3DTNA

Crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei .
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
224
structure length
220
Chain Sequence
LSEIKRKFDAVSGKYDEQRRKFIPCFDDFYGVSVSIASVDTENPDILDLGAGTGLLSAFLMEKYPEATFTLVDMSEKMLEIAKNRFRGNLKVKYIEADYSKYDFEEKYDMVVSALSIHHLEDEDKKELYKRSYSILKESGIFINADLVHGETAFIENLNKTIWRQYVENSGLTEEEIAAGYLDKDIEMNQQLNWLKEAGFRDVSCIYKYYQFAVMFGRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Methyltransferase MM_2633
publication title Crystal structure of putative Methyltransferase-MM_2633 from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 80
structure length 220
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dtnA01
4P7KA 5DX0A 1KP9A 1VPTA 4L7VA 5EKXA 1JTEA 5CCXA 3KQYA 2O07A 1R6AA 3CBGA 4GBED 4PWYA 3A4TA 1SUSA 5DPMA 4P58A 5JUWA 1N2XA 2AOUB 2P1DA 3CJTA 4OA8A 1MHTA 1ORHA 2VP3A 2F8LA 2LD4A 1OR8A 2P8JA 2PGXA 3O31A 3P97A 2XVMA 4KW7A 5EIFA 1QAOA 2OZVA 5K8VA 2P3LA 3K0BA 4LG1A 2PWYA 5E2AA 4RTPA 3TFWA 3AXSA 3E7PA 1IXKA 3I58A 3LL7A 5EOVA 7MHTA 4V0RA 3T0IA 5FULA 3MQ2A 4XUCA 3I9FA 2GLUA 3UJ6A 2FK7A 1KYZA 2NP6A 4YV1A 5CVJA 3TRKA 4FGZA 3KR1A 3PFHA 4FR0A 1NV8A 5CVEA 5HFJA 4RTSA 3FTFA 3DXYA 5P8WA 5DSTA 4DZRA 3OFJA 3SSNA 2ZZKA 3EGVA 3E23A 5IH3A 1JSXA 3G8BA 3HVKA 3H2BA 5CUQA 4AX8A 3EEOA 5EVJA 1XTPA 3HP7A 2O57A 4MWZA 2QE6A 1VE3A 4H0NA 2Q41A 1UIRA 2PX5A 1JTFA 3T7SA 4CTKA 3KR2A 4HGZA 2JJQA 2PLWA 5FTWA 3SVZA 2IDJA 5HIJA 3BGVA 2QRVA 5DTQA 2WA2A 4MIKA 2XYRA 4GQBA 2BR3A 5ICCA 5DXJA 3V97A 4GOOD 1G6Q1 2I7CA 4DMGA 4PNEA 2WA1A 4X41A 3S68A 2ZBPA 5K0EA 2VS1A 3LBFA 4E33A 1BOOA 1R74A 1UWVA 4GOND 5K0NA 2UYHA 2C7PA 1SQGA 3DOUA 2ESRA 2FK8A 2HV9A 4PGHA 5B1SA 3SSMA 3UA3A 2C7RA 5F2KA 2ZCJA 3KPVA 2ZIEA 4RTKA 2QRVB 3G5TA 3KQTA 5HIMA 3UJ9A 5KQSA 5LQNA 1JG1A 1D2GA 1L3BA 1RJEA 5GM1A 4E2ZA 4YV2A 4YUWA 4B17A 2VZ9A 2O0LA 3ELYA 3THRA 1R00A 3QOXA 2IH4A 2KW5A 2PT6A 1EAMA 3EVAA 3G88A 4U7TB 1RJFA 4YUVA 2AVDA 4AZVA 2OYRA 3A26A 3KQWA 3P71T 4GOLD 2Z6AA 5CVVA 2AR0A 3CKKA 5DXAA 3NMUF 3JWGA 2G70A 3B7PA 4GF5A 1AF7A 3GXOA 5EPEA 5DRTA 3SMQA 4MHTA 1YB2A 2UYOA 3C3YA 4PYNA 5E1MA 1NE2A 3FYDA 4KDRA 2FCAA 4X61A 2P35A 3MERA 4YUZA 4QPPA 1I1NA 1KPIA 3MHTA 2FRXA 2FYTA 2PXXA 3TMAA 4PYKA 5GIOE 8MHTA 4IV0A 2IIPA 3JWJA 4ISCA 2XBMA 2ZBRA 5BW4A 1Z3CA 3MCTA 3P9CA 3OZSA 2HMYB 3FUWA 3VC1A 2XYQA 3NJRA 5G02A 3QOWA 1WZNA 3R0QA 5GOZA 4F84A 1UFKA 5E2BA 1XCJA 1L3CA 3HM2A 3HTXA 4BLWA 4X1OA 2IH5A 3DMFA 4KIFA 5K05A 2AOVA 1JR4A 2QM3A 1XXLA 1YZ3A 4PCAA 1INLA 1AV6A 2OXTA 3LKDA 4BLVA 2NXJA 3R6TA 5E1BA 5E1DA 2ADMA 2VDUE 2BH2A 1ORIA 4AZWA 5M5BA 4WVLA 3EVCA 3ELUA 1HNNA 4Y2HA 2JH9A 4NECA 5K0JA 3C6KA 3FPJA 3UJDA 1Q0TA 4PYOA 4HC4A 2PY6A 4RVHA 2JHAA 3UBTA 4EKIA 4PYLA 3CJRA 1PRYA 5KYGA 3AJDA 3E8SA 3G5LA 4EMSA 5K0BA 5LQUA 3EGEA 3PB3A 2BM8A 2IBSA 3A7EA 4KWCA 2OB2A 3GRUA 3UJAA 4E31A 2EJTA 1AQIA 3A27A 5K03A 2P7HA 3AWIA 3HEMA 4KIGA 3K6RA 1L3IA 1KR5A 2PWPA 5BP7A 4OX9Y 3FPHA 3ER8A 1G38A 4E2XA 4CXMA 3MGGA 2H1RA 1SUIA 3LGAA 5GWXA 1G55A 2CL5A 3I64A 4KDCA 5FQNA 3A7DA 5E9JA 4E2YA 2ORED 4QTUB 4V0QA 3TKAA 1ZHFA 4RTQA 2JHPA 4CKBA 2PVCA 3OZRA 4FS8A 2IFTA 3HNRA 3B3FA 4LWOA 5C1IA 4YV0A 4HG2A 3NTVA 5DM1A 3BWCA 2G71A 4C4AA 3AY0A 3HCEA 4C08A 5BXYA 1VQ1A 1VP3A 1XDSA 4BP3A 2H00A 4BY9E 2ZIGA 2YX1A 2XYVA 1U2ZA 4DM3A 3GWZA 5EG5A 1SG9A 2YXEA 2ZFUA 2ZBQA 2ZW9A 3M6VA 1MJFA 5GIPE 2CWWA 1ZKDA 3BXOA 2CKDA 2Y1XA 4RSRA 1F3LA 1L9KA 4OBWA 1R8XA 2ZLBA 2PV0A 3PTAA 1FJXA 10MHA 4XUDA 2UYQA 2AS0A 4IV8A 2WK1A 3HVJA 4RTMA 1XJ5A 3DLCA 2C7QA 3B89A 1DUSA 2IP2A 3HA3A 2JG3A 3UZUA 5BW5A 1JG2A 1RI1A 3LBYA 2C7OA 4O29A 5K01A 1ZGAA 2ZWAA 5LQKA 1VIDA 5GP1A 5F2NA 1TW3A 5F2OA 1I9GA 3ER9A 2Y1WA 3NWBA 2IPXA 5KVAA 5DLYA 1P39A 1QANA 2PXCA 1YF3A 3Q87B 3I5UA 1NKVA 3CGGA 3OFKA 3VC2A 4PCLA 4M7RA 1JQEA 4PIPA 3SSOA 4P7GA 2AN4A 4F86A 3MCZA 2B3TA 1X1AA 2P41A 5EKUA 4QDKA 2B78A 2GPYA 2GS9A 3FTCA 1ZG3A 5GM2A 2ZVJA 9MHTA 2PBFA 1ZQ9A 4QVGA 5E9QA 2OKCA 1F38A 3OE4A 5EC8A 4HSGA 4Y30A 3DTNA 3R24A 3KQMA 2OO3A 4RX1A 1XDZA 1H1DA 1QAQA 1QYRA 1EJ6A 3KQQA 3LPMA 5DT2A 5DX1A 4ATNA 2EJUA 1DL5A 3SXJA 1NW8A 1HMYA 2JH8A 4CTJA 1SQFA 3F4KA 3EMBA 3EGIA 4OQDA 1AQJA 1RJDA 2FPOA 1EIZA 2ZTHA 3BUSA 5EZQA 3P2KA 4EK9A 1WY7A 1R18A 2VDWA 3LDFA 5EMJA 3GRVA 2OB1A 2V7EA 1YFJA 3CC8A 3E05A 4RTRA 4RYLA 4P7JA 4YMHA 2HWKA 3IYLW 3C6MA 1EJ0A 3DUWA 1KPGA 5EHGA 3THSA 3KPWA 3ELDA 1KHHA 4QPNA 5EIWA 3UJ7A 3B3JA 2OPBA 5U4XA 5HIKA 1X1BA 3KR9A 5FQOA 5IKMA 3GO4A 3TQSA 2YUIA 3WSTA 5ICGA 2O06A 4OBXA 4A6DA 2AOXA 2G1PA 2YVLA 1QAMA 3A25A 4YMGA 2EX4A 2EFJA 3P9NA 2CMGA 2PX2A 3FUUA 3UA4A 4AZTA 3DMGA 3GRRA 3KQVA 5E1OA 4CKCA 2V74B 3FRHA 1KPHA 3SR4A 3V8VA 4ER5A 4HH4A 5DTMA 5JR3A 3DXZA 1RI3A 2AOTA 3FPFA 4IKPA 1WXXA 3EPPA 4JXJA 3LCUA 5DM4A 3LECA 1Q0SA 3UWPA 3BWMA 3VSEA 4C05A 4C04A 3TR6A 1JG3A 5C9ZA 3C3PA 3BKWA 2OY0A 3SGLA 3O4FA 3DXXA 4E2WA 3HCFA 4HRAA 3JWIA 3G7UA 4A6EA 1JSZA 2IH2A 4E32A 3NWEA 3BZBA 4Z2YA 5FWAA 2NP7A 1NW5A 4UOEA 1JG4A 1Y8CA 2AOTB 1R8YA 1SKMA 3C0KA 4ER0A 4R6XA 3KPYA 5C0OE 1O9HA 4PIMA 3PLAE 3GGDA 4QTTB 2FHPA 3GCZA 4XUEA 5FCDA 4POOA 4K6MA 4BLUA 5DM2A 2ZSUA 1EQAA 3IEIA 4PYQA 3KHKA 5E8JA 5HIIA 3TLJA 4EVIA 4RTJA 4X60A 