3DTNA

Crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei .
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
224
structure length
220
Chain Sequence
b'LSEIKRKFDAVSGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYPEATFTLVDMSEKMLEIAKNRFRGNLKVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFINADLVHGETAFIENLNKTIWRQYVENSGLTEEEIAAGYLDKDIEMNQQLNWLKEAGFRDVSCIYKYYQFAVMFGRKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Methyltransferase MM_2633
publication title Crystal structure of putative Methyltransferase-MM_2633 from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 80
structure length 220
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dtnA01
4QVGA 2XYVA 3OE5A 5DWQA 5F2KA 1V39A 5GP1A 3NDJA 3REOA 3WSTA 4KVZA 1X19A 4GUAA 2XBMA 1TW2A 1NW5A 4PWYA 3R9XB 4RTRA 1XDSA 1VL5A 2AN5A 1QZZA 4OQDA 4X61A 5DTRA 2IDJA 1SG9A 5FULA 3NVMB 2ZZNA 1N7JA 5EZSA 5E9JA 2FHPA 3G89A 1XVAA 3ANXA 4YUYA 1Y8CA 3HVHA 4JXJA 4QQNA 5HOQA 2P1DA 2B78A 5K0FA 1G55A 4XUDA 1JG4A 3TM5A 4K6MA 1BC5A 1JG3A 3OU6A 4YUZA 3DXZA 1L3CA 3UFBA 2OYRA 4GOND 3UJ9A 2YXDA 4BP3A 4PGHA 4H0NA 4YV0A 4QTUB 2PV0A 1ORHA 2ZSUA 4FSDA 5E9WA 3AXTA 5LQRA 1L3IA 4A6DA 1B42A 1EJ0A 1L1EA 3DR5A 2P3QA 2G72A 2ZZKA 1JG2A 3TLJA 3VC1A 5K05A 1P39A 4QVKA 1RJEA 2BM9A 1SKMA 3LECA 3TM4A 4ISCA 3EVZA 3P97A 3LCVB 4E70A 3D2LA 2AOTA 1G60A 3VYWA 2PJDA 3DMGA 5FQOA 2PXAA 3ME5A 1FP2A 1HNNA 3SM3A 5EGSA 1XCLA 3SSOA 2G8NA 4RTMA 2C7QA 1X1BA 1VP3A 5EMKA 1N7IA 3DH0A 3UJAA 2G1PA 2ORED 9MHTA 1VP9A 4V0RA 3SXJA 2DPMA 3CJTA 3PB3A 2BM8A 5GIOE 3Q7EA 1VE3A 3RW9A 4M37A 2BR3A 1ZGAA 4BLUA 3HNRA 5DSTA 2IBSA 4PCAA 3LDUA 1XCJA 1XDZA 3GGDA 4QPNA 3FTFA 2OXTA 5HILA 2Z6QA 5MHTA 3MGGA 5CCBA 4POOA 2ONZA 2AOWA 3CVOA 2FCAA 10MHA 4NECA 1QAOA 3I64A 5E1OA 4C03A 3FTEA 3DTNA 3FPFA 4YUVA 1DCTA 3OFKA 3LGAA 1FJXA 2FK8A 3E8SA 2YQZA 3V8VA 4EKIA 2PT9A 3ELWA 4OBWA 4Z2YA 2B3TA 3VC2A 5K0CA 1JSXA 3LCCA 2I7CA 2NXJA 3U81A 5BXYA 4RTPA 5DRYA 2H11A 3UA3A 5GM1A 5DM0A 3HA3A 5E8JA 2CL5A 3L8DA 3TKAA 3NWEA 3BXOA 3A26A 4KDCA 2UYQA 1G38A 4GQBA 4PCLA 3K6RA 1NBIA 5K09A 3ELDA 4DKJA 5EZQA 5DT2A 2QM3A 5DXAA 1KPGA 2ZBPA 5LQJA 3PTAA 2VZ9A 3DXXA 2GH1A 4CKBA 4OA5A 3AJDA 4X63A 2ZFUA 3IEIA 2I9KA 3HCFA 1D2GA 3SX0A 1G8SA 3PX2A 4EMSA 2IDKA 4HTFA 5E1BA 3BGDA 3KR0A 3UJ8A 2YXLA 2HMYB 1X1AA 5DM1A 5DX1A 5KVAA 2HV9A 3I58A 5P8WA 4M36A 3G7UA 3KQMA 3SVZA 4PGGA 2PKWA 1RJGA 5FA5A 3G2MA 2PSSA 5DTMA 2BZGA 3A27A 3GRYA 3VSEA 3NW9A 4GBED 1ZKDA 5K0EA 2P41A 3EVAA 3I9FA 3LKZA 1F38A 3P9KA 4BP1A 3FYDA 3P9IA 4BY9E 5ICCA 2ONYA 2WK1A 2IH4A 3LX6A 3KQPA 1R74A 4YMGA 4LWPA 2PBFA 4AZTA 4FZVA 3GDHA 4OX9Y 3R0QA 3C6KA 3LHDA 3A7DA 3FUWA 3PT9A 4R6XA 4Y2HA 4CTJA 4RTQA 4AZSA 2IH2A 1VLMA 3HEMA 2BH2A 3EPPA 1INLA 3EMBA 5EVJA 3HCDA 3BT7A 3PFHA 5E1MA 3NJRA 3R3HA 3GWZA 1MHTA 3MERA 2H1RA 4GF5A 3OZSA 4HGZA 4RTJA 3LCUA 1RJFA 1KYZA 3P9CA 1DL5A 3GCZA 1WS6A 1EJ6A 5K0JA 4E2YA 5LQKA 3M6UA 1YFJA 2P40A 3E05A 2AR0A 3HA5A 1NW8A 3T7TA 3QV2A 4C08A 2I6GA 2ZULA 3MTEA 3M6XA 3UJDA 5EMJA 4XCXA 3M6WA 2OPBA 5HFJA 3TOSA 1O54A 4YV2A 3TFWA 4RVHA 1QYRA 3P71T 2AOVA 2AS0A 3DUWA 2ZLBA 3KPYA 5JR3A 2PVCA 5JUWA 1FPQA 4E32A 1KIAA 4QTTB 2P3LA 4ER7A 2B25A 1KPIA 1P1CA 2O07A 2VS1A 2K4MA 2GPYA 5FUBA 2PX8A 3KU1A 2NXEA 4IV0A 4CXMA 4HC4A 5LR6A 5BW4A 4MIKA 2FYTA 4L7VA 2DULA 2HTEA 4GC5A 5E2BA 1QANA 3G5LA 2O0LA 2XVMA 3GRZA 5K0LA 2QRVA 2ZW9A 3CBGA 3HVIA 4C05A 5HEKA 4DZRA 1PRYA 1KHHA 1SUIA 2E5WA 3BWYA 5LQAA 4QPPA 3FTDA 5FHRA 5GWXA 3TR6A 2IPXA 2OO3A 3OU7A 5E9QA 3JWJA 3HTXA 3JWIA 4KRGA 2ZBRA 4AUKA 1YB2A 2ZIEA 4MQ4A 1X1DA 3EVDA 3FUTA 1I4WA 4DCGA 3R6TA 3LKDA 3B5IA 4QDJA 5EPEA 3RIEA 3FUVA 3B7PA 3GRVA 3HCCA 2BR5A 4EQZA 4DA4A 3GXOA 5CVUA 2VDWA 4PYIA 3BKWA 4RWZA 4HGYA 5GM2A 4FSXA 3A7EA 2AN4A 2P35A 4U7PB 2YVLA 3V97A 2P7HA 2ZWAA 2A14A 4FGZA 1SQFA 4KIGA 3O4FA 2IBTA 4P58A 1UIRA 4PYLA 5EEHA 5U4XA 4E2WA 4ER6A 5CM2Z 1KP9A 3HCEA 3O31A 3A25A 2FPOA 2NNWB 2JHCA 3IHTA 3KPWA 4P7GA 4RTNA 2O57A 1ZGJA 4IV8A 1D2HA 3FPHA 3G2OA 4LWOA 4CTKA 2HNKA 3JWGA 5LQUA 4CKCA 2EX4A 3NDIA 5DTQA 5CIYA 1JQEA 1WY7A 5EC8A 1O9GA 1L3BA 3B89A 3C0KA 3G88A 1R00A 4DMGA 3KPVA 5CD1A 3LSTA 5ICGA 1ZQ9A 1JR4A 2EJTA 3MB5A 4F85A 3BWBA 4R6WA 2EFJA 2F8LA 3OFJA 3O7WA 4P7KA 1SVUA 4LG1A 3ELYA 1JG1A 2Z6UA 2NP7A 3DP7A 3AWIA 4B17A 2V74B 5FCDA 1KR5A 5FHQA 2P7IA 4LECA 3KR2A 4FS8A 3UWPA 2C7PA 4PYMA 3T7SA 3KR1A 5KYGA 4CWAA 2Z6AA 3KKZA 4MTLA 3UJ7A 4R8RA 1WXWA 3OPNA 2GAFA 5EHGA 5BP7A 2ZIGA 4RVDA 2CMGA 5CVEA 2OKCA 3HM2A 1Q0TA 2IH5A 4E2ZA 4YMHA 3P2KA 3TRKA 3FUXA 1YZ3A 3G8BA 5IKMA 4RTKA 4RTSA 4QDKA 2GB4A 1R8YA 2P8JA 1EAMA 3F4KA 4FR0A 3RODA 2XYQA 2EG5A 2QE6A 5T64A 4DF3A 3KPUA 2AOUB 1BHJA 4X60A 4MHTA 3MCTA 3TPZA 3SSMA 4PYKA 4DCMA 2FK7A 5CVDA 4OBXA 5T67A 3GIWA 4PIMA 4E33A 1R6AA 2PWYA 3I5UA 2KW5A 1NW6A 2OZVA 1NBHA 1VIDA 3KQTA 4HG2A 4M7RA 4HH4A 3CKKA 4RYLA 2C7OA 2AVNA 4IWNA 3OU2A 1IM8A 2UYHA 2YUIA 5EHIA 1I1NA 1M6EX 3HVKA 2VP3A 4EKGA 1RI2A 3ELUA 4C04A 4X41A 2JJQA 3UJCA 1IY9A 3EGIA 1FP1D 3LBFA 2QYOA 3E23A 3SMQA 4RVGA 1SUSA 2P3OA 2AZTA 3OCJA 5GOZA 4AZVA 3ER9A 2QY6A 5EMMA 4F84A 1BKYA 3T0IA 2ZBQA 3FRIA 5HIIA 1R18A 1XDUA 4AZWA 5DLYA 3B3GA 3DOUA 