3DTMA

Increased folding stability of tem-1 beta-lactamase by in-vitro selection
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRSEERFPMMSTFKVLLCGAILSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKGLTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTPASRQQLMDWMEADKVAGPLLRSVLPAGWFIADKSGAGERGSRGIVAALGPDGKPSRIVVIYTTGSQATMDELNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased folding stability of TEM-1 beta-lactamase by in vitro selection
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3dtmA00
1LI9A 2ZQCA 4KZ9A 4FH4A 1ALQA 3C7VA 5FAPA 4FSFA 4E3OA 4JF5A 2ZM8A 1IYOA 2I72A 3ZNTA 4Y0OA 1K4FA 1PI5A 1K56D 3NY4A 3OZHA 2X71A 3HLBA 2WZXA 1EWZA 4LV1A 5GLDA 5HW3A 1EI5A 3ZHHA 2V1ZA 2C6WB 1KDSA 2P9VB 1S0WA 4MBKA 4BJPA 4GOGA 5E2EA 4S2KA 4S2IA 4X69A 3B3XA 3SH8A 1QMEA 3Q7VA 3VOYA 1O7EA 1DJBA 4R23A 3GTCA 5HFOA 1ES2A 4X56A 5FAOA 1L0GA 2Y91A 5EUAA 5HX9A 2Y2NA 1KE3A 3UY6A 1LL9A 3LCEA 3VSKA 4OVDA 1AXBA 1K54A 3A3JA 4U3TA 5BOHA 3LY3A 4KG6A 1BTLA 4P0MA 3WS0A 4LCMA 4EUZA 3JYIA 4C3QA 3HLCA 5HL1A 3Q7VB 4R3BA 1KVMA 5GLBA 3EQVA 3ZVWA 5DF8A 4KENB 4EWFA 5DF9A 4JLFA 1NXYA 2FFFB 3BFGA 3TOIA 1K6RA 1K25A 2H0YA 3VMAA 1FR6A 3N8RA 4H8RA 2XGNA 5HAQA 4M3KA 3UDXA 3VFHA 1CI9A 2WKEA 4RX3A 2HDQA 4GZBA 1BZAA 3CG5A 2G2UA 3P98A 3BFDA 4LV2A 4ZJ2A 2C5WB 3WRZA 4A5RA 5J8XA 3DWKA 3LY4A 4OQIA 4WELA 4WMCA 3S22A 4PM7A 3FWLA 2EXBA 4E3IA 1FCOA 2ZQ7A 2WGVA 5FSRA 5FQKA 4IBRA 4WBGA 5M18A 1XA7A 4GKUA 2Z2LB 3D4FA 3NDGA 1IELA 3V50A 3PBTA 1HZOA 1I5QA 1OMEA 1ERQA 3AGFA 5F83A 2EX2A 5HARA 3PTEA 4PPRA 4WZ5C 4GDBA 3UPOA 5U47A 5FQIA 5KSHA 1RGYA 1L0FA 1IEMA 2ZM2A 2ZQ8A 4HESA 4P6BA 4FD8A 4R4SA 5CERA 4KZAA 5E2HA 4JBFA 2R9XA 4LV0A 2J7VA 4OP8A 1ONHA 1XPBA 1FQGA 3A3EA 3ZVTA 3IXHA 4HBUA 3DTMA 4C6YA 5EVIA 4E6WA 2EXAA 3M6HA 1G6AA 3A3DA 1MWUA 3GRJA 2EFUA 4WYYA 3VP1A 4JXSA 2WKHA 4GB7A 5TFQA 3GMWA 4S2MA 2H0TA 2WK0A 1H8YA 4Y0TA 4QHCA 5F1GA 3IF5A 3FKVA 4E3LA 2Y2OA 3MZDA 3IHBA 3SS3A 1K6SA 1ESIA 2DNSA 3G35A 1GCEA 4O7DA 1MBLA 1IKGA 5EVIB 1BLSA 3RXWA 2Y2KA 2J8YA 1SHVA 3UPPA 3NC8A 1IKIA 1K57C 3UO9A 2WGIA 4QY5A 5CGWA 1PWDA 1FSYA 3W4OA 4Z9QA 2ZC3B 2J9OA 1K38A 4KQOA 4Y0UA 4DRTA 5KSCA 2XDMA 3N4IA 4JXGA 4K0WA 4D2OA 4DE1A 4DE3A 3WWXA 4F94A 4KZ6A 4BQMA 2HDUA 1SDEA 4KQRA 4Q8IA 2GDNA 2XK1A 4WM9A 5M19A 3NBLA 1FCNA 5DVAA 3ITBA 3PAEA 5E43A 5JYOA 1YLTA 4OPRA 4IBXA 1KDWA 1PIOA 2JCHA 5D3OA 1JTGA 4R4RA 1LL5A 3AGDA 4X68A 2UWXA 2EX8A 1ERMA 4KG2A 1KGFA 4BD0A 3CJMA 3PBSA 4PM9A 5TGFA 1WE4A 3ISGA 2XLNA 5CTNA 1N9BA 5DTTA 3A3IA 3HREA 1LHYA 4QY6A 4R1GA 4KZ8A 1NJ4A 2H5SA 2XH9A 3WS5A 1E25A 1BLCA 1HTZA 1JWPA 1C3BA 1MWRA 4LCLA 4S2JA 4DXBA 3V3SA 1FCMA 1MY8A 5GL9A 5FI2A 3QNBA 1YLZA 2ZJ9A 3WS2A 3IXBA 1TDLA 1NZOA 2BLSA 3Q81A 2B5RA 4JKTA 3ZG7B 5FATA 2XF3A 2Y2MA 4GD6A 4S2PA 3C7UA 3N8LA 2OV5A 1RGZA 3UDFA 2WYXA 3A3FA 5I94A 3AGEA 1DJCA 2J9PA 1YMXA 5FI6A 5E2FA 4WMCD 1LI0A 5GHXA 3ZFZA 4BD1A 4DE0A 2Y4AA 1MKIA 1W5DA 3UN7A 1XP4A 2XFTA 1XX2A 4S2LA 3OPHA 4HEFA 4N1HA 5TR7A 2XEPA 1BUEA 2Y2PA 3G34A 3NI9A 4DE2A 2G2WA 4R0QA 5FAQA 4WZ5A 5EE8A 4UA7A 1Q2QA 4RX2A 3HLFA 5A92A 2BG1A 2HDRA 3SH9A 5M1AA 4C75A 2JBFA 2R9WA 2ZC7A 4X55A 4KZBA 4NK3A 5F1FA 2VGKA 1PWCA 4NETA 1XGJA 5GHYA 1YLYA 4OONA 5HAPA 4BL2A 5AQAA 2Y2HA 3VP4A 4PM6A 1Q2PA 3IWIA 2WADA 4P85A 5EVID 3VP0A 3PBQA 4EBPA 1PYYA 1M40A 4OQHA 5AQ7A 4JF4A 1HD8A 2ZQAA 2EX9A 1RCJA 3HLWA 4JPMA 3BFFA 3DW0A 3FYZA 1KGEA 3GSGA 3M2KA 5A91A 4WEKA 4GN2A 4PM8A 4OLDA 3MXSA 2VGJA 2PBYA 3Q82A 1ES5A 2V2FF 5G18A 1ESUA 4RVAA 3QNCA 2XQZA 1DY6A 3UE3A 1M6KA 1PW1A 4JXVA 3TG9A 2ZC4B 4EV4A 2IWBA 5CEBA 1SKFA 3BLSA 1H5XA 1K57A 2Y2LA 2ZC6B 1SCWA 1I2WA 4PM5A 3HUOA 4MNRA 1NYMA 1W7FA 1WYCA 4GD8A 5CGSA 3OPRA 3E2LA 4OPQA 3LEZA 5DF7A 3GVBA 1J9MA 1KE4A 1ZC2A 3VP3A 5EOEA 1CEGA 5CEDA 1BLPA 1S6RA 5FQQA 1TVFA 5GLAA 1TDGA 2IWDA 3IQAA 3S1YA 4CPKA 1H8ZA 4ZJ3A 3OCNA 4B4ZA 2XD1A 4KG5A 4QB8A 4JF6A 1JWVA 1L2SA 4ZJ1A 4KZ3A 4XXRA 1RP5A 3UE1A 1NRFA 3VFFA 3IH8A 1BLHA 1YQSA 1ES3A 1ZG4A 3MXRA 4MLLA 5DTSA 1YMSA 3S4XA 4U0TA 2WZZA 1BULA 4B88A 5A90A 3HLDA 3MFDA 1XKZA 2OSUA 3FZCA 4S2NC 5CHJA 1PW8A 2ZMAA 2E8IA 2ZC5B 4KZ5A 1CI8A 1LLBA 5CHMA 2P74A 5FQ9A 1Z6FA 3BFCA 1W8YA 4OP5A 3HUMA 4E3JA 4YFMA 1YT4A 4ZAMA 3OCLA 2Z2MB 4OPZA 1CEFA 3OPPA 2OLUA 1HVBA 2DRWA 3O87A 5EOOA 4OQGA 2RCXA 3IF6C 3IXDA 3ZCZA 1IYSA 3IWOA 3M6BA 3MKEA 3SS5A 3V3RA 4E3MA 2QPNA 4N9KA 4YINA 2V20A 3DWZA 4OH0A 1GHIA 4Y7PA 4BL3A 2WGWA 4B4XA 2FFYA 1K55C 2HP9A 3Q7ZA 4EBNA 5FA7A 1G68A 4LV3A 3RXXA 1KE0A 5CGXA 3NDEA 2HPBA 1N4OA 4EBLA 1KVLA 2ZQ9A 3G32A 3Q1FA 5HAIA 3P09A 4XUZA 5CECA 1FR1A 4LENA 4ZTKA 3OC2A 3IT9A 1ES4A 2RL3A 2OLVA 1PZOA 4RYEA 1YLPA 2A49A 2WGWB 5CRFA 5GHZA 1ONGA 4UAAA 4QU3A 3MKFA 3ZDJA 3N8SA 5JYPA 4HBTA 1IYQA 4DF6A 2CC1A 1NY0A 3BYDA 1TEMA 4X6TA 1U60A 3HBRA 4KZ7A 5CHUA 4XUXA 1L0DA 4IVIA 3G30A 4UA9A 3ZG0A 1E3UA 4BENA 5KMWA 2ZM0A 3G2YA 3GR2A 3HUNA 3I7JA 3NCKA 4S2OA 3N6IA 5FASA 1XXMA 1VM1A 1MWTA 1W8QA 3O86A 3E2KA 3ZG8B 4E6XA 3MZFA 4OOMA 4DKIA 1K56A 1KGGA 1WYBA 4MBFA 3BLMA 1CK3A 3ITAA 1FSWA 2HP5A 5FDHA 2QMIA 4MBHA 4CJNA 4QD4A 1YLJA 3G2ZA 5IHVA 1DJAA 2HDSA 1MXOA 1VQQA 5E2GA 3N7WA 3ZGAB 1ZG6A 2XR0A 4ID4A 3G4PA 4K91A 4DDSA 1GA0A 1SDNA 3HVFA 1XGIA 3RJUA 2WKIA 3WS4A 4JXWA 2WAEA 3BECA 4R3JA 4DDYA 3HL9A 1MWSA 5L2FA 3BM6A 3HLEA 3MZEA 3PBOA 4OLGA 4OOYA 3MBZA 1K4EA 3O88A 4OKPA 3W8KA 1K54C 5EPHA 4ZDXA 4WEJA 3HLGA 1BSGA 2HP6A 1JVJA 4ZBEA 3FV7A 4L0LA 3QHYA 1NZUA 1QMFA 5CTMA 3WRTA 3GV9A 3UNWA 3WS1A 3PBRA 4BLMA 3W4PA 2Y2IA 3C4PA 4N1XA 4KQQA 3VP2A 2XFSA 4P87A 3OPLA 3SS4A 2ZLYA 3O3VA 3SOIA 2PU2A 1PI4A 3UE0A 2X01A 4RA7A 5EECA 4KZ4A 3G31A 3NIAA 3ZG9B 4FH2A 4N9LA 3CZDA 3EQUA 3FKWA 3BFEA 2A3UA 3M2JA 4FCFA 3CMZA 4S2NA 5DTKA 3ZNYA 4E3NA 5AQ9A 3C5AA 2Y2JA 2Y59A 3IWQA 1W79A 3LO7A 3UPNA 1YM1A 3SH7A 1ZKJA 1PZPA 2IWCA 3ZG5A 1L0EA 4EQIA 1O07A 3VOZA 2JC7A 1NYYA 3GQZA 3IF6A 4OOLA 4IVKA 1EROA 3BEBA 1GHPA 5F82A 2EFXA 3IHAA 3IH9A 1MPLA 1K55A 3BRMA 4OPYA 1XA1A 5FQJA 2ZQDA 4MEZA 5FI7A 4E3KA 1IYPA 4U0XA 1GA9A 4GNUA 4QJGA 4PMAA 2Y2QA 3PBNA 3W4QA 5FQMA 5GLCA 4K0XA 5AQBA 3IF6B 2WUQA 1PWGA 3UDIA 4OQ0A 5EVIC 2WAFA 1GHMA 2QZ6A 1BT5A 3IXGA 3VSLA 5A93A 4GDNA 5KZHA 4WZ4A 3TSGA 1I2SA 4DXCA 3V39A 3Q07A 2JE5A 2Q9MA 2ZD8A 1FOFA 1JTDA 4N92A 1YLWA 2H10A 4UA6A 3V5MA 5CXWA 2DCFA 2EX6A 4IEDA 3C4OA 2Y55A 1JWZA 2X02A 2XD5A 2P9VA 4UHUA 1E4DA 1Y54A 3PAGA 2Y2GA 2PU4A 1E3UD 2Q9NA 5EVLA 4X53A
chains in the Genus database with same CATH superfamily