3OU7A 2UYCA 3LX6A 3HCDA 1JQDA 2AN5A 3BGDA 4ER3A 4R6WA 2B2CA 1YFLA 1N7IA 3DH0A 4PGGA 5CVUA 4DF3A 3ELWA 5KQRA 3OPNA 1B42A 2OBFA 3R9XB 4HTFA 1FP1D 3R3HA 2XVAA 4LECA 1FPQA 1NBHA 3GNLA 1WS6A 2G8NA 3MB5A 3PX3A 3NDIA 5FADA 4GOMD 4LWPA 4F85A 3O7WA 1YUBA 3EMDA 3PVCA 5DX8A 3T7RA 3TPZA 2YQZA 2R6ZA 2YXLA 4RVGA 2AZTA 4E70A 5MHTA 3KKZA 1QZZA 2GB4A 4HTFB 3GRYA 3DP7A 3BWBA 5LQJA 4M38A 4G56A 5CCBA 5EZSA 4DQ0A 2I9KA 5T67A 3GJYA 4ER7A 3ORHA 2PX4A 5E8RA 3FTEA 3REOA 4DA4A 3D2LA 3NW9A 1YZHA 3TM4A 3LDGA 3UJBA 1JQ3A 2EG5A 4P7FA 2NXCA 4DKJA 1BHJA 1XDUA 4R8SA 3NDJA 3I53A 3P2IA 1P1CA 1VLMA 2B9EA 2IGTA 4RWZA 5ICEA 4KRGA 3FRIA 3HVHA 2GAFA 3X0DA 1XCLA 4RV9A 3EVGA 3G2MA 3IHTA 4PYJA 1BKYA 4BP1A 2IBTA 2CMHA 4IWNA 2ZULA 4XCXA 3HCBA 3MAGA 1FBNA 2P3QA 4OA5A 5EMMA 1NW3A 3L8DA 3NVMB 4PINA 3IV6A 5DWQA 5FUBA 3CJQA 3FUTA 1DCTA 2R3SA 2ZZNA 3ME5A 5DSXA 5K0CA 2ONYA 3UFBA 4RVFA 5K0FA 3CVOA 3GU3A 4DCMA 2NYUA 5FWDA 2ZZMA 3MTIA 3KPUA 3LDUA 3T7TA 4AUKA 1M6YA 1O9GA 2ONZA 1NBIA 3U81A 5EMLA 1D2CA 3PT9A 4QQNA 3EVEA 1RI5A 1VL5A 4WXHA 5D1HA 5HZMA 5CIYA 4QDJA 3FTDA 5DTRA 5T64A 5K0LA 2PX8A 4GC9A 3KQSA 5FHQA 2DULA 2PSSA 3KU1A 4FSXA 4RVDA 5EQJB 1PJZA 3EVDA 2YR0A 3SM3A 1D2HA 1VBFA 1IY9A 4KVZA 2N47A 3G2OA 5CD1A 2BM9A 3M33A 3OU2A 4PONA 1XVAA 3LKZA 1RI4A 2PJDA 3HA5A 3PS9A 3FUXA 3B3GA 4FSDA 4FT2A 2ZIFA 3LSTA 5GINE 2QYOA 5FA8A 5EMKA 4MTLA 2G72A 1G60A 3ANXA 3HVIA 3OE5A 3BWYA 5LQAA 5HOQA 3G8AA 3EVFA 1WG8A 3KQPA 3AXTA 3OZTA 1V39A 2VDVE 3HCCA 1X19A 4PYIA 4FZVA 5FA5A 5ICFA 4C06A 2K4MA 3G2PA 2QY6A 1KXZA 5CM2Z 3LCVB 3KPJA 2Z6QA 3FYCA 1ZGJA 3SX0A 2JHCA 4QVKA 5K09A 3TKYA 2NNWB 2O05A 4CKEA 5D1NA 2Z6UA 4ZTBA 3LHDA 3UJCA 1P1BA 3OU6A 3EVZA 1FP2A 3FPGA 3M70A 3ID6C 1O54A 2IDKA 3GDHA 2YTZA 2PKWA 1KYWA 4DCGA 1L1EA 4MQ4A 4E30A 3NVKI 4EKGA 3PFGA 4PYMA 1M6EX 3PX2A 1N7JA 2A14A 3ERCA 1KIAA 4GEKA 5KS2A 3G2QA 3BGIA 3CCFA 5LQCA 3TOSA 2NXNA 3GRZA 3DULA 3Q7EA 1RJGA 3JWHA 4OQEA 2YXDA 2BR5A 5DM0A 3BT7A 5ERGB 2AOWA 3BKXA 3KQOA 2P3OA 4U7PB 5DRYA 2GH1A 1NV9A 1VP9A 3M6UA 5T6BA 1X1CA 1T43A 2AN3A 2UZ4A 5E9WA 3UJ8A 5CVDA 5K0GA 3FUVA 3EEYA 5FHRA 2PXAA 4C03A 1TPYA 2ERCA 3QV2A 5HEKA 2GA9A 2P40A 3M6XA 3FPEA 5HILA 4CWAA 2H11A 2P7IA 3RIEA 4M37A 2BZGA 5LR6A 1NT2A 2HR1A 3G89A 1TW2A 2BR4A 2I6GA 3OCJA 5EEHA 2ZWVA 4R8RA 1WXWA 3P9IA 2PT9A 3HA7A 3M4XA 1G8AA 1G8SA 3RW9A 3KR0A 3P9KA 1I4WA 3DR5A 5EEGA 4GUAA 1M0EA 3FZGA 4FP9A 1IM8A 4RTOA 1NW6A 1EG2A 1X1DA 3DMHA 3GIWA 4R05A 3RODA 4YUYA 4RTLA 2NXEA 3EVBA 5EHIA 3VYWA 4FT4A 2B25A 3HCAA 4ER6A 3TM5A 4X63A 2E5WA 4EQZA 3MTEA 4GC5A 3DLIA 2AVNA 2AOUA 3B5IA 3LCCA 3P8ZA 5H02A 4C07A 1BC5A 2DPMA 4YUXA 4M36A 5LQRA 1P91A 1SVUA 4QQKA 5LSAA 4RTNA 3M6WA 3P2EA 4AZSA 1NW7A 4HGYA 2HNKA 2HTEA 5EGSA 2I62A 1RI2A
chains in the Genus database with same CATH superfamily
4QXQA 1K66A 1FEZA 1S5PA 1VPTA 3HSKA 3RAFC 5C52B 3PXXA 1MDFA 5DHRA 4GBED 4ZQFA 4ZI5A 3A4TA 3BULA 5BSHA 5JUWA 2BMVA 1XP5A 2VRCA 4P80A 4RIIA 4N4AA 4WKPA 4I3GA 4JB8A 3RNLA 1OR8A 2OZVA 2BPOA 2KBFA 2FFQA 1G66A 1Q0ZA 1PQUA 3FJOA 4GE3A 5AESA 2D7DA 1IXKA 3CUUA 3WR5A 4KPYA 1P7CA 3OC6A 3A4VA 2HQSA 3ZJ5A 4CV1A 3SZLA 3MOSA 1LJLA 3MQ2A 4RHXA 3N1UA 5BUSA 2FY8A 1X7HA 4N3GA 1YHYA 1T25A 1QOZA 1HZJA 1N78A 2FK7A 2RHOA 1PJQA 3IPLA 1UDRA 4JJ6A 5CA0A 3BFXA 3GGPA 1STOA 3GEBA 3HUUA 1JKXA 4QHYA 1J8YF 1FP4B 2HK8A 4XD7D 5HFJA 4JDPA 2VPXA 3TMKA 1KI7A 1VCHA 2OAQ1 1KBQA 1QIKA 1WVMA 4RETA 3L07A 2PX0A 4QYXA 1JSXA 3E7WA 2G1AA 4NZ9A 4ESOA 5HGJA 1Y6FA 3LL4A 5LCXA 1PI3A 1ZR2A 3GA0A 4JA2A 1YH3A 3A6DA 3QBEA 1FFEA 4RIHA 3RC8A 3JQRA 4ZAWA 3VAAA 1JI0A 1WETA 3KR2A 3P7MA 3ZDDA 4JLVA 1CWUA 2IYOA 3LH5A 1DQYA 3G9UA 4WLVA 3BE8A 1H4SA 3H3JA 2V9ZA 3EN0A 4ND5A 1C4XA 1RLMA 2Y1LA 4JIGA 4RWEA 5ULLA 5DP1A 1J8FA 3P2JA 5CA0F 3BMCA 1Q83A 5A2QA 3IAFA 4JOBA 2CZCA 4MS1B 1IL0A 1BOOA 1N1MA 2YUTA 1AVTA 2H65A 3VH2A 2FZCA 2PUEA 1UJ6A 2WRZA 4O6VA 2UYHA 2X0NA 1W44A 3ZUGA 4I19A 2C95A 2SCUA 3N76A 2VSFA 3P5SA 4K9DA 4V2UA 2GBPA 3G5TA 1W4BA 3NRJA 4LMBA 4GMFA 2BHSA 1QTNA 3KJQA 2Q99A 3R20A 4BDSA 4D3FA 2V7VA 1GITA 1K7SN 4XE5A 3OPQA 1TCAA 2GWRA 5K2MA 2GEKA 3EVAA 2FWJA 2LUOA 4ZI2A 5DYIA 2VT2A 4P0QB 4W6ZA 1VG1A 4N01A 4B6FA 4JNKA 4ZRNA 3PJRA 3WLKX 5JNTA 2R1TB 5JSZB 3AI3A 5COBA 4C21A 2BBOA 2LE0A 4ZAYA 2VHZA 2XMZA 2DKNA 3C3YA 3MGBA 3QUTA 4N0QA 4UHHA 3NALA 2BMFA 4NPCA 4EJ0A 4OH1A 5M3BA 4C76A 3TN7A 1U3WA 4BMDA 4BNDB 4J43A 2H2FA 2VTEA 3GLRA 4E3WA 2YZ7A 3KXIA 1Z3CA 4W1PA 2QTVA 3MCTA 3ZCSA 5A4IS 2GTPA 3I04M 4R3NA 2J6HA 3OKPA 2RE8A 3ODPA 1T0HB 3ILYA 3OLWA 4JP5A 2G06A 5EIXA 4BLWA 2VEDA 5HQ3A 4NICA 1P8JA 1PVOA 4HDMB 1MFPA 3L2OB 1NZDA 3OHPA 4Z7QB 1OZ0A 1I1QB 2REQB 4PGAA 1P2FA 2VDUE 4MRAA 1DIHA 1HG1A 2W0MA 1W73A 3PRKE 2I66A 5FNZA 3IB3A 1L5ZA 1H2YA 5L4LA 4G0OA 3DZGA 3DMNA 2P1RA 4ENPA 3PNYA 2PKYX 2C2WA 2Z30A 2FEKA 4DLZA 1G20A 2YZ2A 2EDCA 1TL7C 2IYAA 2IBSA 2GZ1A 2BMDA 2V4UA 3A7EA 3G9TA 4KWCA 4PTYA 2O5VA 4YP1A 1DBQA 2ATEA 2O1XA 4GVLA 3W1EA 2SBTA 3HB9A 4TL7A 2Y3IA 4RFLA 2C31A 1AQ6A 3JYLA 4MV8A 1V4BA 3WLSA 2OG1A 2WYUA 3FRJA 2WT4A 1YO6A 2IHZA 3JQGA 4QXPA 2Q8NA 1CB0A 5HE9A 3HBLA 2BV3A 2Y05A 3OZ7A 3L43A 5HW0A 3HNRA 1ZN9A 3B3FA 1RHRA 2M98A 3EUEA 3MBOA 5ALKA 2X7JA 3TR5A 