRF A;  4BY7 J;  3ABU A;  5DTK A;  3RH8 B;  2QYO A;  5TJJ A;  4HPQ A;  1JGS A;  3RPQ A;  3ZXS A;  1XD7 A;  1ZEL A;  2W3D A;  4U0X A;  3JRB A;  2V1U A;  1BI2 A;  4PJM A;  3LFV A;  4FXQ A;  2R7X A;  4F91 B;  1QJI A;  5B5E C;  4O3M A;  3WS4 A;  5MC7 A;  3BY8 A;  2G2U A;  1S29 A;  2KZG A;  2P74 A;  2ACJ A;  1OMJ A;  3E0Y A;  1I1G A;  2VJW A;  1LE8 B;  3HB9 A;  2CUZ A;  3W2V A;  1JWV A;  4IUH A;  1XDS A;  2STT A;  2L9R A;  4I09 A;  3QHY A;  2DK8 A;  4CH7 A;  2I8D A;  1W7F A;  3KYE A;  3DTE A;  4RVA A;  2RNJ A;  4BBR J;  3D3O A;  4JKT A;  1XMA A;  3ZVW A;  3RKQ A;  2C6Y A;  2YU3 A;  4LK1 F;  4M9X A;  3W2Z A;  2Y0S N;  5DCF A;  4XKC A;  5B1B H;  2CMN A;  1B9N A;  2P5V A;  3ZYT A;  1MWT A;  3GR2 A;  2P6T A;  3RYR A;  5GLC A;  5M3F J;  3U4L P;  4GF1 A;  3C1D A;  4FU4 A;  4K0X A;  4WEJ A;  3MKW B;  3MS6 A;  2HDQ A;  3TQN A;  2XF6 A;  4HNB A;  3KSG A;  3SOI A;  2HFH A;  4X25 A;  4UB6 C;  2V1Z A;  1ZTU A;  4Y0T A;  4KJZ A;  3FK7 A;  2HI3 A;  5E20 A;  4R4S A;  1USS A;  4OLG A;  2PR6 A;  1BZA A;  5LBR A;  2HQA A;  2B02 A;  3TG9 A;  2GOX B;  1VET A;  3G31 A;  4PHT A;  4U88 A;  4F94 A;  3F15 A;  2PR5 A;  1RRJ A;  3RTY A;  1K78 B;  3D9Y A;  1APL C;  3A3F A;  5D5X B;  4YFM A;  2X02 A;  4KQR A;  2R0Q C;  1ROS A;  2CRG A;  2K31 A;  1ZHH B;  1GVD A;  3CJM A;  4BJ5 C;  2M2E A;  3BLY A;  1IKI A;  4ARZ A;  3KET A;  1R4M B;  4K08 A;  4L9T A;  4KYW A;  1POG A;  1TWF J;  1SVL A;  3RSN A;  4C2M J;  4EJV A;  2Q9N A;  5L09 A;  3MN2 A;  2EFO A;  1UHW A;  1XPB A;  2DBB A;  2JRM A;  4LGW A;  2LRE A;  1P2F A;  1B9M A;  3DLA A;  3EDG A;  2HKO A;  2HJE A;  2EFX A;  2VL8 A;  4M3G A;  2P81 A;  1OM7 A;  5HWT A;  2WOA A;  2OI0 A;  3UB8 A;  3M1E A;  4ZTJ A;  1YW7 A;  1I76 A;  4CZC A;  2NAZ A;  3FHZ A;  1XA7 A;  1ZAO A;  1AST A;  2WKH A;  3HOZ J;  1G12 A;  2NVT J;  1NRF A;  3ICY A;  3KLO A;  2JA7 J;  2WZX A;  4H1Q A;  1VQO I;  2PRF A;  1FBQ A;  2DMN A;  3WTS C;  3TGN A;  2FU4 A;  4PJ0 C;  2L7F P;  3EWJ A;  4MQV A;  3DWZ A;  2K9S A;  3HUO A;  4HEF A;  4GXO A;  3G32 A;  2VBX A;  5FGM A;  3MFD A;  3JTH A;  1TDG A;  5EM1 A;  1FBS A;  1BSG A;  1K54 C;  2F2E A;  4ZDP A;  2QQA A;  5FI7 A;  3IS2 B;  1HVB A;  3OPL A;  2VXD A;  2HYF A;  3WU2 C;  2HZ5 A;  