4KZ9A 3D72A 3C7VA 3UB6A 4JF5A 2I72A 3OZHA 1PI5A 1K56D 3HLBA 2V0UA 1EI5A 1KDSA 2P9VB 4MBKA 4BJPA 2W3GA 3L9KA 4S2KA 1OT6A 1N9OA 3SH8A 3TJZC 4HNBA 3DTEA 1L0GA 5EUAA 2Y2NA 1LL9A 3LCEA 1STZA 4OVDA 4HHDA 1BTLA 4BBUA 4HJ6A 3MFXA 3CPTB 4DJ3A 3Q7VB 4H6JB 5DF8A 4KENB 5AJGA 1K25A 3LICA 3N8RA 4X1LA 4II7A 3MSHA 3VFHA 1CI9A 2K31A 2WKEA 1XFQA 2W3DA 1BZAA 3WRZA 4ZJ2A 4OQIA 3LY4A 4WELA 3BY9A 2EXBA 1FCOA 2WGVA 5FSRA 5FQKA 4IBRA 3D4FA 1OMEA 1UWNX 1ERQA 5HARA 2EX2A 1L3LA 3UPOA 4EQ1A 1L0FA 1IEMA 2ZQ8A 4FD8A 4R4SA 2L1MA 4KZAA 5E2HA 3EEHA 3CI6A 2R9XA 4OP8A 2M7VA 1W63M 4E6WA 1MWUA 2EFUA 3VP1A 2D01A 2ZOHA 1ZTUA 3JVUA 4GB7A 4HJ3A 1H8YA 4Y0TA 1PRQA 3FKVA 3IF5A 4E3LA 3MZDA 2PRFA 2V8CA 2DNSA 2J3TD 2W3FA 1GCEA 2M7UA 1IKGA 4R70A 3UPPA 3NC8A 3NULA 3UO9A 2WGIA 4QY5A 1PWDA 1FSYA 3W4OA 5KSCA 2XDMA 4KQDA 2HDUA 3W2ZA 2GDNA 3T12B 1FCNA 4L9EA 3ITBA 1YLTA 5AVEA 3VOLA 5D3OA 1D7EA 3IX8A 4BD0A 3CJMA 5TGFA 5HDCA 2WKRA 2XA7S 1D06A 4QY6A 3KYEA 3IBRA 1JWPA 1C3BA 1MWRA 4LCLA 2WKPA 5FI2A 3WS2A 3IXBA 4L9GA 3ZG7B 2EA9A 3LI8A 3C7UA 2OV5A 4HY8A 5I94A 3AGEA 4MN6A 3MQ0A 1LSWA 4WMCD 3ZFZA 4BD1A 3UN7A 1CQAA 5EE8A 1XFNA 4UA7A 5A92A 3LR4A 3SH9A 5I5LA 4C75A 4NK3A 2JKRI 3GDIA 2M1CA 5J3WA 1YLYA 2O9AA 4GHIA 1Q2PA 5DJTA 1DP9A 2R78A 2KX6A 3PBQA 4EBPA 2ZQAA 3KSIA 3BFFA 4R6LA 5A91A 3MXSA 1ESUA 2XQZA 1DY6A 3LR5A 3B47A 2GX5A 4EV4A 1VB6A 4NG2A 1K57A 4PM5A 1NYMA 5CGSA 3OPRA 5F68A 5DF7A 1ZC2A 5KIZA 1BLPA 4F3LA 1S6RA 1H8ZA 4YWZA 4KG5A 4ZJ1A 5HWWA 4XXRA 2BASA 3F1NA 3LGOA 4U0TA 2O9CA 3HLDA 5CHJA 1PW8A 4DXBA 1CI8A 3BFCA 1W8YA 1YT4A 4OPZA 2HGVA 1IYSA 4YINA 3RXXA 4CLCE 3T4KA 1S1ZA 2HPBA 2ZQ9A 3Q1FA 5HAIA 5CECA 1FR1A 1PFLA 1TS8A 2RL3A 3T4JA 1YLPA 4XT2A 4QU3A 3MKFA 3N8SA 5JYPA 4DF6A 1TEMA 4X6TA 1U60A 4GS9A 3MQQA 4JGOA 4I3JA 3RFBA 3LIAA 1L0DA 4IVIA 3G30A 5KMWA 2P7JA 3H9WA 1LSXA 3N6IA 1VM1A 1P9RA 1W8QA 3F1PB 3MS6A 4E6XA 5HZHA 4EERA 1UGUA 1CK3A 1FSWA 5FDHA 5LBRA 4BBTA 2QJ7A 1VQQA 2ACGA 1K0KA 3WS4A 4CLCB 4D60A 3CWFA 3BECA 4R3JA 3HL9A 1AWIA 5DKKA 3MZEA 1K4EA 1CJFA 4GLQA 4ZDXA 3FV7A 3WS1A 1NZUA 4FTXA 4G3KA 3GV9A 4MN5A 3PBRA 3CLOA 2Y2IA 1P97A 2O0YA 3RTYA 1S67L 1V9YA 3MF0A 2AVXA 3G6OA 3PYPA 4IUHA 3UE0A 2X01A 4RA7A 5EECA 4KZ4A 3ZG9B 3EQUA 3QP1A 3M2JA 1W63Q 5AQ9A 3IWQA 1YPRA 3A0VA 1ZKJA 1PZPA 2JC7A 1NYYA 3GQZA 1DP6A 4HOIA 2EFXA 4HQAA 3IH9A 1K55A 2JKRM 4E3KA 1GA9A 4GNUA 2PYPA 5GLCA 3IF6B 3UDIA 4OQ0A 5FL3A 1GHMA 3T4TA 4WZ4A 2JE5A 5CXWA 2EX6A 3C4OA 2Y55A 2P9VA 1E4DA 1Y54A 5HL6A 1OJ5A 2ZL1A 3A3FA 5EVLA 3T4QA 5G4YA 2ZQCA 2J80A 1ALQA 4E3OA 3KYQA 1IYOA 3ZNTA 4IUKA 3TRCA 4Y15A 3NY4A 5GLDA 4LV1A 3ZHHA 2C6WB 2PDRA 3CPTA 4GOGA 2MJ6A 3CITA 5E2EA 4X69A 1QMEA 3Q7VA 4KUOA 4R23A 4H6JA 2Y91A 1F5MA 4XT2B 5HX9A 2J3WA 3UY6A 1H3QA 4MDZA 1K54A 2FZ0A 4U3TA 4GS9B 3WS0A 4PHTA 3JYIA 5HL1A 1KVMA 5GLBA 4EWFA 2V9AA 4JLFA 2FFFB 3BFGA 3TOIA 4BMWA 4X25A 2XRNA 2H0YA 3VMAA 1FR6A 3PR6A 3CUEC 5HAQA 3UDXA 4RX3A 3CG5A 3BFDA 2VK3A 1XJ6A 2B95A 3FWLA 4E3IA 2ZQ7A 1XA7A 2PD8A 3NDGA 3OBFA 1S1YA 2IA2A 3QP5A 3AGFA 5F83A 4WZ5C 3QP6A 5HPFA 2ZM2A 4P6BA 4HJ4A 2J7VA 1ONHA 4HBUA 3M6HA 2H28A 3GRJA 2VGLM 1X0OA 3GMWA 4S2MA 2WK0A 3HCYA 4O7DA 1MBLA 5EVIB 2K2NA 2HJEA 3PXPA 3R7WA 3QP8A 4Z9QA 1K38A 4DRTA 4EU0A 4G3WA 4DE1A 2W1RA 2A2LA 4DE3A 3OOVA 2QHKA 4F94A 4KZ6A 2XK1A 5E43A 3O5YA 2UV0E 3UB7A 1PIOA 4WF0A 3LYXA 4R4RA 2UWXA 1ERMA 4KG2A 3PBSA 1WE4A 5CTNA 5DTTA 2H5SA 2XH9A 3WS5A 4S2JA 3V3SA 2ZL1B 3SW1A 4I3AA 1MY8A 1YLZA 4EEPA 1TDLA 3EEAA 2B5RA 4JKTA 5FATA 2XF3A 4GD6A 3NECA 3T4SA 1RGZA 1DJCA 2J9PA 2VA0A 3IS2B 1YMXA 2W0NA 3U4LP 4UQIM 2Y8HA 1GSXA 5HDSA 1XP4A 2XFTA 3OPHA 1BUEA 3G34A 4DE2A 3T50A 4R0QA 4EESA 2JKFA 2VV6A 1Q2QA 1N9LA 4ME4A 5M1AA 3D3OA 3BY8A 2JBFA 2ZC7A 4X55A 2VGKA 3BW6A 4NETA 2QKPA 4KUKA 1NWZA 4PKYA 5GHYA 4OONA 5HAPA 4BL2A 3VP4A 4NEED 2WADA 2INWA 1PYYA 4OQHA 2BTFP 2EX9A 4EUVA 3FYZA 1KGEA 3GSGA 4IHQA 4GN2A 2V8FA 1GSWA 3LIEA 4EETB 1M6KA 3BLSA 2Y2LA 3BWLA 3HJKA 3LEQA 5IT5A 2NUTC 3LEZA 3S7QA 3GVBA 1YSQA 1TVFA 2V1AA 1TDGA 5GLAA 2EWWA 5F69A 4B4ZA 1OPXA 3UMEA 4JF6A 4I3IA 2JHEA 1G6OA 4KZ3A 2ZMFA 1YQSA 3KSHA 3MXRA 3EGDC 3T1SA 2WZZA 1BULA 5HPIA 3VE4A 1FIKA 2OSUA 4S2NC 1MZUA 4Y5FA 2E8IA 4YNRA 2ZC5B 4KZ5A 5CHMA 3E4PA 4ZAMA 3R7WB 2OLUA 4OQGA 3SS5A 4E3MA 1D1JA 2QPNA 2V20A 2FFYA 2GZAA 3Q7ZA 5FA7A 1G68A 3K3DA 5J4EA 1KVLA 3G32A 2Z6DA 4XUZA 4Q0JA 3OC2A 1ES4A 5CRFA 5GHZA 3F1PA 5DJUA 3ZDJA 2W3HA 4NXFA 1NY0A 3BYDA 4Z1WA 2W27A 4XUXA 4UA9A 1LT0A 3C30A 3G2YA 3GR2A 4G3VA 5HSQA 5FASA 3F1OB 4CLCA 3ZG8B 3E2KA 4DKIA 1KGGA 1OTAA 3LIBA 4PAUA 2B18A 3G2ZA 2HDSA 2VZWA 1ZG6A 1IOUA 1GA0A 1T1CA 3HVFA 2WKIA 4WUJA 2WAEA 4WN5A 4DDYA 5L2FA 3HLEA 4OOYA 4OKPA 4NXBA 5EPHA 4EW7A 2YKFA 1QMFA 3UNWA 3P7NA 1S66L 4BLMA 3W4PA 4BBVA 3VP2A 2XFSA 3SZTA 4P87A 4Y3IA 3O3VA 5FDSA 3SOIA 2W1TB 1PI4A 3EOIA 2VJWA 2VGLS 3NIAA 4N9LA 5FEGA 3FKWA 1BYWA 3BFEA 5DTKA 3ZNYA 1W79A 3LO7A 1ZHHB 3MR0A 3SH7A 1L0EA 4EQIA 1O07A 3IF6A 1EROA 3C2WA 3IX3A 4MMNA 3BRMA 1XA1A 1VETA 1IYPA 2O99A 4QJGA 3PBNA 3W4QA 5FQMA 3H82B 3MXQA 3ZQ5A 4LFUA 3LIFA 5AQBA 4EXOA 4Y13A 2WUQA 4NXGA 2WAFA 5F5YA 1BT5A 3VSLA 4O8GA 3TSGA 2ZD8A 1FOFA 4N92A 1YLWA 3TE8A 4E04A 4IEDA 2XD5A 4UHUA 3ICYA 5CX7A 3LFVA 4X53A 5FAPA 4FSFA 2WKQA 4RQ9A 3FC7A 4Y0OA 1K4FA 2WZXA 1EWZA 5HW3A 4UQIS 4S2IA 3B3XA 2VLGA 3VOYA 2G7UA 3C8CA 3GTCA 1ES2A 1G28A 4O0PA 1AXBA 5BOHA 3A3JA 1H0MA 4P0MA 4LCMA 4EUZA 2QYBA 4C3QA 3HLCA 3UB5P 3EQVA 5DF9A 1YAXA 1Y28A 2Z6CA 4H8RA 2XGNA 1NRJA 2HDQA 1TS7A 2JKGA 4LV2A 3P98A 2C5WB 5J8XA 4EEUA 5EVEA 2DMWA 4GKUA 2Z2LB 1IELA 2B02A 3FPWA 1HZOA 3T1RA 4DN0A 4CLCC 4PPRA 2V1BA 4GDBA 1OT9A 5FQIA 5KSHA 2LB9A 1A0KA 4HESA 2KDKA 5CERA 4JBFA 4MN7A 1XPBA 1HLUP 1FQGA 3A3EA 3ZVTA 3DTMA 5EVIA 2EXAA 3A3DA 4CQHA 4JXSA 5TFQA 2H0TA 4QHCA 3IHBA 5L07A 3UB8A 4MCWA 3RXWA 2Y2KA 1SHVA 1IKIA 1K57C 2OOLA 2J9OA 2ZMVA 1TD5A 1VETB 3RH8B 3N4IA 2P04A 4D2OA 5A8BA 4LPZA 4BQMA 1SDEA 4KQRA 4WM9A 3NBLA 4JGPA 3PAEA 5JYOA 2JN7A 3L7HA 4QPRA 5HWVA 4X68A 5DFXA 3NOTC 2EX8A 2XLNA 3A3IA 2HV1A 3HREA 1T19A 4KZ8A 1NJ4A 1Y4OA 1BLCA 1HTZA 3IS2A 4LRXC 3OLOA 1FCMA 2K7SA 5GL9A 5K5BA 2ZJ9A 3NJAA 4I38A 1NZOA 2BLSA 3Q81A 1P9WA 4S2PA 2VEAA 3UDFA 2QJ5A 3R4KA 3U2AA 5E2FA 1F98A 1MKIA 1W5DA 2Y2PA 3CHWP 3NI9A 2G2WA 5FAQA 4RX2A 3HLFA 2HDRA 2R9WA 4KZBA 2CMNA 3T1XA 2PD7A 1IFQA 5AQAA 3KSGA 3IWIA 4LRZE 3VP0A 1F9IA 4K08A 4JF4A 1HD8A 4LGWA 2VX8A 4JPMA 3DW0A 3M2KA 4WEKA 4HP4A 4DJ2A 1Z09A 3Q82A 1ES5A 2V2FF 4RVAA 3H7WB 5TBMB 1PW1A 3S7NA 2QWSA 3TG9A 2ZC4B 5CEBA 2IWBA 1SKFA 4QWOA 1I2WA 2L4RA 2A24B 5HD5A 4MNRA 1XJ4A 4OPQA 2GNXA 3S7PA 5HWTA 3HJIA 3VE3A 1DRMA 1KE4A 5CEDA 5FQQA 2IWDA 3IQAA 4ZJ3A 3OCNA 2XD1A 4QB8A 5TJJA 1JWVA 1L2SA 1NRFA 3IH8A 1BLHA 1H8MA 1ES3A 1ZG4A 5DTSA 4B88A 3MFDA 3FZCA 1TS6A 1SKOB 3LIDA 2XROA 5DFYA 2VV7A 2P74A 4I39A 5FQ9A 4OP5A 3HUMA 4P6ZM 4ETXA 1LSVA 3EWKA 1CEFA 1HVBA 2DRWA 3O87A 2D02A 3IXDA 1KOUA 3M6BA 3IWOA 3S7OA 4N9KA 4BL3A 1GHIA 1MKMA 1TS0A 1PNEA 2HZ5A 4B4XA 1K55C 2HP9A 1KE0A 5CGXA 4GJ4A 4Y2FA 3NOUC 1OTIA 4EBLA 1N4OA 4ZRRA 3P09A 4ZTKA 1UWPX 2OLVA 1PZOA 2WGWB 3F1OA 1IYQA 2VV8A 4KZ7A 5L09A 1E3UA 3HUNA 3I7JA 3KO6A 2LB5A 4ARZA 1XXMA 3O86A 2YKHA 1K56A 1WYBA 2HJ9C 4MBFA 3BLMA 2PAVP 2QMIA 4MBHA 4CJNA 3E0YA 4HH3A 4QD4A 1DJAA 1MXOA 5E2GA 4M4XA 4ID4A 4K91A 1XGIA 3RJUA 4JXWA 2W1TA 1MWSA 2HF6A 3O88A 3W8KA 1K54C 2HP6A 1JVJA 5CTMA 3WRTA 3LI9A 3A0RA 4N1XA 4KQQA 3OPLA 3SS4A 2ZLYA 5G4ZA 3MJQA 4AFIA 3G31A 2PT7A 4FCFA 1YM1A 