2QQEA 4G9BA 2CFTA 4PRZA 3L0BA 3V1LA 3WLEA 1WEKA 4IMJB 4TKZA 1S01A 2DT5A 4Z53A 1U2ZA 1WSDA 5TQ2A 3ZQ4A 1S8NA 5JFOA 1E2DA 2OFXA 3AH8A 3F3SA 1V96A 5A4JA 1B8NA 4MPPA 2Y1XA 2YY5A 2OD9A 2OHIA 3OP1A 1WMDA 4RSRA 4B6OA 1TJPB 2O2YA 2Y0PA 3O4HA 1X38A 5I5GA 1Q1GA 3U4CA 5BMVA 4GLFA 4HNUA 1XQWA 2GARA 2XA9A 5IUNC 1PEKE 3L3BA 5DTEA 3B52X 3C8DA 5JAIA 3HYCA 5K6RA 3LBYA 4CMHA 4U6NA 2DWUA 4PO1A 3RG8A 1RVV1 3ZN2A 4N7MA 2MR6A 1AF4A 1EUCB 4N0PA 3ER9A 4QATA 3OPVA 4WINA 3R8FA 4CMGA 1QANA 1GZ6A 1ORVA 3I5UA 3KT8A 5K3OA 1C7IA 3A06A 3BMQB 4HX2A 1U4OA 2I3GA 2J31A 5K8JB 2WKRA 4L0QA 4XD2A 4DA6A 4CEJA 3GT0A 2FP3A 3NANA 5IAEA 4LUCA 2B3TA 2KX7A 2QORA 4OF4A 5EKUA 1KF0A 4J29A 5CYPA 3LZDA 2B78A 1EVKA 2CUNA 5BMVF 3WNQA 3H0EA 4QECA 3K70B 4JY7A 1F38A 2Q5QA 3Q8WA 3CVUA 1ADBA 5D01A 3L7NA 2XJ4A 3GZTB 3OBIA 3V4LA 2C99A 3VHXA 1D4FA 1QAQA 2FZLA 3LPMA 2FFJA 3SXJA 2WUWE 4YI5A 2IYRA 3O2NA 5I51A 2I0FA 1BE8A 1JAXA 1QTIA 3RFUA 3P32A 3TNYA 1FFGA 1RJDA 3L0DA 4G5FA 1G5IA 2ZTHA 3BUSA 5JAUA 5KIAA 2HC9A 3AZPA 1ETUA 4OB8A 5FNVA 3THYA 2VXOA 3DBIA 1DHTA 3R3JA 1KAMA 4LTDA 4Z7JA 1N4DA 4JJ4A 1RMQA 3AKZA 1SOUA 2UXDB 2DR0A 2GBLC 2QU8A 1AMNA 3IIJA 2HMAA 5U4XA 1YASA 2JVKA 1AUQA 3DLTA 3V2UA 4HN2A 5FBLB 3DM5A 5YASA 4G8JA 1ILWA 3JD0A 5T41A 1X15A 1XTVA 4OM8A 1U9IA 3PDWA 4C4PA 2R8YA 5A6SA 3A25A 4ZICA 1AZSC 5IK2D 5K45A 4RENA 3WL5A 2W2NA 1CRPA 1BE6A 1QOQB 1T8SA 1TB4A 4X8LA 1NQXA 4IQ8A 4WBNB 2GLXA 3MCVA 2AT1A 3IUQA 4Z9AA 1EIWA 1QPZA 3M5WA 3AP1A 4PU0A 5FNVF 2RIPA 4OHMA 3DXZA 4IKPA 1N25A 4IPTA 5FBHA 2QAGA 3EPPA 4JXJA 1IJBA 3C41J 2N1BA 4IDOA 1M9NA 1GIAA 1QBKC 4G1BA 3CO5A 1MA3A 3OT5A 1Q3KA 2K7FA 1PGQA 2B1GA 5BSWA 3TD6A 4A6EA 3M3HA 3MCWA 2ZBGA 2BGNA 3HJTA 1PT9A 2O2CA 1KVTA 4R31A 3VR6H 1H2BA 1RLTA 4WL0A 4AQ7A 4BMSA 1RKQA 3I9LA 4D3DA 1G20E 3C0KA 3O38A 8ATCA 4L72A 1U7DA 2C29D 5DCUA 4AWAA 2E5FA 2IE8A 4UAUA 1XMQB 4EA6A 2FHPA 1W85B 1M2WA 5IX8A 4A5OA 1YQTA 4B3FX 5JDIA 1L6RA 2J7PD 1VL6A 4ER3A 5AI4A 3IP9A 2FZEA 3E9NA 5AQ1A 5IDWA 3PD0A 5AW9A 1X8XA 1XZJA 2A88A 2R7LA 2ZXEA 3DNMA 1L8LA 4GPZA 1B42A 2BLNA 4MA4A 4UBJA 5LMZA 2GEBA 2CNBA 4XZ3A 4HTFA 1WA5A 4ARIA 3F8TA 4PAWA 1TYBE 3WRYC 4AYTA 2JGMA 2V9CA 1AQYA 4IJVA 2X42A 2G8NA 4W5HA 2D74A 3PIIA 1E8NA 3QPWA 4M22A 5J40A 3I92A 2G9ZA 4Q9IA 2W98A 3O7WA 3EMDA 2QSJA 3PVCA 4A0FA 3JAMA 4HLUC 5LDGA 1OYVA 4QULA 3SJZA 2R6ZA 3L46A 4F5YA 3E70C 3AVVA 1ONPA 1LJUA 3N2LA 3IV9A 4NU6A 3CPJB 3RHZA 5BV0A 1Z2DA 1QVAA 1TAGA 2V45A 2G3YA 5TE9A 4DC9A 4MINA 3E3OA 1X3SA 3QF4B 3D2LA 4ISBA 2QE7D 2DAPA 2VPIA 2O2EA 4PZEA 2OQVA 3ZV3A 2R00C 1Y1RA 3SXUB 1KKLA 1XZIA 3L0YA 4HRXA 4NHOA 4AICA 1RZVA 3TSAA 1C2TA 4CV3A 2OWEA 1P6UA 1BWRA 4TWIA 4UU8A 4I3HA 3L8EA 4LE0A 1R4AA 1P1CA 4FFOA 3K31A 2RIRA 2PBLA 4R2JA 5ICEA 1PD1A 4MVWA 3ENWA 4OGLA 2RCNA 3PA6A 2K7ZA 1RM5A 1V47A 1B1CA 4XEUA 1BZYA 4IRXA 1ATZA 1T5OA 2UUBB 5BW6B 3ZX4A 2B5VA 2BVNA 2QN3A 4RPLA 4WN3A 1V37A 7MDHA 5ELLA 1CZHA 4NEGA 4CUZA 2QUKA 1SRRA 1DCTA 4DHWA 3WKBA 4EDFA 1UMBA 1MP0A 1T2UA 4RHEA 5DSXA 3TK1A 1DKNA 1TM1E 1VMAA 3AETA 4MDHA 2CEAA 5D87A 4OJYA 5SZHB 2P2NA 1BMQA 5HTOA 1USGA 5EMHA 3GU3A 4FHFA 4AY4A 1T8PA 3BTOA 4CLEA 1EVZA 3ZCPA 2QTLA 4D4JA 1KERA 4HDRA 4NJEB 1SOVA 1KYTA 3PUHA 1YJBA 2R11A 3QMWA 1A1SA 1EX9A 2RH4A 2X6TA 1D2CA 2IHTA 3OZXA 1MOSA 4IOLA 2R6DA 4OHFA 3SC4A 3JQFA 1EHCA 3SHOA 4LJKA 4OMFG 4DR3B 1RM0A 1CKEA 1RCTE 3BH6A 3MWLA 1GQRA 1T15A 3I61A 2G5PA 2HA3A 1G5RA 4NARA 5LMNB 1RHJA 4XTCS 3BMNB 1HGXA 1QFSA 3G2IA 1QUFA 3HHPA 4CKYA 1FTYA 1L7DA 3D6AA 1ZGBA 3VOSA 1YNOA 2I2FA 1XVAA 3ZE0B 1HYHA 4ARVA 4PX2A 1RT9A 1GU0A 1PK7A 1ZK3A 4NE9A 1NVUQ 1W36B 1KXJA 4YAUA 2FNAA 2D1RA 1PGOA 1WE2A 2DBVO 3PNBA 2DH6A 3B36A 1SKYE 3LPDA 4ODIA 1U1GA 2OWDA 5T6MA 3MZ0A 3MNFA 1AUPA 3JVIA 4AYWA 3Q40A 1L2TA 5HDQA 3GLFB 3DHEA 2QY6A 1YBVA 2DBRA 4RV4A 1L4UA 3MXTA 4C4YA 4CZ2A 1CDOA 2B3DA 2X0KA 2X76A 1FRQA 3PRHA 4MR8B 1XMJA 4S1OA 3TKYA 1AKNA 4CKEA 5FFMA 1XQXA 2ZR7A 3OIGA 2OK8A 3QNUA 3NRCA 4G65A 4U6QA 3T6KA 3OOWA 3LHDA 1HYBA 2CJFA 3DVAB 1E2PA 3LT1A 5ALUA 5TDHA 4CYMA 2WAYA 2WU3A 2YOFA 1VL2A 5EYPA 2IZ5A 3CMCO 3VNBA 2W6PA 4JUFA 3DZJA 4RBNA 3PFNA 3W3AD 3ZDXB 4PZCA 3WY9A 3PFBA 3BJRA 4TKUB 1CEYA 4G5RA 5CTJA 3PFGA 4EKGA 2DXIA 1WDKA 4XSHA 4L51A 1QM5A 4ZCIA 2IOQA 3CIFA 2QR3A 3G2QA 4AN4A 2R0QC 1Z63A 4LZZA 2FSIA 3DULA 1NM5A 2PANA 2RGUA 1FPMA 1BS2A 3JWHA 4N3BA 4XJSA 4GWLA 2EBUA 5CHEA 1IUNA 5DM0A 2ORVA 4AN0A 4B6QA 1U8CB 5LIPA 2YMMA 5A0TA 2Q5IA 2V7WA 1NV9A 1VP9A 3OD1A 2GHRA 2HEGA 1LPBB 1LK5A 1Z73A 1M74A 1O6ZA 1QQTA 2UUPA 4KBGA 4KPUB 4V0SA 4WZZA 2BYTA 5FOQA 2PXAA 4EZBA 2DQZA 2VT6A 1YZQA 1E1RA 4J76A 4ZVOA 5BVHB 1ZO8A 6ADHA 1XA4A 3KZVA 5T4FA 2VP9A 2XAUA 3GMDA 4P81A 2P30A 5HS6A 4BBJA 4QOSA 1LLDA 1ZKMA 2AG8A 2OO7A 2WNSA 2BR4A 2DBZA 5DYGA 2ZWVA 2IU6A 1OIWA 3D4NA 3P2YA 3RVJA 2VHQA 2WJGA 1E5LA 1SELA 3GLUA 5CXXA 3J81k 1GTSA 1E1DA 1EFVB 1O4WA 2DFKB 1MOPA 2PEYA 2YZGA 5LMUB 1ECCA 1MN6A 1GZSA 4JEUA 4MW9A 1BH6A 2CK3A 2XDQA 3GGSA 2OFOA 1AXRA 1E9SA 4DLBA 1FYXA 4B4WA 3UWSA 3NAMA 2LNDA 1U4NA 4L9SA 1DE0A 4KJXA 1QH1A 1ZSVA 4OYLA 3D7KA 2ZR0A 2P2SA 3LPCA 4OLHA 2QTMA 3SOPA 4D82A 4DJDC 1JFLA 3L93A 2IYEA 1SRQA 3K1TA 4X63A 5HCNA 2AOUA 4FX5A 1CS4C 3MJEA 4JVSB 