3DTMA

Increased folding stability of tem-1 beta-lactamase by in-vitro selection
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRSEERFPMMSTFKVLLCGAILSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKGLTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTPASRQQLMDWMEADKVAGPLLRSVLPAGWFIADKSGAGERGSRGIVAALGPDGKPSRIVVIYTTGSQATMDELNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increased folding stability of TEM-1 beta-lactamase by in vitro selection
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3dtmA00
1LL9A 3PBRA 3OPHA 5A93A 2QZ6A 1ERMA 3ZG8B 1K4FA 1NY0A 1KE0A 1U60A 2Y2GA 3O3VA 2EX2A 5EVIB 5FI7A 1KE3A 3VSLA 1EROA 3Q81A 1ZC2A 3GSGA 2FFYA 3HUOA 4XUZA 2JC7A 2X01A 4OLDA 4R1GA 3OPPA 3HLFA 3HLEA 4E6WA 1Y54A 4DRTA 3D4FA 3HL9A 3RXWA 4MLLA 3S4XA 1H5XA 4JPMA 1J9MA 5TR7A 1GHPA 5U47A 3ZVTA 4ZJ1A 1YLTA 5HAQA 1XPBA 4ZBEA 4OPZA 1IELA 2XR0A 2C5WB 2XQZA 4U0XA 2J7VA 1M6KA 4KZ9A 2WUQA 1K6RA 1KVMA 3DWKA 3UDFA 1W7FA 5EVIC 2XH9A 3RXXA 2HP9A 3BM6A 3G35A 4ZTKA 3MXRA 4S2OA 3WS2A 1IEMA 1FCNA 3IXBA 4UA6A 1FR1A 2X71A 4OLGA 5CHMA 3IXHA 5GHYA 4EWFA 1M40A 1PI5A 4LV0A 4IEDA 1L0DA 4BL3A 3PAGA 3G30A 2DCFA 4NK3A 5IHVA 1S6RA 3LY4A 4PM7A 4KQRA 4OH0A 3WS0A 2ZLYA 2Z2MB 3P98A 5HW3A 1ERQA 1SCWA 3E2LA 3Q82A 1K56A 2G2WA 1K4EA 1XX2A 3LO7A 5EOEA 3G34A 4WEKA 2EFUA 2Y2LA 3GR2A 4DDSA 4MBFA 3HLWA 2WKIA 4OP5A 3UE3A 3JYIA 4JXGA 3FKVA 5FQ9A 1ES5A 3G2YA 2Y4AA 4HBUA 2WGWB 3WS5A 4KZ4A 4BLMA 2ZC3B 4CPKA 4K0WA 1SKFA 4RX2A 5FATA 3OCLA 2BLSA 2JCHA 4P87A 1HD8A 1LL5A 5TFQA 3NDEA 1SDNA 2ZQCA 5A92A 2C6WB 2WZXA 3PAEA 5E2HA 4S2MA 4ID4A 2R9XA 4FCFA 1I2WA 5F1GA 5GHZA 3FKWA 3V3RA 3UPNA 1HVBA 3BFFA 3ITAA 2IWCA 2ZQ9A 4Y0OA 1QMFA 1AXBA 4X53A 4KQQA 1RGZA 5DF9A 4DE0A 1ESUA 2WAFA 2XD5A 4EBLA 1TDGA 3OC2A 1FSWA 2HP5A 3C4PA 2ZQAA 3O86A 1IKIA 5TGFA 1K55A 1O07A 1ALQA 3VMAA 3A3EA 4QU3A 4WZ5A 1YT4A 1LLBA 4YFMA 4MNRA 5M19A 4O7DA 4N92A 3SH8A 3VOZA 1KGGA 1K57C 3ISGA 4EUZA 1ESIA 4B4XA 3LEZA 2XDMA 3Q7VA 4OVDA 3M6BA 3AGFA 1PYYA 5JYPA 2EX8A 4N1XA 3BECA 3NC8A 3OCNA 1SHVA 3I7JA 3IF6B 3SOIA 2ZC5B 4F94A 4KZ7A 5FAQA 2OV5A 4JKTA 3IHBA 3IHAA 1TEMA 3ZGAB 2HDSA 3NCKA 1XA1A 1LI9A 4OPRA 2XLNA 2P9VB 1KGFA 1MKIA 1TDLA 1ONGA 4HEFA 4KG6A 3SS5A 3VP3A 1K54C 1EWZA 1ONHA 1K6SA 2Z2LB 1G68A 3CMZA 4N9KA 4QY6A 1YLPA 2UWXA 4LV3A 1Q2PA 4S2NA 3IH9A 5FQMA 1BUEA 2XGNA 2Y2PA 3VP0A 4GOGA 1HZOA 3IF6C 3VP2A 1NYMA 2GDNA 3M2JA 4FH2A 4E3JA 2E8IA 4JF5A 3GTCA 3MZDA 5FAOA 1WYCA 5KSHA 4DF6A 1PZOA 4S2IA 2Y55A 3VP4A 2ZMAA 3S1YA 1YLZA 3O87A 5CERA 3W4QA 4L0LA 1DJBA 1S0WA 1RCJA 2ZC7A 5HL1A 2XK1A 5HFOA 5CHUA 1XKZA 1N4OA 4GD8A 5KZHA 3BYDA 5FI2A 3WWXA 4KQOA 5CGWA 3ZNTA 3MBZA 1RP5A 3NDGA 1BLHA 4WMCA 3UNWA 3BFDA 4BJPA 3LY3A 3IF5A 2P74A 2ZQ7A 4HESA 4IVIA 1K25A 4WMCD 3NIAA 5EOOA 1YMSA 2PU4A 1IKGA 4HBTA 1GA0A 5GLAA 2A3UA 4D2OA 2WYXA 5A90A 4RYEA 4MEZA 3EQVA 4DE3A 4KZ6A 1MWRA 3UO9A 3FZCA 3AGDA 4NETA 3W4OA 1DJAA 3BFCA 3UDIA 2DNSA 4JXSA 3UY6A 4EBPA 4WM9A 1IYSA 1NYYA 1VM1A 1ZKJA 5FAPA 4UHUA 4PM5A 3B3XA 1EI5A 5EVIA 2XFSA 4PM8A 3W8KA 1YM1A 5CHJA 5BOHA 1NXYA 5CTNA 5EVID 2Y2QA 4KZBA 3GVBA 2G2UA 2WADA 1ES2A 4E3MA 1YQSA 1OMEA 2V2FF 3DTMA 4IVKA 4A5RA 2Y91A 3GMWA 3HLBA 1FSYA 3HLDA 1H8YA 4PM9A 2IWBA 4S2JA 1O7EA 3OPRA 2WZZA 1JWPA 5EE8A 1FOFA 4K91A 4PMAA 3Q7ZA 3AGEA 3C5AA 3W4PA 5HAIA 2ZQ8A 3IH8A 4UA7A 2HDQA 2RCXA 4FSFA 4IBXA 3A3FA 3EQUA 4E3IA 4Y7PA 4P0MA 3BRMA 3UE0A 5GLBA 3Q7VB 3G32A 1K38A 2WGIA 3FWLA 1BT5A 5EUAA 4OKPA 5CRFA 4ZJ2A 3TSGA 5DF8A 1MWTA 2WK0A 4EQIA 5HAPA 2H0YA 4Y0UA 2CC1A 3HLCA 2J9PA 4MBHA 4UAAA 5E2FA 4KENB 3WS4A 4BL2A 2EXAA 1W5DA 4C75A 3FV7A 4FD8A 3OZHA 1PWDA 1KDSA 4RA7A 5CGXA 5D3OA 1JVJA 5HX9A 4EBNA 1TVFA 4WELA 1K55C 4R23A 3A3IA 4BQMA 4ZDXA 4GB7A 1YMXA 5AQAA 3P09A 5F82A 1PW1A 2WKEA 3QHYA 4KG5A 2RL3A 1YLJA 2ZM8A 4QD4A 3NBLA 4E3KA 1JWVA 4OPQA 4X68A 3BFEA 3IXGA 1Z6FA 4E3OA 1I2SA 3UPOA 4QY5A 1FCOA 3CG5A 4B4ZA 3RJUA 3DW0A 3UE1A 4E3NA 1YLYA 1ES4A 3HREA 3V39A 3PBNA 3PBQA 4WBGA 5FASA 2FFFB 1KGEA 1BZAA 1FQGA 3MFDA 2HDRA 4JBFA 4S2LA 2XEPA 2Y59A 1I5QA 1XA7A 3HUMA 4P85A 2EX6A 2H5SA 4UA9A 3BFGA 2VGKA 5A91A 3PTEA 4OP8A 1KE4A 3G4PA 4DKIA 4E6XA 2ZC4B 4LENA 3N7WA 4KZ5A 3IXDA 1N9BA 3BLSA 3ZG9B 2Y2OA 1BLSA 3PBTA 3C4OA 4S2NC 1IYQA 1CEGA 1NJ4A 2WKHA 4Z9QA 4K0XA 5AQ7A 5F1FA 3Q1FA 4CJNA 5CXWA 4LCMA 1DY6A 5DTSA 4OQHA 5HARA 3UPPA 1QMEA 3WRZA 3ZG7B 3MZFA 4GDBA 3PBOA 4OQ0A 4QHCA 4JXWA 4ZJ3A 3OPLA 4IBRA 5CECA 2JBFA 4DXBA 5EECA 5AQ9A 1WYBA 5EPHA 4RVAA 2Q9NA 3NI9A 4P6BA 5DTTA 5E2GA 3IWOA 3HVFA 4DE1A 4S2PA 4QJGA 1NZOA 5F83A 2PBYA 1IYOA 4MBKA 1LHYA 3V50A 3PBSA 4X6TA 5CGSA 3V5MA 3WS1A 3LCEA 3ZDJA 1CK3A 2OLVA 4YINA 4EV4A 3VOYA 1ZG6A 2QMIA 2WAEA 3N8SA 3N8LA 2ZM0A 5E43A 3C7UA 2A49A 1DJCA 3MXSA 4X56A 1IYPA 3VFFA 3QNCA 4U3TA 2ZQDA 1GA9A 5M1AA 1E25A 4LCLA 5M18A 5FQKA 1KDWA 1RGYA 2H0TA 2ZD8A 4WYYA 3CJMA 5FQQA 3GQZA 3WRTA 4BD0A 3IWQA 4OPYA 5FDHA 2XF3A 1MWUA 2EFXA 1PZPA 1G6AA 4OOLA 1BTLA 4DDYA 2R9WA 1E3UA 4C3QA 2V1ZA 3O88A 3V3SA 2Y2HA 3UN7A 3ZHHA 1NZUA 3HBRA 2QPNA 1E3UD 3SH7A 2Y2JA 2Y2KA 3DWZA 3GRJA 5FA7A 3ZVWA 5FI6A 3C7VA 4KZ3A 4GN2A 1W8QA 2WGVA 1FR6A 1MY8A 2V20A 3SS3A 1PIOA 4QB8A 1C3BA 2HP6A 5E2EA 1W79A 1BLPA 3A3DA 3UDXA 4OONA 2OLUA 2Q9MA 3E2KA 3NY4A 4GNUA 1L0GA 4LV2A 4XXRA 5DF7A 1Q2QA 4S2KA 4Y0TA 2HPBA 2OSUA 3CZDA 2Y2MA 5DTKA 1SDEA 3M2KA 1K56D 4GDNA 5EVLA 4B88A 2XFTA 3MKEA 1JTDA 1JTGA 4ZAMA 1E4DA 3MZEA 2JE5A 1XXMA 4N9LA 2VGJA 3ZCZA 3VSKA 3SS4A 4X55A 4U0TA 5G18A 3MKFA 4BD1A 4OQIA 2BG1A 4GD6A 2J9OA 3FYZA 3GV9A 1CI8A 4JF6A 5KMWA 4R3JA 2Y2NA 3HUNA 2B5RA 1BLCA 2ZC6B 3QNBA 1KVLA 3N4IA 3VP1A 4KZAA 5FQIA 3ITBA 4JXVA 1YLWA 4DE2A 4WZ5C 1XGIA 3IQAA 5KSCA 1GHMA 1H8ZA 1W8YA 1CEFA 2WGWA 2J8YA 4GZBA 4H8RA 2IWDA 3ZG0A 5JYOA 5CEDA 1MXOA 1ZG4A 1MPLA 4KZ8A 4R4RA 1ES3A 2EXBA 4JF4A 1CI9A 4GKUA 4R4SA 4E3LA 1PI4A 5L2FA 4PPRA 1K57A 5FSRA 2X02A 3TG9A 2HDUA 1XGJA 3HLGA 5GLDA 4M3KA 2DRWA 5GL9A 1HTZA 5I94A 1BSGA 2ZJ9A 1PWGA 1GCEA 2EX9A 4N1HA 3G2ZA 1L0EA 3IT9A 4C6YA 1PWCA 2XD1A 4XUXA 2H10A 2PU2A 1JWZA 4R0QA 3ZG5A 4OQGA 3ZFZA 3BEBA 3N6IA 4KG2A 5GLCA 4LV1A 1GHIA 1WE4A 3SH9A 4RX3A 3A3JA 5DVAA 1K54A 1NRFA 3VFHA 3Q07A 3G31A 3ZNYA 1XP4A 2ZM2A 1MBLA 5GHXA 5J8XA 4WEJA 4R3BA 1LI0A 5CEBA 4Q8IA 3IF6A 1BULA 3S22A 3IWIA 3M6HA 4PM6A 4DXCA 4WZ4A 4BENA 4X69A 5FQJA 2Y2IA 1FCMA 1PW8A 1L0FA 4OOMA 5CTMA 1VQQA 2I72A 3BLMA 5AQBA 4OOYA 4FH4A 1MWSA 2P9VA 3TOIA 4JLFA 3N8RA 1L2SA
chains in the Genus database with same CATH superfamily