3KQSA 5DX8A 5LSAA 5EEGA 5M5BA 3PLAE 3Q87B 1Z3CA 3B3FA 5E2AA 4XUCA 1WZNA 2PY6A 3GU3A 1YFLA 1EIZA 3UBTA 1NW7A 1RI3A 5HIJA 3THRA 5C0OE 2YXEA 4BLVA 3KQWA 3HCAA 4R8SA 3EGVA 4GOMD 1M6YA 2ADMA 3FPEA 4ER5A 1PJZA 5EOVA 2O05A 2XYRA 4KW7A 3R24A 2VDUE 5K0NA 5GINE 2PXCA 1QAMA 2Y1XA 3GNLA 1JTFA 3GJYA 3G5TA 1KXZA 5FA8A 1MJFA 3NWBA 2UZ4A 3NVKI 3PFGA 5D1NA 1U2ZA 5T6BA 1WG8A 3DLCA 2I62A 3EVEA 2NXNA 2BR4A 3LDFA 1XTPA 1ZHFA 2AOTB 5FWAA 2JHPA 2PXXA 3G2PA 3DXYA 5EQJB 4RSRA 1EG2A 2AVDA 3KHKA 2JHAA 5EIWA 1OR8A 3M6VA 1P1BA 3G2QA 1JQ3A 3LPMA 2OY0A 3ERCA 3CJQA 3JWHA 2PT6A 3CCFA 3GRUA 1VPTA 2PX5A 1R8XA 4M38A 2PWPA 3SSNA 2UYCA 5E1DA 3K0BA 3THSA 3UA4A 1L9KA 1RI1A 2HWKA 3BWCA 2C7RA 3DULA 2OB1A 1I9GA 3BGIA 3NTVA 1YF3A 2IFTA 3KQOA 2ZTHA 2N47A 5KQSA 1WXXA 2GA9A 4FT4A 7MHTA 3C3YA 3C3PA 3PX3A 5B1SA 5BW5A 4KDRA 3OZTA 1G6Q1 2IIPA 3EEYA 2CWWA 3UJ6A 2CMHA 3MHTA 2ZZMA 8MHTA 2H00A 3HA7A 3ID6C 1T43A 5F2NA 4AX8A 1AF7A 5LQNA 4RTLA 1JTEA 3UJBA 3EVGA 3LL7A 4C07A 5K01A 3M4XA 3MCZA 3FPJA 5EMLA 3UZUA 2GLUA 4WXHA 4RTOA 1RI4A 1HMYA 1XXLA 5HIKA 5E8RA 3TKYA 2GS9A 3BZBA 3QOXA 3MQ2A 5DPMA 1YZHA 1RJDA 1VBFA 1NT2A 4FP9A 3HP7A 5DX0A 4KIFA 5FQNA 4YV1A 1ZG3A 4ER0A 3GO4A 4ZTBA 3IV6A 3KQVA 4E2XA 4YUXA 3T7RA 5EIFA 2AN3A 2FRXA 4P7JA 1SQGA 2YTZA 2EJUA 5DRTA 4G56A 3TQSA 3P8ZA 2PLWA 3FZGA 3AY0A 4HTFB 2AOXA 1UFKA 1AQJA 5CCXA 3EVFA 1TW3A 2ESRA 5K0BA 2JG3A 5FWDA 4RX1A 5LQCA 4IKPA 3C6MA 5CUQA 5HIMA 3EMDA 4GOLD 4Y30A 4BLWA 1QAQA 3HCBA 4WVLA 1N2XA 1IXKA 1DUSA 2ZWVA 1NE2A 1VQ1A 4MWZA 5K0GA 3EEOA 2B2CA 4FT2A 2YR0A 5K03A 3B3JA 2R6ZA 3EVBA 5ERGB 2PX4A 4R05A 4C4AA 1M0EA 2JH8A 3A4TA 3OE4A 3P2EA 5CVVA 2ZCJA 5DM2A 4QQKA 5IH3A 4XUEA 4E31A 4O29A 2LD4A 4ER3A 4EVIA 1AV6A 4HSGA 3P9NA 4DQ0A 2UYOA 2VDVE 1UWVA 3DMHA 1JQDA 1FBNA 2ZIFA 5FADA 1KPHA 5EKXA 4RV9A 1NV8A 3EGEA 3M33A 4KWCA 5KS2A 5F2OA 4DM3A 1NW3A 3I53A 3KQQA 2O06A 3BGVA 3MTIA 5DXJA 4PONA 3H2BA 3S68A 3G8AA 3TMAA 2XVAA 5DSXA 5GIPE 1XJ5A 2B9EA 2Y1WA 2IP2A 3FTCA 5H02A 3KR9A 3DMFA 1NV9A 1X1CA 2YX1A 3E7PA 3FPGA 3KQYA 4GEKA 1ORIA 1BOOA 2WA2A 5ICFA 3LBYA 2OBFA 5CVJA 3NMUF 5FTWA 3FRHA 4V0QA 4OQEA 5K8VA 2R3SA 3P2IA 4PNEA 3PVCA 5C1IA 1O9HA 2JH9A 4F86A 4A6EA 2V7EA 3CJRA 3IYLW 1EQAA 2PX2A 2CKDA 4C06A 4YUWA 1F3LA 5D1HA 4P7FA 4PINA 3CC8A 5EG5A 4EK9A 4RVFA 1RI5A 2ZVJA 2G71A 3SR4A 3SGLA 2NP6A 1D2CA 4HRAA 1YUBA 4OA8A 3ER8A 1JSZA 3PS9A 2Q41A 4U7TB 1Q0SA 3CGGA 3HVJA 1H1DA 2NXCA 3KPJA 3BWMA 3M70A 2QRVB 3MAGA 5G02A 1NKVA 4E30A 3EVCA 4PYQA 3X0DA 4PYJA 4UOEA 2ERCA 3BUSA 3DLIA 3QOWA 4GOOD 2AOUA 3LDGA 4GC9A 2OB2A 4X1OA 2WA1A 1KYWA 4PYNA 5C9ZA 4PYOA 5KQRA 2PGXA 1TPYA 5ICEA 2HR1A 1P91A 3ORHA 2NYUA 3GRRA 5HZMA 2G70A 4PIPA 4ATNA 1AQIA 4CKEA 2IGTA 5EKUA 3BKXA 1G8AA 3FYCA 3AXSA 3OZRA 5DM4A 3FUUA
chains in the Genus database with same CATH superfamily
1IL0A 2OC9A 2YZGA 4B2LA 4DDKA 1GGKA 3DTVB 1W9MA 5C3UA 1PIWA 3SOPA 4AO8A 5D5HA 1XZNA 4DMLA 2Q8QA 1XDSA 2GD1O 1F1BA 1KAOA 1VL5A 1XLTA 2AN5A 1DLJA 2FPMA 1ESCA 2QRHA 2BFMA 3ABRB 3NVMB 3NT5A 4NE9A 1E79A 3QGMA 1RMYA 3SHTA 5BMVF 1FS4A 1QHYA 1S1CA 2BCJQ 2ZRQA 2A1UB 3JQ9C 1KEEA 4MITA 1SQ6A 1KDRA 2B78A 5C46F 4NENA 1TKCA 4L4YA 3RO7A 1W87A 2XQGA 1CE8B 3ZU5A 3L7YA 3UH1A 4IKEA 1TJ5A 3RAFC 1S8OA 3GAFA 5FAXA 4KHPB 3HM9A 4UMFA 3TE6A 3V1MA 1VI2A 2WJIA 3ADBA 2A3NA 3R7FA 1G4HA 1DEKA 1C8VB 2GLXA 4HATA 1TMKA 4NJEA 3COSA 4P0QB 2BOVA 1K27A 1ORHA 1NATA 3C7KA 1KBZA 4JLWA 1Z0FA 2EX0A 2WKWA 3EOZA 1P18A 4IIEA 3K4PA 4M2LA 5FR2A 4ZV4A 5A4AA 1XVLA 4KHZA 1SIWA 1CRPA 1QUFA 3V1TC 2XKAA 5A3RA 2MSKA 3KWFA 4RENA 1P39A 3ISVA 5EIEA 5K05A 3A0UA 1V4NA 3DLTA 3NOVA 3R6WA 5J9FA 4EGCB 2Q6KA 5TX7A 1XDGA 2PX3A 3T1OA 1JHVA 3QRWA 2CLSA 2VA8A 1OQAA 4OYYA 1NLFA 5FQOA 4KPYA 2O7QA 3GG9A 1T1EA 3IPAA 4HFJA 3AONB 3VU3A 3SVLA 4RTMA 1MQ8B 1QE5A 2WIJA 1COZA 1EFCA 1AXRA 2OXRA 4RHFA 2OFWA 2QTVB 2PSJA 4HKTA 1VL2A 1GZDA 2AXNA 4XQ9A 4MUGA 5IPFA 2AWNA 5CYGA 1P8JA 2AMJA 2Y9PB 3DAOA 4P82A 4M37A 3UQYS 1U8XX 5KYUA 3P4YA 2W9XA 5JT1A 2XUOA 3HNRA 4DDHA 2C0CA 2B8JA 4KAXA 4UBKA 3DOOA 3ITNA 4MV1A 4QLBA 1M83A 2ZWOA 3TK1A 3ZDZB 1CCWA 4NF2A 2PFGA 2OTCA 4KFCA 5EP4A 3DF7A 1L4HA 4NECA 3TI9A 4EW2A 2QX7A 2GDJA 1VJRA 2I2DA 1EXNA 3DVSX 2VFAA 2WU1A 3OT4A 1R8JA 1NBME 3SFTA 3OFKA 3WQSB 4OP3A 1JKMA 4OI1A 2FK8A 5EINA 1B73A 2Q1XA 3BMQB 3E8SA 3RJ9A 5DCUA 2FUCA 1ZMRA 2IIBA 3EUAA 2G82A 1OJLA 5JDCC 1M2VB 3IUBA 4C7VA 2YHAA 3Q15C 3TZQA 3D2BA 5G1OA 2CYBA 4WZZA 3VYUB 1NDUA 1L2TA 1YDMA 4B6JA 1ST3A 2P1RA 3QTTA 2DFPA 4TVBA 4UTRA 821PA 5HRCA 1XZQA 3CT4A 3FBWA 1KIMA 2YVAA 4JSTA 1C8BA 2ALJA 2Q45A 4UDYX 4JBLA 1NLZA 2AC7A 2QK4A 4NV1A 3M9WA 2Q07A 4MJ7A 4NCXA 1B43A 1MH1A 3IEIA 5J43A 1ONPA 2HHHB 4XWAA 3HJGA 1N8NA 3E6AA 4YGYA 1IOWA 1NM5C 1FSFA 2BKLA 1YRAA 4YRRA 5JYEA 1LBTA 3W5DA 2XA1A 3L6EA 2C9MA 2HMYB 4MEJA 5DX1A 4WINA 1KP3A 3F7OA 1R4NA 3A3KA 4LNUA 1IULA 1KI7A 2WF9A 3BIWA 4OHUA 3BK7A 3FPAA 1CS4C 3L46A 3MT0A 3EF3A 5DGXA 1IAVA 4BWYA 3MJEA 4J7XA 4JENA 3TRFA 1MEEA 2R8XA 2WW8A 2YQ5A 1RPTA 5DBFA 3ZV3A 4YRTA 2MSCB 4H7HA 1PFQA 2QVGA 4TLDA 3RFVA 1L1QA 3W04A 4QJ5A 1Z7WA 4AJJA 3JQGB 3QWFA 1Z4PX 4R84A 3WGLA 3LHDA 4YPFA 1N2IA 3ZQKA 2HMAA 4RTQA 2O6HA 4JY7A 1KE2A 3EPLA 5THQA 4OXIA 1K7EB 