4TSFD 1RXEA 5EP1A 1WDWB 2JG3A 4PG5A 3KUXA 3NHFA 1W4RA 2PGDA 2Y1KA 3M6WA 1TAQA 1YS2X 3PSAA 2C3PA 1RPNA 3AR4A 3BRSA 2X2PA 2WOJA 4D1YA 2YJGA 2I62A 2OCKA 4KIUA 3ZI4A 2HDOA 3BD7A 2H2GA 1DLJA 3TOVA 2QN6A 2ISQA 3ZKWA 1F8FA 2X4IA 3Q3IA 4EI2A 4B74A 3RTAA 1H9CA 2VUUA 1N2XA 4BNUA 5JLJA 4CN9A 4ME6A 4EUKA 2R65A 1ORHA 3DNPA 3OMXA 4DZTA 2D7JA 2OAGA 3AEQB 5TQ0B 2BHRA 2XT6A 2NZWA 2W4QA 3M9XA 1XFDA 3TFWA 4B8WA 5JQGF 1UT6A 3HRKA 3KTFA 1WKVA 1YJ5A 2NU7B 5IYZB 4QOJA 4JJIA 5D3QA 4LY0A 4QRDA 5KPDA 3EXG1 3F0TA 5EHNA 4H3VA 1IJKA 4MQ6A 4YV1A 4FR0A 4C88A 4UBLA 1EJ2A 5CVEA 2NACA 1DRKA 4GYKA 2VQ3A 5FPHA 2OBXA 821PA 1F4PA 4COKA 1C9JA 2VJMB 1SG6A 2GRAA 3QKIA 1TQ2A 4YRMA 4B1FA 2I6SA 3M1YA 3LLCA 3RAGA 2AEJA 2ZK7A 5CUQA 4AX8A 1XAIA 1M6VB 3E82A 4QWWA 4DB2A 1SKUA 2YIJA 4JNCA 1TIBA 2VJYA 4Z1OA 4YJ3B 2NXWA 4JODA 1VE3A 3PUYA 2RCYA 1FW8A 1Z8HA 2OQRA 4RD4A 5JCOC 3L1KA 3NAQA 4DCTA 2PLWA 1P7YA 1U9CA 2BMEA 2C5HA 1TEVA 5LZ9A 3BGVA 3LY8A 2M1ZA 2H1IA 2ECPA 2I7CA 3VO9A 1DX6A 2VWHA 4E1VA 2P2YA 1Q74A 1WP9A 4WA8A 2JLCA 4D0SA 5J5CA 3UMFA 3QG1A 4GOND 4EHAA 4MA0A 3WGTA 3B9QA 3TX2A 4JQOA 3DOUA 1O58A 5FTJA 2G9UA 2QX7A 3EHDA 5DYWA 1HQYE 1R0LA 3V34A 1XDDA 1KFBB 1RJ9A 4DR7B 2A33A 3KQTA 1II8B 1ZMXA 3RIMA 3VMFA 2CUZA 1AJEA 1L3BA 1D2GA 3ZWPA 3IDAA 2C4KA 4YDRA 5FI1B 2OILA 3RSFA 1LC3A 3A4YA 3BOSA 4QFMA 3RVSA 4PLHA 2DF8A 1SU8A 4DEVA 4DNXA 5F1KA 1R5NA 1ZJWA 2ACEA 5L3SA 5JCPA 4BNLA 3OF2A 3QV1A 1I0IA 4HDSB 4K9RA 1X13A 2UXBB 5DRTA 1U7HA 3RE1A 4ETWA 1BCSA 2GBFA 5LP6B 1O5IA 2KQUA 2VH5R 4BFXA 1ND5A 3W5UA 1NYTA 1KHTA 3I39X 3TLBA 3HU2A 3LM8A 1UC4B 4PYRA 3RHTA 2FRXA 4CRWB 1VJRA 2FYTA 2N75A 3WKEA 5L53A 2HIHA 4PYKA 4G1MB 5A5FA 3KSDO 1W5TA 3LYHA 5JT1A 4WKOA 2A5LA 3RTDA 2AK2A 2ZBRA 5LKAA 1O0BA 3HZRA 2D5CA 4D6XA 3D3EA 2NZJA 4HGRA 3PKZA 5HKKD 1FNMA 2B98A 2WKPA 1DWUA 3OOEA 4LZJA 4MCJA 4AJ1A 2HLHA 4RD2A 2PK3A 1X1TA 4JLMA 4YCDA 4HAZA 4F60A 1RR6A 2YNMD 1I7LA 1QO9A 2Q8PA 4QLOA 2FUG6 2YS6A 3B2EA 4LTNA 1MOZA 4OJMX 4Q3OA 1Y4ZA 3RC3A 2LKCA 2JH9A 4KI7A 4DNOA 3H83A 3O21A 5E9AA 1R16A 1XKQA 5DWDA 2C4MA 5HF9A 4C7VA 2LR0A 2JS7A 1Y6GA 2JHAA 1MAVA 4Q9KA 3FOAA 2QA5A 3F7NA 1M8KA 1O8BA 3KKPA 1MIOB 2PN1A 3AJDA 2KM1A 3VTZA 1FTGA 4EMSA 4JT2A 1R9MA 2BM8A 3USCS 2E82A 2H63A 1T8WA 1DCFA 3PJFA 3ZW7A 3KBOA 1XRQA 3UT5A 2JFGA 3VI4B 4ZO9A 2G8LA 3BQNB 3PXUA 3I2FA 4CCYA 2CNDA 4M55A 4BTVA 1T5SA 2CDRA 3DJYA 5BP7A 4RJLA 1G38A 3EQ7A 3LY9A 4MIOA 4BFZA 2Q2WA 3C14C 2BI8A 3KK0A 4B3TB 2C00A 5E3JA 4R2MA 1XN1A 4P3OA 4BE4A 1GWNA 3A7DA 3ND8A 5IN5A 3OF5A 3Q0IA 2DP4E 4Q39A 3RRJA 2D3TA 1DAMA 2YYZA 4A91A 3K94A 4CMIA 3K8ZA 1K89A 4PCVA 3Q4GA 4DRYA 3PE3A 2O3QA 3IAUA 3RVQA 4X1IA 4NULA 2OHVA 1GRQA 3C4VA 4DSOA 3R4VA 4HUJA 2HCJB 2K87A 3W8NA 4AUNA 1CQJA 2PTHA 4KJZA 3ISTA 3U4QA 1DXQA 5CFQA 3W7AA 3AVTA 3UTDA 1JA0A 1E4OA 2IIQA 2FZGA 4XVQA 1C0IA 1H5NA 3K9NA 4GRDA 1ZP6A 1G4UR 1OMOA 3RUFA 1MF7A 3GBSA 3FCCA 4CI9A 1P1FA 3PUIA 3ZEAA 4BO1A 2BUBA 4E7OA 4WKCA 2Q6KA 1R8QA 1QZUA 1RE0A 4IV8A 1LI7A 5IZCA 4RTMA 2DUNA 1SXPA 1ZR4A 4ZYLA 1Y5NA 2Z5LA 3KHUA 3RRFA 5JISA 1Z83A 3NYQA 4KX3A 4DBLE 2ZWAA 4DV4B 1NMZA 1XZMA 2ZR9A 4IJQA 3ZY6A 4MV5A 4DLUA 5A4MS 4IO1A 4YP5A 4ZMBA 1ISPA 1JZQA 5JS2A 1P2UA 1U8FO 2BRUC 2FF7A 2X23A 3F71A 3IDFA 5TEWA 3VC2A 4CL2A 1V4VA 1OI3A 1CCWA 4QARA 4C0SA 3RVRA 3AZOA 5DHFA 2C82A 4FYWA 1M1UA 1N0IA 1E2HA 1EMDA 1MIHA 2P41A 3PUKA 4IFTA 4MWTA 5KNCH 1GSHA 3QVWA 4RACA 2FSUA 3BH7A 3O26A 1X7ZA 2QDXA 5E3IA 1YUMA 1QHEA 1TUGA 4WAUA 4EENA 1B1AA 4EGCB 1JBKA 4KOAA 4WBSA 1FTQA 2NIPA 3BREA 4EBFA 2H85A 3VU0A 3C7TA 1RLIA 3INGA 1LBHA 4Z54A 2JA1A 5EXSA 4OB7A 3IPRA 3V1YA 4B2LA 3TYXA 3BMXA 3F4KA 4BUZA 4RJJA 1FUKA 2FPOA 3W06A 4ANFA 1Y1QA 3HCNA 4UUPA 1I4TD 1NVMB 5C4IA 4AM8A 4D4IA 1PJ3A 1WHSA 1FUUA 3K9FC 1PJTA 1TPZA 3AHCA 1TMYA 5AJUA 5GZ1A 3EIOA 3IPCA 4QODA 2G63A 3DO6A 5EKSA 3RYFA 1SVNA 4IS3A 3U7EB 1A5SB 5K0GA 2P77A 2VEOA 5JADA 3PPIA 1VRCA 4KWEA 1NRIA 2VH2A 3U49A 3C1OA 2YVLA 1NXWA 3AF5A 1YFZA 4FE3A 3GRRA 4BO3A 2Q2NA 3L92A 1UJ2A 5KOJB 4URFA 1GAWA 3DC7A 1KI3A 1RXSA 1XNGA 2MTBA 1PV4A 1LWOA 1GPKA 1RI3A 3ESBA 4FYPA 4O4LB 1ZN2A 2CD9A 4BPRA 1S96A 3NOXA 1BNCA 3BTUA 1RRMA 3A6ZA 3N9IA 1XDWA 3OKCA 2NW6A 1U7OA 2UZ0A 1CS0A 1AGNA 3M9LA 1P2DA 1JSZA 3C5WP 4E32A 3IEUA 5KSOA 2IH2A 2GBCA 4F72A 1F6BA 2AFRA 3V8EA 5HZKA 2HRQA 2ZP1A 4AMUA 4D45A 3K0CA 4EHDA 1HEUA 2PMCA 3DM9B 2F8SA 1PWHA 1KYQA 3AK4A 1XYVA 3JYNA 1PFQA 2D0PB 4K6MA 4LISA 4PICA 1GUFA 1MJGA 5LKRA 4P82A 4CTOA 4ZVQA 3ETEA 3KELA 4LOAA 3TVTA 2IZ7A 3EXFB 3PNVA 5KDOA 1JQDA 1K6XA 4NU0A 2QV7A 2A7QA 2W58A 3RQIA 3BN3A 1DMRA 4A1OA 4WXRA 1XRRA 4EELA 4JL6A 1BD3A 4DT1B 5DBOA 2GVZC 1BTOA 4AF8A 3H5VA 2PUBA 4A27A 1NF2A 9LDBA 2PH3A 3Q7RA 1SHKA 4UD2A 1EFKA 4X95A 3ITDA 3ZZTA 3UJNA 5B4VA 2IXDA 2Q27A 3NWPA 3KV3O 4M1QA 2YYYA 2O8BB 1OA1A 2ZJ5A 1YB7A 1W75A 3D3NA 1Z2AA 5AM5A 1HDGO 2GB4A 4TTTS 1H2XA 4PZ0A 1CZLA 4L78A 3SHQA 4AMBA 4G0WA 4MJXA 2VSYA 1UKBA 4FQ8A 5E6UB 1I1HA 5IDVA 3HZOA 1CE8B 4J9UE 3QUCA 3FTEA 1WHTA 3KYDA 1C14A 3PWSA 4XLLA 5TLSA 1J25A 1W0KA 3QVJA 1CU1A 1LZKA 3N8DA 4LHSA 4ZN6A 2GN9A 2GO1A 2IY8A 2NSLA 4RPJA 3S8YA 1T2NA 4KR3A 3L8HA 3PD7A 1SIUA 3DDHA 4HXEB 4TROA 4EG5A 2OCGA 3ORRA 3MIIA 1P45A 