1LL9A 3IX8A 3FPWA 3LYXA 1U60A 2Y2GA 3C30A 3O3VA 1UWPX 3VSLA 3GSGA 1OJGA 3HUOA 2JC7A 2V1BA 4OLDA 4R1GA 3HLEA 2W1RA 3HL9A 4MLLA 1J9MA 4YNRA 2K7SA 1GHPA 2YKHA 5HAQA 1YLTA 1IELA 4Q0JA 1H3QA 2J7VA 1M6KA 2JKRM 4HJ6A 1OTBA 1V9ZA 4I3JA 2HP9A 3G35A 4S2OA 3LI9A 2M7VA 2X71A 5HPFA 1PI5A 4IEDA 3G30A 1DP6A 2ZMVA 1YSQA 4KQRA 1PRQA 3P98A 1SCWA 3E2LA 1K56A 1XFQA 2V8FA 3LO7A 4WEKA 5EOEA 3GR2A 2KDKA 4DDSA 4MBFA 3HLWA 2WKIA 4OP5A 3JYIA 4JXGA 3FKVA 1ES5A 2ZL1B 3F1PB 4K0WA 1SKFA 4RX2A 2JCHA 1HD8A 1N9NA 3L9KA 3T4KA 2C6WB 2VV7A 4ID4A 4X25A 1SKOA 2VKSA 2GNXA 3ITAA 4EETB 5DF9A 1ESUA 2WAFA 1FSWA 3C4PA 1IKIA 1O07A 1YT4A 1LLBA 4O7DA 3H7WA 1KGGA 3E4PA 3LEZA 2XDMA 1PYYA 2EX8A 3BECA 3I7JA 2ZC5B 3MF0A 4KZ7A 5FAQA 4ETXA 2OV5A 1TEMA 5HD5A 1NLZA 3MSHA 1TDLA 3NOTC 4KG6A 3VP3A 1K54C 1K6SA 5C5KA 3CMZA 4QY6A 4WUJA 1LSXA 1YLPA 2KOIA 5FQMA 4GLQA 4GOGA 4R6LA 3IF6C 3VP2A 4FH2A 1S4RA 1TS8A 2J3WA 3GTCA 1L3LA 2Y55A 3PHYA 4FUWA 1W63M 4I5SA 1RCJA 2ZC7A 3BYDA 4L9FA 3MBZA 3NDGA 1IFQA 4Y13A 3LIAA 4II7A 1PNEA 4IVIA 1K25A 4WMCD 1IKGA 4F3LB 4NETA 4MN7A 4NEED 1DJAA 2INWA 2DNSA 4JXSA 1IYSA 1YPRA 2XROA 1ZKJA 4UHUA 3B3XA 1EI5A 2A24B 4L9GA 4KZBA 5EVID 2WADA 1NWZA 2Y91A 1FSYA 3HLDA 1O7EA 1OT9A 1XJ6A 3UB7A 1TS0A 3C5AA 2RCXA 3LIEA 4IBXA 2JHEA 4E3IA 3ZYTA 5GLBA 4CQHA 1MWTA 1A0KA 3HLCA 4MBHA 4UAAA 1EW0A 4GJ4A 1S1ZA 3BY9A 3GDIA 3K3DA 3OZHA 5HX9A 4EBNA 2NUTC 2OOLA 1K55C 5FDSA 3A3IA 4ZDXA 3CWFA 4GB7A 3EEHA 2ZL1A 4D60A 2Y79A 3P7NA 1MC0A 4OPQA 1I2SA 4QY5A 1FCOA 3CG5A 4B4ZA 4E3NA 3HREA 3V39A 3PBQA 5FASA 2FFFB 1BZAA 5F69A 2XEPA 2HV1A 2EX6A 2H5SA 2VGKA 5A91A 3PTEA 3TJZC 2ZC4B 3N7WA 4KZ5A 1N9BA 3BLSA 2ZMFA 1BLSA 1IYQA 4UQIS 4Z9QA 4K0XA 4H6JA 4CJNA 5CXWA 4LCMA 2BTFP 3MR0A 5DTSA 3UPPA 1ACFA 3PBOA 4BBVA 4ZRRA 3LUQA 5DTTA 5E2GA 2QWSA 2OWJA 4S2PA 2VZWA 1NZOA 5F83A 4FOFA 2XA7S 3PBSA 4X6TA 5CGSA 3V5MA 3LCEA 3ZDJA 2OLVA 1ZG6A 1W63Q 3FPVA 2WAEA 3BW6A 5E43A 3MXSA 5AJGA 1S66L 3QNCA 4U3TA 5M1AA 4WYYA 2ZD8A 3CJMA 3WRTA 3GQZA 5G4YA 1MWUA 2EFXA 4OOLA 2R9WA 1E3UA 3V3SA 3UN7A 1NZUA 2QPNA 2Y2JA 3DWZA 3PYPA 3ZVWA 4FTXA 4KZ3A 1W8QA 2PHYA 4IUHA 1MY8A 3SS3A 3QP5A 5J4EA 2HP6A 3LR0A 1W79A 3UDXA 2OLUA 3E2KA 3KSHA 3NY4A 1L0GA 4LV2A 3FG8A 3B42A 3CZDA 2P08A 2VK3A 3M2KA 4GDNA 5EVLA 2XFTA 3GECA 1JTGA 4ZAMA 2JE5A 3VSKA 4BD1A 3MKFA 4GD6A 2QKPA 4EEPA 3T1XA 1ZHHB 3F1NA 1T19A 5FQIA 2PBDP 3T4QA 2W3GA 3IQAA 5KSCA 2WGWA 2J8YA 4GZBA 2DMWA 2IWDA 5JYOA 5CEDA 1MPLA 4KZ8A 2XSSA 2EXBA 5L2FA 4PPRA 5FSRA 2X02A 3TG9A 5GLDA 3T4LA 2DRWA 5I94A 3NHQA 3H9WA 4MCWA 2PU2A 3ZFZA 3N6IA 1WE4A 3A3JA 1YKDA 5DVAA 3Q07A 4Y15A 3G31A 3LFVA 1LI0A 2HF6A 2KX6A 4BENA 3IX4A 5CTMA 4PKYA 4FH4A 1MWSA 3TOIA 3K2NA 4JLFA 3S7NA 3IS2B 3PBRA 1VETB 2ACGA 1ERMA 1GSVA 3B47A 5CX7A 1OTEA 2EX2A 5FI7A 3UMEA 1KE3A 3Q81A 4XUZA 2FFYA 5A8BA 2PRFA 1P97A 3RXWA 2O0YA 4JPMA 4R38A 5U47A 4B93A 3RTYA 2XR0A 4U0XA 1K6RA 2QHKA 3CUEA 3DWKA 1W7FA 2J3TC 3BM6A 4ZTKA 2PR5A 4Q0IA 1FCNA 4O01A 5GHYA 4EWFA 4LV0A 1L0DA 3PAGA 2DCFA 1J3WA 3LY4A 1ERQA 1K4EA 2EFUA 3EWKA 3UE3A 5FQ9A 3G2YA 2Y4AA 4HBUA 3WS5A 4BLMA 3OCLA 5TFQA 2ZQCA 1I2WA 4CLCC 3FKWA 2Y8HA 3OLOA 2ZQ9A 3S7QA 4R70A 2R78A 1QMFA 3C2WA 4KQQA 2XD5A 4EBLA 4E04A 1TDGA 5HWVA 2ZQAA 5TGFA 5IS1A 2K2NA 2W1TB 4WZ5A 1G28A 5M19A 1DP8A 3VOZA 4EUZA 4JGOA 3H82B 3Q7VA 3M6BA 3AGFA 4MDZA 4N1XA 3NC8A 3MXQA 3IF6B 4F94A 2FH5A 1KGFA 1MKIA 4CLCE 1ONGA 5DJTA 3T4SA 4LV3A 3IH9A 1NYMA 4DJ3A 4JF5A 2JN7A 3C8CA 3MZDA 1WYCA 5KSHA 1YLZA 5HL1A 2OAP1 1XKZA 3JPUA 5FI2A 1S1YA 3WWXA 5CGWA 1RP5A 2PD7A 1BLHA 3UNWA 3BFDA 2P74A 1S67L 3F1OA 2PU4A 3PXPA 4HBTA 1G5UA 3EQVA 4KZ6A 1MWRA 3UO9A 3FZCA 1VETA 4Z1WA 3UY6A 4HP9A 4WM9A 2FZ0A 1P0ZA 2EWWA 3W8KA 4Q0HA 4BWIA 2Y2QA 4P6ZM 3GVBA 2G2UA 1ES2A 4I38A 3T50A 3QP6A 4PHTA 2V2FF 4HJ4A 3HLBA 3GMWA 3KSGA 2HZ5A 4YOFA 4S2JA 2WZZA 1JWPA 4GHIA 5EE8A 3AGEA 5LBRA 2HDQA 2HJEA 4EUVA 3IBRA 1K38A 2WGIA 5EUAA 4ZJ2A 2WK0A 5HAPA 2H0YA 3CPTB 2J9PA 3WS4A 3T1SA 4BL2A 4YWZA 2EXAA 1W5DA 1VEUA 3FV7A 4R23A 4BQMA 1D7EA 2WKEA 4MMNA 2ZM8A 2H28A 4QD4A 4WF0A 3NBLA 1JWVA 5HDDA 3UPOA 3IXGA 3T1RA 2ZOHA 4WBGA 3W2ZA 3MFDA 2Y59A 1I5QA 2PYPA 4DKIA 3IXDA 4G3WA 3LICA 2Y2OA 3C4OA 1CEGA 2WKHA 3E98A 3KSFA 5F1FA 3CI6A 4OQHA 3WRZA 4NXEA 3ZG7B 1V9YA 3SW1A 4ZJ3A 4DXBA 5AQ9A 5EPHA 3IWOA 2HJ9C 3HVFA 3A0RA 4LRZE 4KUKA 5F5YA 4DE1A 3E0YA 4QJGA 2QYBA 2PBYA 1IYOA 1ZTUA 4IJGA 4EV4A 4YINA 5HWWA 3N8SA 3DAVA 4ME4A 2A49A 1DJCA 4I39A 2ZQDA 1E25A 4LCLA 1KDWA 2H0TA 3MQ0A 4BD0A 3IWQA 3QP4A 5FDHA 3NOPC 1T18A 1PZPA 4HOIA 1F5MA 1BTLA 1FILA 3ZQ5A 4C3QA 3O88A 3BQAA 1E3UD 3SH7A 5FA7A 2V9AA 5FI6A 4GN2A 4NXFA 3CAXA 1FR6A 2PDRA 1PIOA 4LLOB 4QB8A 1C3BA 3A3DA 1BLPA 2Q9MA 1T1AA 5DF7A 1Q2QA 4S2KA 5DFXA 4ESPA 4GW9A 5HZHA 3MKEA 1JTDA 1XXMA 4N9LA 2VGJA 3ZCZA 1XFNA 4U0TA 2V8CA 2J9OA 4LRXC 3GV9A 1CI8A 2O9BA 1DP9A 2QJ7A 3HUNA 2ZC6B 4KZAA 1D06A 5HPIA 3MQOA 4HH3A 1XGIA 1XJ4A 1CEFA 3F1PA 3ZG0A 1MXOA 4R4RA 3UB6A 4GKUA 4R4SA 4E3LA 1K57A 1XGJA 5HDSA 2PD8A 1HTZA 1BSGA 5IU1A 3IT9A 1JWZA 3ZG5A 2B18A 4LV1A 3VFHA 3NJAA 4JGPA 4I3IA 5J8XA 4WEJA 5CEBA 4Q8IA 3S22A 1BULA 3HJIA 3BY8A 3IWIA 4X69A 1PW8A 1L0FA 4HH2A 2I72A 3BLMA 3N8RA 2JKTI 2QZ6A 1K4FA 1KE0A 2EA9A 4EW7A 2KLIA 1K0KA 4XT2B 4QPRA 2X01A 3OPPA 3HLFA 4KUOA 3CITA 3U4LP 1Y54A 3D4FA 2PT7A 3ZVTA 4OPZA 1UWNX 4G3VA 1P9WA 2C5WB 4KZ9A 2WUQA 3UDFA 5EVIC 2XH9A 1H0MA 3MXRA 4HQAA 4OLGA 5TBMB 1VB6A 2D01A 1M40A 4BL3A 1OPXA 5IHVA 4CLCB 4PM7A 3WS0A 2ZLYA 2Z2MB 1VHMA 5L09A 2G2WA 4EXOA 4F3LA 2Y2LA 1UGUA 2P04A 3R7WB 3UMDA 1CJFA 2ZC3B 2A24A 1LL5A 4P87A 5EVEA 3NDEA 1SDNA 4MN6A 4S2MA 5J3WA 4BMWA 5GHZA 3UPNA 1HVBA 3BFFA 3VE4A 4Y0OA 4X53A 5IT5A 1RGZA 4DE0A 2M7UA 3OC2A 3O86A 1ALQA 3VMAA 4QU3A 3V67A 4HI4A 4NXGA 4YFMA 2V1AA 5EM1A 5L07A 4HNBA 3SH8A 3ISGA 3UB8A 4P6ZS 1ESIA 4OVDA 3LEQA 4K08A 4B9OA 5FL3A 1BYWA 1SHVA 3SOIA 5EM0A 1ODVA 2O9AA 1LI9A 1OTDA 2P9VB 2W3DA 3VV4A 4HEFA 4ARZB 2M1CA 1ONHA 2Z2LB 1G68A 1HLUP 4N9KA 2UWXA 1Q2PA 3DTKA 4S2NA 2XGNA 2Y2PA 4ETZA 3VP0A 1D1JA 3LR3A 3M2JA 4E3JA 3K3CA 4IHQA 5FAOA 5DKLA 4DF6A 4HY8A 3S7PA 1SZVA 3RFBA 4GS9B 3VP4A 2ZMAA 5CERA 3W4QA 5J7EA 4L0LA 1DJBA 1T1BA 2XK1A 2V0WA 5KZHA 5HWTA 3E4QA 3LY3A 4HESA 1XJ2A 3G6OA 3NIAA 2NUPC 4IUKA 1GA0A 5GLAA 2A3UA 4RYEA 4MEZA 4DE3A 3AGDA 4NKPA 3UDIA 1NYYA 1VM1A 3KYEA 5FAPA 3CLOA 2W0NA 4XT2A 1YM1A 5CHJA 1CF0A 2VJWA 5BOHA 5CTNA 3D72A 5MC7A 1YQSA 1OMEA 1SKOB 4IVKA 1DRMA 4PM9A 2XRNA 2JKRI 3UE6A 4K91A 4PMAA 3Q7ZA 2PYRA 2ZQ8A 3R4KA 3A3FA 3EQUA 4I3AA 4P0MA 3H7WB 2WKQA 3UE0A 3KX0X 1X0OA 1BT5A 3FWLA 4OKPA 5CRFA 5DF8A 2WKPA 4Y0UA 5E2FA 4KENB 4C75A 4FD8A 1PWDA 1KDSA 5CGXA 5D3OA 4HP4A 1YMXA 3P09A 3JVUA 3DBAA 3QHYA 2RL3A 1YLJA 4E3KA 3MQQA 4X68A 3BFEA 1Z6FA 3MJQA 5KIZA 3RJUA 3DW0A 4O0PA 3UE1A 1YLYA 1ES4A 1FQGA 4M4XA 2Z6CA 2J80A 4UA9A 3BFGA 4OP8A 1KE4A 1OJ5A 3G4PA 4E6XA 3ZG9B 2I9VA 3T4JA 1NJ4A 4WL9A 1XJ3A 3E4OA 5HARA 1QMEA 4MN5A 3OOVA 3MZFA 4GDBA 3O5YA 4QHCA 4JXWA 3OPLA 4IBRA 2JBFA 4RVAA 2Q9NA 3NI9A 4P6BA 2ZOIA 4EESA 4MBKA 3WS1A 2OAQ1 4LGWA 2QMIA 4NG2A 3N8LA 3KYQA 3C7UA 3CHWP 3IS2A 3LIDA 3MMHA 4X56A 1GA9A 2VGLM 3HCYA 2L4RA 5M18A 4GS9A 1WA9A 3VOLA 1G6AA 2W3HA 3GRJA 4LPZA 4NXBA 3C7VA 2WGVA 3LI8A 2UV0E 4X1MA 1LSVA 3BQ8A 4GNUA 4XXRA 2HPBA 2Y2MA 4PAUA 5DTKA 4B88A 1E4DA 3MZEA 3T12B 5G18A 4R3AA 5HL6A 3FYZA 4R3JA 2Y2NA 1P9RA 1BLCA 3QNBA 1PFLA 3N4IA 3ITBA 4JXVA 1YLWA 4DE2A 1N9LA 1GHMA 3KSIA 3ICYA 1ZG4A 3PR6A 4JF4A 3IBJA 1PI4A 2HDUA 3HLGA 5I5LA 2B02A 4M3KA 