3DTTA

Crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
220
Chain Sequence
GMKIAVLGTGTVGRTMAGALADLGHEVTIGTRDPKATLARAPPFSQWLPEHPHVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIANPLDFSHGMPPTLNPVNTDSLGEQIQRTFPEAKVVKTLNTMNASLMVDPGRAAGGDHSVFVSGNDAAAKAEVATLLKSLGHQDVIDLGDITTARGAEMLLPVWIRLWGALGTANFNFKIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP oxidoreductase
publication title Crystal structure of putative coenzyme F420H2:NADP+ oxidoreductase (YP_830112.1) from Arthrobacter sp. FB24 at 1.70 A resolution
rcsb
source organism Arthrobacter sp. fb24
molecule tags Oxidoreductase
total genus 68
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dttA00
3BTOA 1NFQA 4GMFA 4WUVA 2FP4A 4E5MA 3PYXA 5C5IA 2C7VA 4KOAA 3KZVA 1E7MA 2JD1A 4BNZA 1LI4A 2YZ7A 1CIVA 3H5RA 2GD1O 1E1NA 2QIOA 3I6QA 4CM5A 4P4GA 2X22A 4B3JA 3O4RA 3JQCA 4M8SA 4TZTA 1BXKA 3OSUA 1DOHA 2GASA 1IZ9A 1ZSNA 1ENYA 4E2ZA 1Z45A 4Q9NA 4K28A 3I52A 1OZAA 1E3JA 3DL2A 2BF7A 3CINA 3KYDB 4Q3EA 2O2YA 1Y5RA 2PH5A 3WWYA 1GZ4A 3EDMA 2C2YA 1ZK0A 2A4KA 4EGFA 4UREA 3RI3A 4UAGA 4ZU3A 4BO3A 3KYDA 1FDSA 1IUKA 3IMFA 3D3WB 3BMNA 4D79A 5GZ3A 2X58A 3FPCA 3NRCA 3OIFA 3F1LA 3PLRA 4MP6A 1NX6A 2PV7A 1CJCA 3ASVA 3ZDFA 5A5FA 4QTZA 4R16A 2PK3A 4MDHA 3FHLA 4WEQA 1NVMB 3PJGA 1PS0A 4WCFB 2UYYA 4RPGA 2NLOA 4R3WA 3GK3A 3NT2A 4XYGA 3GUYA 4E2WA 5EIOA 4MVJD 2Q1SA 3LVFO 1XG5A 4PLWA 3JQ7B 4FCCA 1RJWA 5ENVA 5KJ1A 4CUZA 2F00A 1E1KA 4MVJP 4GKBA 3L4SO 1SAYA 1C0IA 2DC1A 4PRKA 4RF3A 3DOCA 3KXDA 5CHEA 3H2SA 3A28A 4L9RA 4PLHA 4R41A 2WYWA 5A1TA 2LDXA 1WDMA 4DPMA 1KS9A 1SO8A 1R0KA 1UXHA 1SZJG 5K6AC 2LDBA 1ZO8A 3ZU3A 1LRKA 3CSDA 4XJTA 4CPDA 2JD0A 1IY8A 4NG5A 4INAA 1SB9A 3E48A 4XQEA 5EERA 1HZZA 4Z6KA 2PGJA 4B3IA 1I3NA 1ZJYA 5JE8A 4CQLB 4GX1A 2G0TA 2YY7A 3SC4A 1U4SA 5A3VA 3GFBA 4J49A 1N5DA 5K6AA 3TQHA 2CF5A 3ENNA 4N18A 4OJNA 4R5HA 4CQLA 1ONOA 4E4YA 4FGSA 5I7VA 1VE9A 1EFKA 1LLUA 1NVTA 5A02A 2VRBA 3BAZA 3OICA 1Y9EA 3F46A 5HM8A 4HADA 3U0BA 