3OIYA 3QU5A 3WISA 1DFHA 1O97D 4NBWA 3GT7A 4Y6OA 1CF2O 2II6A 1WIWA 5D86A 5DMXA 1UQUA 3WJAA 3T9BA 4BDTA 4D0RA 4M6WA 5B3LA 3LDAA 3JATB 2Y66A 4RV9A 4CU2A 5BRAA 4IGEA 4NH4A 3CN9A 2DERA 1K8YB 4IWNA 2WZDA 1GNLA 3V48A 1JQ5A 1KP3A 1VL8A 2AC4A 2O0KA 3K6JA 3R74A 2RARA 4F04A 3WGIA 4OXQA 3EISA 3P20A 1BX0A 1GN9A 2BGKA 2CV2A 1R0XA 4NBTA 1ZGHA 1LNSA 2D8AA 2MSDB 4LRUA 4FN4A 1KQGA 3TLZA 3AVWA 4DV2B 2JHFA 2YZMA 4LZNA 3T7TA 3Q1LA 2HA5A 2P9TA 2X3UA 5IW8A 4P98A 2DHCA 2ZYAA 1O9GA 3LQRA 2ZR8A 5EQFA 1M2OA 4GMDA 3WLTA 1EH5A 2HF7A 3QU9A 1EP3B 2EKBA 2WIAA 3TF5A 1K7EB 5H3LA 3WLQA 3GRPA 3HUFA 4ZEMA 3B70A 5IH7A 4KN6A 4RLQA 1Z0UA 3DLAA 4CMBA 2DULA 2WHPA 4AMYA 3GJ8A 3BORA 3EVDA 2NVBA 1U1FA 4O4IB 5JPIA 2CXQA 3UT0A 3ZDQA 1OH6A 3ECSA 4L8YA 3KKMA 3NETA 1MR3F 4KVZA 2J3DA 4P4NA 2PYZA 3HNOA 2BM9A 5EUMA 4RPHA 1J6UA 2QTGA 1BJKA 4POAA 1ZRNA 3KQUA 3HBJA 4A2CA 3T3EA 4B84A 1ZA2A 3IVAA 2GO7A 2FXVA 5DHSA 3SYTA 2C8VA 5A7FA 3GLIB 2OBMA 3ND5A 3R5HA 4LE1A 5AP9A 4BN5A 4MUFA 3KYCA 1R15A 3IPAA 3MWEB 1TYEB 4I1VA 4X54A 1GRVA 1RBQA 3OZTA 3QYFA 1VYUA 1V39A 5BT8A 4W5WA 5JNUA 1WB5A 3G2PA 1HQCA 3BIJA 4DPKA 1TZJA 2E4WA 4YRRA 5D6OA 5A3JA 5JZBA 3SX0A 1XRNA 5KJ6A 3FN4A 4YRFA 3H0KA 2P4EA 3EAQA 1S2MA 3V32A 2F4NA 1JE1A 4A73A 3I6IA 2JLUA 1GLNA 3UJCA 1A9PA 1U2GA 4S2EA 1AU9A 2IF0A 2XQVA 3EWNA 3IP8A 4IUDS 1KMNA 3QVUA 1E6KA 3RS5A 1C29B 5IN4A 1CY8A 2I03A 4P31A 1L1EA 2C1ZA 1NFRA 3I6MA 2Q0HA 1M8PA 2JARA 1J0EA 2FVXA 2W83A 2VSOA 3HBNA 4LW8A 1XLTA 2PL9A 4I1RA 3QI2A 2DLDA 3TRHA 1CRZA 2YFQA 4MRMA 1J0CA 3CINA 1YK1A 1LFDB 3WI7A 4L0DA 4XYEA 3EVTA 2FWRA 1JEOA 1VKHA 4I46A 1FDRA 2LDBA 4KR0A 3W79A 4R71A 1S4QA 1XK7A 4XQ0A 4JJEA 3BRWA 3CB4A 5H4HA 1T43A 1XAGA 1SUAA 2X0RA 3J7TA 1A88A 2GFHA 5ETJA 5AT1A 4BVHA 4BVFA 1OX4B 3AL0C 4LRWA 3FUVA 4DZZA 1F4LA 1V9SA 4HCJA 3TLEA 3G0HA 3DP9A 4GZLA 5ALQA 4G07A 2BGRA 1MTOA 2GA9A 4F5DA 4CWAA 4TUYB 4ZT5A 4HS9A 4DJJA 1PZEA 5ENZA 1AO0A 2AJ8A 4LN1A 1E6MA 4UNNA 4DV0B 1NHWA 2V97A 1MDBA 2O4UX 3R3VA 4XJTA 3WK8A 4ACAA 1X80B 2R7NA 4JP3A 3ZKAA 1GKLA 1E2IA 2B2XA 1V5IA 4GOKA 4U3JA 4BB5A 1EX6A 4EPTA 4R1PA 4C6RA 1E2BA 4RQAA 1JHDA 1NW6A 1G1MA 3R3XA 4PPFA 5LXTB 1GA4A 3G6KA 5LBIA 3GIWA 4M9ZA 4N6GA 4YNBA 4D8UA 1BHSA 2EGGA 1J1ZA 4HN4B 4JBHA 2ZJOA 3TFOA 1SVWA 5H9WA 2ERXA 4HAIA 2PZMA 5IF9A 3NPMA 1PL8A 1T3HA 1WMFA 3L8YA 1T36A 2OHGA 3CWCA 4KH0A 4M36A 1KAGA 4QQKA 4YJGA 1DFIA 2BFWA 1R5JA 3GVHA 2B5OA 3QI7A 3BA6A 4QSHA 4M1YA 1CX9B 4BMYA 2OHFA 4DBZA 2JKZA 3HFSA 3TBFA 1YQ9A 4GIBA 3V4RA 1CC1S 3IBTA 2QYHA 1RHQA 1Y1KE 2C4UA 3KKKA 3MJCA 3OJFA 2JLSA 4H1HA 5DLQC 4BNZA 4E6EA 2P1DA 5CLJA 4MP8A 3QE0A 4KHZA 5TEVA 4QQ8A 3PICA 4BNTA 1YS1X 2J6CA 1CSEE 2XOEA 2VP3A 1VIYA 1ZIYA 4MQMA 4GBMA 4RTPA 3OUZA 1E20A 1MO4A 1EE2A 1SC4A 2P3LA 3GAZA 4FE7A 5E7JA 1U2TA 4KSYA 3DF9A 5EAIA 2B7LA 1YVUA 4MP3A 4PZ9A 1ZRHA 1EA7A 5JNRA 1R0RE 1AX9A 5CYFA 4RDCA 1V41E 5NLLA 4CF3A 4DKXA 3I9FA 1EDEA 2GLUA 4E5DA 1T1JA 3KJFA 3O91A 3EC7A 3LJKA 2NYVA 4KZKA 3H05A 1EWTA 5ARCA 5KTKA 1Z18A 2QG9A 1CY1A 2W48A 3CF2A 1NV8A 4D4MA 5KYWB 1SN7A 1G5PA 2FWMX 4H7JA 3W3ZB 4YDQA 3FAZA 5BSRA 2DEUA 3R0XA 4TMWA 2AR7A 4DBVO 1UMDB 1V2GA 2WFLB 3PP8A 4KKXB 4QXRA 1IOZA 4GQIA 5CM8B 5CLQA 3WMEA 1KDRA 4UUBA 3L49A 3HQ4O 1PTJC 2F3PA 3RS3A 5K4GA 1M1ZA 3BRCA 5G2OA 3WMXA 4KTTE 3MCAA 4CM8A 1SIWA 4S05A 5JQGB 1JJAA 1W94A 4EUSA 2DKFA 4BEWA 2VDLB 3EBLA 5EVCA 3MPOA 3AV3A 4CR6A 5HM6A 2BR3A 4H1UA 4ZXPA 5HHTA 4MWSA 3RVPA 5JFGA 1H6DA 1AA6A 4J07A 1TC1A 2ZBPA 3GVIA 3C8ZA 2F6RA 2MHCA 5KAPA 3M1LA 5JJBA 2FZWA 3B38A 5LPNA 2EBFX 2FPMA 3R77A 1VIVA 4DC0A 1DXYA 4XDYA 1R4ZA 1H42A 1CBUA 1QH0A 2HU7A 2I3AA 2BELA 3FFAA 4R01A 8OHMA 5KQSA 5LQNA 1PUXA 3I9V1 4LQDA 3RRNA 4M9XA 4ZVVA 3EA4A 4QJ4A 3MD0A 3F46A 4L95C 3RVDA 3H65A 1M1YB 1W581 4KR6A 2VZ9A 2O0LA 3BEDA 2VPQA 4HN9A 1KY5A 1K92A 4NOLA 3THRA 4PS0A 3I73A 2DT8A 2XTMA 3RWOA 4E11A 2WJZB 4A1FA 1XC7A 2C5GA 4BO9A 3KQWA 1UJBA 3GLHA 2O7NA 1V11A 3N0RA 2C3UA 4OQQA 2RG7A 3LOUA 4M3NA 2PT7A 1RP1A 2NVUA 4C3ZA 5IANA 1PK9A 1RAAA 1XEWX 3QJGA 4G5QA 4G63A 4X61A 2NUTA 4HFRA 1XZLA 3FBTA 3KJXA 4NKRA 5DTIA 3IUPA 3FNGA 3Q7SA 1KPIA 4Q12A 3RTGA 2QRKA 2I6FA 3UUWA 2FMXA 2IZ6A 2XR1A 1T1RA 1GZ5A 1KVQA 2X0EA 3RSCA 4KAXA 4BWYA 1UBKS 3G0IA 3HKCB 3JQEA 4IV0A 2A9RA 2PO5A 3VUFA 3RK4A 3OIUA 4RF3A 3TR0A 3GLQA 4JLUA 3VC1A 3D8SA 5FF9A 3ETDA 4B43A 1F48A 3PVZA 5SYAA 4WMLA 4X64B 4I1PA 4EKEA 2BKXA 1ARZA 2XMPA 3DEFA 4J3FA 5DASA 5JH7B 4IDFA 4EO9A 2IH5A 1Y7TA 1YRHA 2JBWA 3N58A 1AV6A 3RFVA 3FI9A 2C9CA 3OM0A 4NSNA 3S8MA 2I7VA 4AY2A 5CFMA 3AI2A 1M0SA 2OO5C 5CK4A 3UB4A 5B64A 4NECA 2POQX 2VJLA 1HT0A 1JYFA 3CWQA 1OWLA 4L27A 1U04A 3IVCA 3F2VA 2A57A 3TSZA 3NBYC 4B8YA 1UDXA 4G0PA 1AKRA 3RJ9A 4FDVA 4AG3A 2ENUA 1YDMA 2P6MA 3R5SA 3B1VA 3HB1A 3KZ1E 4NCAA 3PNPA 2RGRA 3PNSA 3MBIA 4J0GA 3MJ4A 4KIGA 2JJ2A 2DUUA 1WOMA 4CHTA 4ZJYA 3ER8A 1E1RD 2JAUA 3M6AA 2FMHA 3IERA 1CIJA 3BD9A 5G4LA 5A4FS 6CHYA 2AXPA 2YFHA 1MBZA 3R41A 2GZRA 4PVCA 5ALIA 3EWSA 4XIYA 1SC1A 5IJ0B 1RYYA 2VTBB 1FYEA 4OHOA 3VOAA 4FDMA 4TM8A 2EQ5A 4HG2A 2YWEA 3FZQA 2CK3D 1ZJ4A 2PA0A 1JAZA 4OHRA 4PNHA 4LOJA 1VLQA 2R6FA 4GPIB 1G2PA 3FDJA 3VU8A 2BGJA 4FNGA 4CETA 1A9OA 2RGXA 1PHRA 1AKQA 5J4KA 4LVNA 