1U80A 1UK9A 1Y9DA 5KQGA 2QG9A 1MJNA 4RTJA 2HPVA 2BFNA 2WMYA 3PRJA 1RYZA 4I5IA 5ALEA 3D7SA 4KRYA 4FW9A 5AHOA 3OTGA 1Y33E 1DT3A 2R7NA 2X3FA 4J07A 4KK3A 3LQKA 1YFJA 3G9XA 4MWCA 4TRJA 1H5NA 1U4OA 2ETVA 4XRRA 3KZKA 4GM1A 4BB6A 2ZULA 2W8ZA 1UEIA 3M6XA 1LZKA 5EE5B 3GZ4A 4QUBA 2R7KA 3NM6B 2SICE 3E84A 1RXSA 3DUWA 4CG1A 2BI8A 3KPYA 4IX1A 2KM1A 1E32A 4RH1A 3KDPA 2CK3D 3G2JA 4YAEA 2WYIA 3LL4A 3WADA 4ER7A 3THYA 3P20A 4N18A 3TYXA 1QG4A 4GAEA 2K4MA 2QXUA 3VHQA 4BOYA 3BRSA 3W8EA 4JT8A 4TROA 2PX8A 2O9JA 4HB3A 3ZK8A 1A95A 2I2AA 2O2GA 4HEJA 4PLGA 5JXGA 3CKLA 4OSEA 2ST1A 4QG7A 5EXXA 5B6IA 2GCIA 2I6QA 2ZXFA 3G17A 1JT2A 3JU3A 4FDTA 2XVMA 2QVBA 4V0KA 1UBHS 5G3ZA 1AJEA 3EXHB 3P4XA 2POCA 2P4UA 4X54A 2FSUA 1HK7A 3DP9A 1CDOA 1YQEA 2AJ8A 3QVGA 1GZ5A 2OKGA 3I0NA 4F2DA 4UNRA 5ER6A 3JAMA 2FXIA 4B81A 1LI7A 2ISQA 1G2OA 7ABPA 3LKDA 4CL8A 1M1YE 3LY9A 4O4JF 3D6UA 4EQZA 5I45A 5DOVA 2W2OA 2XVZA 1EJBA 3BD7A 4RWZA 3RHSA 2Y3IA 4HWPA 3DAYA 4LZAA 3RVQA 4U6SA 5NULA 2NU6B 1QFJA 2ZBUA 4RVCA 1SQFA 2Z5FA 3FMFA 4EQ6A 4KWEA 3GZTB 3ZD9A 2ZE5A 4F38A 5BR4A 1TEHA 1J7KA 1U5CA 3D43A 2G67A 3L6UA 2CV1A 3F5QA 3K1AA 4LJLA 1ACLA 2HMWA 1GU7A 3ANSA 2OD2A 2PAAA 1C9JA 3KPWA 4P7GA 1QPZA 4B31A 4GVXA 5BN3B 3QVOA 4QFBA 2FKAA 4A26A 2QM8A 2A7XA 3MQFA 5D3ZA 5I4IA 3ODPA 2C5EA 1K08A 1JQEA 1WY7A 1T9CA 1AKTA 2IP4A 2GESA 3WMRA 5JD6A 1ISMA 1OGJA 1YJXA 4BX8A 1CUEA 5B6JA 4PG5A 2J4DA 2VEOA 1TIKA 3QXGA 4KV7A 2GHRA 3ELYA 1JG1A 1DU4A 4X6LA 1BU5A 1QIMA 1C4WA 2HREA 2QRJA 1QC5A 4I19A 1UPBA 1ZUWA 5IX8A 4CV1A 2IYEA 4NPCA 1NJGA 3UWPA 2B7LA 4GE0A 1MIOA 5AVQA 5JH7B 1E6LA 3Q2OA 4B3JA 4BECA 3GEMA 2KS6A 2D0PB 4ILEA 1Z0JA 2ZE8A 1J20A 5IDXA 2V7VA 3EA5A 1PU2A 1TDJA 4CV2A 2HK6A 4OGGA 1OYVA 4XE5A 1KY5A 3GJ5A 1KJ8A 4WUTA 4Q4CA 4EKYA 1LUAA 1VPWA 3D0RA 1R8QA 1JSCA 4Q19A 4BP8A 2A92A 3V3TA 2NUAB 2RK4A 2EG5A 2OO7A 4IKOA 3OZIA 4QSHA 1JLSA 1FU7A 4D0SA 1RM3A 1Z0AA 4PBSA 1QIKA 4OK5A 3F47A 4ZVVA 2ENUA 2IPAB 2NT4A 3CSUA 1QR6A 3N0RA 3NVAA 3QXJA 1OXKB 1EDDA 3IAXA 3M1AA 2QPAA 1PZFA 1VE5A 3CYFA 4NFHA 2C7OA 4TYWA 3S28A 3PVSA 2IEIA 3ISTA 4IWNA 4DUGA 4GO1A 5C8ZA 2YUIA 1SC4A 1Y7HA 2HMTA 2QTZA 1FNCA 3A1CA 4U2EA 2QVXX 4NS1A 2HC9A 3R6GA 2C9YA 5C5DA 1FP1D 3KUDA 2IYSA 1DC7A 4NOMA 3OZFA 3PI7A 4CFZA 4LPKA 3WA7A 1JFVA 2ZPTX 3H1PA 4O25A 1VE6A 3RVKA 4K1XA 2EGHA 1EXDA 2QQ0A 2DWOA 1Z4OA 3T41A 5EEGA 5E0OA 1XMPA 5TPZA 2DECA 1U4SA 1BW9A 1TCBA 2Z83A 3I8SA 1GZ7A 2FZ4A 2GBFA 2V7QD 1QIGA 3FFWA 4JJZA 5LBTA 4JI3B 1QJCA 1RI3A 4TZ0A 3GC6A 2OBNA 2UUBB 4G1BA 3HCAA 3VVMA 1XBTA 1X8XA 2DOKA 1KJNA 1E69A 1N5JA 1X6VA 2ZYRA 2QAGB 3R5FA 3M9XA 3OOWA 1ZS9A 2W48A 3Q3JB 4TUYA 1GAXA 1PTJA 5HDQA 3RSHA 3HJAA 1MJFA 3NWBA 1T8PA 2ZUDA 2XB4A 1SULA 3Q8XB 4KO4S 4P8RA 3UCFA 3L77A 4Q4JB 1OV4A 2XQVA 3F8TA 3ML1A 5PNTA 4D99A 2C2WA 2XZOA 2A6PA 2AFRA 2ZXUA 2Z3VA 5HBRA 3THOA 3M1YA 1LJ8A 3UFXB 1AVTA 2C94A 2O4UX 1E0DA 4B3MB 2JIOA 1M8FA 1ZUIA 1RZRA 1NG1A 5J4KA 3DZCA 5BUZA 1JQBA 5EIWA 4V24A 1NXWA 1YB1A 4LTDA 1H0RA 2ID4A 2IRWA 2OY0A 3GN2A 3IUNA 2X6RA 3PNMA 4P5DA 3HS3A 2JCYA 1C8LA 4R68A 1RJ9B 1YHZA 1VMAA 2WICA 2Y76A 3ABSB 3KTAA 3PUIA 1AZSC 1PEYA 3GLSA 2Q4TA 1HTBA 1EZ4A 2PO7A 3AFNA 4HH0A 4TSKA 5EUCA 2O8EA 1QO9A 2V3CC 1D1TA 5JALA 4MH0R 3X1KA 1YJAA 3ORQA 2RIPA 3ZXXA 2F2TA 2JBWA 1DX6A 1EFVB 4BQEA 1WXXA 2MSEB 3E2PA 4D8YA 1X94A 1ISJA 4JN6B 2EKQA 4HY3A 4KBYA 4BTLA 3C3PA 3O0TA 3PX3A 3DBLA 3NG1A 2YYZA 4MICA 4QYXA 2CLEB 2I3AA 4KKXB 3LT4A 5H5JA 1ZJ5A 5FORA 3R3YA 2CMHA 4QE3A 1I2ZA 3F9RA 2VQ3A 5ADUS 1ZMOA 1RYDA 5CVTA 1TQHA 1TEZA 2V8BA 2A30A 1THZA 3DNFA 1O1YA 3CX4A 5EMLA 4YR9A 1IBRA 2D1YA 5JMPA 1CFJA 2C4MA 3B8HA 1NMQA 5CURA 4N0QA 4BV3A 3PJRA 4Q4HB 3C4JA 1N4AA 3STVA 3LGSA 5JI3E 4JR0A 3B9RA 4MS4A 4BLPA 4N41A 2OCBA 3I2JA 2BSQA 2EWMA 2YY6A 1MC5A 1RT9A 4KIFA 1M0WA 2MYTA 2FF7A 3QSGA 3R9KA 1WIWA 4FYYA 3QBVA 4ISBA 1GT6A 4ALJA 1TMOA 5SZJA 3EC7A 1PL0A 3PJEA 5G40A 3TD6A 1B1CA 1UJ2A 4HTFB 1RXUA 2X2FA 3PITA 4FYMA 5T4FA 4KIWA 4C4OA 1R6DA 4FBGA 4CQMD 4BPRA 4M0LA 4EBFA 3W0LB 4FUTA 3HVRA 2QN6A 2VCHA 4M7PA 2FXVA 1E4EB 3BC1A 4O4IA 2WYUA 1WDLA 2IXBA 3ENWA 3T1QA 5ISMA 5CNJA 1P0MA 3P7MA 1DUSA 2H65A 5AVXA 4MWZA 5REQB 2WHPA 4PY2A 1CU1A 2IITA 3K70C 1BCRA 4I1OA 4UU8A 5K1ZA 2IUYA 2B1GA 3BK2A 3ROPA 1T5TA 1Q1QA 3RSCA 5B3AA 2LGJA 2JH8A 3A4TA 4TYPA 4X7PA 3NBZC 3A36A 3GLTA 2P0YA 5IH3A 5A6VA 2BFDB 4AJ4A 4BFWA 1NUPA 5KSYA 4ZZIA 3OZVA 1ZVQA 1U65A 4JX8A 1TB4A 1KO4A 4JEHA 4KR2A 4BNNA 2W6QA 3R7BA 1NV8A 1RTTA 1ZIOA 2ODNA 3L0IB 5ALIA 1XQWA 2IOQA 3I53A 4N7RA 4ZVKA 3VH1A 4C1BA 1KQ3A 1R0LA 2CHEA 1ZJWA 1EWVA 1WO8A 1BD3A 4G9EA 3UN1A 1L4BA 1Q0HA 2UVQA 1E79D 1H2WA 2VPQA 3KOYA 2ZAYA 4HGOA 4TL8A 4D6PA 2Z4SA 3KR9A 5T8KA 3RT7A 3W8NA 4GEKA 2X14A 4HO1X 2M2IA 4EW6A 2RI1A 2B1QA 3CURA 3GEBA 3PG5A 3UH0A 3P0EA 5ALTA 3BGSA 5FNVA 2CUKA 3NMUF 4BVKA 4DB2A 3WLQA 1FDVA 3OQPA 1DJMA 3C3WA 3AY6A 4AROA 1CF9A 5B1IA 1U3TA 1J0CA 2Q0QA 1CEEA 3CJRA 5ERYA 1CY4A 8GPBA 4BB0A 3W5CA 3CG4A 1RE1A 3WGOA 5ADHA 4CKZA 4JYBA 2F43A 2XMPA 4RVFA 2ZYVX 1XMQB 3WLTA 4DTCA 2IY9A 2JGMA 1H93A 3G2KA 5C4MA 4WOPA 1G2PA 2FPGA 4YDSA 1VLLA 3GEPA 3CGGA 5GONB 4RGQA 1NLMA 2C99A 3KPJA 1XMSA 4J2HA 4JMPA 1P33A 4I1PA 2Q3MA 4HNQA 1YQUA 1BZYA 