3ZG5A 2OWHA 3H82A 4WL9A 2OAP1 4I5SA 3LR0A 4OOLA 2ZOIA 4IVKA 4FUWA 3BEBA 5IS1A 1GHPA 1S4SA 3IHAA 1MPLA 3D9YA 5EV0A 4MEZA 4U0XA 3QP2A 2I9VA 3NOPC 2Y2QA 4HIAA 1VEUB 4IJGA 2QZ6A 5A93A 3Q07A 4R38A 2Q9MA 4UA6A 2DCFA 1JWZA 2X02A 3PAGA 5L10A 2Q9NA 1XJ3A 5HD3A 1LI9A 4FH4A 3BJNA 4CLCD 2ZM8A 2X71A 5C5KA 2V1ZA 1S0WA 4LRYC 1O7EA 1DJBA 4Q0HA 4Q0IA 5HFOA 1LL8A 4X56A 5FAOA 4B93A 1KE3A 3CAXA 3VSKA 3TW8A 1F2KA 1WA9A 3LY3A 4KG6A 1YKDA 5HDDA 1P0ZA 4R3BA 1OTEA 1SZVA 3ZVWA 2PR5A 3A0SA 1NXYA 4ARZB 1K6RA 1V9ZA 1S4RA 4M3KA 1T1AA 4GZBA 4Y17A 4ESPA 2G2UA 4JGRA 4A5RA 1DP8A 3DWKA 4WMCA 3S22A 4PM7A 3FG8A 3E4OA 4WBGA 5M18A 3V50A 3PBTA 1I5QA 3B33A 3MMHA 2VKSA 3PTEA 5U47A 2KOIA 1RGYA 4JGQA 3DTKA 4O01A 4LV0A 3IXHA 3DTIA 4C6YA 5MC7A 3P01A 1G6AA 3GECA 4WYYA 2WKHA 5F1GA 2Y2OA 3SS3A 1N9NA 1K6SA 1ESIA 3G35A 4P6ZS 4ETZA 5J7EA 1BLSA 2J8YA 1ODVA 5CGWA 2ZC3B 4KQOA 4Y0UA 2E8JA 4JXGA 4K0WA 3WWXA 4GCZA 4Q8IA 1EW0A 5M19A 5DVAA 3LR3A 4IBXA 4OPRA 1KDWA 2JCHA 1JTGA 1LL5A 3AGDA 3PHYA 3IX4A 1KGFA 1FILA 4PM9A 1OTDA 3ISGA 1N9BA 2O9BA 4BWIA 1LHYA 4R1GA 2EWVA 1E25A 2PBDP 1VHMA 2GJ3A 3MQOA 3QNBA 4UEYA 3CUEA 3T4LA 2Y2MA 3IBJA 1T1BA 3N8LA 3UMDA 2WYXA 2OAQ1 4X1MA 3BQAA 2J3TC 2NUPC 5FI6A 2JKTI 1LI0A 2XSSA 5GHXA 3UE6A 4DE0A 4HH2A 2Y4AA 4S2LA 1XX2A 5TR7A 4HEFA 4N1HA 1NLZA 2XEPA 4B9OA 2KLIA 4R3AA 4WZ5A 2BG1A 5F1FA 2L0WA 1PWCA 3LUQA 1XGJA 3JPUA 2Y2HA 4PM6A 3H7WA 5TBMA 4P85A 5FEFA 5EVID 4FOFA 1M40A 5AQ7A 2A24A 1RCJA 3HLWA 3QP4A 2PR6A 4PM8A 4OLDA 2VGJA 2PBYA 3V67A 4GHIB 5G18A 5AVFA 2P08A 3QNCA 4LLOB 3UE3A 4JXVA 3VV4A 1H5XA 2ZC6B 5IU1A 1SCWA 3ULFA 3HUOA 3KSFA 1W7FA 1WYCA 3T4OA 4GD8A 3E2LA 1J9MA 1MC0A 3VP3A 5EOEA 1CEGA 4HP9A 1SKOA 4CPKA 3S1YA 5EM1A 3UB9A 4YOFA 1RP5A 3UE1A 3VFFA 4MLLA 3S4XA 1YMSA 5A90A 5F6AA 4GW9A 1XKZA 4F3LB 2ZMAA 1LLBA 1Z6FA 3DBAA 4E3JA 4YFMA 2PYRA 3OCLA 2Z2MB 3OPPA 4DMZA 5EOOA 2RCXA 3IF6C 3EGXC 3ZCZA 3F1NB 3C38A 3MKEA 3E4QA 3V3RA 1J3WA 3DWZA 4OH0A 4Y7PA 2WGWA 4EBNA 4LV3A 1G5UA 3NDEA 4LENA 2W3EA 3IT9A 4RYEA 2A49A 1YSPA 1ONGA 4UAAA 1OTBA 3E98A 4HBTA 1JNUA 2CC1A 2OWJA 2XA7M 3HBRA 2FH5A 5L8MA 5CHUA 3ZG0A 4BENA 4NKPA 2PHYA 2ZM0A 5DKLA 1ACFA 3NCKA 4S2OA 1NLYA 1MWTA 3MZFA 4OOMA 3B42A 3ITAA 3T1QB 2HP5A 1YLJA 5IHVA 3ZGAB 3N7WA 2XR0A 3G4PA 4DDSA 3KX0X 1SDNA 4NXEA 3BM6A 3PBOA 4OLGA 3MBZA 3ZYTA 4WEJA 3HLGA 1BSGA 4ZBEA 4L0LA 3QHYA 3K3CA 3C4PA 2V0WA 1T18A 5EFWA 3FPVA 2PU2A 4PKYG 2Y79A 4FH2A 3CZDA 4HI4A 4L9FA 3NHQA 2A3UA 4S2NA 3CMZA 2JKTM 4E3NA 3C5AA 2Y2JA 2Y59A 3UPNA 2IWCA 1CF0A 3VOZA 1OJGA 1VEUA 3DAVA 5F82A 2Q0OA 4OPYA 5FQJA 2ZQDA 3BQ8A 5FI7A 3K2NA 4PMAA 1TF1A 3JVVA 4K0XA 1PWGA 5EVIC 5EM0A 3IXGA 4GDNA 5KZHA 4DXCA 1I2SA 3V39A 1GSVA 3KYZA 4WLAA 1JTDA 2H10A 3V5MA 1XJ2A 2Y2GA 2PU4A 2ZBBA 1E3UD
chains in the Genus database with same CATH topology
1LI9A 2ZQCA 4KZ9A 4FH4A 1ALQA 3C7VA 5FAPA 4FSFA 4E3OA 4JF5A 2ZM8A 1IYOA 2I72A 3ZNTA 4Y0OA 1K4FA 1PI5A 1K56D 3NY4A 3OZHA 2X71A 3HLBA 2WZXA 1EWZA 4LV1A 5GLDA 5HW3A 1EI5A 3ZHHA 2V1ZA 2C6WB 1KDSA 2P9VB 1S0WA 4MBKA 4BJPA 4GOGA 5E2EA 4S2KA 4S2IA 4X69A 3B3XA 3SH8A 1QMEA 3Q7VA 3VOYA 1O7EA 1DJBA 4R23A 3GTCA 5HFOA 1ES2A 4X56A 5FAOA 1L0GA 2Y91A 5EUAA 5HX9A 2Y2NA 1KE3A 3UY6A 1LL9A 3LCEA 3VSKA 4OVDA 1AXBA 1K54A 3A3JA 4U3TA 5BOHA 3LY3A 4KG6A 1BTLA 4P0MA 3WS0A 4LCMA 4EUZA 3JYIA 4C3QA 3HLCA 5HL1A 3Q7VB 4R3BA 1KVMA 5GLBA 3EQVA 3ZVWA 5DF8A 4KENB 4EWFA 5DF9A 4JLFA 1NXYA 2FFFB 3BFGA 3TOIA 1K6RA 1K25A 2H0YA 3VMAA 1FR6A 3N8RA 4H8RA 2XGNA 5HAQA 4M3KA 3UDXA 3VFHA 1CI9A 2WKEA 4RX3A 2HDQA 4GZBA 1BZAA 3CG5A 2G2UA 3P98A 3BFDA 4LV2A 4ZJ2A 2C5WB 3WRZA 4A5RA 5J8XA 3DWKA 3LY4A 4OQIA 4WELA 4WMCA 3S22A 4PM7A 3FWLA 2EXBA 4E3IA 1FCOA 2ZQ7A 2WGVA 5FSRA 5FQKA 4IBRA 4WBGA 5M18A 1XA7A 4GKUA 2Z2LB 3D4FA 3NDGA 1IELA 3V50A 3PBTA 1HZOA 1I5QA 1OMEA 1ERQA 3AGFA 5F83A 2EX2A 5HARA 3PTEA 4PPRA 4WZ5C 4GDBA 3UPOA 5U47A 5FQIA 5KSHA 1RGYA 1L0FA 1IEMA 2ZM2A 2ZQ8A 4HESA 4P6BA 4FD8A 4R4SA 5CERA 4KZAA 5E2HA 4JBFA 2R9XA 4LV0A 2J7VA 4OP8A 1ONHA 1XPBA 1FQGA 3A3EA 3ZVTA 3IXHA 4HBUA 3DTMA 4C6YA 5EVIA 4E6WA 2EXAA 3M6HA 1G6AA 3A3DA 1MWUA 3GRJA 2EFUA 4WYYA 3VP1A 4JXSA 2WKHA 4GB7A 5TFQA 3GMWA 4S2MA 2H0TA 2WK0A 1H8YA 4Y0TA 4QHCA 5F1GA 3IF5A 3FKVA 4E3LA 2Y2OA 3MZDA 3IHBA 3SS3A 1K6SA 1ESIA 2DNSA 3G35A 1GCEA 4O7DA 1MBLA 1IKGA 5EVIB 1BLSA 3RXWA 2Y2KA 2J8YA 1SHVA 3UPPA 3NC8A 1IKIA 1K57C 3UO9A 2WGIA 4QY5A 5CGWA 1PWDA 1FSYA 3W4OA 4Z9QA 2ZC3B 2J9OA 1K38A 4KQOA 4Y0UA 4DRTA 5KSCA 2XDMA 3N4IA 4JXGA 4K0WA 4D2OA 4DE1A 4DE3A 3WWXA 4F94A 4KZ6A 4BQMA 2HDUA 1SDEA 4KQRA 4Q8IA 2GDNA 2XK1A 4WM9A 5M19A 3NBLA 1FCNA 5DVAA 3ITBA 3PAEA 5E43A 5JYOA 1YLTA 4OPRA 4IBXA 1KDWA 1PIOA 2JCHA 5D3OA 1JTGA 4R4RA 1LL5A 3AGDA 4X68A 2UWXA 2EX8A 1ERMA 4KG2A 1KGFA 4BD0A 3CJMA 3PBSA 4PM9A 5TGFA 1WE4A 3ISGA 2XLNA 5CTNA 1N9BA 5DTTA 3A3IA 3HREA 1LHYA 4QY6A 4R1GA 4KZ8A 1NJ4A 2H5SA 2XH9A 3WS5A 1E25A 1BLCA 1HTZA 1JWPA 1C3BA 1MWRA 4LCLA 4S2JA 4DXBA 3V3SA 1FCMA 1MY8A 5GL9A 5FI2A 3QNBA 1YLZA 2ZJ9A 3WS2A 3IXBA 1TDLA 1NZOA 2BLSA 3Q81A 2B5RA 4JKTA 3ZG7B 5FATA 2XF3A 2Y2MA 4GD6A 4S2PA 3C7UA 3N8LA 2OV5A 1RGZA 3UDFA 2WYXA 3A3FA 5I94A 3AGEA 1DJCA 2J9PA 1YMXA 5FI6A 5E2FA 4WMCD 1LI0A 5GHXA 3ZFZA 4BD1A 4DE0A 2Y4AA 1MKIA 1W5DA 3UN7A 1XP4A 2XFTA 1XX2A 4S2LA 3OPHA 4HEFA 4N1HA 5TR7A 2XEPA 1BUEA 2Y2PA 3G34A 3NI9A 4DE2A 2G2WA 4R0QA 5FAQA 4WZ5A 5EE8A 4UA7A 1Q2QA 4RX2A 3HLFA 5A92A 2BG1A 2HDRA 3SH9A 5M1AA 4C75A 2JBFA 2R9WA 2ZC7A 4X55A 4KZBA 4NK3A 5F1FA 2VGKA 1PWCA 4NETA 1XGJA 5GHYA 1YLYA 4OONA 5HAPA 4BL2A 5AQAA 2Y2HA 3VP4A 4PM6A 1Q2PA 3IWIA 2WADA 4P85A 5EVID 3VP0A 3PBQA 4EBPA 1PYYA 1M40A 4OQHA 5AQ7A 4JF4A 1HD8A 2ZQAA 2EX9A 1RCJA 3HLWA 4JPMA 3BFFA 3DW0A 3FYZA 1KGEA 3GSGA 3M2KA 5A91A 4WEKA 4GN2A 4PM8A 4OLDA 3MXSA 2VGJA 2PBYA 3Q82A 1ES5A 2V2FF 5G18A 1ESUA 4RVAA 3QNCA 2XQZA 1DY6A 3UE3A 1M6KA 1PW1A 4JXVA 3TG9A 2ZC4B 4EV4A 2IWBA 5CEBA 1SKFA 3BLSA 1H5XA 1K57A 2Y2LA 2ZC6B 1SCWA 1I2WA 4PM5A 3HUOA 4MNRA 1NYMA 1W7FA 1WYCA 4GD8A 5CGSA 3OPRA 3E2LA 4OPQA 3LEZA 5DF7A 3GVBA 1J9MA 1KE4A 1ZC2A 3VP3A 5EOEA 1CEGA 5CEDA 1BLPA 1S6RA 5FQQA 1TVFA 5GLAA 1TDGA 2IWDA 3IQAA 3S1YA 4CPKA 1H8ZA 4ZJ3A 3OCNA 4B4ZA 2XD1A 4KG5A 4QB8A 4JF6A 1JWVA 1L2SA 4ZJ1A 4KZ3A 4XXRA 1RP5A 3UE1A 1NRFA 3VFFA 3IH8A 1BLHA 1YQSA 1ES3A 1ZG4A 3MXRA 4MLLA 5DTSA 1YMSA 3S4XA 4U0TA 2WZZA 1BULA 4B88A 5A90A 3HLDA 3MFDA 1XKZA 2OSUA 3FZCA 4S2NC 5CHJA 1PW8A 2ZMAA 2E8IA 2ZC5B 4KZ5A 1CI8A 1LLBA 5CHMA 2P74A 5FQ9A 1Z6FA 3BFCA 1W8YA 4OP5A 3HUMA 4E3JA 4YFMA 1YT4A 4ZAMA 3OCLA 2Z2MB 4OPZA 1CEFA 3OPPA 2OLUA 1HVBA 2DRWA 3O87A 5EOOA 4OQGA 2RCXA 3IF6C 3IXDA 3ZCZA 1IYSA 3IWOA 3M6BA 3MKEA 3SS5A 3V3RA 4E3MA 2QPNA 4N9KA 4YINA 2V20A 3DWZA 4OH0A 1GHIA 4Y7PA 4BL3A 2WGWA 4B4XA 2FFYA 1K55C 2HP9A 3Q7ZA 4EBNA 5FA7A 1G68A 4LV3A 3RXXA 1KE0A 5CGXA 3NDEA 2HPBA 1N4OA 4EBLA 1KVLA 2ZQ9A 3G32A 3Q1FA 5HAIA 3P09A 4XUZA 5CECA 1FR1A 4LENA 4ZTKA 3OC2A 3IT9A 1ES4A 2RL3A 2OLVA 1PZOA 4RYEA 1YLPA 2A49A 2WGWB 5CRFA 5GHZA 1ONGA 4UAAA 