5H81A 1Y1PA 3UOGA 1E3EA 1A9ZA 1YL5A 4X54A 1T1RA 5EJ2A 4YEDA 4IGEA 4E5NA 2XAAA 2UAGA 3M2PA 3FI9A 1K6JA 3ZU2A 5JDIA 3GLQA 3EHEA 3E18A 3NYWA 3DWFA 1DIRA 1HXHA 1XKQA 2W90A 4XB1A 4YYZA 3KETA 3ZI0A 5JAMA 4JN6B 3WB9A 1VC2A 1X0XA 2AQKA 2JKVA 5T57A 4CV3A 1U8XX 2HMTA 3WIDA 2FR1A 2Y0CA 1UZMA 2DPGA 4Y98A 1HT0A 4J0EA 2X8LA 1AN9A 4NU5A 4O63O 4J3FA 4QFDA 1M66A 1PR9A 3PHIA 3TOZA 1Q2XA 5T64A 4U6SA 2Y1OA 4LN1A 4F3YA 4O0LA 4BO0A 3M1LA 1XQ1A 5TJHA 4MVJG 2V7PA 4TSKA 1YDWA 1H93A 3WGYA 4XX0A 4RDIA 1MB4A 1ISFA 2V6FA 2Q50A 5F21A 1VLLA 1XIVA 4GQAA 4NIMA 5I8ZA 4DIOA 1PQUA 4LISA 4WLFA 4AL4A 2GR9A 2PY6A 3HJAA 1AHHA 4DPKA 4DYDA 3MEQA 3DO5A 1ARZA 3ONFA 2G17A 1H0KA 3D64A 2PKRA 1C1XA 5A06A 1PJCA 4IQ0A 3CMCO 4FFOA 2EGGA 4LMRA 3AY3A 1MA0A 2B83A 4GBJA 2WTBA 1XA0A 9LDTA 2CZCA 1LLQA 3ABIA 4RJTA 4NJMB 1FJHA 1QORA 1XU9A 4YAJA 4NK5A 3W4KA 3W8FA 2VYVA 1KY4A 5IDWA 4XDZA 2OBNA 4OAQA 2JCXA 1DJQA 3GG9A 2IXBA 2AEMA 3GNSA 1E7SA 5BNFA 3VZRA 1T2AA 3CPSA 4CMAA 1PZHA 1E6UA 1EUCA 2EHDA 3L07A 4L8VA 4WASA 4AJOA 5JAQA 4B8ZA 3OHSX 4S1VA 3WBFA 1Z6ZA 3PPIA 4OXYA 5AXBA 4YT2A 3V2GA 2GGSA 5ENDA 4KUEA 5COAA 3RROA 4B7UA 3UHAA 3D5QA 3QP9A 1EFLA 3IQDB 4XA8A 4AVYA 3K73O 3GG2A 4R01A 3B70A 1KEUA 5L95A 5B4UA 2W8ZA 3RC7A 4D3FA 2AG8A 4H3VA 3WLFA 1ADCA 1PIWA 4JBIA 3E03A 2JJYA 4L4XA 4OIMA 5TT0A 5TF4A 2CVZA 4ESOA 2O3TA 3QJ5A 1YH3A 2P4QA 3VHRA 2EKQA 4CM1A 3VZQA 3S2EA 2BH9A 3MJTA 2AMFA 3BHMA 4MKXA 1CQJA 1KIFA 4GX0A 5BT9A 3HDQA 4NU6A 5HRUA 2B4RO 4F6CA 2D1YA 1ZSVA 2IODA 3KYCA 5LC1A 2GRAA 2NU9A 1FDTA 2AA3A 3K6JA 3C85A 3K96A 3QQPA 1UAYA 3QVXA 2ZCVA 1NQAO 3HN2A 4ONEA 1WP4A 3GHHA 1Q0HA 1XQ6A 4CM7A 3I6IA 2NVWA 4CM9D 4DRYA 2VZ9A 1O95A 3BHIA 1X1TA 5I9LA 3LT4A 4BNTA 5JO9A 2Y66A 4K6FA 1HF3A 3NGLA 5CG2A 5HWSA 1A7KA 3ZZNA 5DNAA 1DO8A 4DIFA 5A4DA 2VHVA 5JMPA 1X7HA 3ZH2A 1B0AA 1R4NB 1FDUA 4WJZA 3HDJA 4OO3A 1WW8A 4QECA 3KLPX 4EJ6A 1LRJA 1A4UA 1B16A 1N7HA 3D4PA 1J49A 1R4NA 2XF8A 4LVCA 1UXJA 1I2ZA 3FNGA 1O5IA 3DFUA 4I9NA 3Q6IA 2NTJA 3IS3A 3C1AA 