4NQZA 2H07A 4NBSA 1P2UA 1CETA 4HLUC 5JO0A 4M0KA 2QN1A 3NNDA 3H99A 3BWEA 1Y6QA 3PIDA 4ID9A 1RQ2A 5HFNA 1RAAA 3ICEA 1AO3A 5DI3B 1QIIA 4OOFA 3L06A 5KVCA 1W96A 3H1FA 1B76A 3ASUA 1ETUA 1O4WA 4DYVA 4MUJA 4CEIB 3GRRA 2Y05A 2Q2VA 3JQQA 3Q8MA 1OBCA 1NFRA 5D8DA 1AH2A 5EKUA 3OMLA 4IQ4A 1MU0A 4XDYA 4IGKA 3I1IA 4TTIA 3IMCA 5IDVA 5GONF 3KTDA 4B4WA 1X19A 3BHMA 1H0KA 3JATA 2DYKA 1E1LA 1U02A 2A1TR 4UUPA 3VOBA 1P2GA 1DE0A 4X61A 4JFRA 3I2YX 4LRQA 5DK6A 5H16A 1BU8A 3ANXA 4U2CA 4AS3A 2PBZA 3DL2A 1WW8A 621PA 2IBTA 1G42A 1EESA 2GXSA 4LI0A 4M46A 4B34A 3ZG6A 4DRZA 2G07A 2PNFA 3PDIA 3DZDA 1OZFA 4MPDA 2H1HA 3IURA 1CSEE 4MZXA 3FJ1A 1KTIA 1YZQA 4FYWA 3TW6A 3VPCA 1XB2A 1U8ZA 2VUHB 3DR5A 3B1VA 2DQ4A 4RYDA 3ZZUA 1YZVA 1NHWA 3ITDA 3UWOA 3G2NA 3N28A 4WZAE 1CR6A 5IN5A 3KSUA 3QA9A 4WY8A 3V1NA 4EKNB 3N8HA 1QV9A 4KGZA 4OQNA 1M10A 2F8TA 1HZZC 3DONA 4Y2TA 2DU8A 4RXUA 4BN0A 4J49A 2ZDGA 4HOYA 5EPUA 4MARA 4EG1A 4JVNA 2KLBA 3CLUC 1ID1A 3NEJA 2JIQA 3SM3A 4RM2A 2Y0CA 3AOGA 2G8NA 4AG6A 3D9QX 3DH0A 3H2JA 3PQDA 4CCYB 1IQRA 1HT3A 4IV5A 1RXWA 2WTXA 1EG7A 2OORA 3OI7A 3AI1A 1J09A 5CA1B 5JD5A 1WU8A 1PG2A 3A4VA 4RLFA 4XOIA 4AECA 2JVIA 2J3KA 3DAPA 5KX5B 3QVWA 3GUHA 2EZTA 2H1OA 1IY2A 4S24A 4AY5A 4DDMA 3QX3A 4CU2A 1TCVA 1UOQA 1XN4A 2E82A 3BSWA 3K2EA 4MS3A 4UBIA 4UNQA 3WNQA 4POOA 2Z6QA 4GP9A 2FCAA 1NBOA 3ISJA 4RZQA 4Y7CA 5AKKA 3NRCA 3WJAA 1B4DA 1P7PA 3JQ7B 2GVDC 3MIIA 1Z2AA 4IINA 4C7XA 3DZHA 2DR2A 2WT4A 4JA2A 1YKGA 3CS3A 2WYVA 1UL1X 2VTBA 4M1YA 3N1UA 1DCTA 3H1TA 4BO8A 2XGOA 2BE7A 1KZ6A 5EYPA 2X2PA 4S35A 4JHLA 4ARBA 4TTTS 2OLKA 2YQZA 3EYWA 3VX3A 3R6DA 4D5GA 2X9LA 1DX4A 4IR7A 3WMWA 1M7GA 4WTOA 4UOZA 1A0OA 1MW8X 3U81A 1F9AA 1RRFA 1QHEA 1L9XA 2OAQ1 3IOCA 3Q8KA 3ENKA 1OLUB 2IUTA 3Q9NA 5AVSA 3BD9A 5KX5F 1JRLA 1WZEA 3LX5A 2JBHA 3I1JA 4UDNA 4XSGA 2FZCA 1GTG1 2ZGVA 4Y2SA 4YP5A 4D3DA 3LS2A 3ELDA 2GQ0A 5I5GA 3CBQA 4TSRA 2HSZA 2H4WA 1JHMA 2B36A 3OJLA 3HFGA 4MRMB 4OA5A 4TQ9A 5I7HA 5MGBA 2L42A 1ARZA 4LQDA 2I34A 4EPTA 1LFAA 2G04A 2BC9A 4NG4A 5LCXA 5HQTA 3KR0A 3UJ8A 2WV9A 2DUJA 2FX2A 4XQ0A 4LJ7A 4ARVA 3GLQA 4EHFA 2YY5A 4Y1RB 4AJ2A 2PANA 2W43A 4MRSA 3QWHA 4PGGA 1UDWA 2A9VA 3DL4A 1SXJA 5FA5A 4ZVUA 3DWFA 1U7ZA 3NW9A 1R6BX 5EWMA 2RHOA 3M9LA 1F06A 1OAAA 3FCEA 4R4JA 3N6RA 4MP6A 1WOYA 5CLGA 1HLDA 1E3MA 5A7GA 5HHTA 4LWPA 1DZ3A 1YQTA 2CWDA 5KEIA 3W6ZA 2OPHA 4R6XA 4IDOA 4L7QA 2PN1A 3CZ5A 3C1TA 1N0WA 2FPXA 1INLA 2Q3BA 4WE3A 3ZWWA 1TO1E 2DBVO 5LIPA 3BT7A 1FTNA 3U44B 3R44A 3WXMA 1KO7A 3DDSA 4ZYYA 1OLSA 4YNBA 2PZ8A 3KSRA 3CUEF 5HNKA 2VO1A 1SRRA 4GMHA 2HT1A 5A6SA 4HEHA 1SZCA 4KN6A 5EY5B 2VP0A 4YXFA 4NEQA 2HXSA 1QJ4A 4D7AA 1J99A 5BYJA 4CDMA 2Q4DA 5CXQA 3DE0X 1AGRA 1FFGA 1GQFA 1I7PA 2CFTA 3ICWA 4UDOA 2HCJB 3VH3A 3WBBA 1IHPA 2AOVA 2VL7A 3FWNA 4YEDA 3VU9A 3GDOA 3LUCA 3C1OA 1FPQA 3PFIA 1MOQA 1UMBA 4QTTB 1B15A 4DABA 1P7VA 1Y5NA 4TV8A 3OOYA 2W6JA 1IN4A 1B0UA 3BRCA 1QRRA 1NUTA 1XRJA 2OILA 2M6RA 3E4DA 4YP1A 4NOJA 1R3DA 4MIKA 2FYTA 3HK2A 5JASA 1MAAA 1YE3A 3WNDA 3KJZA 2OR3A 2IF2A 5BV7A 2W2MA 4ZYXA 2OGUA 3GZNA 3WLSA 5EJMA 3SY8A 3HUFA 3OOEA 1XYVA 1OFGA 4RHCA 3T38A 2FCRA 5DNVA 4AS1A 2CL7X 2Y68A 2ZYUX 3FIUA 4L5IA 4Y2RA 3QU4A 4Q1CA 5ULLA 3M4YA 3CHYA 2W4QA 1VBMA 3OZDA 3QLEA 2F3SA 5ALNA 1M0SA 1E5TA 1K7XB 1LPSA 1U9IC 1FDSA 1VSBA 2XUKA 3KWMA 1OPRA 5L3SB 3FCOA 3BKWA 4HGYA 4MV3A 4A2CA 4YQFA 5CFOA 2PKYX 1X7ZA 2XVYA 2O52A 1GPJA 3EPRA 1KC3A 1Z6TA 1VMKA 2CF6A 2PGDA 2Z56A 4IJVA 4AJ1A 1DJPA 1PK8A 3U3RA 1XA4A 3O31A 3QVMA 3TLMA 5DHTA 1CQWA 3RBXA 1EH5A 3ZIUA 1JHUA 3LK6A 2G08A 4CTKA 2HGSA 2XT6A 4JBWA 2QIPA 3WDKA 2Q5CA 1ZX1A 2F62A 1DUIA 2OV4A 3CPEA 4ROSA 5CITA 4Y2UA 1JEYB 2WC1A 1U0FA 4YWJA 4K05A 4MYDA 4FKMA 1HEYA 1SOUA 2AKYA 2C9BA 3GDWA 3LP5A 1GGMA 3EH1A 3R6LA 4O2AA 3ZGYA 3ZJ4A 4O8ZA 1OIXA 4A8PA 1SHLA 3W2IA 1T8YA 5TNXA 5AVWA 2WKQA 4EGJA 2B4RO 3LPAA 1XN1A 1PS0A 4PCUA 1HR0B 3KR2A 5A0TA 1W0JD 2GXQA 2QTFA 2P8SA 5H7XA 1W0KA 3G0GA 3WGNA 2C7PA 4KFTA 4PIVA 4AP9A 4KXNA 4JLNA 4MV9A 1ZJ6A 4WD3A 4JI5B 3KLNA 1GCUA 2B5VA 3RAPR 3UMCA 3WWDA 4HYEA 4G8DA 3OPNA 1E20A 4ZOLA 5EHGA 3CNOA 1AO0A 3NM5A 3Q7QA 1FA9A 3JQAB 1U6IA 3BMCA 1SZJG 5DM70 3RTBA 5JARA 1FRZA 3RFCA 1YZ3A 1EWYA 5JJLA 2AMLA 3C97A 2P8JA 3EXIB 3QBDA 3SQXA 4FWTA 1PD0A 5T64A 4HDNB 3KPUA 2FA9A 4MHTA 2QUIA 4JT4A 1RZRD 1RM4A 3PLNA 1HWYA 3DNMA 4XWGA 1M8JA 5CVDA 3W3ZB 4A92A 4FONA 1Q17A 1EFUA 1GSOA 4D4KA 1KAHA 4LRXA 3KYDB 1E3WA 3FZQA 4HG2A 1PL8A 4JITA 1L8QA 1Z56C 3Q10A 5KYWB 1SCQA 1W88B 4NCHA 1FFEA 1C2YA 4QTZA 3PQ3A 4MAFA 1KVSA 2A1IA 3TWOA 3GFPA 1TQ4A 1WAMA 4LJRA 4U2BA 1UWKA 2X13A 5B7PA 2PUTA 5EJ4A 3ZCTA 1Z7BA 2Q7XA 4MR8B 3SMQA 4BXOB 4AZVA 5D6OA 4XX1A 2LCQA 3PQ7A 4W7IA 1KI4A 4UEKA 4GI2A 1ECCA 2ZS9A 3S7TA 1U7UA 2WMDA 5HTOA 5CXUA 1NE7A 1FYVA 3HKEB 5AKEA 5LUBA 4EFKA 1DFIA 2IYYA 4MCIA 3BIXA 3B3FA 3N2YA 1IZZA 5CXSA 1O0SA 4H1UA 1EIZA 3MWFA 4U2DA 5CPBA 2W70A 4V0ME 6REQB 1EFPB 3THRA 3VA7A 4UVHA 3TS1A 5DLQC 5EQFA 4QSMA 2CD9A 3A1DA 4Z9FA 1GGEA 2BZ0A 3VJMA 4AY3A 4ENQA 5MFPA 5KO2A 2CXHA 2G5CA 1XEWX 2WB4A 3ILXA 3NUZA 4K81B 5TGTA 1S2LA 2QJOA 1PNVA 2WVHA 1E0JA 3EY4A 2OBXA 2HFKA 4FFWA 1W30A 2FFAA 2FW9A 5JEDA 1J0BA 5BV0A 2P77A 4JR1A 1XYYA 3PFGA 2O8CB 