4QU3A 3MKFA 3ZDJA 3N8SA 5JYPA 4HBTA 1IYQA 4DF6A 2CC1A 1NY0A 3BYDA 1TEMA 4X6TA 1U60A 3HBRA 4KZ7A 5CHUA 4XUXA 1L0DA 4IVIA 3G30A 4UA9A 3ZG0A 1E3UA 4BENA 5KMWA 2ZM0A 3G2YA 3GR2A 3HUNA 3I7JA 3NCKA 4S2OA 3N6IA 5FASA 1XXMA 1VM1A 1MWTA 1W8QA 3O86A 3E2KA 3ZG8B 4E6XA 3MZFA 4OOMA 4DKIA 1K56A 1KGGA 1WYBA 4MBFA 3BLMA 1CK3A 3ITAA 1FSWA 2HP5A 5FDHA 2QMIA 4MBHA 4CJNA 4QD4A 1YLJA 3G2ZA 5IHVA 1DJAA 2HDSA 1MXOA 1VQQA 5E2GA 3N7WA 3ZGAB 1ZG6A 2XR0A 4ID4A 3G4PA 4K91A 4DDSA 1GA0A 1SDNA 3HVFA 1XGIA 3RJUA 2WKIA 3WS4A 4JXWA 2WAEA 3BECA 4R3JA 4DDYA 3HL9A 1MWSA 5L2FA 3BM6A 3HLEA 3MZEA 3PBOA 4OLGA 4OOYA 3MBZA 1K4EA 3O88A 4OKPA 3W8KA 1K54C 5EPHA 4ZDXA 4WEJA 3HLGA 1BSGA 2HP6A 1JVJA 4ZBEA 3FV7A 4L0LA 3QHYA 1NZUA 1QMFA 5CTMA 3WRTA 3GV9A 3UNWA 3WS1A 3PBRA 4BLMA 3W4PA 2Y2IA 3C4PA 4N1XA 4KQQA 3VP2A 2XFSA 4P87A 3OPLA 3SS4A 2ZLYA 3O3VA 3SOIA 2PU2A 1PI4A 3UE0A 2X01A 4RA7A 5EECA 4KZ4A 3G31A 3NIAA 3ZG9B 4FH2A 4N9LA 3CZDA 3EQUA 3FKWA 3BFEA 2A3UA 3M2JA 4FCFA 3CMZA 4S2NA 5DTKA 3ZNYA 4E3NA 5AQ9A 3C5AA 2Y2JA 2Y59A 3IWQA 1W79A 3LO7A 3UPNA 1YM1A 3SH7A 1ZKJA 1PZPA 2IWCA 3ZG5A 1L0EA 4EQIA 1O07A 3VOZA 2JC7A 1NYYA 3GQZA 3IF6A 4OOLA 4IVKA 1EROA 3BEBA 1GHPA 5F82A 2EFXA 3IHAA 3IH9A 1MPLA 1K55A 3BRMA 4OPYA 1XA1A 5FQJA 2ZQDA 4MEZA 5FI7A 4E3KA 1IYPA 4U0XA 1GA9A 4GNUA 4QJGA 4PMAA 2Y2QA 3PBNA 3W4QA 5FQMA 5GLCA 4K0XA 5AQBA 3IF6B 2WUQA 1PWGA 3UDIA 4OQ0A 5EVIC 2WAFA 1GHMA 2QZ6A 1BT5A 3IXGA 3VSLA 5A93A 4GDNA 5KZHA 4WZ4A 3TSGA 1I2SA 4DXCA 3V39A 3Q07A 2JE5A 2Q9MA 2ZD8A 1FOFA 1JTDA 4N92A 1YLWA 2H10A 4UA6A 3V5MA 5CXWA 2DCFA 2EX6A 4IEDA 3C4OA 2Y55A 1JWZA 2X02A 2XD5A 2P9VA 4UHUA 1E4DA 1Y54A 3PAGA 2Y2GA 2PU4A 1E3UD 2Q9NA 5EVLA 4X53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LI9 A;  2ZQC A;  4KZ9 A;  4FH4 A;  1ALQ A;  3C7V A;  5FAP A;  4FSF A;  4E3O A;  4JF5 A;  2ZM8 A;  1IYO A;  2I72 A;  3ZNT A;  4Y0O A;  1K4F A;  1PI5 A;  1K56 D;  3NY4 A;  3OZH A;  2X71 A;  3HLB A;  2WZX A;  1EWZ A;  4LV1 A;  5GLD A;  5HW3 A;  1EI5 A;  3ZHH A;  2V1Z A;  2C6W B;  1KDS A;  2P9V B;  1S0W A;  4MBK A;  4BJP A;  4GOG A;  5E2E A;  4S2K A;  4S2I A;  4X69 A;  3B3X A;  3SH8 A;  1QME A;  3Q7V A;  3VOY A;  1O7E A;  1DJB A;  4R23 A;  3GTC A;  5HFO A;  1ES2 A;  4X56 A;  5FAO A;  1L0G A;  2Y91 A;  5EUA A;  5HX9 A;  2Y2N A;  1KE3 A;  3UY6 A;  1LL9 A;  3LCE A;  3VSK A;  4OVD A;  1AXB A;  1K54 A;  3A3J A;  4U3T A;  5BOH A;  3LY3 A;  4KG6 A;  1BTL A;  4P0M A;  3WS0 A;  4LCM A;  4EUZ A;  3JYI A;  4C3Q A;  3HLC A;  5HL1 A;  3Q7V B;  4R3B A;  1KVM A;  5GLB A;  3EQV A;  3ZVW A;  5DF8 A;  4KEN B;  4EWF A;  5DF9 A;  4JLF A;  1NXY A;  2FFF B;  3BFG A;  3TOI A;  1K6R A;  1K25 A;  2H0Y A;  3VMA A;  1FR6 A;  3N8R A;  4H8R A;  2XGN A;  5HAQ A;  4M3K A;  3UDX A;  3VFH A;  1CI9 A;  2WKE A;  4RX3 A;  2HDQ A;  4GZB A;  1BZA A;  3CG5 A;  2G2U A;  3P98 A;  3BFD A;  4LV2 A;  4ZJ2 A;  2C5W B;  3WRZ A;  4A5R A;  5J8X A;  3DWK A;  3LY4 A;  4OQI A;  4WEL A;  4WMC A;  3S22 A;  4PM7 A;  3FWL A;  2EXB A;  4E3I A;  1FCO A;  2ZQ7 A;  2WGV A;  5FSR A;  5FQK A;  4IBR A;  4WBG A;  5M18 A;  1XA7 A;  4GKU A;  2Z2L B;  3D4F A;  3NDG A;  1IEL A;  3V50 A;  3PBT A;  1HZO A;  1I5Q A;  1OME A;  1ERQ A;  3AGF A;  5F83 A;  2EX2 A;  5HAR A;  3PTE A;  4PPR A;  4WZ5 C;  4GDB A;  3UPO A;  5U47 A;  5FQI A;  5KSH A;  1RGY A;  1L0F A;  1IEM A;  2ZM2 A;  2ZQ8 A;  4HES A;  4P6B A;  4FD8 A;  4R4S A;  5CER A;  4KZA A;  5E2H A;  4JBF A;  2R9X A;  4LV0 A;  2J7V A;  4OP8 A;  1ONH A;  1XPB A;  1FQG A;  3A3E A;  3ZVT A;  3IXH A;  4HBU A;  3DTM A;  4C6Y A;  5EVI A;  4E6W A;  2EXA A;  3M6H A;  1G6A A;  3A3D A;  1MWU A;  3GRJ A;  2EFU A;  4WYY A;  3VP1 A;  4JXS A;  2WKH A;  4GB7 A;  5TFQ A;  3GMW A;  4S2M A;  2H0T A;  2WK0 A;  1H8Y A;  4Y0T A;  4QHC A;  5F1G A;  3IF5 A;  3FKV A;  4E3L A;  2Y2O A;  3MZD A;  3IHB A;  3SS3 A;  1K6S A;  1ESI A;  2DNS A;  3G35 A;  1GCE A;  4O7D A;  1MBL A;  1IKG A;  5EVI B;  1BLS A;  3RXW A;  2Y2K A;  2J8Y A;  1SHV A;  3UPP A;  3NC8 A;  1IKI A;  1K57 C;  3UO9 A;  2WGI A;  4QY5 A;  5CGW A;  1PWD A;  1FSY A;  3W4O A;  4Z9Q A;  2ZC3 B;  2J9O A;  1K38 A;  4KQO A;  4Y0U A;  4DRT A;  5KSC A;  2XDM A;  3N4I A;  4JXG A;  4K0W A;  4D2O A;  4DE1 A;  4DE3 A;  3WWX A;  4F94 A;  4KZ6 A;  4BQM A;  2HDU A;  1SDE A;  4KQR A;  4Q8I A;  2GDN A;  2XK1 A;  4WM9 A;  5M19 A;  3NBL A;  1FCN A;  5DVA A;  3ITB A;  3PAE A;  5E43 A;  5JYO A;  1YLT A;  4OPR A;  4IBX A;  1KDW A;  1PIO A;  2JCH A;  5D3O A;  1JTG A;  4R4R A;  1LL5 A;  3AGD A;  4X68 A;  2UWX A;  2EX8 A;  1ERM A;  4KG2 A;  1KGF A;  4BD0 A;  3CJM A;  3PBS A;  4PM9 A;  5TGF A;  1WE4 A;  3ISG A;  2XLN A;  5CTN A;  1N9B A;  5DTT A;  3A3I A;  3HRE A;  1LHY A;  4QY6 A;  4R1G A;  4KZ8 A;  1NJ4 A;  2H5S A;  2XH9 A;  3WS5 A;  1E25 A;  1BLC A;  1HTZ A;  1JWP A;  1C3B A;  1MWR A;  4LCL A;  4S2J A;  4DXB A;  3V3S A;  1FCM A;  1MY8 A;  5GL9 A;  5FI2 A;  3QNB A;  1YLZ A;  2ZJ9 A;  3WS2 A;  3IXB A;  1TDL A;  1NZO A;  2BLS A;  3Q81 A;  2B5R A;  4JKT A;  3ZG7 B;  5FAT A;  2XF3 A;  2Y2M A;  4GD6 A;  4S2P A;  3C7U A;  3N8L A;  2OV5 A;  1RGZ A;  3UDF A;  2WYX A;  3A3F A;  5I94 A;  3AGE A;  1DJC A;  2J9P A;  1YMX A;  5FI6 A;  5E2F A;  4WMC D;  1LI0 A;  5GHX A;  3ZFZ A;  4BD1 A;  4DE0 A;  2Y4A A;  1MKI A;  1W5D A;  3UN7 A;  1XP4 A;  2XFT A;  1XX2 A;  4S2L A;  3OPH A;  4HEF A;  4N1H A;  5TR7 A;  2XEP A;  1BUE A;  2Y2P A;  3G34 A;  3NI9 A;  4DE2 A;  2G2W A;  4R0Q A;  5FAQ A;  4WZ5 A;  5EE8 A;  4UA7 A;  1Q2Q A;  4RX2 A;  3HLF A;  5A92 A;  2BG1 A;  2HDR A;  3SH9 A;  5M1A A;  4C75 A;  2JBF A;  2R9W A;  2ZC7 A;  4X55 A;  4KZB A;  4NK3 A;  5F1F A;  2VGK A;  1PWC A;  4NET A;  1XGJ A;  5GHY A;  1YLY A;  4OON A;  5HAP A;  4BL2 A;  5AQA A;  2Y2H A;  3VP4 A;  4PM6 A;  1Q2P A;  3IWI A;  2WAD A;  4P85 A;  5EVI D;  3VP0 A;  3PBQ A;  4EBP A;  1PYY A;  1M40 A;  4OQH A;  5AQ7 A;  4JF4 A;  1HD8 A;  2ZQA A;  2EX9 A;  1RCJ A;  3HLW A;  4JPM A;  3BFF A;  3DW0 A;  3FYZ A;  1KGE A;  3GSG A;  3M2K A;  5A91 A;  4WEK A;  4GN2 A;  4PM8 A;  4OLD A;  3MXS A;  2VGJ A;  2PBY A;  3Q82 A;  1ES5 A;  2V2F F;  5G18 A;  1ESU A;  4RVA A;  3QNC A;  2XQZ A;  1DY6 A;  3UE3 A;  1M6K A;  1PW1 A;  4JXV A;  3TG9 A;  2ZC4 B;  4EV4 A;  2IWB A;  5CEB A;  1SKF A;  3BLS A;  1H5X A;  1K57 A;  2Y2L A;  2ZC6 B;  1SCW A;  1I2W A;  4PM5 A;  3HUO A;  4MNR A;  1NYM A;  1W7F A;  1WYC A;  4GD8 A;  5CGS A;  3OPR A;  3E2L A;  4OPQ A;  3LEZ A;  5DF7 A;  3GVB A;  1J9M A;  1KE4 A;  1ZC2 A;  3VP3 A;  5EOE A;  1CEG A;  5CED A;  1BLP A;  1S6R A;  5FQQ A;  1TVF A;  5GLA A;  1TDG A;  2IWD A;  3IQA A;  3S1Y A;  4CPK A;  1H8Z A;  4ZJ3 A;  3OCN A;  4B4Z A;  2XD1 A;  4KG5 A;  4QB8 A;  4JF6 A;  1JWV A;  1L2S A;  4ZJ1 A;  4KZ3 A;  4XXR A;  1RP5 A;  3UE1 A;  1NRF A;  3VFF A;  3IH8 A;  1BLH A;  1YQS A;  1ES3 A;  1ZG4 A;  3MXR A;  4MLL A;  5DTS A;  