2ZPAA 2CCGA 3AEZA 1MG0A 1J42A 1U3VA 4LRSB 4MAMA 4PC7A 5IULC 1BX3A 3E7XA 4M8IA 3M6VA 3TRJA 4ENVA 1VGVA 1PLLA 1JQBA 2GD1O 4IH1A 1HE4A 1SBTA 2XE7A 4BYMA 4CL8A 2WM8A 1CEQA 1SVMA 4OBWA 1E3WB 2F43A 4Z0NA 2IUFA 4JUDX 2RI6A 1EP9A 1C9EA 4IEFB 4C2BA 3A1WA 3FTNA 3PKJA 1JH8A 1ADGA 3CS3A 4NOKA 4UBIA 2NVOA 2CNNA 4DARA 1S6YA 5LOVB 1KOGA 5IAKA 1T1IA 2FE4A 4DNQA 3IIIA 4AP6A 1CDDA 1SBZA 1XYGA 2AMFA 3D7SA 4IFIA 1BRMA 1I10A 2MSLA 2Q7OE 3RSOA 4D6YA 5BVGA 4XGKA 1J2RA 4QDXA 2FSVC 3L0ZA 3OA2A 5BSFA 5ISMA 2O54A 1QGYA 1ZJYA 2MU1A 4KQ6A 5DCLA 5JSYA 4ALNA 1LLCA 1LF5A 4BFTA 1Q1QA 1NVXQ 2BMAA 2UAGA 3P9ZA 4P7GA 4LJRA 1N7HA 4G8BA 3DB1A 2W6CX 4FI3C 3BGSA 3BFKA 4XVRA 4IRUB 2VYQA 3LWZA 3HKDB 5EIAA 3TW4A 2ZVJA 9MHTA 1ECPA 4WA7A 2NUPA 1DAEA 2ZT5A 1T9ZA 2XVZA 4MWCA 3DTNA 1Y81A 3LK6A 1BH2A 2OO3A 2XEDA 4O2AA 5CCEA 4B47A 3BE5A 3WNBA 1H1DA 2V7QA 1GYQA 1Z15A 2LCIA 3JQBA 4FGLA 4KWTA 5GJCA 1UXIA 4AK9A 5BRNA 1C7RA 3EEFA 4WOKA 5F7XA 1UAAA 2D00A 2CLSA 3GLHE 3HY6A 4MCHA 1KZ9A 1R18A 3K96A 3Q72A 4GNKA 4BTEA 4EGQA 3SNHA 2HF9A 5TIIA 3S27A 3IH5A 1RWXA 4B6RA 3GEHA 4WD3A 1J2YA 4NL4H 1SXJA 1DB3A 1I5OA 1MU0A 1YS4A 1VSQA 1TCCA 2JBAA 2W2QA 2XQKA 3ZY2A 4C3UA 2O3TA 2WMNB 2YW9A 1OV6A 3M4YA 3NJ4A 1KPGA 3SC2B 4QKQA 3ADCA 5CLLA 3TZKA 3DFUA 5B55A 3EMKA 3HO6A 1ABFA 2C7GA 2VXYA 5CVDA 1KEKA 3DVAA 3S44A 4O2AF 4Q1CA 1W34A 3GK3A 4LBWA 3V3TA 1MZVA 2JGLA 5ICGA 4R9SA 3ASVA 2CNLA 4LYHA 4WWHA 5EIEA 1E5VA 3A1TA 5A3VA 3TTTA 1PQ4A 2ZYWX 1U2SA 3GW8A 2Y1FA 4MQEB 1WJGA 4TKUA 2JGDA 3FUUA 2EP7A 3VU9B 4Y1EA 1E6UA 1WVIA 1RQ7A 3KKOA 4X93A 4ER5A 1GOTA 4JI5B 5DXFA 3U7GA 1QYXA 1SY7A 2ASVA 2O6HA 4GGMX 3IOBA 5HQTA 3FOZA 4MV7A 2IQIA 2GM9A 3QWIA 3F5QA 1WUTA 3SGLA 2E4VA 1KFKB 3HCFA 3IAM6 1OZAA 3JD1A 1N6IA 4HRAA 4J2HA 3TW8B 3TW0A 4H3HB 5KYUB 2GM4A 3EXIB 2R8ZA 4CQNA 3BZBA 1XTTA 3N5KA 3VYUB 5DV9A 4IVPA 4DCCA 1KWGA 1IG0A 4TS4A 4HPJB 2ZRAA 3FYUA 1ZOLA 4OL0A 4MYTA 2LV8A 4TRNA 3JQ7B 4AB1A 4BB9A 3S7TA 1JWBB 2K2QB 4DMLA 4BV9A 1W19A 1AT1A 2PH1A 2VXBA 3ADOA 1O9HA 1YVPA 1V35A 3IOEA 2F8MA 1JPNA 2FWAA 5FCDA 1PIWA 2VTKA 2H2WA 2R25B 4Q4HB 1HR0B 5FXMA 2J08A 5GZ3A 3OU7A 1JBQA 3BEOA 1DCMA 3ANTA 4IIJF 1QK4A 2KLBA 1O96B 2ENWA 3QX9A 1WBBA 2J4FA 4JVOA 4PGGA 1WM1A 3S70A 1CVRA 1NC3A 4MS4A 3SZGA 1OFVA 4BZZA 2G4CA 3DOCA 1HLFA 1SBNE 4UXJA 2GZDA 4P9NA 4YRCA 4PQYA 3ENKA 4IVRA 1H0KA 3FUCA 3NDIA 4NZPA 1WQ3A 5F78A 2JIDA 1H6CA 3LQYA 4QOFA 3GP5A 2CXNA 2WJ6A 3DC2A 1FYDA 4DV7B 5F3DA 4O0MA 3RAJA 2M6SA 1ISJA 1CQIA 3DBRB 3V4OA 4X91A 5BV7A 1JFRA 5F9MA 2AJLI 2W7TA 1OTXA 3STWA 3Q3JB 3F6SA 1N3BA 2V1UA 4CQLA 5HM8A 3LUGA 1I1OA 4G23A 3SX2A 1E58A 5T3UA 1Z3IX 1MRZA 1NATA 2C4WA 1TOAA 2I1WA 2NXCA 2PZLA 4XB2A 3JZAA 3EGDB 3SC6A 4YONB 2AMJA 1SHJA 1JQAA 4ARZB 1KMHB 4P0PB 2CXTA 4C01A 1W0CA 1FSPA 2B9EA 2NU7A 4MQFA 4WCFC 2QOEA 4FFBA 2PX6A 3L40A 4TLCA 5L4NA 4N8EA 3V7FA 3QBJA 3LFHA 1Q0PA 3QZUA 4MQLA 1ODFA 1EG7A 5DBIA 5TQVA 4PYJA 1U28C 5DZSA 1WCIA 2O2IA 1BFDA 3DMTC 5G0TA 3PC4A 1Q15A 4ZAFA 5JVDB 3FHTA 1PJCA 2ZWPA 3IS3A 3MAGA 3T34A 2WEKA 4EYEA 3IKMB 1PYGA 5EE1A 1UM9A 2OCLA 3ANMA 1ZBQA 3OLZA 1ZNXA 4DIFA 3G0CA 2HA4A 1M6VA 4NIMA 5IVDA 4KVGA 1L7VC 5K3AA 1E2FA 3LT2A 2ECFA 4Z9BA 3UK2A 3ZGXA 5ESRA 1A5BB 1SAYA 4TTPA 3TCXB 4A82A 4D96A 4J0JA 2PU7A 5KU1A 2GCOA 3QSGA 2V6IA 2V4MA 4I1UA 4Q48A 3SJAA 3FOWA 4JKOA 4A03A 3FGZA 2ZYSA 1USIA 3VTFA 3WC4A 4EX6A 1E6WA 1RM3A 1SXJE 1HRKA 2AHOA 5DHQA 3TG2A 1JU4A 2OSVA 1Z7GA 3D3QA 1J56A 1L7PA 1SVKA 3K09C 3KU1A 1D6MA 2A9FA 2GNAA 3LBIA 3PCRB 4HGPA 1C1XA 1OB2A 3AW8A 4GL2A 4R7GA 1E2MA 4LSMA 3KKLA 2XB9A 3QA9A 2VZ8A 3B6MA 1AQNA 3DAOA 4F45A 1SM4A 3FDZA 3QITA 2IXFA 2QMHA 3SQWA 1FVOA 5B5SA 4TQ9A 2A9KA 1P75A 3PQ6A 4NFLA 5DFAA 4M83A 1ENPA 3WLIA 4PTLA 5FA8A 4YRAA 3NIDB 3A9TA 2WMYA 1X8KA 4EB6B 2RGGA 4DJFC 4XQCA 1MVOA 3KKQA 2PRJA 3QXXA 4Y2VA 1VPLA 1S4MA 2C42A 3H6KA 2HXYA 2VK1A 2WR8A 3I9MA 4FXPA 4PYIA 3WHIA 5FR1A 4YRQA 1B6GA 5MDHA 2PS0A 5CM2Z 4D8XA 1XF9A 1ZGJA 5DT9A 2QD5A 4UU1A 1ZSNA 1ULTA 2NNWB 2HM7A 4OYYA 4R41A 3CUSA 3M5DA 4U8GA 2CVQA 1G3IA 4GNRA 1FNCA 3VR2A 3LKBA 4DDHA 2IUYA 3F78A 4KACA 2UVQA 4AROA 5FOWA 3KS9A 3M82A 3DF7A 4RHTA 5ALEA 3NHZA 3V8QA 5BWOA 2D54A 4F7DA 3F1KA 2VCEA 3EG5A 3KAJA 1I2ZA 1C9YA 1MO3A 4PYMA 5DM60 5A71A 2A14A 2B37A 4QEDA 4ZQEA 3VZSA 3WK7A 1VLLA 5TSDA 5DHTA 1PEYA 5DTJA 2VJAA 3OCCA 4WKBA 4Y2JA 3CZ9A 5CA1F 1T8RA 1X0XA 1Z4QA 1XG5A 2DR2A 4ZZ1A 2CVHA 2QTHA 3V46A 4EYKA 4REOA 1K7YA 8GPBA 3FTPA 2QRJA 4B3RB 2IEDA 2QLBA 3T8YA 3VKUA 4KXVA 3WWPA 1LQTA 2Z2IA 4BGIA 2B4TO 2MYUA 5HRAA 5H5JA 3J80A 2RHDA 4AKHA 2IYTA 5B4TA 1IULA 2HA2A 3CW9A 5F1YA 1MJGM 2CMKA 4KG7A 1XEFA 3GUVA 3KNZA 2A58A 3ILVA 2WMDA 4LVOA 5J5AA 3KFLA 3RLIA 3WTBA 3WMFA 1BVYF 1E77A 2Z83A 1YA4A 2W43A 2Y0CA 2WIBA 3HDHA 3K0AB 1NJ8A 3MT0A 1LPMA 1H5UA 4HWKA 2Y68A 4LHVA 3ZBQA 3QVVA 4W1SA 5EEGA 2XRFA 3FVTA 1COWA 4OJTA 1L4HA 4IZHA 4UNIA 1K5GA 5CT5A 1NYRA 5AVQA 4U9IS 1DADA 2OBNA 2PLFA 1D04A 4FDTA 4TMKA 2E1RA 3A0RB 3R5TA 2B25A 3HCAA 2JPDA 3ADBA 4B80A 1C8BA 3TM5A 2EZUA 3MUFA 4JCOA 4LXHA 1VHLA 1E3JA 4KYIB 1LF0A 2CN1A 3E9QA 3R3ZA 4OXIA 3N53A 1BJTA 4KXMA 4Q6BA 2MYPA 3D2AA 4BKRA 3U31A 1H3EA 4P3PA 1ZM4A 4QC2A 2HMSA 4PLZA 2PJRA 5K0ZA 1GT6A 4P7KA 