5F08 A;  3AL0 B;  2L9N A;  1VB6 A;  4KT6 A;  1GCE A;  5K1Y A;  3IAS 2;  1UEL B;  2DI3 A;  4PKW A;  4BMW A;  4HDV A;  2QYB A;  2L01 A;  4B48 A;  3EDZ A;  4J00 A;  2OY4 A;  3VI1 A;  2LSO A;  3L2R A;  1KGE A;  4I38 A;  3ZVT A;  5F27 A;  1BR4 A;  1N9L A;  1TP4 A;  4H49 A;  4BDY A;  3HDD A;  4KIC A;  4OQI A;  3NAU A;  2JA2 A;  1OPX A;  1ZG5 A;  1T38 A;  1JE8 A;  5AQ9 A;  2A49 A;  2E1C A;  1YIJ I;  2OF7 A;  5DD8 A;  1ZVX A;  1QHH D;  4M3D A;  4JXW A;  3RXW A;  2ZLY A;  3GFJ A;  3IKT A;  3CZD A;  5JLW A;  2MJ6 A;  2TCL A;  4BH9 A;  1Z3Y A;  1AYK A;  2JRT A;  3L1P A;  3LO7 A;  1W63 M;  3KP3 A;  3Q0W A;  4UVC A;  2DFI A;  5TBM A;  1ETK A;  4E7J A;  2PBI A;  2F5F A;  3N2U A;  3HTS B;  4XN0 A;  4H2E A;  2DDA A;  2L7M P;  2BLS A;  1EKE A;  2HQN A;  1TC3 C;  4G7H F;  2CH0 A;  4CQH A;  1ODD A;  1XKZ A;  5FLX K;  4GRI A;  5FRM A;  2N8G A;  1W7P D;  4ME4 A;  4GLQ A;  2CFO A;  3HOW J;  4C2U A;  1K25 A;  5J1Y A;  4XXR A;  3TL4 X;  4MEZ A;  1HD8 A;  2VV8 A;  1V4R A;  2C6W B;  2IEK A;  966C A;  3TW6 A;  2M4K A;  5DCM B;  1Q2P A;  4R23 A;  4D9J A;  4MN5 A;  4AWX B;  2DMU A;  2GA2 A;  2K7L A;  2GOM A;  2Q2E A;  3DV8 A;  4WM9 A;  2Y48 A;  1P7I A;  4C3J J;  4B8X A;  1Y8Q B;  3WRT A;  1ES4 A;  2XV4 S;  4X53 A;  4IBR A;  3QP1 A;  3NEU A;  4GS9 B;  2A6E F;  2ZQ8 A;  4X68 A;  2VQH A;  1Y56 A;  3DPU A;  3IF6 C;  1GKC A;  2K4J A;  3MKE A;  2FML A;  1VZ0 A;  2E8J A;  5GTI C;  2HGV A;  3O5Y A;  1OQY A;  3MFX A;  1P9R A;  2L5Q A;  1UST A;  4U0T A;  5L10 A;  4DMZ A;  3OWT A;  5FKN A;  1Z6R A;  1C8T A;  3PO2 J;  1RIO H;  3LSH A;  4BWI A;  2PU4 A;  2WKE A;  3ERE D;  1BI0 A;  3BFC A;  1JWP A;  5HW3 A;  3K4B A;  2B7E A;  1K6Y A;  2M0C A;  1D8J A;  4LLN A;  2D01 A;  1SMT A;  2VOD A;  4G6T B;  2OOL A;  4LRX C;  4A0Z A;  4DJA A;  1OIS A;  4V2G A;  3ECO A;  1OYI A;  1XG1 A;  1H0M A;  4B4C A;  2E1M B;  4II3 A;  5FLX Z;  2ID3 A;  5D8K B;  4D5F A;  3G73 A;  1G4D A;  2GQQ A;  1R1T A;  4KNY A;  1LE8 A;  1OJG A;  2ZO4 A;  1CXV A;  4Y15 A;  2KDO A;  1A0K A;  1GKD A;  3A0H C;  2YKF A;  1ENH A;  4E3M A;  1LNW A;  5D7W A;  4CA0 A;  3V42 A;  3OOP A;  3CUQ B;  5CGW A;  1BW5 A;  3LID A;  3E2L A;  2KRC A;  3LCE A;  2H27 A;  3CMZ A;  2RN7 A;  1FYM A;  5J6X A;  