5HDCA 2ZJ9A 2EX9A 4H6JB 4DJ2A 2BASA 3G2ZA 1PWCA 4HHDA 2XD1A 4XUXA 2H10A 4R0QA 3BEBA 5GLCA 3SH9A 3NECA 4RX3A 3B33A 2W1TA 1K54A 4AFIA 3H82A 1LL8A 5GHXA 3TE8A 1GSWA 3IX3A 1OTAA 3IF6A 4RQ9A 4WZ4A 3TW8A 3A0VA 2W3FA 1FCMA 3D9YA 4EU0A 3LR4A 1VQQA 2HGVA 5AQBA 3TRCA 1TF1A 3OPHA 5A93A 3MFXA 4JGQA 3ZG8B 1NY0A 5EFWA 3EGDC 5EVIB 3U2AA 1EROA 2E8JA 3LR5A 1ZC2A 2VV6A 4E6WA 4DRTA 3S4XA 1H5XA 1YSPA 5TR7A 4ZJ1A 1XPBA 4ZBEA 2W3EA 2XQZA 1Y4OA 1KVMA 2VX8A 3FC7A 3RXXA 5G4ZA 1T1CA 3WS2A 1IEMA 3IXBA 4UA6A 1FR1A 2PAVP 5CHMA 3IXHA 4NK3A 1S6RA 3LIBA 4OH0A 5HW3A 3Q82A 1STZA 1XX2A 3F1NB 4HIAA 1MZUA 3G34A 5FEFA 4G3KA 4X1LA 4DN0A 3KYZA 5DJUA 2WGWB 2LB5A 4KZ4A 4PKYG 4CPKA 5FATA 2BLSA 4EEUA 5A92A 1MKMA 2WZXA 3PAEA 5E2HA 2R9XA 4FCFA 4KQDA 5F1GA 3V3RA 1NLYA 2IWCA 5HD3A 1AXBA 5HSQA 4BBUA 2GZAA 2HP5A 3DTIA 3QP1A 1K55A 3A3EA 2YKFA 2OWHA 4MNRA 3T4OA 4N92A 1K57C 4B4XA 5JYPA 3OCNA 3KO6A 3T1QB 4EERA 1AWIA 4JKTA 3IHBA 3A0SA 3CPTA 3UB9A 1JNUA 3IHAA 4LFUA 2HDSA 3QP2A 3ZGAB 2ZBBA 3NCKA 1XA1A 4OPRA 3LIFA 2XLNA 3SS5A 1EWZA 4BBTA 2Z6DA 1YAXA 2W27A 3MS6A 4GCZA 1BUEA 2VV8A 4O8GA 3LGOA 1HZOA 2GDNA 4L9EA 2E8IA 1PZOA 4S2IA 4Y2FA 1LT0A 3S1YA 3O87A 1TD5A 2QJ5A 1S0WA 2VEAA 5HFOA 5CHUA 1N4OA 4GD8A 4KQOA 2LB9A 1TS7A 1LSWA 3ZNTA 4WMCA 4LRYC 4BJPA 3IF5A 2ZQ7A 1F98A 5EOOA 1YMSA 3C38A 4D2OA 2WYXA 5A90A 2B95A 1N9OA 3W4OA 3BFCA 4EBPA 1S4SA 4Y5FA 2A2LA 4PM5A 5EVIA 5F68A 2XFSA 4PM8A 1NXYA 4Y3IA 2J3TD 4E3MA 3UB5P 1FIKA 3DTMA 4A5RA 1H8YA 2IWBA 2O9CA 3OPRA 1FOFA 2G7UA 3W4PA 5HAIA 3IH8A 4UA7A 3P01A 4FSFA 4Y7PA 3BRMA 3Q7VB 3G32A 2WKRA 3NOUC 2VGLS 3TSGA 4EQIA 2CC1A 2K31A 4CLCD 4RA7A 1JVJA 1TVFA 1KOUA 4WELA 1F2KA 5AQAA 5F82A 1PW1A 3EEAA 4KG5A 3VE3A 5AVFA 4E3OA 2P7JA 2D02A 3PBNA 1KGEA 2HDRA 4JBFA 4S2LA 1XA7A 3HUMA 4P85A 2JKTM 1CQAA 3L7HA 5TJJA 3BWLA 4LENA 2Q0OA 5DKKA 3PBTA 4S2NC 5AQ7A 3Q1FA 3QP8A 1G6OA 1DY6A 3T4TA 3DTEA 3EOIA 3SZTA 3F1OB 5L10A 4OQ0A 1OTIA 2GX5A 2MJ6A 2VLGA 5CECA 4WLAA 5K5BA 1IOUA 5EECA 1WYBA 2PR6A 2JKGA 1LHYA 3V50A 1CK3A 3VOYA 4JGRA 3BJNA 2ZM0A 2EWVA 3JVVA 3CUEC 2L0WA 1IYPA 3VFFA 3S7OA 5FQKA 1RGYA 1Z09A 5FQQA 4OPYA 2XF3A 4GHIB 4DDYA 2V1ZA 2Y2HA 3ZHHA 3HBRA 4WN5A 2Y2KA 3EGXC 1GSXA 5DFYA 3RH8B 4DMZA 4Y17A 1NRJA 2V0UA 4EQ1A 2V20A 2L1MA 5E2EA 4OONA 1H8MA 5AVEA 1VEUB 4Y0TA 4UEYA 2OSUA 5EV0A 1SDEA 1K56D 4HJ3A 5TBMA 5L8MA 3SS4A 4X55A 4CLCA 3OBFA 4OQIA 2BG1A 4UQIM 4JF6A 1OT6A 5KMWA 2IA2A 2B5RA 3NULA 1KVLA 3VP1A 4QWOA 1TS6A 3HJKA 2JKFA 3ULFA 4WZ5C 3R7WA 2AVXA 1H8ZA 1W8YA 4H8RA 1ES3A 1F9IA 1CI9A 1Y28A 2GJ3A 5GL9A 2XA7M 1PWGA 1GCEA 4N1HA 1L0EA 4C6YA 4OQGA 3D3OA 4KG2A 1GHIA 5F6AA 1NRFA 2O99A 3ZNYA 1XP4A 2ZM2A 1MBLA 4R3BA 2CMNA 3M6HA 4PM6A 4DXCA 5FQJA 2Y2IA 4OOMA 5FEGA 4OOYA 2P9VA 2VA0A 1L2SA 4ARZA
chains in the Genus database with same CATH topology
1LL9A 3PBRA 3OPHA 5A93A 2QZ6A 1ERMA 3ZG8B 1K4FA 1NY0A 1KE0A 1U60A 2Y2GA 3O3VA 2EX2A 5EVIB 5FI7A 1KE3A 3VSLA 1EROA 3Q81A 1ZC2A 3GSGA 2FFYA 3HUOA 4XUZA 2JC7A 2X01A 4OLDA 4R1GA 3OPPA 3HLFA 3HLEA 4E6WA 1Y54A 4DRTA 3D4FA 3HL9A 3RXWA 4MLLA 3S4XA 1H5XA 4JPMA 1J9MA 5TR7A 1GHPA 5U47A 3ZVTA 4ZJ1A 1YLTA 5HAQA 1XPBA 4ZBEA 4OPZA 1IELA 2XR0A 2C5WB 2XQZA 4U0XA 2J7VA 1M6KA 4KZ9A 2WUQA 1K6RA 1KVMA 3DWKA 3UDFA 1W7FA 5EVIC 2XH9A 3RXXA 2HP9A 3BM6A 3G35A 4ZTKA 3MXRA 4S2OA 3WS2A 1IEMA 1FCNA 3IXBA 4UA6A 1FR1A 2X71A 4OLGA 5CHMA 3IXHA 5GHYA 4EWFA 1M40A 1PI5A 4LV0A 4IEDA 1L0DA 4BL3A 3PAGA 3G30A 2DCFA 4NK3A 5IHVA 1S6RA 3LY4A 4PM7A 4KQRA 4OH0A 3WS0A 2ZLYA 2Z2MB 3P98A 5HW3A 1ERQA 1SCWA 3E2LA 3Q82A 1K56A 2G2WA 1K4EA 1XX2A 3LO7A 5EOEA 3G34A 4WEKA 2EFUA 2Y2LA 3GR2A 4DDSA 4MBFA 3HLWA 2WKIA 4OP5A 3UE3A 3JYIA 4JXGA 3FKVA 5FQ9A 1ES5A 3G2YA 2Y4AA 4HBUA 2WGWB 3WS5A 4KZ4A 4BLMA 2ZC3B 4CPKA 4K0WA 1SKFA 4RX2A 5FATA 3OCLA 2BLSA 2JCHA 4P87A 1HD8A 1LL5A 5TFQA 3NDEA 1SDNA 2ZQCA 5A92A 2C6WB 2WZXA 3PAEA 5E2HA 4S2MA 4ID4A 2R9XA 4FCFA 1I2WA 5F1GA 5GHZA 3FKWA 3V3RA 3UPNA 1HVBA 3BFFA 3ITAA 2IWCA 2ZQ9A 4Y0OA 1QMFA 1AXBA 4X53A 4KQQA 1RGZA 5DF9A 4DE0A 1ESUA 2WAFA 2XD5A 4EBLA 1TDGA 3OC2A 1FSWA 2HP5A 3C4PA 2ZQAA 3O86A 1IKIA 5TGFA 1K55A 1O07A 1ALQA 3VMAA 3A3EA 4QU3A 4WZ5A 1YT4A 1LLBA 4YFMA 4MNRA 5M19A 4O7DA 4N92A 3SH8A 3VOZA 1KGGA 1K57C 3ISGA 4EUZA 1ESIA 4B4XA 3LEZA 2XDMA 3Q7VA 4OVDA 3M6BA 3AGFA 1PYYA 5JYPA 2EX8A 4N1XA 3BECA 3NC8A 3OCNA 1SHVA 3I7JA 3IF6B 3SOIA 2ZC5B 4F94A 4KZ7A 5FAQA 2OV5A 4JKTA 3IHBA 3IHAA 1TEMA 3ZGAB 2HDSA 3NCKA 1XA1A 1LI9A 4OPRA 2XLNA 2P9VB 1KGFA 1MKIA 1TDLA 1ONGA 4HEFA 4KG6A 3SS5A 3VP3A 1K54C 1EWZA 1ONHA 1K6SA 2Z2LB 1G68A 3CMZA 4N9KA 4QY6A 1YLPA 2UWXA 4LV3A 1Q2PA 4S2NA 3IH9A 5FQMA 1BUEA 2XGNA 2Y2PA 3VP0A 4GOGA 1HZOA 3IF6C 3VP2A 1NYMA 2GDNA 3M2JA 4FH2A 4E3JA 2E8IA 4JF5A 3GTCA 3MZDA 5FAOA 1WYCA 5KSHA 4DF6A 1PZOA 4S2IA 2Y55A 3VP4A 2ZMAA 3S1YA 1YLZA 3O87A 5CERA 3W4QA 4L0LA 1DJBA 1S0WA 1RCJA 2ZC7A 5HL1A 2XK1A 5HFOA 5CHUA 1XKZA 1N4OA 4GD8A 5KZHA 3BYDA 5FI2A 3WWXA 4KQOA 5CGWA 3ZNTA 3MBZA 1RP5A 3NDGA 1BLHA 4WMCA 3UNWA 3BFDA 4BJPA 3LY3A 3IF5A 2P74A 2ZQ7A 4HESA 4IVIA 1K25A 4WMCD 3NIAA 5EOOA 1YMSA 2PU4A 1IKGA 4HBTA 1GA0A 5GLAA 2A3UA 4D2OA 2WYXA 5A90A 4RYEA 4MEZA 3EQVA 4DE3A 4KZ6A 1MWRA 3UO9A 3FZCA 3AGDA 4NETA 3W4OA 1DJAA 3BFCA 3UDIA 2DNSA 4JXSA 3UY6A 4EBPA 4WM9A 1IYSA 1NYYA 1VM1A 1ZKJA 5FAPA 4UHUA 4PM5A 3B3XA 1EI5A 5EVIA 2XFSA 4PM8A 3W8KA 1YM1A 5CHJA 5BOHA 1NXYA 5CTNA 5EVID 2Y2QA 4KZBA 3GVBA 2G2UA 2WADA 1ES2A 4E3MA 1YQSA 1OMEA 2V2FF 3DTMA 4IVKA 4A5RA 2Y91A 3GMWA 3HLBA 1FSYA 3HLDA 1H8YA 4PM9A 2IWBA 4S2JA 1O7EA 3OPRA 2WZZA 1JWPA 5EE8A 1FOFA 4K91A 4PMAA 3Q7ZA 3AGEA 3C5AA 3W4PA 5HAIA 2ZQ8A 3IH8A 4UA7A 2HDQA 2RCXA 4FSFA 4IBXA 3A3FA 3EQUA 4E3IA 4Y7PA 4P0MA 3BRMA 3UE0A 5GLBA 3Q7VB 3G32A 1K38A 2WGIA 3FWLA 1BT5A 5EUAA 4OKPA 5CRFA 4ZJ2A 3TSGA 5DF8A 1MWTA 2WK0A 4EQIA 5HAPA 2H0YA 4Y0UA 2CC1A 3HLCA 2J9PA 4MBHA 4UAAA 5E2FA 4KENB 3WS4A 4BL2A 2EXAA 1W5DA 4C75A 3FV7A 4FD8A 3OZHA 1PWDA 1KDSA 4RA7A 5CGXA 5D3OA 1JVJA 5HX9A 4EBNA 1TVFA 4WELA 1K55C 4R23A 3A3IA 4BQMA 4ZDXA 4GB7A 1YMXA 5AQAA 3P09A 5F82A 1PW1A 2WKEA 3QHYA 4KG5A 2RL3A 1YLJA 2ZM8A 4QD4A 3NBLA 4E3KA 1JWVA 4OPQA 4X68A 3BFEA 3IXGA 1Z6FA 4E3OA 1I2SA 3UPOA 4QY5A 1FCOA 3CG5A 4B4ZA 3RJUA 3DW0A 3UE1A 4E3NA 1YLYA 1ES4A 3HREA 3V39A 3PBNA 3PBQA 4WBGA 5FASA 2FFFB 1KGEA 1BZAA 1FQGA 3MFDA 2HDRA 4JBFA 4S2LA 2XEPA 2Y59A 1I5QA 1XA7A 3HUMA 4P85A 2EX6A 2H5SA 4UA9A 3BFGA 2VGKA 5A91A 3PTEA 4OP8A 1KE4A 3G4PA 4DKIA 4E6XA 2ZC4B 4LENA 3N7WA 4KZ5A 3IXDA 1N9BA 3BLSA 3ZG9B 2Y2OA 1BLSA 3PBTA 3C4OA 4S2NC 1IYQA 1CEGA 1NJ4A 2WKHA 4Z9QA 4K0XA 5AQ7A 5F1FA 3Q1FA 4CJNA 5CXWA 4LCMA 1DY6A 5DTSA 4OQHA 5HARA 3UPPA 1QMEA 3WRZA 3ZG7B 3MZFA 4GDBA 3PBOA 4OQ0A 4QHCA 4JXWA 4ZJ3A 3OPLA 4IBRA 5CECA 2JBFA 4DXBA 5EECA 5AQ9A 1WYBA 5EPHA 4RVAA 2Q9NA 3NI9A 4P6BA 5DTTA 5E2GA 3IWOA 3HVFA 4DE1A 4S2PA 4QJGA 1NZOA 5F83A 2PBYA 1IYOA 4MBKA 1LHYA 3V50A 3PBSA 4X6TA 5CGSA 3V5MA 3WS1A 3LCEA 3ZDJA 1CK3A 2OLVA 4YINA 4EV4A 3VOYA 1ZG6A 2QMIA 2WAEA 3N8SA 3N8LA 