3ONNA 3BMOB 4Y2TA 3ASZA 4D9EA 4IJMA 3C7DB 4P58A 2J9ZB 3U2QA 3CJTA 3C85A 4TXMA 4C0JA 5BOSA 4L16A 2WD7A 3ROTA 1UBHS 3QEMA 4R0VA 1RKVA 2VTDA 2JGIA 2X58A 3USZA 3A32A 4C22A 3Q9UA 2ZB4A 1ZK4A 5BN5B 4GFDA 3UC5A 4GX0A 2H8GA 4EFDA 4HMQA 3AIOA 1YONA 1K08A 4JOCA 4A4DA 2OXCA 4TXNA 5IT4A 1AGYA 1X7YB 5AHXA 3FVWA 3O3MB 4MLDA 4FPXA 1WQ4A 2IP1A 1W0KD 5CX4A 1FS5A 2ILTA 3BIXA 4NMWA 4Q4AB 3W1WA 4I36A 2XNCA 1OQAA 1ZIDA 1H3NA 1E1CA 1M2HA 2IPMA 1ES9A 4TTVA 4D3YA 4U2EA 4D3SA 4RTSA 4JI7B 1JWAB 1QQ6A 2YHUA 4BJ6A 5C5DA 4CHGA 1BEUB 4X6UA 4BE7B 2Z98A 4WE3A 5H82A 4R0MA 2E37A 2X9NA 4HXYA 4ESEA 2CJXA 3BT7A 3NFRA 1NU6A 2JNWA 3SEAA 4O1IA 2GYUA 2X2FA 4HL6A 4RNCA 1KE1A 1A77A 4CTKA 2RHTA 1N5IA 3GJRA 1LTQA 4MO9A 1JA1A 2J9XB 4HQ6A 1NVEA 4X6XA 1AXEA 4MIKA 3WADA 4PLWA 3PJEA 3DMRA 3KD2A 1N1GA 4NH0A 1G6Q1 1KSFX 3KWLA 4OXYA 4RORA 3ZZMA 2PSHA 3S68A 1GKKA 1HDOA 4CPDA 2PS3A 3PI6A 3N07A 3QKSB 2XB2A 4RGBA 4CV2A 4KQ9A 5CJJA 3WLNA 4GM0A 1V8ZA 4JBYA 4NX2A 2ODWA 5DMHA 4DR2B 1R37A 2CB0A 4Q4DA 1BXGB 2QN7A 3QEJA 4S1VA 3TQIA 5FO1A 1XHFA 2GETA 1QHGA 3JQ8A 3AF2A 5FV4A 3GPDG 1WBDA 1MJNA 3HDQA 3OJLA 1LS6A 3AF0A 4M53A 1JA9A 3NATA 4G2TA 2Q0SA 4MXDA 3QOXA 4EB3A 2ZQ5A 1WB6A 2AVDA 3MFQA 1KP2A 5AXDA 3QTLA 3AP2A 4RQTA 3RQSA 4XLTA 2C97A 4AMGA 1M72A 5TX7A 3RABA 2EKLA 4BFVA 5DK4A 3TLGA 1T8TA 2YJ3A 4O4LA 3T1VA 5EPEA 4B31A 4LDQA 5AW5A 4I5IA 4TQUS 3EF0A 3O5AA 4KO8A 4EP1A 2IY7A 3GRKA 1QO0A 4QPCA 4K6OA 2IS6A 1R27A 4J7XA 1T6BY 1HFWA 2P6NA 3OTGA 2WFAA 5LMCA 1P1IA 2IX9A 1VM6A 2J87A 1RQGA 3FWZA 3KSUA 2M6RA 3P9QA 5GIOE 1NN1A 1T2CA 4MLCA 4WKGA 2X86A 1O6GA 4B2PA 3ILHA 3A9VA 3LOQA 2VOEA 3OZSA 4B3DA 3SWWA 3GFGA 2JFNA 5IARA 5DB4A 3R0QA 1TT5A 3K6SB 1RBZA 2XA1A 1UFKA 1G0OA 4Q7EA 1J8VA 3EXHC 1C3VA 2W2TA 2HYIC 3ROZA 4YN3A 1NJGA 2WAMA 2EJBA 2R6JA 5M2QA 3EPJA 2QIOA 5I9BA 3OFNA 1U2RA 1XMXA 4H1TA 4CLRB 1XPUA 4AY3A 1X9IA 2Z9BA 1QFYA 4YFYA 3OT1A 2ETVA 4J1SA 1DJQA 2YKGA 1JJVA 1LBQA 1Y3IA 2Z2KA 3OZDA 1GDTA 4LHWA 5IHPA 2Y71A 2E0IA 4FKMA 4L8WB 2QRHA 3BRWD 3H9QA 1EFTA 2F48A 2OB2A 4Y7DA 4ZOLB 1PW5A 1HOTA 4D92A 1QV7A 4E31A 1EB8A 3AWIA 3GLKA 3OQ1A 3THXB 1EWKA 2CLKB 5KDDA 1A7UA 1SUCA 1NXTA 4TWZA 4UASA 4OX9Y 2IEZA 3HDVA 1LFAA 4KNWA 3WLHA 5CFPA 1V5WA 4OIMA 4GU5A 1XBTA 3ANSA 4FEYA 2CLMB 4ZDKA 3FPLA 2IEGA 3SF8B 3WYEA 4YX9A 2WB4A 3M6IA 4C7BA 4NVRA 5F5LA 1ZI6A 3TLYA 2ORED 1E9BA 1NGSA 3F7OA 4BMZA 3ADPA 4P22A 2Z8YM 2QAJA 3P0JA 2F1HA 5B36A 1W0JD 2XMDA 2YDYA 4FBLA 4LWOA 3AUSA 3TNLA 2AWNA 1QOPB 4QUBA 4XIJA 4RSMA 1BIFA 3ZYCA 4GOJA 3RFCA 3AIIA 3UHAA 1VP3A 2FKAA 1TU0A 1NBOA 3KB1A 4ZRMA 5FPQA 5T8KA 4DLRA 3RI3A 1MEJA 1JG6A 1SG9A 4XX0A 3U48A 1PJ2A 3K8QA 4DSZA 2PKQP 3NB0A 1NIJA 2XCOA 1D2AA 4EH1A 2IWRA 1OLSB 5CJPA 2DFNA 1E32A 2ZJ0A 3UV7A 5KJ1A 5AOVA 2QW1A 3ONFA 3GJ3A 1LPSA 3EY9A 3QWHA 5HMMA 2E89A 3SU8A 2J5KA 2GK7A 3PXCX 1XLVA 2IP2A 1SZJG 3ZS8A 3CISA 4CMAA 2F1RA 3BSWA 3N5CA 4NBUA 2QZ9A 3M5CA 4HNRA 3UAVA 1VIDA 3KAPA 1L5RA 2EBWA 4G1EB 2V4ZA 3F97A 3PV0A 2IRWA 3DL7A 3VKGA 1P4JA 2PXCA 1EUDA 1QG0A 2TRSB 4M7RA 4PCLA 5F3RA 3S2FA 4DGQA 1KK0A 4WDQA 4CF7A 3FSGA 5I7VA 3MCZA 3PJGA 1SKQA 4TQGA 2RGBA 3DYIA 4Q1BA 5E38A 3EZLA 2RBGA 4UDXX 3HC7A 4B4OA 1D2EA 3RHFA 2PGJA 4E5VA 5IZ4A 4O4IA 1YQUA 2OLEA 1UK8A 1E7QA 1Z2EA 3WWEA 4QYWA 4H1WA 5B1YA 2I99A 3I9NA 4G9GA 1J5XA 3R23A 3DE3X 3H16A 1RIIA 2JGRA 3A6EA 3EBPA 1MCZA 4FKBA 3TVDA 5J43A 1G2QA 3CO0S 2GN6A 1NW8A 4ZI7B 2NU8A 3X2SA 5F5XA 1KZYC 4IXDA 3HJHA 4HPXB 3KTAA 1I01A 1A8PA 1L5SA 1R1DA 3PQDA 4RPIA 2R2AA 4WOPA 5SV2A 5FWYA 3MWEA 4ZU1X 3DWIA 4WN9B 3GRVA 3I30X 3STHA 1NI5A 1RTKA 5JFTA 1YFKA 4K05A 1X77A 4P7JA 4WZBA 4ZHQA 4OXNA 3QELA 5JY1A 3I34X 4LI3X 4E08A 4D3ZA 4G01B 3ZNPA 1Z68A 3FBWA 1D8TA 4DDVA 4DIMA 1DBRA 1X1BA 5AMXA 3VDRA 1J99A 3D6HA 3FCEA 1ZPDA 2FJPA 2ZROA 4F38A 4V0NA 3WQHA 1QAMA 1F6DA 3O8OB 2WYVA 3HJGA 3S2YA 2EFJA 3TB4A 2QQGA 3S6JA 2XWJI 5DCYA 5JBNA 1Z4KA 1TMOA 3UA4A 4C2AA 5JU6A 1VJ0A 3EDRA 4X1YA 3A70A 1BGXT 3BWDD 4CM5A 3O1IC 2RC6A 1XI2A 2QD4A 4MW2A 4MPTA 4H7FA 2GCPA 2AG6A 1P1RA 1EWVA 1U0SY 1WXXA 1XV5A 3B9BA 4TKLA 2AJDA 2UYYA 3WJ2A 5ALNA 4DWVA 1R64A 5LQSA 3KZKA 5LB4A 4ZHQF 5C9ZA 4WJLA 2O8BA 5C7LO 1JG3A 1PJBA 4X8HA 1C8KA 4UZEA 2V3VA 1XK6A 1ECJA 2BEKA 4C1NA 5F7OA 1ULAA 4UMFA 2CHGA 3OPYI 3CX3A 3PK0A 3UOGA 3H2ZA 3OMLA 1QO7A 5FLKA 1TUEA 1KSHA 3N3BC 1N5JA 4E21A 5JBIA 3HJRA 2WPDA 4OSEA 1OASA 5FL7A 1UC8A 1DKUA 4DLWA 1MOQA 3PCXA 1IZ8A 1L8XA 4YRIA 3L9WA 5J4VA 2M2IA 1XZAA 3FD8A 3R6WA 1QHFA 1I3MA 4Q05A 2J3QA 3PQ2A 1CUFA 4JL5A 2FQQA 4UE6A 4BO2A 4G1CA 1RYDA 3B8EA 2ZIXA 1M2FA 5IMBA 1GJRA 3FPKA 2BKAA 4LPSA 4BZPA 5JRJA 1P5ZB 1ISSA 1MXHA 2J45A 3DTVB 3ZBPA 3ELWA 5EKTA 3I0NA 5CXUA 4WJZA 2O19A 5F1PA 2WF6A 2HFKA 3R9XB 2VF8A 1OKKA 3UH1A 4INAA 4XIFA 2VOJA 3KVRA 3SDBA 5IAAA 4TXLA 3FY4A 1NBHA 1DIOB 3BIFA 3GLGB 4A26A 1JIQA 1BOFA 5LQMA 3HSYA 1RRVA 3PXAA 5AK6A 3N59A 4WH0A 1VKJA 4R2HA 1L5HB 1PR6A 3KJIA 3JYPA 3M49A 2CXHA 1D2MA 2AZTA 4K5QA 2FFRA 2V3WA 2NTEA 1QZZA 4LOLA 3UJ3X 1OC2A 3PYLA 4JD5A 4M9CA 4M38A 4G5OA 4IDGA 3UENA 1R0BA 3A2NA 2QMYA 2WG0A 4DCNA 2ZRFA 4M49A 3L4JA 5E8RA 1MG5A 2I3ZA 2BM1A 4FX2A 3ULKA 3DEIA 3LDGA 4KRXA 3A4IA 1QC5A 1YU9A 2O3UA 4P4LA 1WPRA 3IVGA 4P7FA 3SM9A 