1IPFA 2Y1FA 4YJGA 4J91A 3F9IA 1YO6A 1HTBA 1EE2A 4W4TA 5FWNA 4G81A 4CMEC 5JCJD 1ZBQA 1O6ZA 3TZHA 5KVSA 1Y5MA 1KEVA 4MVJH 2PGLA 3PK0A 4WOKA 5JFOA 1M67A 3MWEB 4BIIA 1AGNA 1E3SA 1Z73A 3FF4A 3JQAB 4GX5A 3PWSA 2YV2A 3OJFA 4Y6RA 3A4VA 4JP2A 3CH6A 3QSGA 4W7HA 2B37A 4NK4A 3RBZA 3TDKA 3V5NA 1J0XO 3BHJA 4BNIA 1RM5A 3H9UA 4S3MA 3JQAA 1GZ3A 3CEAA 2YV1A 4XCVA 5B1YA 1UP6A 5EESA 3PJDA 4CM4B 3BMCA 2DUUA 4GWKA 3JQFA 4RVFA 2TMGA 3SVTA 1XLTA 4J1QA 1U7HA 3QWAA 1LSUA 5U1PA 2QYTA 2Q3EA 3JQDA 3ZU4A 4ND1A 1IULA 3ZW8A 2BGLA 1TA4A 4CM4A 1DAPA 3DAFA 5JSFA 1UXGA 1IE3A 3K5PA 4ZRMA 3I5MA 4JX8A 1Q7CA 3D1LA 3CZMA 5COQA 3GN2A 1Y8RA 4M86A 5KKAA 1U28A 4I5GA 1YRLA 1DSSG 3JSAA 2BFOA 3I9OA 4IXWA 3ETDA 1SEVA 3F1KA 2DBRA 2VHWA 3ZV4A 4B4OA 3F47A 3HG7A 4RVSA 3UCFA 4FC6A 2O4CA 3H4VA 8ADHA 1P1JA 3ANLA 5B12A 3TJRA 4K9DA 2EKPA 2BFAA 3I9JA 3GT0A 4GSKA 3JQGB 5FI3A 3WOHA 1E5LA 1W0CA 1RYEA 4RGBA 3Q9NA 4N5NA 1U3TA 3UCXA 3WJAA 3X2FA 3WR5A 1H6CA 3H2ZA 3JQGA 1GPDG 3FPLA 4L0QA 1I33A 1XELA 2B35A 3H7AA 3OH8A 2CD9A 4OYRA 4D42A 2Q99A 1U2DA 3FR8A 3ITKA 5ER6A 3HB5X 3HWRA 1YOVB 3R6DA 2X9VA 3VH4A 1H6BA 4EEXA 2JFGA 5DOZA 3EY4A 1WZEA 4HFJA 1ZXLA 1YOVA 1EBFA 1V3VA 3OM9A 5ER9A 1GDHA 1Q1NA 3RUFA 4DQUA 1GV0A 2C29D 1PGOA 3ZNPA 2UVDA 1LNQA 5A3JA 3U4HA 5T67A 4FJ2A 1X7DA 1VSUA 3UAGA 4EI2A 3WGTA 4FS3A 1NQOA 3WGHA 3OQBA 1PS9A 2GERA 5EN4A 4HP8A 4J4BA 5AOVA 4YBZA 4CMIB 3IUSA 1J4AA 4KQXA 1LTHR 3GVIA 3LZ6A 4PVDA 2X0NA 1BG6A 3JQAD 5JNLA 2P9EA 3PFFA 4D45A 3VC7A 4EEZA 4KDEA 3B1FA 3C3XA 1L7EA 2H6EA 2FPGA 2IDZA 3ZV6A 4URFA 1CETA 2Y1CA 2AE1A 1K6IA 5GZ6A 3TZKA 2XXBA 3T7CA 2Q1TA 4XYMA 3GOHA 2AEJA 3COSA 4GH5A 5G4KB 2D2IA 3BTSA 3PHHA 1Z75A 3ANNA 1GD1O 1B8PA 4BO2A 2VOJA 5K0ZA 1N9GB 1HDCA 3EVNA 2Y99A 3GR6A 3W8DA 3WG9A 2Y0EA 4BQPA 2YW9A 3H6KA 5G4KA 3AM3A 5FYDA 4XB2A 4LVUA 1N9GA 4RQUA 1R4MB 3K8ZA 4YJFB 4E21A 4OH1A 5EINA 4DC1A 1UJMA 2B4TO 5L45A 4YQYA 3K92A 1R4MA 2JL1A 4GPD1 1ZK2A 1RYDA 1BMDA 4J1SA 3UUWA 4D3SA 2FR8A 1IL0A 1DIHA 1PJQA 1U5AA 1KOLA 