2ZM0A 5E43A 3C7UA 2A49A 1DJCA 3MXSA 4X56A 1IYPA 3VFFA 3QNCA 4U3TA 2ZQDA 1GA9A 5M1AA 1E25A 4LCLA 5M18A 5FQKA 1KDWA 1RGYA 2H0TA 2ZD8A 4WYYA 3CJMA 5FQQA 3GQZA 3WRTA 4BD0A 3IWQA 4OPYA 5FDHA 2XF3A 1MWUA 2EFXA 1PZPA 1G6AA 4OOLA 1BTLA 4DDYA 2R9WA 1E3UA 4C3QA 2V1ZA 3O88A 3V3SA 2Y2HA 3UN7A 3ZHHA 1NZUA 3HBRA 2QPNA 1E3UD 3SH7A 2Y2JA 2Y2KA 3DWZA 3GRJA 5FA7A 3ZVWA 5FI6A 3C7VA 4KZ3A 4GN2A 1W8QA 2WGVA 1FR6A 1MY8A 2V20A 3SS3A 1PIOA 4QB8A 1C3BA 2HP6A 5E2EA 1W79A 1BLPA 3A3DA 3UDXA 4OONA 2OLUA 2Q9MA 3E2KA 3NY4A 4GNUA 1L0GA 4LV2A 4XXRA 5DF7A 1Q2QA 4S2KA 4Y0TA 2HPBA 2OSUA 3CZDA 2Y2MA 5DTKA 1SDEA 3M2KA 1K56D 4GDNA 5EVLA 4B88A 2XFTA 3MKEA 1JTDA 1JTGA 4ZAMA 1E4DA 3MZEA 2JE5A 1XXMA 4N9LA 2VGJA 3ZCZA 3VSKA 3SS4A 4X55A 4U0TA 5G18A 3MKFA 4BD1A 4OQIA 2BG1A 4GD6A 2J9OA 3FYZA 3GV9A 1CI8A 4JF6A 5KMWA 4R3JA 2Y2NA 3HUNA 2B5RA 1BLCA 2ZC6B 3QNBA 1KVLA 3N4IA 3VP1A 4KZAA 5FQIA 3ITBA 4JXVA 1YLWA 4DE2A 4WZ5C 1XGIA 3IQAA 5KSCA 1GHMA 1H8ZA 1W8YA 1CEFA 2WGWA 2J8YA 4GZBA 4H8RA 2IWDA 3ZG0A 5JYOA 5CEDA 1MXOA 1ZG4A 1MPLA 4KZ8A 4R4RA 1ES3A 2EXBA 4JF4A 1CI9A 4GKUA 4R4SA 4E3LA 1PI4A 5L2FA 4PPRA 1K57A 5FSRA 2X02A 3TG9A 2HDUA 1XGJA 3HLGA 5GLDA 4M3KA 2DRWA 5GL9A 1HTZA 5I94A 1BSGA 2ZJ9A 1PWGA 1GCEA 2EX9A 4N1HA 3G2ZA 1L0EA 3IT9A 4C6YA 1PWCA 2XD1A 4XUXA 2H10A 2PU2A 1JWZA 4R0QA 3ZG5A 4OQGA 3ZFZA 3BEBA 3N6IA 4KG2A 5GLCA 4LV1A 1GHIA 1WE4A 3SH9A 4RX3A 3A3JA 5DVAA 1K54A 1NRFA 3VFHA 3Q07A 3G31A 3ZNYA 1XP4A 2ZM2A 1MBLA 5GHXA 5J8XA 4WEJA 4R3BA 1LI0A 5CEBA 4Q8IA 3IF6A 1BULA 3S22A 3IWIA 3M6HA 4PM6A 4DXCA 4WZ4A 4BENA 4X69A 5FQJA 2Y2IA 1FCMA 1PW8A 1L0FA 4OOMA 5CTMA 1VQQA 2I72A 3BLMA 5AQBA 4OOYA 4FH4A 1MWSA 2P9VA 3TOIA 4JLFA 3N8RA 1L2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL9 A;  3PBR A;  3OPH A;  5A93 A;  2QZ6 A;  1ERM A;  3ZG8 B;  1K4F A;  1NY0 A;  1KE0 A;  1U60 A;  2Y2G A;  3O3V A;  2EX2 A;  5EVI B;  5FI7 A;  1KE3 A;  3VSL A;  1ERO A;  3Q81 A;  1ZC2 A;  3GSG A;  2FFY A;  3HUO A;  4XUZ A;  2JC7 A;  2X01 A;  4OLD A;  4R1G A;  3OPP A;  3HLF A;  3HLE A;  4E6W A;  1Y54 A;  4DRT A;  3D4F A;  3HL9 A;  3RXW A;  4MLL A;  3S4X A;  1H5X A;  4JPM A;  1J9M A;  5TR7 A;  1GHP A;  5U47 A;  3ZVT A;  4ZJ1 A;  1YLT A;  5HAQ A;  1XPB A;  4ZBE A;  4OPZ A;  1IEL A;  2XR0 A;  2C5W B;  2XQZ A;  4U0X A;  2J7V A;  1M6K A;  4KZ9 A;  2WUQ A;  1K6R A;  1KVM A;  3DWK A;  3UDF A;  1W7F A;  5EVI C;  2XH9 A;  3RXX A;  2HP9 A;  3BM6 A;  3G35 A;  4ZTK A;  3MXR A;  4S2O A;  3WS2 A;  1IEM A;  1FCN A;  3IXB A;  4UA6 A;  1FR1 A;  2X71 A;  4OLG A;  5CHM A;  3IXH A;  5GHY A;  4EWF A;  1M40 A;  1PI5 A;  4LV0 A;  4IED A;  1L0D A;  4BL3 A;  3PAG A;  3G30 A;  2DCF A;  4NK3 A;  5IHV A;  1S6R A;  3LY4 A;  4PM7 A;  4KQR A;  4OH0 A;  3WS0 A;  2ZLY A;  2Z2M B;  3P98 A;  5HW3 A;  1ERQ A;  1SCW A;  3E2L A;  3Q82 A;  1K56 A;  2G2W A;  1K4E A;  1XX2 A;  3LO7 A;  5EOE A;  3G34 A;  4WEK A;  2EFU A;  2Y2L A;  3GR2 A;  4DDS A;  4MBF A;  3HLW A;  2WKI A;  4OP5 A;  3UE3 A;  3JYI A;  4JXG A;  3FKV A;  5FQ9 A;  1ES5 A;  3G2Y A;  2Y4A A;  4HBU A;  2WGW B;  3WS5 A;  4KZ4 A;  4BLM A;  2ZC3 B;  4CPK A;  4K0W A;  1SKF A;  4RX2 A;  5FAT A;  3OCL A;  2BLS A;  2JCH A;  4P87 A;  1HD8 A;  1LL5 A;  5TFQ A;  3NDE A;  1SDN A;  2ZQC A;  5A92 A;  2C6W B;  2WZX A;  3PAE A;  5E2H A;  4S2M A;  4ID4 A;  2R9X A;  4FCF A;  1I2W A;  5F1G A;  5GHZ A;  3FKW A;  3V3R A;  3UPN A;  1HVB A;  3BFF A;  3ITA A;  2IWC A;  2ZQ9 A;  4Y0O A;  1QMF A;  1AXB A;  4X53 A;  4KQQ A;  1RGZ A;  5DF9 A;  4DE0 A;  1ESU A;  2WAF A;  2XD5 A;  4EBL A;  1TDG A;  3OC2 A;  1FSW A;  2HP5 A;  3C4P A;  2ZQA A;  3O86 A;  1IKI A;  5TGF A;  1K55 A;  1O07 A;  1ALQ A;  3VMA A;  3A3E A;  4QU3 A;  4WZ5 A;  1YT4 A;  1LLB A;  4YFM A;  4MNR A;  5M19 A;  4O7D A;  4N92 A;  3SH8 A;  3VOZ A;  1KGG A;  1K57 C;  3ISG A;  4EUZ A;  1ESI A;  4B4X A;  3LEZ A;  2XDM A;  3Q7V A;  4OVD A;  3M6B A;  3AGF A;  1PYY A;  5JYP A;  2EX8 A;  4N1X A;  3BEC A;  3NC8 A;  3OCN A;  1SHV A;  3I7J A;  3IF6 B;  3SOI A;  2ZC5 B;  4F94 A;  4KZ7 A;  5FAQ A;  2OV5 A;  4JKT A;  3IHB A;  3IHA A;  1TEM A;  3ZGA B;  2HDS A;  3NCK A;  1XA1 A;  1LI9 A;  4OPR A;  2XLN A;  2P9V B;  1KGF A;  1MKI A;  1TDL A;  1ONG A;  4HEF A;  4KG6 A;  3SS5 A;  3VP3 A;  1K54 C;  1EWZ A;  1ONH A;  1K6S A;  2Z2L B;  1G68 A;  3CMZ A;  4N9K A;  4QY6 A;  1YLP A;  2UWX A;  4LV3 A;  1Q2P A;  4S2N A;  3IH9 A;  5FQM A;  1BUE A;  2XGN A;  2Y2P A;  3VP0 A;  4GOG A;  1HZO A;  3IF6 C;  3VP2 A;  1NYM A;  2GDN A;  3M2J A;  4FH2 A;  4E3J A;  2E8I A;  4JF5 A;  3GTC A;  3MZD A;  5FAO A;  1WYC A;  5KSH A;  4DF6 A;  1PZO A;  4S2I A;  2Y55 A;  3VP4 A;  2ZMA A;  3S1Y A;  1YLZ A;  3O87 A;  5CER A;  3W4Q A;  4L0L A;  1DJB A;  1S0W A;  1RCJ A;  2ZC7 A;  5HL1 A;  2XK1 A;  5HFO A;  5CHU A;  1XKZ A;  1N4O A;  4GD8 A;  5KZH A;  3BYD A;  5FI2 A;  3WWX A;  4KQO A;  5CGW A;  3ZNT A;  3MBZ A;  1RP5 A;  3NDG A;  1BLH A;  4WMC A;  3UNW A;  3BFD A;  4BJP A;  3LY3 A;  3IF5 A;  2P74 A;  2ZQ7 A;  4HES A;  4IVI A;  1K25 A;  4WMC D;  3NIA A;  5EOO A;  1YMS A;  2PU4 A;  1IKG A;  4HBT A;  1GA0 A;  5GLA A;  2A3U A;  4D2O A;  2WYX A;  5A90 A;  4RYE A;  4MEZ A;  3EQV A;  4DE3 A;  4KZ6 A;  1MWR A;  3UO9 A;  3FZC A;  3AGD A;  4NET A;  3W4O A;  1DJA A;  3BFC A;  3UDI A;  2DNS A;  4JXS A;  3UY6 A;  4EBP A;  4WM9 A;  1IYS A;  1NYY A;  1VM1 A;  1ZKJ A;  5FAP A;  4UHU A;  4PM5 A;  3B3X A;  1EI5 A;  5EVI A;  2XFS A;  4PM8 A;  3W8K A;  1YM1 A;  5CHJ A;  5BOH A;  1NXY A;  5CTN A;  5EVI D;  2Y2Q A;  4KZB A;  3GVB A;  2G2U A;  2WAD A;  1ES2 A;  4E3M A;  1YQS A;  1OME A;  2V2F F;  3DTM A;  4IVK A;  4A5R A;  2Y91 A;  3GMW A;  3HLB A;  1FSY A;  3HLD A;  1H8Y A;  4PM9 A;  2IWB A;  4S2J A;  1O7E A;  3OPR A;  2WZZ A;  1JWP A;  5EE8 A;  1FOF A;  4K91 A;  4PMA A;  3Q7Z A;  3AGE A;  3C5A A;  3W4P A;  5HAI A;  2ZQ8 A;  3IH8 A;  4UA7 A;  2HDQ A;  2RCX A;  4FSF A;  4IBX A;  3A3F A;  3EQU A;  4E3I A;  4Y7P A;  4P0M A;  3BRM A;  3UE0 A;  5GLB A;  3Q7V B;  3G32 A;  1K38 A;  2WGI A;  3FWL A;  1BT5 A;  5EUA A;  4OKP A;  5CRF A;  4ZJ2 A;  3TSG A;  5DF8 A;  1MWT A;  2WK0 A;  4EQI A;  5HAP A;  2H0Y A;  4Y0U A;  2CC1 A;  3HLC A;  2J9P A;  4MBH A;  4UAA A;  5E2F A;  4KEN B;  3WS4 A;  4BL2 A;  2EXA A;  1W5D A;  4C75 A;  3FV7 A;  4FD8 A;  3OZH A;  1PWD A;  1KDS A;  4RA7 A;  5CGX A;  5D3O A;  1JVJ A;  5HX9 A;  4EBN A;  1TVF A;  4WEL A;  1K55 C;  4R23 A;  3A3I A;  4BQM A;  4ZDX A;  4GB7 A;  1YMX A;  5AQA A;  3P09 A;  5F82 A;  1PW1 A;  2WKE A;  3QHY A;  4KG5 A;  2RL3 A;  1YLJ A;  2ZM8 A;  4QD4 A;  3NBL A;  4E3K A;  1JWV A;  4OPQ A;  4X68 A;  3BFE A;  3IXG A;  1Z6F A;  4E3O A;  1I2S A;  3UPO A;  4QY5 A;  1FCO A;  3CG5 A;  4B4Z A;  3RJU A;  3DW0 A;  3UE1 A;  4E3N A;  1YLY A;  1ES4 A;  3HRE A;  3V39 A;  3PBN A;  3PBQ A;  4WBG A;  5FAS A;  2FFF B;  1KGE A;  1BZA A;  1FQG A;  3MFD A;  