1YMS A;  3S4X A;  4U0T A;  2WZZ A;  1BUL A;  4B88 A;  5A90 A;  3HLD A;  3MFD A;  1XKZ A;  2OSU A;  3FZC A;  4S2N C;  5CHJ A;  1PW8 A;  2ZMA A;  2E8I A;  2ZC5 B;  4KZ5 A;  1CI8 A;  1LLB A;  5CHM A;  2P74 A;  5FQ9 A;  1Z6F A;  3BFC A;  1W8Y A;  4OP5 A;  3HUM A;  4E3J A;  4YFM A;  1YT4 A;  4ZAM A;  3OCL A;  2Z2M B;  4OPZ A;  1CEF A;  3OPP A;  2OLU A;  1HVB A;  2DRW A;  3O87 A;  5EOO A;  4OQG A;  2RCX A;  3IF6 C;  3IXD A;  3ZCZ A;  1IYS A;  3IWO A;  3M6B A;  3MKE A;  3SS5 A;  3V3R A;  4E3M A;  2QPN A;  4N9K A;  4YIN A;  2V20 A;  3DWZ A;  4OH0 A;  1GHI A;  4Y7P A;  4BL3 A;  2WGW A;  4B4X A;  2FFY A;  1K55 C;  2HP9 A;  3Q7Z A;  4EBN A;  5FA7 A;  1G68 A;  4LV3 A;  3RXX A;  1KE0 A;  5CGX A;  3NDE A;  2HPB A;  1N4O A;  4EBL A;  1KVL A;  2ZQ9 A;  3G32 A;  3Q1F A;  5HAI A;  3P09 A;  4XUZ A;  5CEC A;  1FR1 A;  4LEN A;  4ZTK A;  3OC2 A;  3IT9 A;  1ES4 A;  2RL3 A;  2OLV A;  1PZO A;  4RYE A;  1YLP A;  2A49 A;  2WGW B;  5CRF A;  5GHZ A;  1ONG A;  4UAA A;  4QU3 A;  3MKF A;  3ZDJ A;  3N8S A;  5JYP A;  4HBT A;  1IYQ A;  4DF6 A;  2CC1 A;  1NY0 A;  3BYD A;  1TEM A;  4X6T A;  1U60 A;  3HBR A;  4KZ7 A;  5CHU A;  4XUX A;  1L0D A;  4IVI A;  3G30 A;  4UA9 A;  3ZG0 A;  1E3U A;  4BEN A;  5KMW A;  2ZM0 A;  3G2Y A;  3GR2 A;  3HUN A;  3I7J A;  3NCK A;  4S2O A;  3N6I A;  5FAS A;  1XXM A;  1VM1 A;  1MWT A;  1W8Q A;  3O86 A;  3E2K A;  3ZG8 B;  4E6X A;  3MZF A;  4OOM A;  4DKI A;  1K56 A;  1KGG A;  1WYB A;  4MBF A;  3BLM A;  1CK3 A;  3ITA A;  1FSW A;  2HP5 A;  5FDH A;  2QMI A;  4MBH A;  4CJN A;  4QD4 A;  1YLJ A;  3G2Z A;  5IHV A;  1DJA A;  2HDS A;  1MXO A;  1VQQ A;  5E2G A;  3N7W A;  3ZGA B;  1ZG6 A;  2XR0 A;  4ID4 A;  3G4P A;  4K91 A;  4DDS A;  1GA0 A;  1SDN A;  3HVF A;  1XGI A;  3RJU A;  2WKI A;  3WS4 A;  4JXW A;  2WAE A;  3BEC A;  4R3J A;  4DDY A;  3HL9 A;  1MWS A;  5L2F A;  3BM6 A;  3HLE A;  3MZE A;  3PBO A;  4OLG A;  4OOY A;  3MBZ A;  1K4E A;  3O88 A;  4OKP A;  3W8K A;  1K54 C;  5EPH A;  4ZDX A;  4WEJ A;  3HLG A;  1BSG A;  2HP6 A;  1JVJ A;  4ZBE A;  3FV7 A;  4L0L A;  3QHY A;  1NZU A;  1QMF A;  5CTM A;  3WRT A;  3GV9 A;  3UNW A;  3WS1 A;  3PBR A;  4BLM A;  3W4P A;  2Y2I A;  3C4P A;  4N1X A;  4KQQ A;  3VP2 A;  2XFS A;  4P87 A;  3OPL A;  3SS4 A;  2ZLY A;  3O3V A;  3SOI A;  2PU2 A;  1PI4 A;  3UE0 A;  2X01 A;  4RA7 A;  5EEC A;  4KZ4 A;  3G31 A;  3NIA A;  3ZG9 B;  4FH2 A;  4N9L A;  3CZD A;  3EQU A;  3FKW A;  3BFE A;  2A3U A;  3M2J A;  4FCF A;  3CMZ A;  4S2N A;  5DTK A;  3ZNY A;  4E3N A;  5AQ9 A;  3C5A A;  2Y2J A;  2Y59 A;  3IWQ A;  1W79 A;  3LO7 A;  3UPN A;  1YM1 A;  3SH7 A;  1ZKJ A;  1PZP A;  2IWC A;  3ZG5 A;  1L0E A;  4EQI A;  1O07 A;  3VOZ A;  2JC7 A;  1NYY A;  3GQZ A;  3IF6 A;  4OOL A;  4IVK A;  1ERO A;  3BEB A;  1GHP A;  5F82 A;  2EFX A;  3IHA A;  3IH9 A;  1MPL A;  1K55 A;  3BRM A;  4OPY A;  1XA1 A;  5FQJ A;  2ZQD A;  4MEZ A;  5FI7 A;  4E3K A;  1IYP A;  4U0X A;  1GA9 A;  4GNU A;  4QJG A;  4PMA A;  2Y2Q A;  3PBN A;  3W4Q A;  5FQM A;  5GLC A;  4K0X A;  5AQB A;  3IF6 B;  2WUQ A;  1PWG A;  3UDI A;  4OQ0 A;  5EVI C;  2WAF A;  1GHM A;  2QZ6 A;  1BT5 A;  3IXG A;  3VSL A;  5A93 A;  4GDN A;  5KZH A;  4WZ4 A;  3TSG A;  1I2S A;  4DXC A;  3V39 A;  3Q07 A;  2JE5 A;  2Q9M A;  2ZD8 A;  1FOF A;  1JTD A;  4N92 A;  1YLW A;  2H10 A;  4UA6 A;  3V5M A;  5CXW A;  2DCF A;  2EX6 A;  4IED A;  3C4O A;  2Y55 A;  1JWZ A;  2X02 A;  2XD5 A;  2P9V A;  4UHU A;  1E4D A;  1Y54 A;  3PAG A;  2Y2G A;  2PU4 A;  1E3U D;  2Q9N A;  5EVL A;  4X53 A; 
#chains in the Genus database with same CATH topology
 4KZ9 A;  3D72 A;  3C7V A;  3UB6 A;  4JF5 A;  2I72 A;  3OZH A;  1PI5 A;  1K56 D;  3HLB A;  2V0U A;  1EI5 A;  1KDS A;  2P9V B;  4MBK A;  4BJP A;  2W3G A;  3L9K A;  4S2K A;  1OT6 A;  1N9O A;  3SH8 A;  3TJZ C;  4HNB A;  3DTE A;  1L0G A;  5EUA A;  2Y2N A;  1LL9 A;  3LCE A;  1STZ A;  4OVD A;  4HHD A;  1BTL A;  4BBU A;  4HJ6 A;  3MFX A;  3CPT B;  4DJ3 A;  3Q7V B;  4H6J B;  5DF8 A;  4KEN B;  5AJG A;  1K25 A;  3LIC A;  3N8R A;  4X1L A;  4II7 A;  3MSH A;  3VFH A;  1CI9 A;  2K31 A;  2WKE A;  1XFQ A;  2W3D A;  1BZA A;  3WRZ A;  4ZJ2 A;  4OQI A;  3LY4 A;  4WEL A;  3BY9 A;  2EXB A;  1FCO A;  2WGV A;  5FSR A;  5FQK A;  4IBR A;  3D4F A;  1OME A;  1UWN X;  1ERQ A;  5HAR A;  2EX2 A;  1L3L A;  3UPO A;  4EQ1 A;  1L0F A;  1IEM A;  2ZQ8 A;  4FD8 A;  4R4S A;  2L1M A;  4KZA A;  5E2H A;  3EEH A;  3CI6 A;  2R9X A;  4OP8 A;  2M7V A;  1W63 M;  4E6W A;  1MWU A;  2EFU A;  3VP1 A;  2D01 A;  2ZOH A;  1ZTU A;  3JVU A;  4GB7 A;  4HJ3 A;  1H8Y A;  4Y0T A;  1PRQ A;  3FKV A;  3IF5 A;  4E3L A;  3MZD A;  2PRF A;  2V8C A;  2DNS A;  2J3T D;  2W3F A;  1GCE A;  2M7U A;  1IKG A;  4R70 A;  3UPP A;  3NC8 A;  3NUL A;  3UO9 A;  2WGI A;  4QY5 A;  1PWD A;  1FSY A;  3W4O A;  5KSC A;  2XDM A;  4KQD A;  2HDU A;  3W2Z A;  2GDN A;  3T12 B;  1FCN A;  4L9E A;  3ITB A;  1YLT A;  5AVE A;  3VOL A;  5D3O A;  1D7E A;  3IX8 A;  4BD0 A;  3CJM A;  5TGF A;  5HDC A;  2WKR A;  2XA7 S;  1D06 A;  4QY6 A;  3KYE A;  3IBR A;  1JWP A;  1C3B A;  1MWR A;  4LCL A;  2WKP A;  5FI2 A;  3WS2 A;  3IXB A;  4L9G A;  3ZG7 B;  2EA9 A;  3LI8 A;  3C7U A;  2OV5 A;  4HY8 A;  5I94 A;  3AGE A;  4MN6 A;  3MQ0 A;  1LSW A;  4WMC D;  3ZFZ A;  4BD1 A;  3UN7 A;  1CQA A;  5EE8 A;  1XFN A;  4UA7 A;  5A92 A;  3LR4 A;  3SH9 A;  5I5L A;  4C75 A;  4NK3 A;  2JKR I;  3GDI A;  2M1C A;  5J3W A;  1YLY A;  2O9A A;  4GHI A;  1Q2P A;  5DJT A;  1DP9 A;  2R78 A;  2KX6 A;  3PBQ A;  4EBP A;  2ZQA A;  3KSI A;  3BFF A;  4R6L A;  5A91 A;  3MXS A;  1ESU A;  2XQZ A;  1DY6 A;  3LR5 A;  3B47 A;  2GX5 A;  4EV4 A;  1VB6 A;  4NG2 A;  1K57 A;  4PM5 A;  1NYM A;  5CGS A;  3OPR A;  5F68 A;  5DF7 A;  1ZC2 A;  5KIZ A;  1BLP A;  4F3L A;  1S6R A;  1H8Z A;  4YWZ A;  4KG5 A;  4ZJ1 A;  5HWW A;  4XXR A;  2BAS A;  3F1N A;  3LGO A;  4U0T A;  2O9C A;  3HLD A;  5CHJ A;  1PW8 A;  4DXB A;  1CI8 A;  3BFC A;  1W8Y A;  1YT4 A;  4OPZ A;  2HGV A;  1IYS A;  4YIN A;  3RXX A;  4CLC E;  3T4K A;  1S1Z A;  2HPB A;  2ZQ9 A;  3Q1F A;  5HAI A;  5CEC A;  1FR1 A;  1PFL A;  1TS8 A;  2RL3 A;  3T4J A;  1YLP A;  4XT2 A;  4QU3 A;  3MKF A;  3N8S A;  5JYP A;  4DF6 A;  1TEM A;  4X6T A;  1U60 A;  4GS9 A;  3MQQ A;  4JGO A;  4I3J A;  3RFB A;  3LIA A;  1L0D A;  4IVI A;  3G30 A;  5KMW A;  2P7J A;  3H9W A;  1LSX A;  3N6I A;  1VM1 A;  1P9R A;  1W8Q A;  3F1P B;  3MS6 A;  4E6X A;  5HZH A;  4EER A;  1UGU A;  1CK3 A;  1FSW A;  5FDH A;  5LBR A;  4BBT A;  2QJ7 A;  1VQQ A;  2ACG A;  1K0K A;  3WS4 A;  4CLC B;  4D60 A;  3CWF A;  3BEC A;  4R3J A;  3HL9 A;  1AWI A;  5DKK A;  3MZE A;  1K4E A;  1CJF A;  4GLQ A;  4ZDX A;  3FV7 A;  3WS1 A;  1NZU A;  4FTX A;  4G3K A;  3GV9 A;  4MN5 A;  3PBR A;  3CLO A;  2Y2I A;  1P97 A;  2O0Y A;  3RTY A;  1S67 L;  1V9Y A;  3MF0 A;  2AVX A;  3G6O A;  3PYP A;  4IUH A;  3UE0 A;  2X01 A;  4RA7 