3DMPA 1AKQA 4KE7A 3FF1A 3OQOA 3CQ9A 4FN5A 5F9HA 1G7CA 2CVFA 2JFXA 3RABA 1IWBB 4IMRA 1L7EA 4ZCLA 1GKKA 1V6SA 2XT9A 4FM9A 3I8XA 3T3DA 3A6JA 4MHSA 4F2PA 3U7FB 3MLBA 3RC1A 3Q8LA 2H4ZA 2Q5JA 4QZVA 1EP9A 1QX4A 3L7AA 2YIJA 1X14A 4MA5A 4K7JA 1KMQA 2NSDA 2VRWA 1EU1A 4NULA 5DF1A 1H23A 5FPTA 2YFHA 2GUWA 4IS3A 1ADFA 1W48A 1KERA 2IE0A 2J1LA 3N53A 4GGMX 3VR4A 1PT7A 5ILQA 3JCZA 1Y8QB 5EZYA 5JNWA 3V2UA 2G5GX 2EBFX 1PCXA 3OZTA 4NAUA 3P9PA 4TT3D 2P62A 5E6RA 4TTPA 3ENZA 3AQ4A 3IQFA 3ID6C 1T43A 1K3TA 2CB0A 2G4VA 4HUJA 3TW8B 5ALUA 4DJEC 5F2NA 5KOJB 4LA4A 4LJ5A 3DOIA 2EIXA 5HJ2A 3VZBA 4HH1A 1GUFA 1IMJA 3FPJA 3ZLJA 1EE9A 1WMBA 1PKEA 4RTOA 1RI4A 2XRYA 2VWHA 2RGBA 3NALA 2WJZB 5EWLA 3DB1A 1OU0A 4ZVTA 2FZVA 4F9FA 5DNUA 1M5TA 2PMKA 1TO6A 3AEXA 3BZBA 3I6IA 2UVDA 3A6LA 3QOXA 3ZVRA 5AW8A 2J9YB 1ZG3A 1LCIA 5CBPB 4IHJB 3CZAA 3BWVA 3IAUA 5AOCA 4DY6A 4MRPA 1SH7A 5KAMA 2C7GA 3TR5A 3EW7A 3ZYCA 3BSYA 4BN5A 4P7JA 3GAMA 3ZCRA 3DE7X 3P8ZA 1EXMA 1UBFA 4X3OA 1VHWA 3DE2X 2JGEA 3EXEA 4B32A 4ABYA 4BVJA 4WXMA 2AOXA 5ITZB 4R01A 1THMA 3BSFA 3AR7A 1MV8A 4LNAA 4CEHA 2OV6A 1WZCA 3VR4H 2OXFA 1TZBA 4ND8B 1N1GA 5AK0A 3LKBA 4ES6A 3KQLA 3ND7A 4LYHA 4CNQA 4ZIRB 1AQ6A 2O50A 4D3YA 2Q6IA 4C9BA 2JL1A 4IHJF 4BLRA 1Z06A 5K03A 1RZVA 1K88A 3TTUA 2X8JB 4R05A 2YINC 4J91A 3KOOA 4A16A 3EFOA 3HDHA 5DFAA 3CPSA 4CZ2A 4US2R 4DV0B 4GPZA 3TQCA 1YCHA 1G20A 1DWQA 1QS0B 4LMRA 4JD5A 2JS7A 1G8KA 2FPKA 3P9NA 5HQJA 2UYOA 1F2TA 3BILA 1QV6A 2ZJAA 4IUCS 4JQCA 3MMSA 2W6NA 4XWYA 4C22A 1T9AA 5IHPA 3E0XA 2P69A 4Q93A 3B36A 1OOEA 2IHTA 2WTMA 1NI4A 3H9QA 3GLRA 2GM5A 3INGA 3MT8A 4KSBA 1UKYA 4I7EA 4LGYA 4C0LA 2XVAA 1YS2X 1Y7IA 3NAQA 3U1TA 2GLTA 5GIPE 4EOGA 5H02A 1CPYA 1F20A 3KWLA 3WYDA 2HRRA 2I1QA 3ZS8A 5AXBA 4QM7A 1MO5A 4ND3A 4B2YA 3ZDQA 4MP3A 3TJRA 3IPRA 4IY1A 5H59A 1Y8RB 4IG4A 3W5IA 1A8PA 5EJ5A 3PX7A 1P80A 3EQ6A 5IP5A 4Q4LA 3RADC 4YUWA 1XIVA 1ZRSA 3N07A 4BO4A 5B3KA 3JZAA 2VF8A 3CC8A 5IXJA 1NZDA 2FR8C 4FEGA 4JYAB 4ODIA 3K8YA 2BGWA 4UTPA 2IPLA 1JSZA 8ADHA 4EKEA 1E6KA 4IXMA 4C6TA 3FFTA 1N7HA 5BR7A 3EVCA 3D5QA 2FHSA 2HQSA 1QP0A 2AF4C 5SZKB 4MS1B 2GEJA 3U4CA 3GFBA 4E94A 1SO8A 2VXOA 2OB2A 4EUKA 4NCKA 4OHOA 3PEFA 1KRXA 4Z49A 3P0JA 1IHOA 3OUUA 3RS9A 1H9CA 1CRLA 1P77A 4J0QA 2OCDA 1RHUA 2OSVA 4U3JA 5I7FA 3RARA 5JJCA 1F0KA 2LUOA 4KQIA 3DTVD 3I12A 4PIPA 5JS1A 4RFLA 2GHQA 3LQ1A 4BJ3A 2CNDA 2YJTD 4QVGA 4RK7A 4EVSA 4WA7A 5DWQA 1R37A 3TI7A 2V6JA 4Q47A 1PZEA 2YKGA 5JCOA 2VSQA 3C39A 3TCNA 1JVSA 1L8LA 1EFLA 5HCUA 3F97A 2J3HA 2FPPB 4LDPA 1ABFA 3L8ZA 4XLTA 3IVCA 2VP9A 3G8DA 1XGKA 2W93A 5DTRA 5IMBA 3ACCA 4UUAA 2BJHA 2FHPA 3T0GA 2PX6A 3O4HA 1XVAA 1F6BA 1G8FA 3RAGA 4JNKA 1UFQA 1E2FA 2SKDA 3W6NA 4KR6A 3PKZA 5BT8A 1G55A 3UT6A 3H5OA 2GM3A 1P7YA 5CT9A 2JJYA 4ZOCA 4RVSA 3PUZA 2BSAA 2YWDA 4TKLA 3GAAA 3IRUA 2Z2JA 4HAVA 4RFVA 1V16B 3UFBA 3VDNB 3N0TA 2W58A 2PL3A 4JQOA 4XFDA 1S3IA 3I28A 2WAYA 5CGQB 1P0IA 2HRDA 4ZDIA 4QECA 3L8MA 5DISB 1L4MA 2RG1A 4MKIA 4KQ6A 3ZTYA 3P2JA 3GPIA 5TF4A 2NVOA 1SD1A 1WXEA 3AXTA 4LYFA 3TMKA 5B1EA 2NYVA 4K2HA 4CM4B 4R0NA 5E7JA 2HJWA 2DWCA 2WT9A 2Z43A 3G5MA 3OHMA 3M6FA 1GDTA 2TMDA 2RKBA 1HE8B 3KXPA 5JJKA 3FLMA 3F3MA 1HSZA 1N6KA 2UZAA 2PEYA 2YN2A 4WESA 1IJBA 3O4RA 4Z86A 2MSWA 1E89A 2QZSA 4J7UA 4X84A 1KZYC 1K66A 3PA6A 4YAWA 2HSEA 5BNWA 5ICMA 1RHMA 1VP3A 2YJ5A 4G36A 1K5DA 3LA8A 2G1PA 2BBTA 2XDAA 3BTVA 1SXJD 3EGDA 4GMXA 2X0DA 5KJ1A 3GR6A 1DC8A 1PW7A 2PH1A 1QIDA 1D6SA 1Y3FE 1GTRA 2A9RA 1ZGAA 3IPXA 1ZYUA 2DKFA 4PCAA 2O3JA 1M67A 1RCUA 2V8OA 2P67A 1R6XA 3MCAA 1Y80A 1ZWLA 1MJGA 2PUEA 3A58B 2PA0A 1JAYA 3GP5A 3IE0A 1JFTA 3L1KA 5EA2A 3IUEA 5K99A 4GXNA 4B75A 3T3IA 2PGIA 4YUVA 4BMCA 5T3UA 4KREA 5HIAA 2ZQZA 4DWVA 2Z8YA 2JAPA 3LGAA 2ZU6A 4B76A 4U0KA 1Y1PA 2X77A 1RYHA 4V39A 1M73E 4IDQA 1I3CA 1N3IA 1YR2A 2CXOA 3GK3A 3K96A 4K1LA 4FX2A 3HRKA 2QDXA 1KDTA 5TMEA 3IE1A 1JSXA 2X5XA 1XKTA 1PE0A 2Z4RA 3KYCB 2WHEA 2ZTUA 3KOUA 5JZMA 3ZH9B 2WF7A 3ESYA 4Y6RA 3VR6A 1E63A 2YRWA 4LE2A 2GXAA 1QH1A 3TKAA 3A4MA 2BCGY 3VVCA 2NVUA 1W2WB 1P3DA 3BZWA 4C0WA 3DAHA 1ICIA 2YMLA 3NJ4A 5K09A 4LF7B 2QM3A 3QEMA 2VZ9A 5AW5A 1T10A 2BBOA 2W6JD 2R4QA 4QUDA 5JBIA 2ZFUA 3RV4A 4K6OA 2B8TA 1LDBA 2C07A 5THXA 1H5QA 4OUDB 3MBOA 2HWWA 1Y3DE 4X1YB 5E1BA 2GGSA 4UTOA 4CTOA 2K2WA 5CT5A 5CPFA 3DBVO 2YXLA 3R7DA 3RC9A 4G4GA 5CFLA 5JCPA 2Z58A 2R1VA 3IESA 1N5LA 3W4KA 2C4KA 5CB6A 4RJIA 1EGAA 1SCDA 5DTMA 2JKYA 2RI6A 4YMLA 2XKBA 2Z08A 2H85A 1FU4A 4OQZA 3WMGA 2P6PA 1CVIA 3FYDA 3P9IA 1AQUA 1WVGA 1MG0A 4M1ZA 4TWAA 4JKOA 3S1AB 4BUJA 5FBZA 3RVPA 5EIBC 3Q3GE 1P45A 2EJBA 3O83A 2G5TA 2QTHA 3HEMA 1U0NA 4R8VA 1EWTA 2XE4A 3R3ZA 3WKCA 1EWKA 1NBMA 2FFJA 4NBVA 3W90A 4N39A 3VR6H 3PRKE 3WHIA 3ZK9A 5JMWA 2RHCA 1M34B 4GP7A 3KKMA 4JLJA 2XXAB 2JARA 5JXHA 5EWJA 1NQTA 3COVA 2ZI5A 2HRQA 4E2YA 1WMFA 2BKUA 4AF7A 2O6LA 4KUHA 2COEA 4TRMA 3BB3A 4RCZA 2ID7A 3QV2A 4QDTA 2FMUA 2H92A 4RLSA 5JVDA 2HB6A 1YTUA 1NP6A 4TOIA 4E5SA 3O3OB 1Q3TA 4JB8A 4RPIA 4D42A 4JK3A 4ALNA 3KHSA 1SBHA 2HHAA 5EXDA 3D3EA 2AS0A 5LYJB 1T24A 5JUWA 3OP1A 2REQB 4BO2A 3O8CA 3H65A 4QNRA 4AP5A 4E32A 4NYIQ 2G09A 4Q5IA 1PYGA 1LNZA 3HDQA 1RXVA 2AFIE 1AS3A 1FNNA 1Q77A 3G2IA 2ZDQA 1TUBA 