1MND A;  4EQ1 A;  1Z7U A;  2DRW A;  3IHA A;  2BW3 A;  3FG8 A;  3RQ4 A;  4XNF A;  3SDB A;  4RDU A;  4HST A;  1R23 A;  1KBC A;  1REP C;  4G8X A;  3GQZ A;  3OYL A;  3WU1 B;  3TRC A;  5KHD A;  5F64 A;  2Z16 A;  1IEL A;  3SS3 A;  4H6J B;  5CTM A;  1IXC A;  4IBX A;  3KP2 A;  2XF7 A;  3E5X A;  4HMA A;  1JT0 A;  4AXQ A;  2GA1 A;  3S1R J;  2W14 A;  1K78 A;  3KSI A;  1OT6 A;  2G2W A;  2WKI A;  1YT4 A;  1UEA A;  3O3K A;  2KIF A;  3HSE A;  1AU7 A;  4XLN F;  3OPP A;  1R1V A;  5GHZ A;  4CLC B;  1DRM A;  1YYV A;  2M3A A;  3AIG A;  4P9U A;  4BBT A;  3DFG A;  4BS9 A;  4YIN A;  3F8F A;  1FOW A;  1YS6 A;  3L2W A;  2JN6 A;  3A2K A;  1NLZ A;  2BV6 A;  4UNO A;  4MHG A;  3L2Q A;  1KU3 A;  1XCV A;  1UG0 A;  1GE7 A;  5ERI A;  5EOE A;  3UNG C;  3DKY A;  4AYK A;  3LIE A;  1TS8 A;  3FK6 A;  2DU9 A;  3JAM Z;  5J4V A;  3E7L A;  1PNE A;  3HB2 P;  5JLX A;  2ZC3 B;  3QPT A;  4IHT A;  4KIG A;  2EZI A;  2XAU A;  4OQ0 A;  1N9O A;  3BM6 A;  1V9Y A;  4LEN A;  2L0K A;  2DTZ A;  3BP8 A;  3CKI A;  4B3X A;  5CJ9 A;  2CGP A;  2DA5 A;  3S32 A;  2VON A;  4ENM A;  1JTG A;  1N77 A;  5F5Y A;  1JHF A;  3ELK A;  1Y1W J;  3ZG8 B;  1L0O C;  1D1C A;  2O3E A;  1AWC A;  5IP6 A;  4ZTF A;  3HG9 A;  2EWN A;  2VX8 A;  1H8A C;  1FLS A;  3ZQF A;  1WZ2 A;  2VKE A;  4BD1 A;  2EV5 A;  3IC7 A;  1MMS A;  3G35 A;  1NJ4 A;  1DQU A;  1G3W A;  3HPH A;  2DLL A;  5BNG A;  3IS2 A;  1W7P B;  2VI6 A;  3MZY A;  3RTS A;  3EWK A;  1OCP A;  1I2S A;  1XGN A;  3W8K A;  1BKC I;  2Q1Z B;  4A3L J;  3KLN A;  3BG3 A;  2XB0 X;  4I76 A;  5FQK A;  4UHU A;  3CP2 A;  3T4O A;  5L2F A;  2KKO A;  3HTU A;  5KK1 A;  3EGD C;  1ONH A;  4EGZ A;  3PIO F;  1ZP5 A;  1S1Y A;  1MWU A;  1U0J A;  2QCO A;  1FYL A;  4UEY A;  4UVA A;  1UGU A;  2XA7 S;  4A3C J;  4GDB A;  2R7O A;  2NOJ B;  3ZPL A;  5FKM A;  1DU0 A;  1OTD A;  2IT0 A;  3NHQ A;  2Y9Z A;  2L0W A;  3VP4 A;  3MR0 A;  5C44 J;  2ME0 A;  5KSH A;  5E1Z B;  3UPP A;  5FFX A;  3I54 A;  3ZG9 B;  4HES A;  4FHT A;  2Y2Q A;  4IED A;  1QMF A;  4HJ3 A;  2Q8K A;  3NWS A;  2IVM A;  2V26 A;  1SKF A;  3PL8 A;  4CPK A;  4GD8 A;  2Z9O A;  2XDV A;  5GLD A;  5CVR A;  4BLM A;  5KMW A;  3S3N A;  2QQB A;  1J7N A;  3DBH B;  2O03 A;  1B72 A;  2CLT A;  4WK7 A;  1IAG A;  2OU2 A;  1Y28 