A;  5EEC A;  4KZ4 A;  3ZG9 B;  3EQU A;  3QP1 A;  3M2J A;  1W63 Q;  5AQ9 A;  3IWQ A;  1YPR A;  3A0V A;  1ZKJ A;  1PZP A;  2JC7 A;  1NYY A;  3GQZ A;  1DP6 A;  4HOI A;  2EFX A;  4HQA A;  3IH9 A;  1K55 A;  2JKR M;  4E3K A;  1GA9 A;  4GNU A;  2PYP A;  5GLC A;  3IF6 B;  3UDI A;  4OQ0 A;  5FL3 A;  1GHM A;  3T4T A;  4WZ4 A;  2JE5 A;  5CXW A;  2EX6 A;  3C4O A;  2Y55 A;  2P9V A;  1E4D A;  1Y54 A;  5HL6 A;  1OJ5 A;  2ZL1 A;  3A3F A;  5EVL A;  3T4Q A;  5G4Y A;  2ZQC A;  2J80 A;  1ALQ A;  4E3O A;  3KYQ A;  1IYO A;  3ZNT A;  4IUK A;  3TRC A;  4Y15 A;  3NY4 A;  5GLD A;  4LV1 A;  3ZHH A;  2C6W B;  2PDR A;  3CPT A;  4GOG A;  2MJ6 A;  3CIT A;  5E2E A;  4X69 A;  1QME A;  3Q7V A;  4KUO A;  4R23 A;  4H6J A;  2Y91 A;  1F5M A;  4XT2 B;  5HX9 A;  2J3W A;  3UY6 A;  1H3Q A;  4MDZ A;  1K54 A;  2FZ0 A;  4U3T A;  4GS9 B;  3WS0 A;  4PHT A;  3JYI A;  5HL1 A;  1KVM A;  5GLB A;  4EWF A;  2V9A A;  4JLF A;  2FFF B;  3BFG A;  3TOI A;  4BMW A;  4X25 A;  2XRN A;  2H0Y A;  3VMA A;  1FR6 A;  3PR6 A;  3CUE C;  5HAQ A;  3UDX A;  4RX3 A;  3CG5 A;  3BFD A;  2VK3 A;  1XJ6 A;  2B95 A;  3FWL A;  4E3I A;  2ZQ7 A;  1XA7 A;  2PD8 A;  3NDG A;  3OBF A;  1S1Y A;  2IA2 A;  3QP5 A;  3AGF A;  5F83 A;  4WZ5 C;  3QP6 A;  5HPF A;  2ZM2 A;  4P6B A;  4HJ4 A;  2J7V A;  1ONH A;  4HBU A;  3M6H A;  2H28 A;  3GRJ A;  2VGL M;  1X0O A;  3GMW A;  4S2M A;  2WK0 A;  3HCY A;  4O7D A;  1MBL A;  5EVI B;  2K2N A;  2HJE A;  3PXP A;  3R7W A;  3QP8 A;  4Z9Q A;  1K38 A;  4DRT A;  4EU0 A;  4G3W A;  4DE1 A;  2W1R A;  2A2L A;  4DE3 A;  3OOV A;  2QHK A;  4F94 A;  4KZ6 A;  2XK1 A;  5E43 A;  3O5Y A;  2UV0 E;  3UB7 A;  1PIO A;  4WF0 A;  3LYX A;  4R4R A;  2UWX A;  1ERM A;  4KG2 A;  3PBS A;  1WE4 A;  5CTN A;  5DTT A;  2H5S A;  2XH9 A;  3WS5 A;  4S2J A;  3V3S A;  2ZL1 B;  3SW1 A;  4I3A A;  1MY8 A;  1YLZ A;  4EEP A;  1TDL A;  3EEA A;  2B5R A;  4JKT A;  5FAT A;  2XF3 A;  4GD6 A;  3NEC A;  3T4S A;  1RGZ A;  1DJC A;  2J9P A;  2VA0 A;  3IS2 B;  1YMX A;  2W0N A;  3U4L P;  4UQI M;  2Y8H A;  1GSX A;  5HDS A;  1XP4 A;  2XFT A;  3OPH A;  1BUE A;  3G34 A;  4DE2 A;  3T50 A;  4R0Q A;  4EES A;  2JKF A;  2VV6 A;  1Q2Q A;  1N9L A;  4ME4 A;  5M1A A;  3D3O A;  3BY8 A;  2JBF A;  2ZC7 A;  4X55 A;  2VGK A;  3BW6 A;  4NET A;  2QKP A;  4KUK A;  1NWZ A;  4PKY A;  5GHY A;  4OON A;  5HAP A;  4BL2 A;  3VP4 A;  4NEE D;  2WAD A;  2INW A;  1PYY A;  4OQH A;  2BTF P;  2EX9 A;  4EUV A;  3FYZ A;  1KGE A;  3GSG A;  4IHQ A;  4GN2 A;  2V8F A;  1GSW A;  3LIE A;  4EET B;  1M6K A;  3BLS A;  2Y2L A;  3BWL A;  3HJK A;  3LEQ A;  5IT5 A;  2NUT C;  3LEZ A;  3S7Q A;  3GVB A;  1YSQ A;  1TVF A;  2V1A A;  1TDG A;  5GLA A;  2EWW A;  5F69 A;  4B4Z A;  1OPX A;  3UME A;  4JF6 A;  4I3I A;  2JHE A;  1G6O A;  4KZ3 A;  2ZMF A;  1YQS A;  3KSH A;  3MXR A;  3EGD C;  3T1S A;  2WZZ A;  1BUL A;  5HPI A;  3VE4 A;  1FIK A;  2OSU A;  4S2N C;  1MZU A;  4Y5F A;  2E8I A;  4YNR A;  2ZC5 B;  4KZ5 A;  5CHM A;  3E4P A;  4ZAM A;  3R7W B;  2OLU A;  4OQG A;  3SS5 A;  4E3M A;  1D1J A;  2QPN A;  2V20 A;  2FFY A;  2GZA A;  3Q7Z A;  5FA7 A;  1G68 A;  3K3D A;  5J4E A;  1KVL A;  3G32 A;  2Z6D A;  4XUZ A;  4Q0J A;  3OC2 A;  1ES4 A;  5CRF A;  5GHZ A;  3F1P A;  5DJU A;  3ZDJ A;  2W3H A;  4NXF A;  1NY0 A;  3BYD A;  4Z1W A;  2W27 A;  4XUX A;  4UA9 A;  1LT0 A;  3C30 A;  3G2Y A;  3GR2 A;  4G3V A;  5HSQ A;  5FAS A;  3F1O B;  4CLC A;  3ZG8 B;  3E2K A;  4DKI A;  1KGG A;  1OTA A;  3LIB A;  4PAU A;  2B18 A;  3G2Z A;  2HDS A;  2VZW A;  1ZG6 A;  1IOU A;  1GA0 A;  1T1C A;  3HVF A;  2WKI A;  4WUJ A;  2WAE A;  4WN5 A;  4DDY A;  5L2F A;  3HLE A;  4OOY A;  4OKP A;  4NXB A;  5EPH A;  4EW7 A;  2YKF A;  1QMF A;  3UNW A;  3P7N A;  1S66 L;  4BLM A;  3W4P A;  4BBV A;  3VP2 A;  2XFS A;  3SZT A;  4P87 A;  4Y3I A;  3O3V A;  5FDS A;  3SOI A;  2W1T B;  1PI4 A;  3EOI A;  2VJW A;  2VGL S;  3NIA A;  4N9L A;  5FEG A;  3FKW A;  1BYW A;  3BFE A;  5DTK A;  3ZNY A;  1W79 A;  3LO7 A;  1ZHH B;  3MR0 A;  3SH7 A;  1L0E A;  4EQI A;  1O07 A;  3IF6 A;  1ERO A;  3C2W A;  3IX3 A;  4MMN A;  3BRM A;  1XA1 A;  1VET A;  1IYP A;  2O99 A;  4QJG A;  3PBN A;  3W4Q A;  5FQM A;  3H82 B;  3MXQ A;  3ZQ5 A;  4LFU A;  3LIF A;  5AQB A;  4EXO A;  4Y13 A;  2WUQ A;  4NXG A;  2WAF A;  5F5Y A;  1BT5 A;  3VSL A;  4O8G A;  3TSG A;  2ZD8 A;  1FOF A;  4N92 A;  1YLW A;  3TE8 A;  4E04 A;  4IED A;  2XD5 A;  4UHU A;  3ICY A;  5CX7 A;  3LFV A;  4X53 A;  5FAP A;  4FSF A;  2WKQ A;  4RQ9 A;  3FC7 A;  4Y0O A;  1K4F A;  2WZX A;  1EWZ A;  5HW3 A;  4UQI S;  4S2I A;  3B3X A;  2VLG A;  3VOY A;  2G7U A;  3C8C A;  3GTC A;  1ES2 A;  1G28 A;  4O0P A;  1AXB A;  5BOH A;  3A3J A;  1H0M A;  4P0M A;  4LCM A;  4EUZ A;  2QYB A;  4C3Q A;  3HLC A;  3UB5 P;  3EQV A;  5DF9 A;  1YAX A;  1Y28 A;  2Z6C A;  4H8R A;  2XGN A;  1NRJ A;  2HDQ A;  1TS7 A;  2JKG A;  4LV2 A;  3P98 A;  2C5W B;  5J8X A;  4EEU A;  5EVE A;  2DMW A;  4GKU A;  2Z2L B;  1IEL A;  2B02 A;  3FPW A;  1HZO A;  3T1R A;  4DN0 A;  4CLC C;  4PPR A;  2V1B A;  4GDB A;  1OT9 A;  5FQI A;  5KSH A;  2LB9 A;  1A0K A;  4HES A;  2KDK A;  5CER A;  4JBF A;  4MN7 A;  1XPB A;  1HLU P;  1FQG A;  3A3E A;  3ZVT A;  3DTM A;  5EVI A;  2EXA A;  3A3D A;  4CQH A;  4JXS A;  5TFQ A;  2H0T A;  4QHC A;  3IHB A;  5L07 A;  3UB8 A;  4MCW A;  3RXW A;  2Y2K A;  1SHV A;  1IKI A;  1K57 C;  2OOL A;  2J9O A;  2ZMV A;  1TD5 A;  1VET B;  3RH8 B;  3N4I A;  2P04 A;  4D2O A;  5A8B A;  4LPZ A;  4BQM A;  1SDE A;  4KQR A;  4WM9 A;  3NBL A;  4JGP A;  3PAE A;  5JYO A;  2JN7 A;  3L7H A;  4QPR A;  5HWV A;  4X68 A;  5DFX A;  3NOT C;  2EX8 A;  2XLN A;  3A3I A;  2HV1 A;  3HRE A;  1T19 A;  4KZ8 A;  1NJ4 A;  1Y4O A;  1BLC A;  1HTZ A;  3IS2 A;  4LRX C;  3OLO A;  1FCM A;  2K7S A;  5GL9 A;  5K5B A;  2ZJ9 A;  3NJA A;  4I38 A;  1NZO A;  2BLS A;  3Q81 A;  1P9W A;  4S2P A;  2VEA A;  3UDF A;  2QJ5 A;  3R4K A;  3U2A A;  5E2F A;  1F98 A;  1MKI A;  1W5D A;  2Y2P A;  3CHW P;  3NI9 A;  2G2W A;  5FAQ A;  4RX2 A;  3HLF A;  2HDR A;  2R9W A;  4KZB A;  2CMN A;  3T1X A;  2PD7 A;  1IFQ A;  5AQA A;  3KSG A;  3IWI A;  4LRZ E;  3VP0 A;  1F9I A;  4K08 A;  4JF4 A;  1HD8 A;  4LGW A;  2VX8 A;  4JPM A;  3DW0 A;  3M2K A;  4WEK A;  4HP4 A;  4DJ2 A;  1Z09 A;  3Q82 A;  1ES5 A;  2V2F F;  4RVA A;  3H7W B;  5TBM B;  1PW1 A;  3S7N A;  2QWS A;  3TG9 A;  2ZC4 B;  5CEB A;  2IWB A;  1SKF A;  4QWO A;  1I2W A;  2L4R A;  2A24 B;  5HD5 A;  4MNR A;  1XJ4 A;  4OPQ A;  2GNX A;  3S7P A;  5HWT A;  3HJI A;  3VE3 A;  1DRM A;  1KE4 A;  5CED A;  5FQQ A;  2IWD A;  3IQA A;  4ZJ3 A;  3OCN A;  2XD1 A;  4QB8 A;  5TJJ A;  1JWV A;  1L2S A;  1NRF A;  3IH8 A;  1BLH A;  1H8M A;  1ES3 A;  1ZG4 A;  5DTS A;  4B88 A;  3MFD A;  3FZC A;  1TS6 A;  1SKO B;  3LID A;  2XRO A;  5DFY A;  2VV7 A;  2P74 A;  4I39 A;  5FQ9 A;  4OP5 A;  3HUM A;  4P6Z M;  4ETX A;  1LSV A;  3EWK A;  1CEF A;  1HVB A;  2DRW