2HDR A;  4JBF A;  4S2L A;  2XEP A;  2Y59 A;  1I5Q A;  1XA7 A;  3HUM A;  4P85 A;  2EX6 A;  2H5S A;  4UA9 A;  3BFG A;  2VGK A;  5A91 A;  3PTE A;  4OP8 A;  1KE4 A;  3G4P A;  4DKI A;  4E6X A;  2ZC4 B;  4LEN A;  3N7W A;  4KZ5 A;  3IXD A;  1N9B A;  3BLS A;  3ZG9 B;  2Y2O A;  1BLS A;  3PBT A;  3C4O A;  4S2N C;  1IYQ A;  1CEG A;  1NJ4 A;  2WKH A;  4Z9Q A;  4K0X A;  5AQ7 A;  5F1F A;  3Q1F A;  4CJN A;  5CXW A;  4LCM A;  1DY6 A;  5DTS A;  4OQH A;  5HAR A;  3UPP A;  1QME A;  3WRZ A;  3ZG7 B;  3MZF A;  4GDB A;  3PBO A;  4OQ0 A;  4QHC A;  4JXW A;  4ZJ3 A;  3OPL A;  4IBR A;  5CEC A;  2JBF A;  4DXB A;  5EEC A;  5AQ9 A;  1WYB A;  5EPH A;  4RVA A;  2Q9N A;  3NI9 A;  4P6B A;  5DTT A;  5E2G A;  3IWO A;  3HVF A;  4DE1 A;  4S2P A;  4QJG A;  1NZO A;  5F83 A;  2PBY A;  1IYO A;  4MBK A;  1LHY A;  3V50 A;  3PBS A;  4X6T A;  5CGS A;  3V5M A;  3WS1 A;  3LCE A;  3ZDJ A;  1CK3 A;  2OLV A;  4YIN A;  4EV4 A;  3VOY A;  1ZG6 A;  2QMI A;  2WAE A;  3N8S A;  3N8L A;  2ZM0 A;  5E43 A;  3C7U A;  2A49 A;  1DJC A;  3MXS A;  4X56 A;  1IYP A;  3VFF A;  3QNC A;  4U3T A;  2ZQD A;  1GA9 A;  5M1A A;  1E25 A;  4LCL A;  5M18 A;  5FQK A;  1KDW A;  1RGY A;  2H0T A;  2ZD8 A;  4WYY A;  3CJM A;  5FQQ A;  3GQZ A;  3WRT A;  4BD0 A;  3IWQ A;  4OPY A;  5FDH A;  2XF3 A;  1MWU A;  2EFX A;  1PZP A;  1G6A A;  4OOL A;  1BTL A;  4DDY A;  2R9W A;  1E3U A;  4C3Q A;  2V1Z A;  3O88 A;  3V3S A;  2Y2H A;  3UN7 A;  3ZHH A;  1NZU A;  3HBR A;  2QPN A;  1E3U D;  3SH7 A;  2Y2J A;  2Y2K A;  3DWZ A;  3GRJ A;  5FA7 A;  3ZVW A;  5FI6 A;  3C7V A;  4KZ3 A;  4GN2 A;  1W8Q A;  2WGV A;  1FR6 A;  1MY8 A;  2V20 A;  3SS3 A;  1PIO A;  4QB8 A;  1C3B A;  2HP6 A;  5E2E A;  1W79 A;  1BLP A;  3A3D A;  3UDX A;  4OON A;  2OLU A;  2Q9M A;  3E2K A;  3NY4 A;  4GNU A;  1L0G A;  4LV2 A;  4XXR A;  5DF7 A;  1Q2Q A;  4S2K A;  4Y0T A;  2HPB A;  2OSU A;  3CZD A;  2Y2M A;  5DTK A;  1SDE A;  3M2K A;  1K56 D;  4GDN A;  5EVL A;  4B88 A;  2XFT A;  3MKE A;  1JTD A;  1JTG A;  4ZAM A;  1E4D A;  3MZE A;  2JE5 A;  1XXM A;  4N9L A;  2VGJ A;  3ZCZ A;  3VSK A;  3SS4 A;  4X55 A;  4U0T A;  5G18 A;  3MKF A;  4BD1 A;  4OQI A;  2BG1 A;  4GD6 A;  2J9O A;  3FYZ A;  3GV9 A;  1CI8 A;  4JF6 A;  5KMW A;  4R3J A;  2Y2N A;  3HUN A;  2B5R A;  1BLC A;  2ZC6 B;  3QNB A;  1KVL A;  3N4I A;  3VP1 A;  4KZA A;  5FQI A;  3ITB A;  4JXV A;  1YLW A;  4DE2 A;  4WZ5 C;  1XGI A;  3IQA A;  5KSC A;  1GHM A;  1H8Z A;  1W8Y A;  1CEF A;  2WGW A;  2J8Y A;  4GZB A;  4H8R A;  2IWD A;  3ZG0 A;  5JYO A;  5CED A;  1MXO A;  1ZG4 A;  1MPL A;  4KZ8 A;  4R4R A;  1ES3 A;  2EXB A;  4JF4 A;  1CI9 A;  4GKU A;  4R4S A;  4E3L A;  1PI4 A;  5L2F A;  4PPR A;  1K57 A;  5FSR A;  2X02 A;  3TG9 A;  2HDU A;  1XGJ A;  3HLG A;  5GLD A;  4M3K A;  2DRW A;  5GL9 A;  1HTZ A;  5I94 A;  1BSG A;  2ZJ9 A;  1PWG A;  1GCE A;  2EX9 A;  4N1H A;  3G2Z A;  1L0E A;  3IT9 A;  4C6Y A;  1PWC A;  2XD1 A;  4XUX A;  2H10 A;  2PU2 A;  1JWZ A;  4R0Q A;  3ZG5 A;  4OQG A;  3ZFZ A;  3BEB A;  3N6I A;  4KG2 A;  5GLC A;  4LV1 A;  1GHI A;  1WE4 A;  3SH9 A;  4RX3 A;  3A3J A;  5DVA A;  1K54 A;  1NRF A;  3VFH A;  3Q07 A;  3G31 A;  3ZNY A;  1XP4 A;  2ZM2 A;  1MBL A;  5GHX A;  5J8X A;  4WEJ A;  4R3B A;  1LI0 A;  5CEB A;  4Q8I A;  3IF6 A;  1BUL A;  3S22 A;  3IWI A;  3M6H A;  4PM6 A;  4DXC A;  4WZ4 A;  4BEN A;  4X69 A;  5FQJ A;  2Y2I A;  1FCM A;  1PW8 A;  1L0F A;  4OOM A;  5CTM A;  1VQQ A;  2I72 A;  3BLM A;  5AQB A;  4OOY A;  4FH4 A;  1MWS A;  2P9V A;  3TOI A;  4JLF A;  3N8R A;  1L2S A; 
#chains in the Genus database with same CATH topology
 1LL9 A;  3IX8 A;  3FPW A;  3LYX A;  1U60 A;  2Y2G A;  3C30 A;  3O3V A;  1UWP X;  3VSL A;  3GSG A;  1OJG A;  3HUO A;  2JC7 A;  2V1B A;  4OLD A;  4R1G A;  3HLE A;  2W1R A;  3HL9 A;  4MLL A;  1J9M A;  4YNR A;  2K7S A;  1GHP A;  2YKH A;  5HAQ A;  1YLT A;  1IEL A;  4Q0J A;  1H3Q A;  2J7V A;  1M6K A;  2JKR M;  4HJ6 A;  1OTB A;  1V9Z A;  4I3J A;  2HP9 A;  3G35 A;  4S2O A;  3LI9 A;  2M7V A;  2X71 A;  5HPF A;  1PI5 A;  4IED A;  3G30 A;  1DP6 A;  2ZMV A;  1YSQ A;  4KQR A;  1PRQ A;  3P98 A;  1SCW A;  3E2L A;  1K56 A;  1XFQ A;  2V8F A;  3LO7 A;  4WEK A;  5EOE A;  3GR2 A;  2KDK A;  4DDS A;  4MBF A;  3HLW A;  2WKI A;  4OP5 A;  3JYI A;  4JXG A;  3FKV A;  1ES5 A;  2ZL1 B;  3F1P B;  4K0W A;  1SKF A;  4RX2 A;  2JCH A;  1HD8 A;  1N9N A;  3L9K A;  3T4K A;  2C6W B;  2VV7 A;  4ID4 A;  4X25 A;  1SKO A;  2VKS A;  2GNX A;  3ITA A;  4EET B;  5DF9 A;  1ESU A;  2WAF A;  1FSW A;  3C4P A;  1IKI A;  1O07 A;  1YT4 A;  1LLB A;  4O7D A;  3H7W A;  1KGG A;  3E4P A;  3LEZ A;  2XDM A;  1PYY A;  2EX8 A;  3BEC A;  3I7J A;  2ZC5 B;  3MF0 A;  4KZ7 A;  5FAQ A;  4ETX A;  2OV5 A;  1TEM A;  5HD5 A;  1NLZ A;  3MSH A;  1TDL A;  3NOT C;  4KG6 A;  3VP3 A;  1K54 C;  1K6S A;  5C5K A;  3CMZ A;  4QY6 A;  4WUJ A;  1LSX A;  1YLP A;  2KOI A;  5FQM A;  4GLQ A;  4GOG A;  4R6L A;  3IF6 C;  3VP2 A;  4FH2 A;  1S4R A;  1TS8 A;  2J3W A;  3GTC A;  1L3L A;  2Y55 A;  3PHY A;  4FUW A;  1W63 M;  4I5S A;  1RCJ A;  2ZC7 A;  3BYD A;  4L9F A;  3MBZ A;  3NDG A;  1IFQ A;  4Y13 A;  3LIA A;  4II7 A;  1PNE A;  4IVI A;  1K25 A;  4WMC D;  1IKG A;  4F3L B;  4NET A;  4MN7 A;  4NEE D;  1DJA A;  2INW A;  2DNS A;  4JXS A;  1IYS A;  1YPR A;  2XRO A;  1ZKJ A;  4UHU A;  3B3X A;  1EI5 A;  2A24 B;  4L9G A;  4KZB A;  5EVI D;  2WAD A;  1NWZ A;  2Y91 A;  1FSY A;  3HLD A;  1O7E A;  1OT9 A;  1XJ6 A;  3UB7 A;  1TS0 A;  3C5A A;  2RCX A;  3LIE A;  4IBX A;  2JHE A;  4E3I A;  3ZYT A;  5GLB A;  4CQH A;  1MWT A;  1A0K A;  3HLC A;  4MBH A;  4UAA A;  1EW0 A;  4GJ4 A;  1S1Z A;  3BY9 A;  3GDI A;  3K3D A;  3OZH A;  5HX9 A;  4EBN A;  2NUT C;  2OOL A;  1K55 C;  5FDS A;  3A3I A;  4ZDX A;  3CWF A;  4GB7 A;  3EEH A;  2ZL1 A;  4D60 A;  2Y79 A;  3P7N A;  1MC0 A;  4OPQ A;  1I2S A;  4QY5 A;  1FCO A;  3CG5 A;  4B4Z A;  4E3N A;  3HRE A;  3V39 A;  3PBQ A;  5FAS A;  2FFF B;  1BZA A;  5F69 A;  2XEP A;  2HV1 A;  2EX6 A;  2H5S A;  2VGK A;  5A91 A;  3PTE A;  3TJZ C;  2ZC4 B;  3N7W A;  4KZ5 A;  1N9B A;  3BLS A;  2ZMF A;  1BLS A;  1IYQ A;  4UQI S;  4Z9Q A;  4K0X A;  4H6J A;  4CJN A;  5CXW A;  4LCM A;  2BTF P;  3MR0 A;  5DTS A;  3UPP A;  1ACF A;  3PBO A;  4BBV A;  4ZRR A;  3LUQ A;  5DTT A;  5E2G A;  2QWS A;  2OWJ A;  4S2P A;  2VZW A;  1NZO A;  5F83 A;  4FOF A;  2XA7 S;  3PBS A;  4X6T A;  5CGS A;  3V5M A;  3LCE A;  3ZDJ A;  2OLV A;  1ZG6 A;  1W63 Q;  3FPV A;  2WAE A;  3BW6 A;  5E43 A;  3MXS A;  5AJG A;  1S66 L;  3QNC A;  4U3T A;  5M1A A;  4WYY A;  2ZD8 A;  3CJM A;  3WRT A;  3GQZ A;  5G4Y A;  1MWU A;  2EFX A;  4OOL A;  2R9W A;  1E3U A;  3V3S A;  3UN7 A;  1NZU A;  2QPN A;  2Y2J A;  3DWZ A;  3PYP A;  3ZVW A;  4FTX A;  4KZ3 A;  1W8Q A;  2PHY A;  4IUH A;  1MY8 A;  3SS3 A;  3QP5 A;  5J4E A;  2HP6 A;  3LR0 A;  1W79 A;  3UDX A;  2OLU A;  3E2K A;  3KSH A;  3NY4 A;  1L0G