A;  4UV9 A;  4L63 A;  2AO9 A;  1WSU A;  3LK8 A;  4CCL A;  3C2H A;  5DF7 A;  1KA8 A;  3W2W A;  3H9Q A;  1FSW A;  1RI7 A;  5BPD A;  4GW9 A;  5DCM A;  1JIW P;  3IWO A;  1LLB A;  2IW5 A;  1S6L A;  2O9B A;  4WXH A;  4MTE A;  2R3S A;  1Z3X A;  1VI0 A;  4RBO A;  3UDI A;  3I58 A;  2ISY A;  4IJA A;  3JRD A;  2J3W A;  1MDM B;  4FT8 A;  2DJI A;  2VZW A;  4EBN A;  3OYJ A;  1ZRC A;  1FIA A;  1KDW A;  3ZCZ A;  3I9V 2;  4BE0 A;  4Y5F A;  4ID4 A;  2WK0 A;  5CHU A;  1F36 A;  1OLT A;  3AG3 H;  2ZXW H;  1J2X A;  4XRS A;  3FZV A;  3BFF A;  2OW0 A;  2K9L A;  2P04 A;  2R9X A;  2X1D A;  3SFI A;  3O6B B;  2PJP A;  4HG2 A;  3ZMS A;  3H1C A;  3CCS I;  5K7Z A;  3ZDJ A;  1FCN A;  3T4S A;  2XAQ A;  3F1N B;  3GEZ A;  1BSW A;  3A0S A;  1YKD A;  3F16 A;  1Z05 A;  3HKZ N;  1B4A A;  3TOI A;  2MBF A;  1NK2 P;  3KWV C;  4L5E A;  4YEJ A;  5L7F A;  2CQQ A;  3HOS A;  5DS9 A;  5G4Z A;  2M1B A;  1SC7 A;  1DJC A;  2JPC A;  2UV0 E;  2Y2L A;  3CJT B;  5IU1 A;  1Y39 A;  1WCM J;  2KRJ A;  1QGP A;  2CQ7 A;  4E3J A;  1ULY A;  1OR7 C;  4WZV A;  2MA3 A;  1HW5 A;  3DW0 A;  4LG0 B;  2K9C A;  1SD5 A;  3BJA A;  3CUQ A;  2MZE A;  2CQK A;  1MC0 A;  4BYY A;  2EIK H;  3V8K A;  3I64 A;  3LA7 A;  2OAQ 1;  2F5V A;  4LPZ A;  1QZY A;  4X1M A;  1PWG A;  4FOF A;  1OO9 A;  1RKW A;  2CV2 A;  3A01 B;  1SMP A;  2AQE A;  5KIZ A;  3FXM A;  2JKG A;  4BNC A;  1K61 A;  2XKO A;  5FLV A;  1R7J A;  1D7X A;  3KP4 A;  2LYC A;  3F0C A;  2D02 A;  5FQ9 A;  1JKY A;  2JWT A;  3GTC A;  1IXS B;  3HRE A;  3O88 A;  1C3B A;  4NXB A;  4GJ4 A;  1R22 A;  2LLK A;  1YJ9 I;  3A03 A;  1FSH A;  1M1E B;  1TBX A;  3M9A A;  3VP3 A;  1NLY A;  3T5X A;  1G68 A;  2VV7 A;  1GE6 A;  3TW7 A;  4EM0 B;  2O99 A;  3L09 A;  1R00 A;  1YLP A;  2UWM A;  4G0D A;  2VOO A;  4Q47 A;  2XS4 A;  1QBJ A;  4CLC A;  3I7J A;  4HF2 A;  3C38 A;  3LE9 A;  4QY6 A;  3GW2 A;  3FKI J;  3FM3 A;  2YS9 A;  4IHS A;  3ZFZ A;  1D0Z A;  2L7Z A;  2O5R A;  4OIQ F;  3FIW A;  3DU6 A;  3OHL A;  4AYB A;  2CQX A;  4UQI M;  1QVT A;  1WYB A;  2KL4 A;  4FAS D;  1JAO A;  3B47 A;  3D5S C;  3LSK A;  2A3S A;  830C A;  4EM2 A;  4HV5 A;  2ECB A;  4II2 A;  3VE3 A;  3HOY J;  2QSG X;  3CCR I;  3ROU A;  4ON1 A;  2JT6 A;  2QGU A;  2J5O A;  1VHM A;  1ETQ A;  4C30 