A;  3O87 A;  2D02 A;  3IXD A;  1KOU A;  3M6B A;  3IWO A;  3S7O A;  4N9K A;  4BL3 A;  1GHI A;  1MKM A;  1TS0 A;  1PNE A;  2HZ5 A;  4B4X A;  1K55 C;  2HP9 A;  1KE0 A;  5CGX A;  4GJ4 A;  4Y2F A;  3NOU C;  1OTI A;  4EBL A;  1N4O A;  4ZRR A;  3P09 A;  4ZTK A;  1UWP X;  2OLV A;  1PZO A;  2WGW B;  3F1O A;  1IYQ A;  2VV8 A;  4KZ7 A;  5L09 A;  1E3U A;  3HUN A;  3I7J A;  3KO6 A;  2LB5 A;  4ARZ A;  1XXM A;  3O86 A;  2YKH A;  1K56 A;  1WYB A;  2HJ9 C;  4MBF A;  3BLM A;  2PAV P;  2QMI A;  4MBH A;  4CJN A;  3E0Y A;  4HH3 A;  4QD4 A;  1DJA A;  1MXO A;  5E2G A;  4M4X A;  4ID4 A;  4K91 A;  1XGI A;  3RJU A;  4JXW A;  2W1T A;  1MWS A;  2HF6 A;  3O88 A;  3W8K A;  1K54 C;  2HP6 A;  1JVJ A;  5CTM A;  3WRT A;  3LI9 A;  3A0R A;  4N1X A;  4KQQ A;  3OPL A;  3SS4 A;  2ZLY A;  5G4Z A;  3MJQ A;  4AFI A;  3G31 A;  2PT7 A;  4FCF A;  1YM1 A;  3ZG5 A;  2OWH A;  3H82 A;  4WL9 A;  2OAP 1;  4I5S A;  3LR0 A;  4OOL A;  2ZOI A;  4IVK A;  4FUW A;  3BEB A;  5IS1 A;  1GHP A;  1S4S A;  3IHA A;  1MPL A;  3D9Y A;  5EV0 A;  4MEZ A;  4U0X A;  3QP2 A;  2I9V A;  3NOP C;  2Y2Q A;  4HIA A;  1VEU B;  4IJG A;  2QZ6 A;  5A93 A;  3Q07 A;  4R38 A;  2Q9M A;  4UA6 A;  2DCF A;  1JWZ A;  2X02 A;  3PAG A;  5L10 A;  2Q9N A;  1XJ3 A;  5HD3 A;  1LI9 A;  4FH4 A;  3BJN A;  4CLC D;  2ZM8 A;  2X71 A;  5C5K A;  2V1Z A;  1S0W A;  4LRY C;  1O7E A;  1DJB A;  4Q0H A;  4Q0I A;  5HFO A;  1LL8 A;  4X56 A;  5FAO A;  4B93 A;  1KE3 A;  3CAX A;  3VSK A;  3TW8 A;  1F2K A;  1WA9 A;  3LY3 A;  4KG6 A;  1YKD A;  5HDD A;  1P0Z A;  4R3B A;  1OTE A;  1SZV A;  3ZVW A;  2PR5 A;  3A0S A;  1NXY A;  4ARZ B;  1K6R A;  1V9Z A;  1S4R A;  4M3K A;  1T1A A;  4GZB A;  4Y17 A;  4ESP A;  2G2U A;  4JGR A;  4A5R A;  1DP8 A;  3DWK A;  4WMC A;  3S22 A;  4PM7 A;  3FG8 A;  3E4O A;  4WBG A;  5M18 A;  3V50 A;  3PBT A;  1I5Q A;  3B33 A;  3MMH A;  2VKS A;  3PTE A;  5U47 A;  2KOI A;  1RGY A;  4JGQ A;  3DTK A;  4O01 A;  4LV0 A;  3IXH A;  3DTI A;  4C6Y A;  5MC7 A;  3P01 A;  1G6A A;  3GEC A;  4WYY A;  2WKH A;  5F1G A;  2Y2O A;  3SS3 A;  1N9N A;  1K6S A;  1ESI A;  3G35 A;  4P6Z S;  4ETZ A;  5J7E A;  1BLS A;  2J8Y A;  1ODV A;  5CGW A;  2ZC3 B;  4KQO A;  4Y0U A;  2E8J A;  4JXG A;  4K0W A;  3WWX A;  4GCZ A;  4Q8I A;  1EW0 A;  5M19 A;  5DVA A;  3LR3 A;  4IBX A;  4OPR A;  1KDW A;  2JCH A;  1JTG A;  1LL5 A;  3AGD A;  3PHY A;  3IX4 A;  1KGF A;  1FIL A;  4PM9 A;  1OTD A;  3ISG A;  1N9B A;  2O9B A;  4BWI A;  1LHY A;  4R1G A;  2EWV A;  1E25 A;  2PBD P;  1VHM A;  2GJ3 A;  3MQO A;  3QNB A;  4UEY A;  3CUE A;  3T4L A;  2Y2M A;  3IBJ A;  1T1B A;  3N8L A;  3UMD A;  2WYX A;  2OAQ 1;  4X1M A;  3BQA A;  2J3T C;  2NUP C;  5FI6 A;  2JKT I;  1LI0 A;  2XSS A;  5GHX A;  3UE6 A;  4DE0 A;  4HH2 A;  2Y4A A;  4S2L A;  1XX2 A;  5TR7 A;  4HEF A;  4N1H A;  1NLZ A;  2XEP A;  4B9O A;  2KLI A;  4R3A A;  4WZ5 A;  2BG1 A;  5F1F A;  2L0W A;  1PWC A;  3LUQ A;  1XGJ A;  3JPU A;  2Y2H A;  4PM6 A;  3H7W A;  5TBM A;  4P85 A;  5FEF A;  5EVI D;  4FOF A;  1M40 A;  5AQ7 A;  2A24 A;  1RCJ A;  3HLW A;  3QP4 A;  2PR6 A;  4PM8 A;  4OLD A;  2VGJ A;  2PBY A;  3V67 A;  4GHI B;  5G18 A;  5AVF A;  2P08 A;  3QNC A;  4LLO B;  3UE3 A;  4JXV A;  3VV4 A;  1H5X A;  2ZC6 B;  5IU1 A;  1SCW A;  3ULF A;  3HUO A;  3KSF A;  1W7F A;  1WYC A;  3T4O A;  4GD8 A;  3E2L A;  1J9M A;  1MC0 A;  3VP3 A;  5EOE A;  1CEG A;  4HP9 A;  1SKO A;  4CPK A;  3S1Y A;  5EM1 A;  3UB9 A;  4YOF A;  1RP5 A;  3UE1 A;  3VFF A;  4MLL A;  3S4X A;  1YMS A;  5A90 A;  5F6A A;  4GW9 A;  1XKZ A;  4F3L B;  2ZMA A;  1LLB A;  1Z6F A;  3DBA A;  4E3J A;  4YFM A;  2PYR A;  3OCL A;  2Z2M B;  3OPP A;  4DMZ A;  5EOO A;  2RCX A;  3IF6 C;  3EGX C;  3ZCZ A;  3F1N B;  3C38 A;  3MKE A;  3E4Q A;  3V3R A;  1J3W A;  3DWZ A;  4OH0 A;  4Y7P A;  2WGW A;  4EBN A;  4LV3 A;  1G5U A;  3NDE A;  4LEN A;  2W3E A;  3IT9 A;  4RYE A;  2A49 A;  1YSP A;  1ONG A;  4UAA A;  1OTB A;  3E98 A;  4HBT A;  1JNU A;  2CC1 A;  2OWJ A;  2XA7 M;  3HBR A;  2FH5 A;  5L8M A;  5CHU A;  3ZG0 A;  4BEN A;  4NKP A;  2PHY A;  2ZM0 A;  5DKL A;  1ACF A;  3NCK A;  4S2O A;  1NLY A;  1MWT A;  3MZF A;  4OOM A;  3B42 A;  3ITA A;  3T1Q B;  2HP5 A;  1YLJ A;  5IHV A;  3ZGA B;  3N7W A;  2XR0 A;  3G4P A;  4DDS A;  3KX0 X;  1SDN A;  4NXE A;  3BM6 A;  3PBO A;  4OLG A;  3MBZ A;  3ZYT A;  4WEJ A;  3HLG A;  1BSG A;  4ZBE A;  4L0L A;  3QHY A;  3K3C A;  3C4P A;  2V0W A;  1T18 A;  5EFW A;  3FPV A;  2PU2 A;  4PKY G;  2Y79 A;  4FH2 A;  3CZD A;  4HI4 A;  4L9F A;  3NHQ A;  2A3U A;  4S2N A;  3CMZ A;  2JKT M;  4E3N A;  3C5A A;  2Y2J A;  2Y59 A;  3UPN A;  2IWC A;  1CF0 A;  3VOZ A;  1OJG A;  1VEU A;  3DAV A;  5F82 A;  2Q0O A;  4OPY A;  5FQJ A;  2ZQD A;  3BQ8 A;  5FI7 A;  3K2N A;  4PMA A;  1TF1 A;  3JVV A;  4K0X A;  1PWG A;  5EVI C;  5EM0 A;  3IXG A;  4GDN A;  5KZH A;  4DXC A;  1I2S A;  3V39 A;  1GSV A;  3KYZ A;  4WLA A;  1JTD A;  2H10 A;  3V5M A;  1XJ2 A;  2Y2G A;  2PU4 A;  2ZBB A;  1E3U D; 
#chains in the Genus database with same CATH homology
 1LI9 A;  2ZQC A;  4KZ9 A;  4FH4 A;  1ALQ A;  3C7V A;  5FAP A;  4FSF A;  4E3O A;  4JF5 A;  2ZM8 A;  1IYO A;  2I72 A;  3ZNT A;  4Y0O A;  1K4F A;  1PI5 A;  1K56 D;  3NY4 A;  3OZH A;  2X71 A;  3HLB A;  2WZX A;  1EWZ A;  4LV1 A;  5GLD A;  5HW3 A;  1EI5 A;  3ZHH A;  2V1Z A;  2C6W B;  1KDS A;  2P9V B;  1S0W A;  4MBK A;  4BJP A;  4GOG A;  5E2E A;  4S2K A;  4S2I A;  4X69 A;  3B3X A;  3SH8 A;  1QME A;  3Q7V A;  3VOY A;  1O7E A;  1DJB A;  4R23 A;  3GTC A;  5HFO A;  1ES2 A;  4X56 A;  5FAO A;  1L0G A;  2Y91 A;  5EUA A;  5HX9 A;  2Y2N A;  1KE3 A;  3UY6 A;  1LL9 A;  3LCE A;  3VSK A;  4OVD A;  1AXB A;  1K54 A;  3A3J A;  4U3T A;  5BOH A;  3LY3 A;  4KG6 A;  1BTL A;  4P0M A;  3WS0 A;  4LCM A;  4EUZ A;  3JYI A;  4C3Q A;  3HLC A;  5HL1 A;  3Q7V B;  4R3B A;  1KVM A;  5GLB A;  3EQV A;  3ZVW A;  5DF8 A;  4KEN B;  4EWF A;  5DF9 A;  4JLF A;  1NXY A;  2FFF B;  3BFG A;  3TOI A;  1K6R A;  1K25 A;  2H0Y A;  3VMA A;  1FR6 A;  3N8R A;  4H8R A;  2XGN A;  5HAQ A;  4M3K A;  3UDX A;  3VFH A;  1CI9 A;  2WKE A;  4RX3 A;  2HDQ A;  4GZB A;  1BZA A;  3CG5 A;  2G2U A;  3P98 A;  3BFD A;  4LV2 A;  4ZJ2 A;  2C5W B;  3WRZ A;  4A5R A;  5J8X A;  3DWK A;  3LY4 A;  4OQI A;  4WEL A;  4WMC A;  3S22 A;  4PM7 A;  3FWL A;  2EXB A;  4E3I A;  1FCO A;  2ZQ7 A;  2WGV A;  5FSR A;  5FQK A;  4IBR A;  4WBG A;  5M18 A;  1XA7 A;  4GKU A;  2Z2L B;  3D4F A;  3NDG A;  1IEL A;  3V50 A;  3PBT A;  1HZO A;  1I5Q A;  1OME A;  1ERQ A;  3AGF A;  5F83 A;  2EX2 A;  5HAR A;  3PTE A;  4PPR A;  4WZ5 C;  4GDB A;  3UPO A;  5U47 A;  5FQI A;  5KSH A;  1RGY A;  1L0F A;  1IEM A;  2ZM2 A;  2ZQ8 A;  4HES A;  4P6B A;  4FD8 A;  4R4S A;  5CER A;  4KZA A;  5E2H A;  4JBF A;  2R9X A;  4LV0 A;  2J7V A;  4OP8 A;  1ONH A;  1XPB A;  1FQG A;  3A3E A;  3ZVT A;  3IXH A;  4HBU A;  3DTM A;  4C6Y A;  5EVI A;  4E6W A;  