A;  4LV2 A;  3FG8 A;  3B42 A;  3CZD A;  2P08 A;  2VK3 A;  3M2K A;  4GDN A;  5EVL A;  2XFT A;  3GEC A;  1JTG A;  4ZAM A;  2JE5 A;  3VSK A;  4BD1 A;  3MKF A;  4GD6 A;  2QKP A;  4EEP A;  3T1X A;  1ZHH B;  3F1N A;  1T19 A;  5FQI A;  2PBD P;  3T4Q A;  2W3G A;  3IQA A;  5KSC A;  2WGW A;  2J8Y A;  4GZB A;  2DMW A;  2IWD A;  5JYO A;  5CED A;  1MPL A;  4KZ8 A;  2XSS A;  2EXB A;  5L2F A;  4PPR A;  5FSR A;  2X02 A;  3TG9 A;  5GLD A;  3T4L A;  2DRW A;  5I94 A;  3NHQ A;  3H9W A;  4MCW A;  2PU2 A;  3ZFZ A;  3N6I A;  1WE4 A;  3A3J A;  1YKD A;  5DVA A;  3Q07 A;  4Y15 A;  3G31 A;  3LFV A;  1LI0 A;  2HF6 A;  2KX6 A;  4BEN A;  3IX4 A;  5CTM A;  4PKY A;  4FH4 A;  1MWS A;  3TOI A;  3K2N A;  4JLF A;  3S7N A;  3IS2 B;  3PBR A;  1VET B;  2ACG A;  1ERM A;  1GSV A;  3B47 A;  5CX7 A;  1OTE A;  2EX2 A;  5FI7 A;  3UME A;  1KE3 A;  3Q81 A;  4XUZ A;  2FFY A;  5A8B A;  2PRF A;  1P97 A;  3RXW A;  2O0Y A;  4JPM A;  4R38 A;  5U47 A;  4B93 A;  3RTY A;  2XR0 A;  4U0X A;  1K6R A;  2QHK A;  3CUE A;  3DWK A;  1W7F A;  2J3T C;  3BM6 A;  4ZTK A;  2PR5 A;  4Q0I A;  1FCN A;  4O01 A;  5GHY A;  4EWF A;  4LV0 A;  1L0D A;  3PAG A;  2DCF A;  1J3W A;  3LY4 A;  1ERQ A;  1K4E A;  2EFU A;  3EWK A;  3UE3 A;  5FQ9 A;  3G2Y A;  2Y4A A;  4HBU A;  3WS5 A;  4BLM A;  3OCL A;  5TFQ A;  2ZQC A;  1I2W A;  4CLC C;  3FKW A;  2Y8H A;  3OLO A;  2ZQ9 A;  3S7Q A;  4R70 A;  2R78 A;  1QMF A;  3C2W A;  4KQQ A;  2XD5 A;  4EBL A;  4E04 A;  1TDG A;  5HWV A;  2ZQA A;  5TGF A;  5IS1 A;  2K2N A;  2W1T B;  4WZ5 A;  1G28 A;  5M19 A;  1DP8 A;  3VOZ A;  4EUZ A;  4JGO A;  3H82 B;  3Q7V A;  3M6B A;  3AGF A;  4MDZ A;  4N1X A;  3NC8 A;  3MXQ A;  3IF6 B;  4F94 A;  2FH5 A;  1KGF A;  1MKI A;  4CLC E;  1ONG A;  5DJT A;  3T4S A;  4LV3 A;  3IH9 A;  1NYM A;  4DJ3 A;  4JF5 A;  2JN7 A;  3C8C A;  3MZD A;  1WYC A;  5KSH A;  1YLZ A;  5HL1 A;  2OAP 1;  1XKZ A;  3JPU A;  5FI2 A;  1S1Y A;  3WWX A;  5CGW A;  1RP5 A;  2PD7 A;  1BLH A;  3UNW A;  3BFD A;  2P74 A;  1S67 L;  3F1O A;  2PU4 A;  3PXP A;  4HBT A;  1G5U A;  3EQV A;  4KZ6 A;  1MWR A;  3UO9 A;  3FZC A;  1VET A;  4Z1W A;  3UY6 A;  4HP9 A;  4WM9 A;  2FZ0 A;  1P0Z A;  2EWW A;  3W8K A;  4Q0H A;  4BWI A;  2Y2Q A;  4P6Z M;  3GVB A;  2G2U A;  1ES2 A;  4I38 A;  3T50 A;  3QP6 A;  4PHT A;  2V2F F;  4HJ4 A;  3HLB A;  3GMW A;  3KSG A;  2HZ5 A;  4YOF A;  4S2J A;  2WZZ A;  1JWP A;  4GHI A;  5EE8 A;  3AGE A;  5LBR A;  2HDQ A;  2HJE A;  4EUV A;  3IBR A;  1K38 A;  2WGI A;  5EUA A;  4ZJ2 A;  2WK0 A;  5HAP A;  2H0Y A;  3CPT B;  2J9P A;  3WS4 A;  3T1S A;  4BL2 A;  4YWZ A;  2EXA A;  1W5D A;  1VEU A;  3FV7 A;  4R23 A;  4BQM A;  1D7E A;  2WKE A;  4MMN A;  2ZM8 A;  2H28 A;  4QD4 A;  4WF0 A;  3NBL A;  1JWV A;  5HDD A;  3UPO A;  3IXG A;  3T1R A;  2ZOH A;  4WBG A;  3W2Z A;  3MFD A;  2Y59 A;  1I5Q A;  2PYP A;  4DKI A;  3IXD A;  4G3W A;  3LIC A;  2Y2O A;  3C4O A;  1CEG A;  2WKH A;  3E98 A;  3KSF A;  5F1F A;  3CI6 A;  4OQH A;  3WRZ A;  4NXE A;  3ZG7 B;  1V9Y A;  3SW1 A;  4ZJ3 A;  4DXB A;  5AQ9 A;  5EPH A;  3IWO A;  2HJ9 C;  3HVF A;  3A0R A;  4LRZ E;  4KUK A;  5F5Y A;  4DE1 A;  3E0Y A;  4QJG A;  2QYB A;  2PBY A;  1IYO A;  1ZTU A;  4IJG A;  4EV4 A;  4YIN A;  5HWW A;  3N8S A;  3DAV A;  4ME4 A;  2A49 A;  1DJC A;  4I39 A;  2ZQD A;  1E25 A;  4LCL A;  1KDW A;  2H0T A;  3MQ0 A;  4BD0 A;  3IWQ A;  3QP4 A;  5FDH A;  3NOP C;  1T18 A;  1PZP A;  4HOI A;  1F5M A;  1BTL A;  1FIL A;  3ZQ5 A;  4C3Q A;  3O88 A;  3BQA A;  1E3U D;  3SH7 A;  5FA7 A;  2V9A A;  5FI6 A;  4GN2 A;  4NXF A;  3CAX A;  1FR6 A;  2PDR A;  1PIO A;  4LLO B;  4QB8 A;  1C3B A;  3A3D A;  1BLP A;  2Q9M A;  1T1A A;  5DF7 A;  1Q2Q A;  4S2K A;  5DFX A;  4ESP A;  4GW9 A;  5HZH A;  3MKE A;  1JTD A;  1XXM A;  4N9L A;  2VGJ A;  3ZCZ A;  1XFN A;  4U0T A;  2V8C A;  2J9O A;  4LRX C;  3GV9 A;  1CI8 A;  2O9B A;  1DP9 A;  2QJ7 A;  3HUN A;  2ZC6 B;  4KZA A;  1D06 A;  5HPI A;  3MQO A;  4HH3 A;  1XGI A;  1XJ4 A;  1CEF A;  3F1P A;  3ZG0 A;  1MXO A;  4R4R A;  3UB6 A;  4GKU A;  4R4S A;  4E3L A;  1K57 A;  1XGJ A;  5HDS A;  2PD8 A;  1HTZ A;  1BSG A;  5IU1 A;  3IT9 A;  1JWZ A;  3ZG5 A;  2B18 A;  4LV1 A;  3VFH A;  3NJA A;  4JGP A;  4I3I A;  5J8X A;  4WEJ A;  5CEB A;  4Q8I A;  3S22 A;  1BUL A;  3HJI A;  3BY8 A;  3IWI A;  4X69 A;  1PW8 A;  1L0F A;  4HH2 A;  2I72 A;  3BLM A;  3N8R A;  2JKT I;  2QZ6 A;  1K4F A;  1KE0 A;  2EA9 A;  4EW7 A;  2KLI A;  1K0K A;  4XT2 B;  4QPR A;  2X01 A;  3OPP A;  3HLF A;  4KUO A;  3CIT A;  3U4L P;  1Y54 A;  3D4F A;  2PT7 A;  3ZVT A;  4OPZ A;  1UWN X;  4G3V A;  1P9W A;  2C5W B;  4KZ9 A;  2WUQ A;  3UDF A;  5EVI C;  2XH9 A;  1H0M A;  3MXR A;  4HQA A;  4OLG A;  5TBM B;  1VB6 A;  2D01 A;  1M40 A;  4BL3 A;  1OPX A;  5IHV A;  4CLC B;  4PM7 A;  3WS0 A;  2ZLY A;  2Z2M B;  1VHM A;  5L09 A;  2G2W A;  4EXO A;  4F3L A;  2Y2L A;  1UGU A;  2P04 A;  3R7W B;  3UMD A;  1CJF A;  2ZC3 B;  2A24 A;  1LL5 A;  4P87 A;  5EVE A;  3NDE A;  1SDN A;  4MN6 A;  4S2M A;  5J3W A;  4BMW A;  5GHZ A;  3UPN A;  1HVB A;  3BFF A;  3VE4 A;  4Y0O A;  4X53 A;  5IT5 A;  1RGZ A;  4DE0 A;  2M7U A;  3OC2 A;  3O86 A;  1ALQ A;  3VMA A;  4QU3 A;  3V67 A;  4HI4 A;  4NXG A;  4YFM A;  2V1A A;  5EM1 A;  5L07 A;  4HNB A;  3SH8 A;  3ISG A;  3UB8 A;  4P6Z S;  1ESI A;  4OVD A;  3LEQ A;  4K08 A;  4B9O A;  5FL3 A;  1BYW A;  1SHV A;  3SOI A;  5EM0 A;  1ODV A;  2O9A A;  1LI9 A;  1OTD A;  2P9V B;  2W3D A;  3VV4 A;  4HEF A;  4ARZ B;  2M1C A;  1ONH A;  2Z2L B;  1G68 A;  1HLU P;  4N9K A;  2UWX A;  1Q2P A;  3DTK A;  4S2N A;  2XGN A;  2Y2P A;  4ETZ A;  3VP0 A;  1D1J A;  3LR3 A;  3M2J A;  4E3J A;  3K3C A;  4IHQ A;  5FAO A;  5DKL A;  4DF6 A;  4HY8 A;  3S7P A;  1SZV A;  3RFB A;  4GS9 B;  3VP4 A;  2ZMA A;  5CER A;  3W4Q A;  5J7E A;  4L0L A;  1DJB A;  1T1B A;  2XK1 A;  2V0W A;  5KZH A;  5HWT A;  3E4Q A;  3LY3 A;  4HES A;  1XJ2 A;  3G6O A;  3NIA A;  2NUP C;  4IUK A;  1GA0 A;  5GLA A;  2A3U A;  4RYE A;  4MEZ A;  4DE3 A;  3AGD A;  4NKP A;  3UDI A;  1NYY A;  1VM1 A;  3KYE A;  5FAP A;  3CLO A;  2W0N A;  4XT2 A;  1YM1 A;  5CHJ A;  1CF0 A;  2VJW A;  5BOH A;  5CTN A;  3D72 A;  5MC7 A;  1YQS A;  1OME A;  1SKO B;  4IVK A;  1DRM A;  4PM9 A;  2XRN A;  2JKR I;  3UE6 A;  4K91 A;  4PMA A;  3Q7Z A;  2PYR A;  2ZQ8 A;  3R4K A;  3A3F A;  3EQU A;  4I3A A;  4P0M A;  3H7W B;  2WKQ A;  3UE0 A;  3KX0 X;  1X0O A;  1BT5 A;  3FWL A;  4OKP A;  5CRF A;  5DF8 A;  2WKP A;  4Y0U A;  5E2F A;  4KEN B;  4C75 A;  4FD8 A;  1PWD A;  1KDS A;  5CGX A;  5D3O A;  4HP4 A;  1YMX A;  3P09 A;  3JVU A;  3DBA A;  3QHY A;  2RL3 A;  1YLJ A;  4E3K A;  3MQQ A;  4X68 A;  3BFE A;  1Z6F A;  3MJQ A;  5KIZ A;  3RJU A;  3DW0 A;  4O0P A;  3UE1 A;  1YLY A;  1ES4 A;  1FQG A;  4M4X A;  2Z6C A;  2J80 A;  4UA9 A;  3BFG A;  4OP8 A;  1KE4 A;  1OJ5 A;  3G4P A;  4E6X A;  3ZG9 B;  2I9V A;  3T4J A;  1NJ4 A;  4WL9 A;  1XJ3 A;  