3O2QB 3QEBZ 2ZP1A 3NBMA 3AHEA 3L0PA 4CL2A 3ABQB 4TXMA 1P0CA 2VJLA 3AHFA 1I14A 4L7VA 3AR6A 5DP1A 4IRXA 5E2BA 1EX1A 5GADl 3G5LA 4GQAA 1G3UA 1MAUA 1W9HA 2O3UA 3DPSA 2BLLA 3GRZA 1JT9A 3L7MA 4I1RA 5FLYA 4DZRA 2FF5A 3QF4A 2V59A 5IMSA 2JAOA 5LYJF 1YS4A 4HJRA 1NTRA 1M8GA 2VPWA 4CMIB 1K98A 3EVDA 5H8WA 3W06A 3DOFA 5EPEA 4Q9KA 2HQBA 5BQ3A 1V41E 1C7EA 3JVUA 1D4FA 4OGKA 4BNZA 2I1WA 2VDWA 2ACEA 3AEQB 4EH1A 4GIBA 4LDZA 2ONJA 3RS7A 4B4KA 4E6PA 3I9JA 3R0IA 1XA0A 4PZDA 3GLUA 4ZAVA 4H35A 1KOGA 5AI5A 1J0XO 3L7NA 1AUVA 1U8EA 3Q9SA 3DT8A 5G53C 1BS9A 4C7KA 4RSMA 4EI9A 2BP7B 5E6SB 3CF6R 4LVNA 1M7HA 1AOXA 3A6ZA 3H4MA 3L6OO 4FCCA 4O0MA 3BF8A 3GJ4A 3OT5A 3QWBA 4RGYA 4W9NA 3UXMA 3I9LA 3NANA 2JIDA 1GN8A 1J8YF 4YRPA 3YASA 3SNKA 2RC5A 1WUTA 1K2WA 2FQQA 4U7GA 2QMEA 4YY3B 3EX7C 4B3TB 1QP8A 3H5NA 4E5PA 2J5RA 1T9HA 4DQUA 3WIDA 3CONA 4G5FA 1YL7A 4B17A 3OTWA 1CHNA 2FGJA 2IHNA 4W6ZA 2FPLA 3QPUA 2CBXA 4Y9RA 5DMXA 4PYMA 1TNDA 4DIMA 3L6CA 2BLNA 3R7NA 4OL0A 3PEUA 4R8RA 1UMCA 1URPA 5THKA 3LAWA 4Q7EA 5CB4A 3M3HA 5JZBA 3EB9A 4RTKA 1DQPA 5IKMA 2OMKA 4RE5A 4C01A 1R8YA 5KKCA 1M1YA 1YACA 1EAMA 1OBVA 4ZYLA 4HAOA 2PGJA 4GR4A 2YFKA 4DV6B 1E99A 3WK5A 5EL0A 4YWHA 3A32A 2XQKA 3X1WA 4H3KB 4KQ2A 2J8ZA 4LYEA 2OZKA 3O91A 3NTXA 4DCMA 2BGRA 3GIWA 2FEXA 4AN1A 4GOXA 3ZE2B 4E09A 4E33A 3JD0A 3OFSA 5IVHA 1NW6A 3P0HA 4ZCTA 4C76A 2OBLA 1HSOA 3CR7A 4TRNA 4BPBA 5LJIA 1CIPA 3FYUB 3CH7A 4JVMA 5HUJA 4KGDA 2Q46A 2Y4NA 3P26A 4HGRA 4M6WB 4A8TA 3EPHA 3PNBA 3E18A 4M54A 1F2DA 4S1VA 2PFKA 1KH3A 3N2KA 3VR4D 4MUAA 1GYPA 4C0XA 2OUIA 3D6AA 3CUVA 3EDRA 1M2HA 3IVAA 2E5FA 3L4BA 4JOBA 4JJFA 4QNNA 4UFNA 5LD2B 3N8KA 1YIOA 2EP7A 4JYZA 4WXPA 2ZI4A 5BSKA 5LNK6 5TDHA 1KI8A 4HAZA 3CH4B 3NHYA 5DYGA 3TNFA 4KR7A 2CVPA 1ADGA 2BGIA 3CZQA 1NWHA 3MJHA 2BKXA 1LF0A 4KO1S 1W6UA 4YAGA 1GXSB 3GGGA 2M1ZA 4TQGA 4J0HA 2O54A 1XNHA 1II8A 2ZKIA 3PR2B 4H1WA 1LV7A 4KQ1A 4FLFA 1GGNA 1UBCA 4WV3A 1ILEA 2PXCA 4FNMA 4CEJB 2CJWA 1KXZA 2DVMA 3JSAA 3BE8A 5K6RA 2EBUA 3NVKI 2EL7A 4R83A 4CV3A 1Q50A 1L4FA 1U8UA 1UF9A 4IGIA 2Y66A 4UTZA 4X65B 1LSSA 4X9XA 4PHGA 4I5GA 4EJSA 4JYCA 4QAJA 3ZTWA 4NS4A 2CZGA 4GX1A 4L4RA 1UKCA 2VYVA 4MW2A 1A4IA 2JHAA 4EW1A 1OKKD 5H3LA 1SXIA 1JQ3A 1O97C 1GSIA 1WVMA 4FKZA 2E18A 4FYPA 4MROA 4QXRA 4ENRA 3JWHA 1UBGA 3UANA 2IYUA 5DTJA 2RGNA 5AM4A 2XQJA 4HWKA 1P2TA 3MSXA 3FCAA 5K8IA 1C3OB 3NTVA 1HA3A 3VX4A 2VYND 1IRIA 3CXRA 3VZDA 1DKNA 2I4NA 5I7OA 1M5UA 1FNDA 3UOGA 4YFVA 5AKZA 3GLIB 2WU8A 1Z29A 1D4AA 1KAGA 4DCCA 3AF2A 4PZ9A 1WQ1R 4BNDB 3MOIA 3GJ6A 3PKJA 4WKBA 2QG6A 1JHDA 5AW3A 5IF9A 4DLZA 1GTVA 2BFEB 4OREX 4WUVA 2VPZA 5ARDA 3TTVA 2HDNB 4IEFB 1A1SA 1VJDA 4BAUA 4F4CA 1S9HA 4OG2A 2HO4A 5HIKA 5A62A 1JEAA 1K2VN 1ORRA 4ZK6A 2HMSA 3OWXA 2NAPA 1TTQB 5HE8A 3T34A 2JVJA 1NT2A 2F9FA 3CUKA 3GRKA 1G21A 3TRHA 4OL9A 5JS7A 4F6CA 1HDYA 3GO4A 5EJGA 3MTGA 1X38A 3WWPA 1A7UA 4PFKA 4BZWA 1Z83A 3OD1A 4WBNA 4I55F 1X80A 3SJUA 1T4CB 2X2EA 3JS5A 3TQSA 1FB5A 4DBZA 1XK7A 5A05A 1RLJA 4AXXA 3CLRC 1YRQA 3F1KA 3VPSA 2JJMA 1SNYA 1EGVB 2PU7A 4G0WA 5ICSA 2JLZA 3W4IA 4H4EA 4MGHA 2CUZA 3H8WA 4FQ7A 2IUSA 1UM9B 3PDWA 1FX0B 1J07A 3QJYA 4Y30A 4BDTA 4BV8A 4CKXA 3SX4A 2WFAA 4G67A 5C5CA 4LGMA 3KIPA 2XH8A 1QIJA 1VQ1A 1ZN9A 4UVIA 4X71A 4QFDA 3B3JA 1LX7A 1XXHB 2QL6A 3ONFA 3UEOA 8ATCA 2VTKA 4C4AA 3PGA1 1Z88A 1WW3A 2R62A 4J7CA 3HV0A 1VSTA 4WY5A 4MWSA 1PAUA 5CVVA 4N6GA 5B58T 1KFCB 4IHQA 4QQKA 2ZU0C 2X6QA 5DI9A 3O3CA 3WK4A 2O1XA 3RRFA 3TEJA 4AP6A 1R0YA 2VDVE 3L01A 1JQDA 4MWEA 2C2KA 1E9DA 1M6VB 1YR3A 1KPHA 3EZ6A 3PUHA 4M1SA 4DN6A 3TDKA 4P3YA 4DUYB 2HGZA 1DO8A 2HXYA 4UXHA 3ITEA 3PC4A 1UXGA 3F4BA 3BGVA 2HIGA 1XP5A 2IZOA 4O2BA 1WXQA 1UDAA 1M2JA 3R8FA 1QPGA 4CF5A 3L0OA 4IXNA 5FI3A 4PAOA 2EJCA 1UZAA 2WJ6A 2NU9A 1CY2A 3VC1A 2W71A 1JLHA 3WY9A 4DG9A 3LBYA 3E03A 3SFZA 2G83A 3QU9A 4KO8A 5FUMA 2Q27A 3DMYA 3LX8A 4PNEA 4RGBA 5HK9A 1T4MA 4FR2A 2JH9A 3KJEA 2RBKA 3SKXA 1BHSA 4A0HA 3LTEA 4HCJA 2CKDA 1F3LA 1W0CA 1T6BY 4P7FA 4R51A 2VP2A 4Q01A 3HCNA 2G1KA 4HLDA 4PQFA 1FYWA 1O5OA 4EF5A 1TI7A 1XQ9A 3DGEC 1ISSA 2ZJFA 3JWEA 1S7GA 4EDFA 2O2SA 2N1MA 4UU7A 1JV2B 4JASB 2X7XA 2PNJA 2F55A 3AEUA 2YZMA 5LKRA 4NZPA 5K3FA 1CUUA 2BUCA 3NUGA 2QRMA 2XODA 4FXPA 2QU7A 4ZKDA 1D3AA 1T9ZA 4UU1A 1QU2A 1CQJB 4C0KA 2H54A 1HTWA 5AW1A 1KS9A 2SBTA 1CEYA 1A97A 4TSFD 4KGXA 1I5OA 3C8ZA 5HR5A 3LHSA 2OE2A 2J85A 3T3GA 2D74A 2VZ0A 4ZMBA 1N92A 2ODPA 2YY7A 5K2MA 4U7JA 3V1UA 3B3QA 2H63A 2ZAGA 5B6PA 1WLSA 3H2SA 1T13A 2H0QA 2O2JA 3FYCA 2WFLB 4LDAA 3SHWA 1RBYA 1VLJA 3FMOB 1YOVA 3FUUA 3RQSA 1CUAA 3SQWA 3K31A 1F1JA 3IAS6 4LJKA 1HFKA 1IUKA 2LZ0A 3K94A 3KZ1E 4G0XA 3P0FA 4FYKA 5BSTA 1C3LA 2BMAA 2ZJ1A 3BWDD 4UARA 2F1OA 5GY7A 3WB1A 1LNSA 3WP1B 3TIXB 4M0MA 2KE5A 4ENTA 3MT9A 3WGZA 4EYQA 3T5GA 4C5CA 1S2GA 3ZUPA 4BO3A 4KTTE 3TAXA 4F6RA 3U60B 2NGRA 3DEAA 1NL3A 1C9YA 1OTXA 3CE6A 1KVUA 1MOSA 3EQ7A 1FTGA 4LRWA 4HYYA 2GPWA 3FHOA 4KCGA 4EWLA 2I2CA 3GELA 3Q3HA 1VHTA 1XZKA 3I1FA 3GX1A 3Q85A 1SCUA 4QFCA 4X97A 1IN1A 2QM0A 4EYGA 3S4YA 1E7QA 1E8DA 3IKLA 2LCFA 1Z0DA 4JVLA 5A2QA 4G5XA 2MJLA 3KEGA 1CRQA 5IT9A 4JJEA 2Q3LA 4XJVA 2ZSUA 3GT0A 1CLUA 1QCDA 4MVJG 2GXUA 1S6YA 1E6UA 3ZY4A 1E6WA 1NUUA 4Z4QA 