2EXA A;  3M6H A;  1G6A A;  3A3D A;  1MWU A;  3GRJ A;  2EFU A;  4WYY A;  3VP1 A;  4JXS A;  2WKH A;  4GB7 A;  5TFQ A;  3GMW A;  4S2M A;  2H0T A;  2WK0 A;  1H8Y A;  4Y0T A;  4QHC A;  5F1G A;  3IF5 A;  3FKV A;  4E3L A;  2Y2O A;  3MZD A;  3IHB A;  3SS3 A;  1K6S A;  1ESI A;  2DNS A;  3G35 A;  1GCE A;  4O7D A;  1MBL A;  1IKG A;  5EVI B;  1BLS A;  3RXW A;  2Y2K A;  2J8Y A;  1SHV A;  3UPP A;  3NC8 A;  1IKI A;  1K57 C;  3UO9 A;  2WGI A;  4QY5 A;  5CGW A;  1PWD A;  1FSY A;  3W4O A;  4Z9Q A;  2ZC3 B;  2J9O A;  1K38 A;  4KQO A;  4Y0U A;  4DRT A;  5KSC A;  2XDM A;  3N4I A;  4JXG A;  4K0W A;  4D2O A;  4DE1 A;  4DE3 A;  3WWX A;  4F94 A;  4KZ6 A;  4BQM A;  2HDU A;  1SDE A;  4KQR A;  4Q8I A;  2GDN A;  2XK1 A;  4WM9 A;  5M19 A;  3NBL A;  1FCN A;  5DVA A;  3ITB A;  3PAE A;  5E43 A;  5JYO A;  1YLT A;  4OPR A;  4IBX A;  1KDW A;  1PIO A;  2JCH A;  5D3O A;  1JTG A;  4R4R A;  1LL5 A;  3AGD A;  4X68 A;  2UWX A;  2EX8 A;  1ERM A;  4KG2 A;  1KGF A;  4BD0 A;  3CJM A;  3PBS A;  4PM9 A;  5TGF A;  1WE4 A;  3ISG A;  2XLN A;  5CTN A;  1N9B A;  5DTT A;  3A3I A;  3HRE A;  1LHY A;  4QY6 A;  4R1G A;  4KZ8 A;  1NJ4 A;  2H5S A;  2XH9 A;  3WS5 A;  1E25 A;  1BLC A;  1HTZ A;  1JWP A;  1C3B A;  1MWR A;  4LCL A;  4S2J A;  4DXB A;  3V3S A;  1FCM A;  1MY8 A;  5GL9 A;  5FI2 A;  3QNB A;  1YLZ A;  2ZJ9 A;  3WS2 A;  3IXB A;  1TDL A;  1NZO A;  2BLS A;  3Q81 A;  2B5R A;  4JKT A;  3ZG7 B;  5FAT A;  2XF3 A;  2Y2M A;  4GD6 A;  4S2P A;  3C7U A;  3N8L A;  2OV5 A;  1RGZ A;  3UDF A;  2WYX A;  3A3F A;  5I94 A;  3AGE A;  1DJC A;  2J9P A;  1YMX A;  5FI6 A;  5E2F A;  4WMC D;  1LI0 A;  5GHX A;  3ZFZ A;  4BD1 A;  4DE0 A;  2Y4A A;  1MKI A;  1W5D A;  3UN7 A;  1XP4 A;  2XFT A;  1XX2 A;  4S2L A;  3OPH A;  4HEF A;  4N1H A;  5TR7 A;  2XEP A;  1BUE A;  2Y2P A;  3G34 A;  3NI9 A;  4DE2 A;  2G2W A;  4R0Q A;  5FAQ A;  4WZ5 A;  5EE8 A;  4UA7 A;  1Q2Q A;  4RX2 A;  3HLF A;  5A92 A;  2BG1 A;  2HDR A;  3SH9 A;  5M1A A;  4C75 A;  2JBF A;  2R9W A;  2ZC7 A;  4X55 A;  4KZB A;  4NK3 A;  5F1F A;  2VGK A;  1PWC A;  4NET A;  1XGJ A;  5GHY A;  1YLY A;  4OON A;  5HAP A;  4BL2 A;  5AQA A;  2Y2H A;  3VP4 A;  4PM6 A;  1Q2P A;  3IWI A;  2WAD A;  4P85 A;  5EVI D;  3VP0 A;  3PBQ A;  4EBP A;  1PYY A;  1M40 A;  4OQH A;  5AQ7 A;  4JF4 A;  1HD8 A;  2ZQA A;  2EX9 A;  1RCJ A;  3HLW A;  4JPM A;  3BFF A;  3DW0 A;  3FYZ A;  1KGE A;  3GSG A;  3M2K A;  5A91 A;  4WEK A;  4GN2 A;  4PM8 A;  4OLD A;  3MXS A;  2VGJ A;  2PBY A;  3Q82 A;  1ES5 A;  2V2F F;  5G18 A;  1ESU A;  4RVA A;  3QNC A;  2XQZ A;  1DY6 A;  3UE3 A;  1M6K A;  1PW1 A;  4JXV A;  3TG9 A;  2ZC4 B;  4EV4 A;  2IWB A;  5CEB A;  1SKF A;  3BLS A;  1H5X A;  1K57 A;  2Y2L A;  2ZC6 B;  1SCW A;  1I2W A;  4PM5 A;  3HUO A;  4MNR A;  1NYM A;  1W7F A;  1WYC A;  4GD8 A;  5CGS A;  3OPR A;  3E2L A;  4OPQ A;  3LEZ A;  5DF7 A;  3GVB A;  1J9M A;  1KE4 A;  1ZC2 A;  3VP3 A;  5EOE A;  1CEG A;  5CED A;  1BLP A;  1S6R A;  5FQQ A;  1TVF A;  5GLA A;  1TDG A;  2IWD A;  3IQA A;  3S1Y A;  4CPK A;  1H8Z A;  4ZJ3 A;  3OCN A;  4B4Z A;  2XD1 A;  4KG5 A;  4QB8 A;  4JF6 A;  1JWV A;  1L2S A;  4ZJ1 A;  4KZ3 A;  4XXR A;  1RP5 A;  3UE1 A;  1NRF A;  3VFF A;  3IH8 A;  1BLH A;  1YQS A;  1ES3 A;  1ZG4 A;  3MXR A;  4MLL A;  5DTS A;  1YMS A;  3S4X A;  4U0T A;  2WZZ A;  1BUL A;  4B88 A;  5A90 A;  3HLD A;  3MFD A;  1XKZ A;  2OSU A;  3FZC A;  4S2N C;  5CHJ A;  1PW8 A;  2ZMA A;  2E8I A;  2ZC5 B;  4KZ5 A;  1CI8 A;  1LLB A;  5CHM A;  2P74 A;  5FQ9 A;  1Z6F A;  3BFC A;  1W8Y A;  4OP5 A;  3HUM A;  4E3J A;  4YFM A;  1YT4 A;  4ZAM A;  3OCL A;  2Z2M B;  4OPZ A;  1CEF A;  3OPP A;  2OLU A;  1HVB A;  2DRW A;  3O87 A;  5EOO A;  4OQG A;  2RCX A;  3IF6 C;  3IXD A;  3ZCZ A;  1IYS A;  3IWO A;  3M6B A;  3MKE A;  3SS5 A;  3V3R A;  4E3M A;  2QPN A;  4N9K A;  4YIN A;  2V20 A;  3DWZ A;  4OH0 A;  1GHI A;  4Y7P A;  4BL3 A;  2WGW A;  4B4X A;  2FFY A;  1K55 C;  2HP9 A;  3Q7Z A;  4EBN A;  5FA7 A;  1G68 A;  4LV3 A;  3RXX A;  1KE0 A;  5CGX A;  3NDE A;  2HPB A;  1N4O A;  4EBL A;  1KVL A;  2ZQ9 A;  3G32 A;  3Q1F A;  5HAI A;  3P09 A;  4XUZ A;  5CEC A;  1FR1 A;  4LEN A;  4ZTK A;  3OC2 A;  3IT9 A;  1ES4 A;  2RL3 A;  2OLV A;  1PZO A;  4RYE A;  1YLP A;  2A49 A;  2WGW B;  5CRF A;  5GHZ A;  1ONG A;  4UAA A;  4QU3 A;  3MKF A;  3ZDJ A;  3N8S A;  5JYP A;  4HBT A;  1IYQ A;  4DF6 A;  2CC1 A;  1NY0 A;  3BYD A;  1TEM A;  4X6T A;  1U60 A;  3HBR A;  4KZ7 A;  5CHU A;  4XUX A;  1L0D A;  4IVI A;  3G30 A;  4UA9 A;  3ZG0 A;  1E3U A;  4BEN A;  5KMW A;  2ZM0 A;  3G2Y A;  3GR2 A;  3HUN A;  3I7J A;  3NCK A;  4S2O A;  3N6I A;  5FAS A;  1XXM A;  1VM1 A;  1MWT A;  1W8Q A;  3O86 A;  3E2K A;  3ZG8 B;  4E6X A;  3MZF A;  4OOM A;  4DKI A;  1K56 A;  1KGG A;  1WYB A;  4MBF A;  3BLM A;  1CK3 A;  3ITA A;  1FSW A;  2HP5 A;  5FDH A;  2QMI A;  4MBH A;  4CJN A;  4QD4 A;  1YLJ A;  3G2Z A;  5IHV A;  1DJA A;  2HDS A;  1MXO A;  1VQQ A;  5E2G A;  3N7W A;  3ZGA B;  1ZG6 A;  2XR0 A;  4ID4 A;  3G4P A;  4K91 A;  4DDS A;  1GA0 A;  1SDN A;  3HVF A;  1XGI A;  3RJU A;  2WKI A;  3WS4 A;  4JXW A;  2WAE A;  3BEC A;  4R3J A;  4DDY A;  3HL9 A;  1MWS A;  5L2F A;  3BM6 A;  3HLE A;  3MZE A;  3PBO A;  4OLG A;  4OOY A;  3MBZ A;  1K4E A;  3O88 A;  4OKP A;  3W8K A;  1K54 C;  5EPH A;  4ZDX A;  4WEJ A;  3HLG A;  1BSG A;  2HP6 A;  1JVJ A;  4ZBE A;  3FV7 A;  4L0L A;  3QHY A;  1NZU A;  1QMF A;  5CTM A;  3WRT A;  3GV9 A;  3UNW A;  3WS1 A;  3PBR A;  4BLM A;  3W4P A;  2Y2I A;  3C4P A;  4N1X A;  4KQQ A;  3VP2 A;  2XFS A;  4P87 A;  3OPL A;  3SS4 A;  2ZLY A;  3O3V A;  3SOI A;  2PU2 A;  1PI4 A;  3UE0 A;  2X01 A;  4RA7 A;  5EEC A;  4KZ4 A;  3G31 A;  3NIA A;  3ZG9 B;  4FH2 A;  4N9L A;  3CZD A;  3EQU A;  3FKW A;  3BFE A;  2A3U A;  3M2J A;  4FCF A;  3CMZ A;  4S2N A;  5DTK A;  3ZNY A;  4E3N A;  5AQ9 A;  3C5A A;  2Y2J A;  2Y59 A;  3IWQ A;  1W79 A;  3LO7 A;  3UPN A;  1YM1 A;  3SH7 A;  1ZKJ A;  1PZP A;  2IWC A;  3ZG5 A;  1L0E A;  4EQI A;  1O07 A;  3VOZ A;  2JC7 A;  1NYY A;  3GQZ A;  3IF6 A;  4OOL A;  4IVK A;  1ERO A;  3BEB A;  1GHP A;  5F82 A;  2EFX A;  3IHA A;  3IH9 A;  1MPL A;  1K55 A;  3BRM A;  4OPY A;  1XA1 A;  5FQJ A;  2ZQD A;  4MEZ A;  5FI7 A;  4E3K A;  1IYP A;  4U0X A;  1GA9 A;  4GNU A;  4QJG A;  4PMA A;  2Y2Q A;  3PBN A;  3W4Q A;  5FQM A;  5GLC A;  4K0X A;  5AQB A;  3IF6 B;  2WUQ A;  1PWG A;  3UDI A;  4OQ0 A;  5EVI C;  2WAF A;  1GHM A;  2QZ6 A;  1BT5 A;  3IXG A;  3VSL A;  5A93 A;  4GDN A;  5KZH A;  4WZ4 A;  3TSG A;  1I2S A;  4DXC A;  3V39 A;  3Q07 A;  2JE5 A;  2Q9M A;  2ZD8 A;  1FOF A;  1JTD A;  4N92 A;  1YLW A;  2H10 A;  4UA6 A;  3V5M A;  5CXW A;  2DCF A;  2EX6 A;  4IED A;  3C4O A;  2Y55 A;  1JWZ A;  2X02 A;  2XD5 A;  2P9V A;  4UHU A;  1E4D A;  1Y54 A;  3PAG A;  2Y2G A;  2PU4 A;  1E3U D;  2Q9N A;  5EVL A;  4X53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...