3E4O A;  5HAR A;  1QME A;  4MN5 A;  3OOV A;  3MZF A;  4GDB A;  3O5Y A;  4QHC A;  4JXW A;  3OPL A;  4IBR A;  2JBF A;  4RVA A;  2Q9N A;  3NI9 A;  4P6B A;  2ZOI A;  4EES A;  4MBK A;  3WS1 A;  2OAQ 1;  4LGW A;  2QMI A;  4NG2 A;  3N8L A;  3KYQ A;  3C7U A;  3CHW P;  3IS2 A;  3LID A;  3MMH A;  4X56 A;  1GA9 A;  2VGL M;  3HCY A;  2L4R A;  5M18 A;  4GS9 A;  1WA9 A;  3VOL A;  1G6A A;  2W3H A;  3GRJ A;  4LPZ A;  4NXB A;  3C7V A;  2WGV A;  3LI8 A;  2UV0 E;  4X1M A;  1LSV A;  3BQ8 A;  4GNU A;  4XXR A;  2HPB A;  2Y2M A;  4PAU A;  5DTK A;  4B88 A;  1E4D A;  3MZE A;  3T12 B;  5G18 A;  4R3A A;  5HL6 A;  3FYZ A;  4R3J A;  2Y2N A;  1P9R A;  1BLC A;  3QNB A;  1PFL A;  3N4I A;  3ITB A;  4JXV A;  1YLW A;  4DE2 A;  1N9L A;  1GHM A;  3KSI A;  3ICY A;  1ZG4 A;  3PR6 A;  4JF4 A;  3IBJ A;  1PI4 A;  2HDU A;  3HLG A;  5I5L A;  2B02 A;  4M3K A;  5HDC A;  2ZJ9 A;  2EX9 A;  4H6J B;  4DJ2 A;  2BAS A;  3G2Z A;  1PWC A;  4HHD A;  2XD1 A;  4XUX A;  2H10 A;  4R0Q A;  3BEB A;  5GLC A;  3SH9 A;  3NEC A;  4RX3 A;  3B33 A;  2W1T A;  1K54 A;  4AFI A;  3H82 A;  1LL8 A;  5GHX A;  3TE8 A;  1GSW A;  3IX3 A;  1OTA A;  3IF6 A;  4RQ9 A;  4WZ4 A;  3TW8 A;  3A0V A;  2W3F A;  1FCM A;  3D9Y A;  4EU0 A;  3LR4 A;  1VQQ A;  2HGV A;  5AQB A;  3TRC A;  1TF1 A;  3OPH A;  5A93 A;  3MFX A;  4JGQ A;  3ZG8 B;  1NY0 A;  5EFW A;  3EGD C;  5EVI B;  3U2A A;  1ERO A;  2E8J A;  3LR5 A;  1ZC2 A;  2VV6 A;  4E6W A;  4DRT A;  3S4X A;  1H5X A;  1YSP A;  5TR7 A;  4ZJ1 A;  1XPB A;  4ZBE A;  2W3E A;  2XQZ A;  1Y4O A;  1KVM A;  2VX8 A;  3FC7 A;  3RXX A;  5G4Z A;  1T1C A;  3WS2 A;  1IEM A;  3IXB A;  4UA6 A;  1FR1 A;  2PAV P;  5CHM A;  3IXH A;  4NK3 A;  1S6R A;  3LIB A;  4OH0 A;  5HW3 A;  3Q82 A;  1STZ A;  1XX2 A;  3F1N B;  4HIA A;  1MZU A;  3G34 A;  5FEF A;  4G3K A;  4X1L A;  4DN0 A;  3KYZ A;  5DJU A;  2WGW B;  2LB5 A;  4KZ4 A;  4PKY G;  4CPK A;  5FAT A;  2BLS A;  4EEU A;  5A92 A;  1MKM A;  2WZX A;  3PAE A;  5E2H A;  2R9X A;  4FCF A;  4KQD A;  5F1G A;  3V3R A;  1NLY A;  2IWC A;  5HD3 A;  1AXB A;  5HSQ A;  4BBU A;  2GZA A;  2HP5 A;  3DTI A;  3QP1 A;  1K55 A;  3A3E A;  2YKF A;  2OWH A;  4MNR A;  3T4O A;  4N92 A;  1K57 C;  4B4X A;  5JYP A;  3OCN A;  3KO6 A;  3T1Q B;  4EER A;  1AWI A;  4JKT A;  3IHB A;  3A0S A;  3CPT A;  3UB9 A;  1JNU A;  3IHA A;  4LFU A;  2HDS A;  3QP2 A;  3ZGA B;  2ZBB A;  3NCK A;  1XA1 A;  4OPR A;  3LIF A;  2XLN A;  3SS5 A;  1EWZ A;  4BBT A;  2Z6D A;  1YAX A;  2W27 A;  3MS6 A;  4GCZ A;  1BUE A;  2VV8 A;  4O8G A;  3LGO A;  1HZO A;  2GDN A;  4L9E A;  2E8I A;  1PZO A;  4S2I A;  4Y2F A;  1LT0 A;  3S1Y A;  3O87 A;  1TD5 A;  2QJ5 A;  1S0W A;  2VEA A;  5HFO A;  5CHU A;  1N4O A;  4GD8 A;  4KQO A;  2LB9 A;  1TS7 A;  1LSW A;  3ZNT A;  4WMC A;  4LRY C;  4BJP A;  3IF5 A;  2ZQ7 A;  1F98 A;  5EOO A;  1YMS A;  3C38 A;  4D2O A;  2WYX A;  5A90 A;  2B95 A;  1N9O A;  3W4O A;  3BFC A;  4EBP A;  1S4S A;  4Y5F A;  2A2L A;  4PM5 A;  5EVI A;  5F68 A;  2XFS A;  4PM8 A;  1NXY A;  4Y3I A;  2J3T D;  4E3M A;  3UB5 P;  1FIK A;  3DTM A;  4A5R A;  1H8Y A;  2IWB A;  2O9C A;  3OPR A;  1FOF A;  2G7U A;  3W4P A;  5HAI A;  3IH8 A;  4UA7 A;  3P01 A;  4FSF A;  4Y7P A;  3BRM A;  3Q7V B;  3G32 A;  2WKR A;  3NOU C;  2VGL S;  3TSG A;  4EQI A;  2CC1 A;  2K31 A;  4CLC D;  4RA7 A;  1JVJ A;  1TVF A;  1KOU A;  4WEL A;  1F2K A;  5AQA A;  5F82 A;  1PW1 A;  3EEA A;  4KG5 A;  3VE3 A;  5AVF A;  4E3O A;  2P7J A;  2D02 A;  3PBN A;  1KGE A;  2HDR A;  4JBF A;  4S2L A;  1XA7 A;  3HUM A;  4P85 A;  2JKT M;  1CQA A;  3L7H A;  5TJJ A;  3BWL A;  4LEN A;  2Q0O A;  5DKK A;  3PBT A;  4S2N C;  5AQ7 A;  3Q1F A;  3QP8 A;  1G6O A;  1DY6 A;  3T4T A;  3DTE A;  3EOI A;  3SZT A;  3F1O B;  5L10 A;  4OQ0 A;  1OTI A;  2GX5 A;  2MJ6 A;  2VLG A;  5CEC A;  4WLA A;  5K5B A;  1IOU A;  5EEC A;  1WYB A;  2PR6 A;  2JKG A;  1LHY A;  3V50 A;  1CK3 A;  3VOY A;  4JGR A;  3BJN A;  2ZM0 A;  2EWV A;  3JVV A;  3CUE C;  2L0W A;  1IYP A;  3VFF A;  3S7O A;  5FQK A;  1RGY A;  1Z09 A;  5FQQ A;  4OPY A;  2XF3 A;  4GHI B;  4DDY A;  2V1Z A;  2Y2H A;  3ZHH A;  3HBR A;  4WN5 A;  2Y2K A;  3EGX C;  1GSX A;  5DFY A;  3RH8 B;  4DMZ A;  4Y17 A;  1NRJ A;  2V0U A;  4EQ1 A;  2V20 A;  2L1M A;  5E2E A;  4OON A;  1H8M A;  5AVE A;  1VEU B;  4Y0T A;  4UEY A;  2OSU A;  5EV0 A;  1SDE A;  1K56 D;  4HJ3 A;  5TBM A;  5L8M A;  3SS4 A;  4X55 A;  4CLC A;  3OBF A;  4OQI A;  2BG1 A;  4UQI M;  4JF6 A;  1OT6 A;  5KMW A;  2IA2 A;  2B5R A;  3NUL A;  1KVL A;  3VP1 A;  4QWO A;  1TS6 A;  3HJK A;  2JKF A;  3ULF A;  4WZ5 C;  3R7W A;  2AVX A;  1H8Z A;  1W8Y A;  4H8R A;  1ES3 A;  1F9I A;  1CI9 A;  1Y28 A;  2GJ3 A;  5GL9 A;  2XA7 M;  1PWG A;  1GCE A;  4N1H A;  1L0E A;  4C6Y A;  4OQG A;  3D3O A;  4KG2 A;  1GHI A;  5F6A A;  1NRF A;  2O99 A;  3ZNY A;  1XP4 A;  2ZM2 A;  1MBL A;  4R3B A;  2CMN A;  3M6H A;  4PM6 A;  4DXC A;  5FQJ A;  2Y2I A;  4OOM A;  5FEG A;  4OOY A;  2P9V A;  2VA0 A;  1L2S A;  4ARZ A; 
#chains in the Genus database with same CATH homology
 1LL9 A;  3PBR A;  3OPH A;  5A93 A;  2QZ6 A;  1ERM A;  3ZG8 B;  1K4F A;  1NY0 A;  1KE0 A;  1U60 A;  2Y2G A;  3O3V A;  2EX2 A;  5EVI B;  5FI7 A;  1KE3 A;  3VSL A;  1ERO A;  3Q81 A;  1ZC2 A;  3GSG A;  2FFY A;  3HUO A;  4XUZ A;  2JC7 A;  2X01 A;  4OLD A;  4R1G A;  3OPP A;  3HLF A;  3HLE A;  4E6W A;  1Y54 A;  4DRT A;  3D4F A;  3HL9 A;  3RXW A;  4MLL A;  3S4X A;  1H5X A;  4JPM A;  1J9M A;  5TR7 A;  1GHP A;  5U47 A;  3ZVT A;  4ZJ1 A;  1YLT A;  5HAQ A;  1XPB A;  4ZBE A;  4OPZ A;  1IEL A;  2XR0 A;  2C5W B;  2XQZ A;  4U0X A;  2J7V A;  1M6K A;  4KZ9 A;  2WUQ A;  1K6R A;  1KVM A;  3DWK A;  3UDF A;  1W7F A;  5EVI C;  2XH9 A;  3RXX A;  2HP9 A;  3BM6 A;  3G35 A;  4ZTK A;  3MXR A;  4S2O A;  3WS2 A;  1IEM A;  1FCN A;  3IXB A;  4UA6 A;  1FR1 A;  2X71 A;  4OLG A;  5CHM A;  3IXH A;  5GHY A;  4EWF A;  1M40 A;  1PI5 A;  4LV0 A;  4IED A;  1L0D A;  4BL3 A;  3PAG A;  3G30 A;  2DCF A;  4NK3 A;  5IHV A;  1S6R A;  3LY4 A;  4PM7 A;  4KQR A;  4OH0 A;  3WS0 A;  2ZLY A;  2Z2M B;  3P98 A;  5HW3 A;  1ERQ A;  1SCW A;  3E2L A;  3Q82 A;  1K56 A;  2G2W A;  1K4E A;  1XX2 A;  3LO7 A;  5EOE A;  3G34 A;  4WEK A;  2EFU A;  2Y2L A;  3GR2 A;  4DDS A;  4MBF A;  3HLW A;  2WKI A;  4OP5 A;  3UE3 A;  3JYI A;  4JXG A;  3FKV A;  5FQ9 A;  1ES5 A;  3G2Y A;  2Y4A A;  4HBU A;  2WGW B;  3WS5 A;  4KZ4 A;  4BLM A;  2ZC3 B;  4CPK A;  4K0W A;  1SKF A;  4RX2 A;  5FAT A;  3OCL A;  2BLS A;  2JCH A;  4P87 A;  1HD8 A;  1LL5 A;  5TFQ A;  3NDE A;  1SDN A;  2ZQC A;  5A92 A;  2C6W B;  2WZX A;  3PAE A;  5E2H A;  4S2M A;  4ID4 A;  2R9X A;  4FCF A;  1I2W A;  5F1G A;  5GHZ A;  3FKW A;  3V3R A;  3UPN A;  1HVB A;  3BFF A;  3ITA A;  2IWC A;  2ZQ9 A;  4Y0O A;  1QMF A;  1AXB A;  4X53 A;  4KQQ A;  1RGZ A;  5DF9 A;  4DE0 A;  1ESU A;  2WAF A;  2XD5 A;  4EBL A;  1TDG A;  3OC2 A;  1FSW A;  2HP5 A;  