1JG2A 1GU1A 1U8FO 1P2DA 3MM4A 5KYTA 5FI1B 1QG0A 3FIJA 2WABA 4EHBA 2A9OA 1GDDA 1ZK3A 1MKYA 3LRPA 4BNYA 3AUFA 4DLWA 2ZM5A 4R3UC 3F0TA 4MLCA 3TZEA 1MPXA 1T1SA 4ETIA 3KC2A 1ZA2A 3AU8A 3PWKA 4Q4AA 1FP4A 1VKOA 2SKEA 3PR1A 3BCHA 2PQ0A 2C9ZA 3HUTA 4L9WA 3GDFA 4YCAA 5CD9A 1YHYA 5KOIA 3MWJA 5I7RA 4JLMA 3IOBA 4H3SA 4WKGA 4XVRA 4CR6A 3T1HB 3THXA 1C1DB 2I0FA 2MMGA 2GKSA 4DM7A 3RW9A 3MTBA 1I1HA 5KYVA 1HE5A 2IBSA 2W2KA 3ZHYA 3S1SA 4DW8A 1JHQA 3OHPA 1QLHA 1CKEA 1U0EA 3QLJA 4UFPA 1LRLA 4WCFA 2H59A 3WV5A 3ZLTA 2PT5A 2GEKA 4J6FA 2YJGA 4RU1A 4UKDA 1I24A 1JU9A 1YS9A 1QAOA 2NO1A 2OVBA 2VAMA 4Y7DA 3R9WA 3R3JA 4HMQA 4ZANA 3UMVA 2ZB2A 1N9GB 3DTNA 1I13A 2OZLA 2OBMA 3HU5A 1PTJC 4Q9HA 4TL9A 3RJ5A 3U49A 5K20A 1BHQ1 2UKDA 3U19A 1GKIA 3EZYA 1G7RA 3MWEA 1SCNE 5CBKA 2V4UA 4JUIA 3U0VA 1SUAA 1V26A 5BWOA 1B41A 5JNLA 4UMDA 1ZNYA 4EA7A 2IYFA 3AVUA 4FPXA 4UUOA 5E8JA 4I2NA 4YJ3A 1ZOLA 1BWRA 1T6YA 3MRXA 4MCJA 3AILA 2LDBA 4HDSA 4H7PA 1DC3A 3H5AA 4WZAA 2Y77A 5EZQA 2RB5A 5DXAA 4KQKA 1SOVA 4GBMA 4KWIA 4QNMA 5ALHA 3O8QA 3UK2A 5JJBA 1OH7A 3AOEA 1EEHA 3WLLA 4WXRA 1VXRA 2Q3CA 3NTRA 3EBPA 4IFEA 3SX0A 2PVSA 4YXWA 2PJRA 2H57A 2WV7A 3QOFA 5TV2A 1X1AA 4FUQA 4AQ7A 2JAHA 2ZYAA 3B1KA 1U3FA 2P2NA 2O2ZA 3N2GB 1ZD4A 2OD9A 4Y9TA 3RU7A 5AM3A 3ESBA 1RR6A 1FXUA 3PEEA 4D6XA 2I4IA 3RRMA 3DDNA 3VSEA 2FWNA 1DRUA 5LPNA 3EWSA 2HK7A 1DWOA 1TAHA 3FLEA 1KMMA 1P0PA 3C6ZA 4HF7A 4BY9E 3BJMA 1NULA 1VPDA 4M53A 5KMGA 3LO5A 1DKUA 3A9UA 4R5MA 2FWAA 4M0DA 4E7OA 2G63A 4AY6A 2ZYWX 1NYQA 2M9MA 4KEAA 3HUEA 3N3AC 2BH2A 4MRNA 1UBNA 2DWPA 5F4BA 1BEZA 3PFHA 4HZGA 1QK5A 3DBHB 1C0IA 1CERA 2W6ZA 3GRFA 2BZ1A 3MK31 3NJRA 3W1EA 1PNOA 3TZKA 1LW6E 3BK1A 1GEGA 1RJFA 1A9ZA 1U2DA 1U2GC 4G0QA 4KFUA 1JLLA 2PRKA 4OIFA 4F8EA 2XE8A 1W2GA 1H2HA 4LBZA 4EA6A 1L4UA 1M2WA 2GF9A 2I6GA 3GH1A 2A5YB 4EJ2A 3BCRA 4LVOA 5IT5A 1LDMA 3C7CB 1P2BA 1Q21A 3GUZA 4XCXA 5C3MA 3E5RA 2CXXA 3D1LA 4GMFA 4KQEA 4D8UA 2D8AA 1EUCA 2D6FA 3FNHA 1XDBA 4HUQA 4FR5A 4BQOA 5AESA 2PVCA 2HSWA 2QG4A 4IIVA 1H2RS 3ZIDA 1Y81A 3WBJA 4LJAA 4LY3A 3UC5A 2WD9A 3PRYA 4LXGA 4DM4A 3HXMA 4D4LA 1DIBA 1PZMA 1BDMA 4Y0VA 3JQFA 3QZUA 1P19A 4IIJB 5FTLA 1F14A 4YBZA 1VSQA 2CDNA 1Y34E 1P4GA 3KBOA 4DJJA 5HW0A 4DR2B 1Q1AA 4EIWA 2DULA 3NAGA 4ZO8A 3W79A 3UJNA 2IDMA 4CQMB 1O96B 2Z8ZA 4DMMA 5EUBA 2Q7OE 4FWBA 4I1SA 1CUYA 5CK5A 2JDID 3C3EA 4TLMB 3GCXA 3H6GA 3QITA 3BTSA 2QTRA 2EERA 1YB2A 2J0EA 2C9CA 2BGKA 1B16A 1Z4QA 3FUTA 1I4WA 2NZXA 2VDRB 1KAQA 4KFRA 4EX6A 2RH5A 4HZUA 4QXPA 5A3QA 1I6LA 1JFFA 2OLJA 4B33A 3I6YA 4Y2XA 3GRVA 1H6AA 3AI7A 4ZQCB 3TZLA 3BFPA 4IIJF 3GXOA 3DZ8A 1HE4A 2HCTA 1BQ4A 2R44A 4KLAA 2IZ6A 1NX6A 2BFCB 1J2EA 3A7EA 1DG1G 2P35A 3LVBA 3MQ4A 4IJUA 5T8KC 4ASUA 5D7NA 2YIVX 3SQOA 2ZK7A 2H7VA 3OLWA 5EHZA 5J23A 2GPNA 3I34X 3ZCVA 4FBLA 4RO0A 5AM2A 4GMGA 3QVUA 4C5AA 3C7AA 4JI1B 1JKXA 1NSFA 3FR8A 2F4NA 2Y1DA 3OVMA 3O3NB 5DTQA 2CD7A 3B82A 3HB9A 4ZO4A 5AFSA 3FVQA 1MXFA 1VG8A 3F6CA 4KMRA 1JE0A 4L95C 5ICGA 1ZQ9A 2DFKB 2F8LA 1WSDA 1OFHA 3ONVA 4P7KA 3K1ZA 5LQSA 3DMTA 1KOJA 2YASA 3VH4A 2W2XA 3IP5A 4L8GA 1OX5A 3PF8A 4PN3A 2C7BA 4QO7A 2I5PO 3U39A 3KJFA 2LCIA 3ZQ6A 5LMZA 3B1ZA 5C5EA 4W7SA 2YHIB 3ZHBA 4HDAA 5KYGA 3LG2A 3MGAA 4DBVO 5B58C 4B7UA 4JI0B 2JLCA 1FVXA 5HGJA 2GAFA 4PAWA 2WTNA 5GJCA 1P0FA 3LRTA 4MO2A 3SZOA 3ZKWA 1OC2A 3RJZA 2QX6A 1BIFA 3P2KA 2OA0A 3G0DA 4B3FX 1BWPA 5FA6A 1SZDA 3F4KA 5BV1A 2VJCA 1BE8A 2B2XA 3VPFA 1Q15A 5LWQA 2WE7A 2ZREA 4AULA 3N8IA 3Q41A 3OPYI 1XELA 5BSVA 3LF1A 2WIBA 2OQRA 4Q48A 4UZSA 3LBHA 5DHRA 2Z9BA 2W5UA 3GFQA 1XZBA 2OZVA 2N3ZA 4RYLA 1BE6A 5IC4A 2J07A 1P75A 2QUKA 2AVNA 4HX5A 3AL2A 1ZNWA 1JNXX 2HU8A 3AVYA 4DR5B 1JEQA 2CKMA 2EEPA 2O3SA 4W8OA 3LD9A 4H2DA 2YXBA 1GIAA 3D5EA 4X41A 1JXOA 4U6QA 5KUTA 4EI8A 1EKXA 1MTOA 3FNFA 4KIJA 4Y2JA 4DLNA 2JLXA 4EMUA 1CUSA 3H5WA 5I01A 1EXWA 1ZA1A 1EE2A 5C8YA 2UXCB 1BCSB 1K8ZB 4GW3A 2NG1A 1SG0A 2O20A 3SIPA 3PLAE 4N4AA 1QM5A 1WZNA 1EEXB 3GU3A 5AUPB 1YFLA 1KQOA 2QN2A 3H8JA 3MHPA 2Q1WA 4REQB 2VRBA 2VK1A 2YXEA 4PLYA 1CT9A 2UZ3A 4RELA 3WRXA 1XO1A 4MLPA 1QQ6A 1GM5A 1KMIY 2L17A 4QYSA 4WH0A 2HPZA 4H6VA 2VHCA 5K0SA 3GJYA 2ZIXA 2V6GA 5CT6A 1CULC 5BQFA 1ZBQA 2RSLA 5JMOA 3VNVA 1YZTA 4EPVA 5DN6A 2HY7A 1P3Y1 3SPXA 5B3LA 1N57A 4EUEA 1SXHA 3M7IA 4Q3KA 4EY6A 1PFGA 1EMDA 3DXYA 4QOGA 4FZJA 3Q6MA 4XGIA 2NSJA 1ZZGA 3BQMB 2UZ0A 4PZCA 3ULKA 3QH4A 4L0QA 4DT1B 1P9LA 4UZFA 2OQVA 3T7CA 3MRVA 1LKZA 5KVSA 3KYJB 4EFNA 1PX2A 3EDCA 2OESA 3K0BA 4GLLA 2H7XA 1OXBB 4OATA 2P9GA 4DVGA 1E7RA 2HWKA 3MFYA 1UMKA 3CF4A 4FYVA 5IDQA 3ZEIA 2FQYA 4QFMA 3DV2A 1VL6A 4J29A 4PVCA 5C52B 3RBVA 2E4AA 5KYKA 5JSUA 2BY4A 1KH2A 1HL7A 1RMTA 3MGKA 1K4MA 4NU6A 1TVKB 2H00A 3AF0A 4LSMA 4DA8A 1Q57A 2E3JA 1AF7A 4DMHA 1ZR4A 3VNBA 2XB8A 3NZEA 4V0MA 1K6EA 4C07A 4C7JA 4EENA 1TC1A 2C2MA 5TGZA 3QYJA 4LWZA 1BGVA 3OJFA 4Z5XA 2IYNA 1GNTA 4KXYA 4U9HS 2GLUA 1YZNA 1BE1A 1I0IA 4Y6QA 1EUDB 2E4XA 4S04A 3NV7A 1XXLA 4L8FA 4BFXA 2GEFA 2QSZA 3H1GA 3E35A 3ICVA 4BQNA 1BQEA 2CZCA 5CX4A 2CJYA 2ZUVA 4FEAA 4ZQBA 2VI5A 5DPMA 1RJDA 1ISGA 3K53A 5HFAA 4YQEA 1WRBA 3HP7A 3GVXA 5DBGA 1L7QA 1POWA 3D81A 4G0NA 4JXKA 2J3JA 5DNWA 3OURA 4HV4A 4KRFA 4IDCA 3MAAC 5K3DA 3R7AA 