A;  2CU7 A;  3QYB A;  2GAU A;  5FKO A;  3CCV I;  1Z09 A;  4WYY A;  4HNT A;  2PT7 A;  2X4H A;  1HLV A;  5CTN A;  4IQ4 A;  4I3I A;  2BY2 A;  4EJU A;  2V8C A;  3SH7 A;  4PUS A;  1OPC A;  5CKT A;  4I03 A;  4XN3 A;  4GWM A;  2EZH A;  3GLX A;  5GHX A;  5DM6 F;  2ZNY A;  3L2V A;  3PAG A;  4L9J A;  5ED4 A;  4QJG A;  2QSF X;  2DT7 B;  2CW7 A;  1O3Q A;  2JSC A;  2E2H J;  4GUY A;  4CO8 A;  1RCJ A;  4RB1 A;  1DPR A;  1IYS A;  5B5P A;  1MNM C;  4ZJ3 A;  1CAQ A;  2MLR A;  3UE0 A;  3G71 I;  2RNG A;  2DYS H;  1IN6 A;  1T0F A;  3EEH A;  1W7P A;  1T39 A;  2F4M B;  3E6B A;  4BEN A;  2VN2 A;  2B95 A;  2ZSH B;  2VKD A;  3KYQ A;  3GUD A;  1EW0 A;  2W57 A;  1ZR2 A;  4JX4 A;  2LFB A;  5E3M A;  3L2C A;  1WRJ A;  2H0T A;  2DOE A;  2HPB A;  1V5F A;  4GQL A;  4S2N C;  5HFO A;  6PAX A;  2V4J C;  3LSG A;  1SLN A;  2WB1 A;  1UHM A;  2O36 A;  3T4T A;  2KLO A;  2Q0O A;  3G4S I;  3M3Y J;  3WTX C;  2WTE A;  3H5N A;  1GHI A;  3KSF A;  2BZT A;  2ZQ7 A;  3PQK A;  1CF7 B;  4XK4 A;  1D5Y A;  3NDE A;  4I99 C;  2DFE A;  3G2Z A;  2PHY A;  4BL2 A;  2Y9Y A;  4RLF A;  1SDE A;  3SW1 A;  2X6Y A;  2KOI A;  2R93 J;  4H30 A;  3I4N J;  3BRM A;  2BAS A;  2LDU A;  4Y3O A;  1GSX A;  4U3T A;  1A6I A;  4YFN F;  5CED A;  1MBH A;  2F4I A;  1PJR A;  3ZQL A;  3EHY A;  3GFI A;  3OIQ A;  4PKV A;  2XQZ A;  4OH0 A;  1N25 A;  2BEO A;  1ZTQ A;  3BTJ A;  1LFU P;  2MLS A;  2Z2M B;  1X2N A;  4Q0H A;  3OS0 A;  5HS7 A;  2MD5 A;  2DQR A;  2DMW A;  1ZS0 A;  4KDP A;  1R58 A;  1QUA A;  4NC8 A;  3T1R A;  1I3Q J;  1O7E A;  1MKI A;  3KP7 A;  1FP1 D;  3G5C A;  3A4C A;  4JQG A;  1MDM A;  1PI5 A;  3VFH A;  1HCR A;  1EJ9 A;  2ZJ9 A;  4R6L A;  2OA4 A;  2A2L A;  3WGH A;  3SJM A;  3BCB A;  4I7H A;  4JOM A;  1CGL A;  2XH9 A;  4BHP A;  1LSV A;  3CPT B;  3ISG A;  2GXA A;  2VGL S;  5JHF A;  1MBE A;  3MD2 A;  3V96 B;  1MJA A;  1X2M A;  3KEC A;  1K4S A;  3BPX A;  4E3N A;  4WCG A;  3ABT A;  1HF0 A;  2WGW A;  1XA1 A;  2QQ8 A;  4NHJ A;  1CQR A;  2EIL H;  1DU6 A;  1RPW A;  4IOC F;  2VXZ A;  4BQQ A;  3V7R A;  5ICC A;  2XPV A;  1L0D A;  1XSV A;  4GDF A;  4N4N B;  1XFV A;  2HTS A;  5L8M A;  2KZV A;  3P09 A;  2GIZ A;  3F1N A;  1BR2 A;  3A3J A;  5JR3 A;  2R7Q A;  3MZ8 A;  1X19 A;  4S2P A;  5L3G A;  3KP