3C4P A;  2ZQA A;  3O86 A;  1IKI A;  5TGF A;  1K55 A;  1O07 A;  1ALQ A;  3VMA A;  3A3E A;  4QU3 A;  4WZ5 A;  1YT4 A;  1LLB A;  4YFM A;  4MNR A;  5M19 A;  4O7D A;  4N92 A;  3SH8 A;  3VOZ A;  1KGG A;  1K57 C;  3ISG A;  4EUZ A;  1ESI A;  4B4X A;  3LEZ A;  2XDM A;  3Q7V A;  4OVD A;  3M6B A;  3AGF A;  1PYY A;  5JYP A;  2EX8 A;  4N1X A;  3BEC A;  3NC8 A;  3OCN A;  1SHV A;  3I7J A;  3IF6 B;  3SOI A;  2ZC5 B;  4F94 A;  4KZ7 A;  5FAQ A;  2OV5 A;  4JKT A;  3IHB A;  3IHA A;  1TEM A;  3ZGA B;  2HDS A;  3NCK A;  1XA1 A;  1LI9 A;  4OPR A;  2XLN A;  2P9V B;  1KGF A;  1MKI A;  1TDL A;  1ONG A;  4HEF A;  4KG6 A;  3SS5 A;  3VP3 A;  1K54 C;  1EWZ A;  1ONH A;  1K6S A;  2Z2L B;  1G68 A;  3CMZ A;  4N9K A;  4QY6 A;  1YLP A;  2UWX A;  4LV3 A;  1Q2P A;  4S2N A;  3IH9 A;  5FQM A;  1BUE A;  2XGN A;  2Y2P A;  3VP0 A;  4GOG A;  1HZO A;  3IF6 C;  3VP2 A;  1NYM A;  2GDN A;  3M2J A;  4FH2 A;  4E3J A;  2E8I A;  4JF5 A;  3GTC A;  3MZD A;  5FAO A;  1WYC A;  5KSH A;  4DF6 A;  1PZO A;  4S2I A;  2Y55 A;  3VP4 A;  2ZMA A;  3S1Y A;  1YLZ A;  3O87 A;  5CER A;  3W4Q A;  4L0L A;  1DJB A;  1S0W A;  1RCJ A;  2ZC7 A;  5HL1 A;  2XK1 A;  5HFO A;  5CHU A;  1XKZ A;  1N4O A;  4GD8 A;  5KZH A;  3BYD A;  5FI2 A;  3WWX A;  4KQO A;  5CGW A;  3ZNT A;  3MBZ A;  1RP5 A;  3NDG A;  1BLH A;  4WMC A;  3UNW A;  3BFD A;  4BJP A;  3LY3 A;  3IF5 A;  2P74 A;  2ZQ7 A;  4HES A;  4IVI A;  1K25 A;  4WMC D;  3NIA A;  5EOO A;  1YMS A;  2PU4 A;  1IKG A;  4HBT A;  1GA0 A;  5GLA A;  2A3U A;  4D2O A;  2WYX A;  5A90 A;  4RYE A;  4MEZ A;  3EQV A;  4DE3 A;  4KZ6 A;  1MWR A;  3UO9 A;  3FZC A;  3AGD A;  4NET A;  3W4O A;  1DJA A;  3BFC A;  3UDI A;  2DNS A;  4JXS A;  3UY6 A;  4EBP A;  4WM9 A;  1IYS A;  1NYY A;  1VM1 A;  1ZKJ A;  5FAP A;  4UHU A;  4PM5 A;  3B3X A;  1EI5 A;  5EVI A;  2XFS A;  4PM8 A;  3W8K A;  1YM1 A;  5CHJ A;  5BOH A;  1NXY A;  5CTN A;  5EVI D;  2Y2Q A;  4KZB A;  3GVB A;  2G2U A;  2WAD A;  1ES2 A;  4E3M A;  1YQS A;  1OME A;  2V2F F;  3DTM A;  4IVK A;  4A5R A;  2Y91 A;  3GMW A;  3HLB A;  1FSY A;  3HLD A;  1H8Y A;  4PM9 A;  2IWB A;  4S2J A;  1O7E A;  3OPR A;  2WZZ A;  1JWP A;  5EE8 A;  1FOF A;  4K91 A;  4PMA A;  3Q7Z A;  3AGE A;  3C5A A;  3W4P A;  5HAI A;  2ZQ8 A;  3IH8 A;  4UA7 A;  2HDQ A;  2RCX A;  4FSF A;  4IBX A;  3A3F A;  3EQU A;  4E3I A;  4Y7P A;  4P0M A;  3BRM A;  3UE0 A;  5GLB A;  3Q7V B;  3G32 A;  1K38 A;  2WGI A;  3FWL A;  1BT5 A;  5EUA A;  4OKP A;  5CRF A;  4ZJ2 A;  3TSG A;  5DF8 A;  1MWT A;  2WK0 A;  4EQI A;  5HAP A;  2H0Y A;  4Y0U A;  2CC1 A;  3HLC A;  2J9P A;  4MBH A;  4UAA A;  5E2F A;  4KEN B;  3WS4 A;  4BL2 A;  2EXA A;  1W5D A;  4C75 A;  3FV7 A;  4FD8 A;  3OZH A;  1PWD A;  1KDS A;  4RA7 A;  5CGX A;  5D3O A;  1JVJ A;  5HX9 A;  4EBN A;  1TVF A;  4WEL A;  1K55 C;  4R23 A;  3A3I A;  4BQM A;  4ZDX A;  4GB7 A;  1YMX A;  5AQA A;  3P09 A;  5F82 A;  1PW1 A;  2WKE A;  3QHY A;  4KG5 A;  2RL3 A;  1YLJ A;  2ZM8 A;  4QD4 A;  3NBL A;  4E3K A;  1JWV A;  4OPQ A;  4X68 A;  3BFE A;  3IXG A;  1Z6F A;  4E3O A;  1I2S A;  3UPO A;  4QY5 A;  1FCO A;  3CG5 A;  4B4Z A;  3RJU A;  3DW0 A;  3UE1 A;  4E3N A;  1YLY A;  1ES4 A;  3HRE A;  3V39 A;  3PBN A;  3PBQ A;  4WBG A;  5FAS A;  2FFF B;  1KGE A;  1BZA A;  1FQG A;  3MFD A;  2HDR A;  4JBF A;  4S2L A;  2XEP A;  2Y59 A;  1I5Q A;  1XA7 A;  3HUM A;  4P85 A;  2EX6 A;  2H5S A;  4UA9 A;  3BFG A;  2VGK A;  5A91 A;  3PTE A;  4OP8 A;  1KE4 A;  3G4P A;  4DKI A;  4E6X A;  2ZC4 B;  4LEN A;  3N7W A;  4KZ5 A;  3IXD A;  1N9B A;  3BLS A;  3ZG9 B;  2Y2O A;  1BLS A;  3PBT A;  3C4O A;  4S2N C;  1IYQ A;  1CEG A;  1NJ4 A;  2WKH A;  4Z9Q A;  4K0X A;  5AQ7 A;  5F1F A;  3Q1F A;  4CJN A;  5CXW A;  4LCM A;  1DY6 A;  5DTS A;  4OQH A;  5HAR A;  3UPP A;  1QME A;  3WRZ A;  3ZG7 B;  3MZF A;  4GDB A;  3PBO A;  4OQ0 A;  4QHC A;  4JXW A;  4ZJ3 A;  3OPL A;  4IBR A;  5CEC A;  2JBF A;  4DXB A;  5EEC A;  5AQ9 A;  1WYB A;  5EPH A;  4RVA A;  2Q9N A;  3NI9 A;  4P6B A;  5DTT A;  5E2G A;  3IWO A;  3HVF A;  4DE1 A;  4S2P A;  4QJG A;  1NZO A;  5F83 A;  2PBY A;  1IYO A;  4MBK A;  1LHY A;  3V50 A;  3PBS A;  4X6T A;  5CGS A;  3V5M A;  3WS1 A;  3LCE A;  3ZDJ A;  1CK3 A;  2OLV A;  4YIN A;  4EV4 A;  3VOY A;  1ZG6 A;  2QMI A;  2WAE A;  3N8S A;  3N8L A;  2ZM0 A;  5E43 A;  3C7U A;  2A49 A;  1DJC A;  3MXS A;  4X56 A;  1IYP A;  3VFF A;  3QNC A;  4U3T A;  2ZQD A;  1GA9 A;  5M1A A;  1E25 A;  4LCL A;  5M18 A;  5FQK A;  1KDW A;  1RGY A;  2H0T A;  2ZD8 A;  4WYY A;  3CJM A;  5FQQ A;  3GQZ A;  3WRT A;  4BD0 A;  3IWQ A;  4OPY A;  5FDH A;  2XF3 A;  1MWU A;  2EFX A;  1PZP A;  1G6A A;  4OOL A;  1BTL A;  4DDY A;  2R9W A;  1E3U A;  4C3Q A;  2V1Z A;  3O88 A;  3V3S A;  2Y2H A;  3UN7 A;  3ZHH A;  1NZU A;  3HBR A;  2QPN A;  1E3U D;  3SH7 A;  2Y2J A;  2Y2K A;  3DWZ A;  3GRJ A;  5FA7 A;  3ZVW A;  5FI6 A;  3C7V A;  4KZ3 A;  4GN2 A;  1W8Q A;  2WGV A;  1FR6 A;  1MY8 A;  2V20 A;  3SS3 A;  1PIO A;  4QB8 A;  1C3B A;  2HP6 A;  5E2E A;  1W79 A;  1BLP A;  3A3D A;  3UDX A;  4OON A;  2OLU A;  2Q9M A;  3E2K A;  3NY4 A;  4GNU A;  1L0G A;  4LV2 A;  4XXR A;  5DF7 A;  1Q2Q A;  4S2K A;  4Y0T A;  2HPB A;  2OSU A;  3CZD A;  2Y2M A;  5DTK A;  1SDE A;  3M2K A;  1K56 D;  4GDN A;  5EVL A;  4B88 A;  2XFT A;  3MKE A;  1JTD A;  1JTG A;  4ZAM A;  1E4D A;  3MZE A;  2JE5 A;  1XXM A;  4N9L A;  2VGJ A;  3ZCZ A;  3VSK A;  3SS4 A;  4X55 A;  4U0T A;  5G18 A;  3MKF A;  4BD1 A;  4OQI A;  2BG1 A;  4GD6 A;  2J9O A;  3FYZ A;  3GV9 A;  1CI8 A;  4JF6 A;  5KMW A;  4R3J A;  2Y2N A;  3HUN A;  2B5R A;  1BLC A;  2ZC6 B;  3QNB A;  1KVL A;  3N4I A;  3VP1 A;  4KZA A;  5FQI A;  3ITB A;  4JXV A;  1YLW A;  4DE2 A;  4WZ5 C;  1XGI A;  3IQA A;  5KSC A;  1GHM A;  1H8Z A;  1W8Y A;  1CEF A;  2WGW A;  2J8Y A;  4GZB A;  4H8R A;  2IWD A;  3ZG0 A;  5JYO A;  5CED A;  1MXO A;  1ZG4 A;  1MPL A;  4KZ8 A;  4R4R A;  1ES3 A;  2EXB A;  4JF4 A;  1CI9 A;  4GKU A;  4R4S A;  4E3L A;  1PI4 A;  5L2F A;  4PPR A;  1K57 A;  5FSR A;  2X02 A;  3TG9 A;  2HDU A;  1XGJ A;  3HLG A;  5GLD A;  4M3K A;  2DRW A;  5GL9 A;  1HTZ A;  5I94 A;  1BSG A;  2ZJ9 A;  1PWG A;  1GCE A;  2EX9 A;  4N1H A;  3G2Z A;  1L0E A;  3IT9 A;  4C6Y A;  1PWC A;  2XD1 A;  4XUX A;  2H10 A;  2PU2 A;  1JWZ A;  4R0Q A;  3ZG5 A;  4OQG A;  3ZFZ A;  3BEB A;  3N6I A;  4KG2 A;  5GLC A;  4LV1 A;  1GHI A;  1WE4 A;  3SH9 A;  4RX3 A;  3A3J A;  5DVA A;  1K54 A;  1NRF A;  3VFH A;  3Q07 A;  3G31 A;  3ZNY A;  1XP4 A;  2ZM2 A;  1MBL A;  5GHX A;  5J8X A;  4WEJ A;  4R3B A;  1LI0 A;  5CEB A;  4Q8I A;  3IF6 A;  1BUL A;  3S22 A;  3IWI A;  3M6H A;  4PM6 A;  4DXC A;  4WZ4 A;  4BEN A;  4X69 A;  5FQJ A;  2Y2I A;  1FCM A;  1PW8 A;  1L0F A;  4OOM A;  5CTM A;  1VQQ A;  2I72 A;  3BLM A;  5AQB A;  4OOY A;  4FH4 A;  1MWS A;  2P9V A;  3TOI A;  4JLF A;  3N8R A;  1L2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...