4BPBA 1HEIA 2JJ2D 4J1TA 3PC3A 4R8SA 5EQDA 1GUYA 2JJ8A 1YT5A 5ECDA 3UO8B 1CV2A 1J4AA 4XM2A 5JMOA 3T7JA 1J8DA 4RGQA 4AFNA 1E0KA 1RLOA 4QNMA 3X44A 1KR2A 1XCLA 1XJCA 2CLCX 3WP1B 1YBHA 2H4HA 3VKHA 1PGPA 2Q3EA 1IB6A 2VTVA 5DNEA 4UVHA 1AY0A 2QZJA 3WFZA 5KSWB 1E1KA 1IOVA 1Q20A 1RYEA 3GH1A 3L1HA 4O08A 4QUIA 5E2IA 1M2EA 1Y89A 3GGGA 4JT4A 4BMCA 1WXDA 3QENA 1OJLA 5EMMA 3GZJA 1XPJA 2PH7A 3L8DA 3QTBA 3V00A 1WDMA 4PAMA 4YLYA 2ZZNA 2QF7A 4WOJA 1C1DB 2NOAA 1O94C 2WFLA 4JC0A 4CI0B 1GPUA 3M8KA 1PFYA 1ISMA 1GUDA 3A14A 2CXPA 2IHVA 2NYUA 2ZSIA 3ACBA 3LUPA 3R7NA 1T0IA 5ADVA 2GI4A 2ZZMA 4I7EA 1Y82A 3ZDAA 1M8FA 1NWHA 1R0CA 3OEWA 3BCRA 1TM5E 4M86A 4M89A 4QBKA 3QHPA 2EXXA 2ONZA 2ZT6A 1YR2A 2YINC 3NEPX 3CSSA 3ZQ6A 2QT9A 3K16A 3HRIA 3NU1A 2V7UA 4BQSA 4I4TB 5HZMA 2H48A 4M0FA 2FN4A 4UU0A 5KOHB 1IDN1 4WZBE 3N8NA 3L06A 2GPSA 2Y8EA 2BCJQ 1SQSA 3C3XA 1GAXA 1KK3A 2RBKA 1UJNA 4IO0A 4WFKA 1N32B 1H66A 1NP3A 1VBFA 2C7BA 2XZTA 3L5KA 4TYPA 1WLYA 2VDOB 4QG7A 1G6HA 2N47A 3QE4A 2BP7B 4EHBA 1JX6A 1KJ9A 1VKZA 4AJEA 1FMCA 1P1KA 1KDPA 1HZZC 1RI4A 4LY6A 4BQIA 1SNYA 4JB0A 2PFGA 1V6CA 1W4CA 2WJIA 1KSJA 2G0AA 2ORWA 4CFSA 4E22A 4E5YA 5HG0A 1I3LA 3C7KA 3UB3A 3Q3GE 1KOJA 2P79A 2Z0MA 3AXTA 5DIFA 5HP4A 1WLSA 5DYYA 5LWQA 1RTTA 1Y0BA 3KDSE 4XOUA 5FA5A 5JAQA 4KSCA 3RSSA 1BU5A 2K4MA 4ERXA 2V7QD 3AGQA 1FLDA 4CU5A 5FWXB 4RVNA 2XGOA 1RKXA 4HAWA 4A8HA 4LJ4A 1JHVA 2FW8A 4GH5A 4YCAA 1JMVA 1Q95A 1U2DC 2VPWA 1XVVA 3WAKA 4CLOA 1QQ5A 2WJAA 3K9BA 1SXJD 2WE7A 4I99A 4E5UA 3ZZ1A 1MD9A 1SD1A 1TF5A 2WIJA 3EXAA 1SCAA 3SPXA 1G8JA 5EGNA 3FROA 3YASA 5HDBB 4ZFNA 3E22A 3BTSA 3T3PB 5BWBA 5KS2A 3ADDA 4XEHA 4JOQA 4BKMA 2QMZA 3Q7EA 2Q0QA 2BR5A 1FX0B 2VUIB 4EY6A 4IDQA 1NJ2A 1EVLA 4FXOA 5LXTA 1T10A 3T15A 2XAAA 2CFOA 1CF4A 2FTKE 1PE0A 1D1SA 2VKTA 2EKQA 4FYMA 1C4KA 5AK5A 3LVRE 4CKZA 5I9SA 1BRTA 5FYQA 1RYZA 1RQRA 2HHCA 3EDOA 3O8NA 4ZCQA 5HILA 4MYHA 4UQOA 3U7JA 3ZHUA 3OLCX 2VVTA 3GQVA 4NV3A 3SEFA 3G89A 1XD2A 2BKVA 2F3QA 3LDHA 2UZ3A 3PGJA 4D81A 4OAOA 2ZI9A 4PRLA 3DE6X 4XJVA 5JJCA 1QIEA 3PGA1 4RM3A 4G4IA 3RU7A 1XEXA 5ELXA 2AYXA 3AFGA 4ZZ0A 1JQJC 1OVMA 4DG8A 1SCUB 3GGCA 1EG2A 3RIXA 2NM0A 1H8HA 5LXTF 3W6UA 2HKIA 3WLRA 1KI6A 4YDSA 4P53A 1T13A 1OU0A 4EPYA 1DTEA 5IF3A 2XXAB 3MTEA 3DLIA 5F2EA 3GJQA 4Q4JB 4CMKA 1BC5A 2WTXA 4Z4GA 3V7WA 2X7HA 5HRUA 3OM9A 3K0KA 1GA1A 2X0IA 4UOQA 1JYEA 2E3JA 4IIUA 4YJFA 4DGSA 1OT3A 2WD9A 1NUHA 3EIEA 3L05A 4JLSA 1UZMA 2GX6A 3H9CA 4QOGA 3ZOKA 2IITA 5I7UA 4ZYZA 1V48A 2XVYA 4N3AA 4QELA 2PT5A 3FYTA 4R68A 2O07A 4UEKA 4ZREA 1FXWA 5K8TA 1NP7A 3O75A 4OGFA 4A8JA 5C5IA 1UPXA 2FPGB 5IKEA 3AF6A 4BX3A 1MLDA 1ISRA 3RFTA 3ICWA 1QAOA 3WKAA 4PAQA 3FX2A 1NJSA 3F5FA 4JN6B 5UKDA 4BRUA 3BB1A 4CUKA 3RBXA 1X92A 2KYRA 1IHOA 3EGOA 3QVSA 1DOAA 1ZM7A 1K68A 4V0RA 5H1YA 1AHNA 2XITA 1BSVA 2JF0A 4XUCA 2ZYTX 4XQ9A 5A5GA 4II3A 1NG1A 3VNUA 1S02A 2D2EA 1X7WA 1Z17A 3H13A 1E18A 4CM9A 3KR1A 5AKJA 3OCVA 3I6BA 1XTKA 3DXYA 1FXWF 1GNVA 5C8YA 3WDLA 1T4GA 3HKDA 4Z86A 3OFJA 3E15A 1V4NA 1NXOA 1P17A 1J49A 1XELA 5EVJA 4YQEA 1QJCA 2P6PA 1U0GA 4HYEA 4XPIB 5AK0A 5ECYA 1W47A 4K6HA 2V3CC 2PQ2A 3GGOA 3T5MA 1N92A 5FTWA 4IFBA 1CUWA 1JVNA 1NAIA 3F5DA 4J0DA 4TS3A 5EWJB 4A16A 2EX0A 1T8UA 4GQBA 1G17A 3D0KA 3UJHA 1XHLA 3BZUA 3JQAA 4ZV9A 4IKOA 4C3OB 3OY2A 2QBYB 5DYNA 2A9QA 5F35A 2VP5A 5CDUA 2NU9A 1KRHA 1DDOA 5C8YF 3IIKA 1SQGA 1BKSB 3NHMA 2C9MA 2ESRA 4MYCA 4QUHA 3DE7X 3DHNA 1POWA 3JRWA 3ORFA 4LQLA 4DR6B 3ZDBA 3ENNA 3FCOA 3OLVA 4K9NA 3BCHA 4X0EA 3PE4A 5FIUA 5F9HA 5LUAA 1ADFA 2HPZA 4HBGA 2OP0A 3QXSA 4OL9A 2W70A 3SX4A 4FWBA 4YUWA 2DRIA 3SKYA 1PSDA 2ORYA 4GS5A 4FMBB 4MQEA 4EGFA 4CEIA 2FXIA 2GPAA 2WLSA 4WGFA 4YUVA 1KMQA 2PD6A 5I5EA 1EFPB 5KKNB 2Q5JA 3CLUD 3LPNA 4WADA 1H2RS 1PG5A 1EZ4A 2JIRA 3GHYA 2GEUA 1A7JA 1YS9A 4GOLD 5HTKA 4B3CA 1JVBA 2HMUA 3SLKA 2Z6AA 1ECLA 1L4BA 1X1SA 1MB3A 4MO2A 4M1MA 4CIYA 4GKVA 1PF7E 4LA4A 3ZDZB 3GFTA 2IS1A 1WVGA 3N2KA 3X1YA 3FDIA 3AIMA 2V5UA 2CGEA 2QMQA 2PXXA 4HLNA 2AQ8A 2ZUVA 2LW7A 1VHQA 1QK3A 3N7AA 3RG2A 1AB5A 2NYAA 3MJRA 4JUAA 3K9CA 1DEAA 4PX9A 4WY8A 5IFLA 3K71B 3FUWA 4C4XA 1HDRA 4WLOA 3JALB 4IIFA 2WC1A 1JHMA 3K35A 3ONEA 1H8EA 1PAUA 1EGVB 1U0TA 2IHKA 4PO9A 3VR2D 5HFNA 2HRBA 1DQSA 4L5IA 1JAHA 2GCEA 3AQIA 4LXIA 3G82C 4HAUA 4W7HA 4WASA 4Y2RA 3TNJA 5JSUA 3OQNA 5BUQA 1LV8A 5LYJB 1O96A 1YVEI 2QG4A 1T2VA 2FVYA 4FE4A 4JJZA 2AN1A 3C3KA 2NSJA 4C0AC 2N42A 3C87A 5I9LA 1EK1A 4E07A 2G5GX 1C80A 2RAFA 1ZK2A 1AKMA 5BWMA 1AHIA 1ZEJA 4KQJA 4Q01A 3V55A 3QQ5A 4HDKB 4EG6A 1HDEA 3Q8KA 2O8EB 3E8SA 1N6LA 3G5LA 5A9RA 3MTAA 3SHWA 2REXB 4FYVA 1YS6A 2EJTA 1RC1A 1U7WA 3DDCA 1M76A 3FBGA 4Y8VA 4Y6PA 1L3IA 3I23A 3Q88A 1L5KA 3JW8A 2P4HX 2H1HA 4MR9B 1Z37A 5CBPA 4DR5B 1HEYA 2ACWA 4I4NA 3VH1A 3LGAA 4NDZA 3B6EA 2ZRPA 2AA3A 3GJ0A 4JIMA 1OT5A 4V0QA 1ZHFA 4EHLA 3O83A 4W5TA 3AILA 4LGMA 4HEA6 1SXHA 2QVBA 3FKSA 3RUCA 4PAOA 1WL8A 3ZV5A 1I80A 2H7CA 1COWD 1KMHA 1UOPA 3UK0A 2H92A 1ZD3A 5BXYA 5DJ5A 2Q6VA 1SXGA 3LUBA 3OURA 1ZW6A 4BY9E 4BNNA 4W6QA 4LMRA 3G13A 3N0XA 4K1XA 1KS2A 1GDHA 3GWZA 3I8OA 4TT3A 4ALLA 3MJSA 4LVUA 4OHVA 1V7ZA 1Y3DE 4CKBB 1GQ2A 1F3LA 3QLUC 1G21B 2YV3A 2XF8A 1F7UA 5IWCA 1QUEA 1G5QA 1F1JA