2QXYA 4ADSG 4Z1MD 5F78A 1IATA 4YJ2F 4M9QA 2EJUA 2YW2A 5BNFA 2DUUA 4ME6A 2YIMA 2IXGA 1E2EA 3LW7A 3E7FA 3TTTA 3VYSB 5CCXA 4EGFA 3Q88A 1MORA 1L5SA 2VPIA 3T3OA 3S2FA 2EEZA 5EMHA 2CEKA 4KQWA 3WFIA 1XNJA 3FPBA 1O4VA 5DBIA 2GKGA 1VLZA 3NHPA 5CUQA 5LBUA 1Z36A 3I6ZA 4ND1A 1E8MA 1T2FA 2X1HA 4GLFA 1V2HE 1W49A 4OTZA 1KSFX 3D6VA 1FVFA 1WHSA 2AFHB 3ZV6A 5KSOA 3OKFA 2Q5HA 1N0IA 3WIBA 2P2DA 2HX1A 3B1JA 3ZVMA 2XDYA 1S0UA 1YFKA 1FE8A 3CEHA 3VU1A 3TTWA 4EJ6A 1RKXA 4X45A 5A9SB 4MIOA 3DJYA 1Y3AA 5D85A 1SU8A 1T6XA 3NBAA 1RYBA 4R9VA 3F5SA 5JD3A 5IUJC 1AMUA 1WE2A 2XGSA 3CTMA 4FYJA 4KQXA 3DOEA 5CTJA 3SICE 1VTKA 1CZHA 1FZTA 1A8SA 1L5RA 1UJ5A 3LYUA 4EEXA 4DSZA 5K4GA 3ZHXA 2NUBA 2R1TA 5F2OA 3MGCA 1DQZA 2CLLB 2R9VA 3KQQA 1UPAA 2XCQA 3IJEB 4RS4A 4JUDX 2H0AA 3H2BA 5DXJA 5JLAA 3V55A 4CETA 3OZEA 4UHKA 3ROQA 2HWYA 2GEDA 3BQ9A 4MNTA 1SHKA 2OGTA 4LHZA 4Y8VA 4AICA 1XPUA 5BR8B 1T9GR 1BDBA 3FHJA 2IDZA 3IOMA 3A1NA 1NY6A 3UAZA 4D74A 3S0JA 3AG5A 3QPBA 2IK8A 2LBPA 5DHSA 5DIZA 2PGNA 1CR1A 1U2RA 3QELA 1IXRC 1PGQA 1QSGA 1IDN1 1KMHB 2FZ5A 4TXHA 4E5NA 1P5ZB 1DOZA 1N5IA 2XD4A 1OROA 5HMMA 1C81A 5FEMA 4BNXA 2PX2A 4F04A 5D01A 3R5KA 4MQEB 3BMNA 1NOJA 2H3HA 4BHTA 1Z74A 4MVJM 1S01A 3C8UA 4IRMA 2FW8A 1NNI1 1XTVA 1GCGA 3GFOA 4FFBA 1WBJB 4XGQA 2XF8A 5FWXB 4X62B 1ODTC 4UU0A 4GUDA 2VR1A 2V45A 3C6QA 2BEWA 4GOOD 1T2NA 1R1DA 1ZN8A 1AGXA 3JQCA 5E3HA 4D3SA 2WWYA 2HADA 2L0XA 4OM7A 2CLOB 3SHOA 1XZ8A 4JX9A 3AHJA 3FNIA 2VRCA 3PV0A 1IG0A 1OW3B 1DG3A 3V2GA 2FB9A 1GLGA 1QCYA 3K0CA 2H1CA 3ZI0A 1LBQA 3FCXA 1K8YB 3JALB 2C31A 1XRPA 4GBGA 2FN7A 2IOFK 4PQYA 1N6RA 3AIOA 4M98A 4QQ8A 1PYOA 4BCCA 1VKHA 4QOEA 5FTJA 3MMNA 3U6KA 3ETLA 1U28A 2BSXA 1V39A 2VT7A 1ZZEA 5GP1A 4CF3A 3QW2A 2RFLA 4G24A 2XBMA 1AM4D 3DCYA 1TECE 4H16A 4QU0A 5AM0A 1M54A 1QF7A 1NIJA 1MJHA 2JCSA 5BN4B 3WBKA 3IUYA 2JBAB 2X0NA 4OP1A 5LMCA 2G9QA 4KNYA 2VJAA 1F6DA 3D4PA 2JD0A 3HVHA 5EEHA 1OCEA 5HOQA 1MVLA 3I9NA 5J2TB 3GJ8A 3N2LA 5CMLA 5DM60 1Q1NA 4ZYVA 1H2XA 2Y67A 4OAQA 2R8EA 4K6MA 1WDTA 2WVGA 4CMEC 2QPLA 4YUZA 1OX4A 1A5AB 3EAGA 2WJYA 1G7SA 4NCIA 2ZBEA 3WB9A 1LVUA 4BV9A 1I4DD 2YXDA 4NR0A 1K63A 4PGHA 1CR2A 4ZC8A 4DIBA 4EHHA 3DKIA 1AB6A 1F8XA 1U2QA 2J3DA 3ADDA 2REOA 2DBRA 2F9MA 1IB6A 2ODWA 4MR9B 3DKRA 4OHVA 2ZZKA 2HT6A 4B8YA 4LBVA 1T3HA 2O3TA 5JV5A 4CQNA 1TQ6A 1W5AA 1A77A 3QWIA 1UDCA 1VFNA 2F3RA 3RSQA 3UK7A 5I7VA 1CIJA 2JC3A 5J2TF 1KI3A 5JNRA 1ZVMA 4BASA 4LZPA 2YZNA 1F4VA 2BHNA 3HJTA 4O4JA 4NH0A 1ZL0A 3PEVA 4E70A 1Z6YA 1FFHA 3HY6A 3EQ2A 1HOTA 4ARZA 3D1VA 3ME5A 4B73A 3UMFA 4IZOA 5CA0B 5JAHA 2C8KA 3JAKA 1QE0A 2QYHA 1KQNA 5DTEA 4CIDA 1N7IA 3UJAA 3V8RA 3AY3A 3COWA 2WT8A 1HY3A 1PYDA 3RWBA 1Z82A 1QFXA 3W5SA 1C0EA 3CJTA 1E2KA 4EY7A 5GIOE 1S2OA 2BUBA 3IIIA 4NBLA 1DC6A 4WA8A 3ORSA 1D5WA 2YHUA 2FZWA 4MWTA 7REQA 1DQYA 2DWUA 2QW1A 1VIAA 1XAHA 1XROA 3GLHE 3EXFA 5SZHB 3B48A 1CWUA 4BNFA 5F3WB 5ARBA 1OUMA 1WB5A 4CM6A 3IBTA 4YJKA 5JXIA 2Y2UA 2FSVA 3VHXA 1IFXA 2C2GA 3SZGA 4RGVA 4W5HA 2POQX 3RVOA 1AXGA 2V9CA 1CUGA 3TW0A 3MINB 4L6IA 3VC7A 5CA0F 3R77A 3UXEA 1QB8A 1DDOA 4FNGA 4S2EA 3BDIA 1HDOA 4G0YA 2G3YA 3T95A 2PT9A 2GEVA 4FD2A 1H94A 1IM5A 3V2IA 4JWKA 3EDMA 3GJTA 2H11A 3BRQA 4WEOA 3B2EA 3RYHA 2J0QA 2FZKA 1Q0PA 3V2HA 3NWEA 2XMQA 5KQPA 2CNWD 2XECA 3USZA 1XD9A 2Z57A 3DTYA 3ZPXA 1GCAA 4JLOA 5KNLA 1P31A 3SQDA 1KPGA 4IYJA 2H2DA 2X41A 4NE7A 1G6OA 3DXXA 3ESCA 4L2IA 4RD2A 1SRQA 3AJDA 4XLLA 3D7MA 4KLRA 4RACA 4B8WA 4WGGA 4LGCA 3IXLA 4BBPA 1BKSB 4J2TA 1NY5A 3NPAA 3TGWA 3K1JA 5D7BA 3OF2A 1P5JA 3DEYX 1K8RA 1KI1A 3BGDA 3LV8A 1IEXA 4MW5A 2JGAA 2QRUA 3ZXIA 1LC3A 1U1EA 3KO8A 2BTQB 3QFHA 4Q16A 3KQMA 5KU1A 1PQUA 4YMUA 2PKWA 1R64A 1HRKA 1UJ6A 3LK7A 4TKUA 2F1RA 5E3IA 1F38A 2BF7A 3TXAA 1VXOA 4G6ZA 2ONYA 2QVYX 3HWSA 1XWIA 1MG5A 2HUPA 3WIUA 1ZH6A 1R66A 4L9RA 4OKIA 4AZTA 1P2SA 1W85A 3Q1KA 1II0A 3M4ZA 4NSNA 3FUWA 3TR0A 4OX9Y 1AKRA 2GYUA 1N2OA 4LFAB 3NAZA 4PLZA 3ZH2A 3ANLA 5C35A 4PX2A 2QJRA 1E2DA 4KXUA 4BE4A 4X1IA 3L49A 3FKJA 3LLSA 3MERA 4E7PA 2BTEA 2GF0A 2VC2B 3LCUA 1D0IA 2X42A 4Z4CA 2B20A 4FW8A 1Z17A 1DL5A 1L5MA 3TLKA 1DCMA 4C2AA 4IXTA 3GP8A 5ABPA 2JZNA 1ZUNA 2Q5IA 1O9BA 2ZXEA 3TSAA 3HA5A 2V03A 3CN9A 1LLFA 1Z2CA 2H7CA 3OLVA 3QA3E 5I8ZA 4OB8A 3T7TA 5KJCA 3I8OA 3QYFA 3VR5A 1WKCA 3ZCXA 2B69A 4N7BA 5JCZA 1H8ED 3HACA 3WAJA 1PJCA 2ZUSA 2OVFA 1YBVA 4KE9A 4PRZA 5IG2A 3GA5A 3G82C 4FINA 1FNBA 1XD2B 5JDCA 3O75A 1NVVQ 1T36B 3S5JA 1OFUA 1Q5PA 2GPTA 2YWEA 2P3LA 3HKBB 1UFRA 2XF2A 2YYYA 3BL5A 3OF3A 3ROFA 4GPAA 3HKCA 4BZQA 1CG6A 1QMGA 1VE7A 2VS1A 1KIFA 3ITKA 3TRJA 1RWKA 2JI6A 5CJ2A 2NZUG 3W8FA 3WLEA 4BE9A 4N6OA 3WQBA 3DV9A 3DB2A 4NPAA 5BMOA 3RSGA 1LDNA 2CMFA 3AO0B 5HE9A 5B55A 1RP1A 2ZRHA 1SBTA 4E08A 2X23A 5HEKA 3L4KA 3BWYA 4LE1A 2X15A 4ZRDA 1XRQA 3UY4A 1NM5A 5CFNA 1EFRD 4WLOA 1RQPA 2FEOA 2GVZC 3DL0A 2PMEA 4XB2A 1PR6A 1KU6A 1Z5WA 3CB4A 4ZVRA 5J4YA 3A10A 3IQEA 1IIBA 2YWCA 3VR5H 1CVLA 1DO0A 2VSYA 3UF0A 1DXYA 5ALVA 2JIPA 3OMXA 1FVOA 1WNTA 2HAEA 3OQVA 4MOWA 1LY1A 1NJSA 1E2IA 4CG0A 2C8LA 3WGKA 1K8QA 4NICA 1KP9A 1U2EA 4GSLA 1NNLA 1RPZA 4DUZB 3COYA 4LISA 3WRVA 3PFWO 1WB4A 3AETA 2F3PA 4KLCA 1DEXA 1LPOA 2A94A 4L0DA 3G2OA 4IJ6A 3T5CA 1J2YA