5DBGA 1DIGA 3IP3A 1P1FA 4KUGA 1W4ZA 4PLGA 4H15A 2W2LD 3SC6A 1RM0A 4TQGA 3PYMA 1F12A 1MFPA 3ZGYA 5JY1A 4BNWA 2RIRA 4R1NA 3RUHA 3DZJA 1B3RA 1LJ8A 3PWKA 3WXBA 3QIVA 4PG8A 4XRGA 3NAQA 4WOJA 2I3AA 1QSGA 3ZN2A 4PLZA 2Z1NA 1UXKA 3JYNA 4YB8A 2HU2A 4CMCA 1XDWA 1LA2A 2HO5A 1GEEA 5KOIA 3IIEA 1PZGA 1QP8A 1BTOA 2VRCD 1HDGO 1I30A 4J2HA 4D0RA 4RPLA 2Y67A 3BTUA 1ZXBA 4BS9A 4BL5A 1KVTA 3RJ5A 2YDXA 2OFPA 3WFIA 3WQSB 4EITA 1DFHA 4YT5A 4L4SA 1SBYA 3ROQA 3PYLA 1JKJA 3JD4A 4IDEA 5LCXA 1QYWA 2RCYA 3PDUA 3VH2A 1Z74A 4ND3A 3TF5A 1JKFA 1TT5B 4CLXA 1N2SA 1NR7A 1ORRA 5DDIP 2DLDA 3K31A 2XPCA 1G6KA 3KO8A 1U4OA 1J5PA 4BO5A 4JQCA 1QYDA 4PG4A 3TRIA 1TT5A 3JD3A 3B1JA 4AJIA 1HDXA 2HK9A 1HRDA 1P0CA 1PSDA 3IC5A 4KZPA 4CR7A 1A5ZA 3WBBA 1PWZA 3QWIA 3WNQA 2HUNA 2VNSA 1LUAA 3WSVA 1PJLA 3C7DB 3GZNB 1P9LA 2E37A 8LDHA 3V2UA 1ENZA 4QEDA 3P7MA 3O03A 3FWNA 2H63A 4FBGA 3RU7A 5THQA 3Q2KA 1NBOA 1ZIDA 3WICA 5JC1A 4KQWA 2B69A 4YPOA 1E6WA 4O5OA 3DB2A 2I6TA 1B3BA 2EGHA 3INGA 2E82A 4MVJM 1R66A 4PLPA 3KTDA 5FEUA 5JO0A 3WGQA 2WYVA 1MUUA 5DBFA 1LC3A 1QYCA 1XU7A 4P4NA 3P2OA 1PL8A 1P45A 2O48X 4NPCA 5G2OA 2WDZA 4MVJI 4IMPA 4NMHA 3RUAA 3BMQB 1EK6A 2WMDA 5DCYA 3O26A 2VZ8A 4AJLA 1PEDA 3F5QA 4QT0A 3S2FA 3BMQA 3NKLA 1GEGA 3B6ZA 1TT7A 3W4IA 3WMXA 3M2TA 2ZKLA 3JQBC 4HNHA 1RM4A 4W7IA 1W6UA 4ALNA 4BGVA 5JY6A 3KLMX 4CQMB 1FXSA 2YQ5A 1FF9A 2AQHA 1W8DA 2Q1WA 3VTFA 2AQ8A 1DLIA 1DEHA 1HLPA 1R15A 3L6OO 3ZWVA 1PX0A 2UDPA 3VZPA 4OHUA 4CQMA 3WGIA 2HMSA 3VZSA 1PJ2A 4CUKA 1U2GA 3LK7A 4LK3A 2Q45A 4QX6A 2VTEA 4WE3A 3JQBA 5TGDA 2QQ5A 1E7QA 3MJCA 4BUCA 1HKUA 3C1TA 3GGPA 3QV1A 4HFNA 4CM8B 5LDHA 1WDKA 2EV9A 5F1OA 4CLOB 4KDFA 4DVJA 1YL7A 1HYEA 2PR2A 2E49A 2C5EA 3ZWCA 4CM8A 1KC1A 4XEHA 1HZJA 1M6HA 3R3SA 5TLSA 1G1AA 2GZ1A 4CLOA 3BMNB 3LYLA 4PLVA 1EVZA 2GYYA 3GEGA 1YE3A 1C1DA 1T4DA 2H1SA 3GEDA 5C37A 3U4IA 1BVUA 4FR5A 1QMGA 3VAZA 4AJ2A 3ICPA 5ICSA 2WEKA 4KWHA 3JCZA 4UVDA 3E9MA 2EIHA 1T4BA 3DR3A 5ITVA 3AOEC 2CDBA 4RPKA 2IZZA 2VHZA 2PA3A 5L4SA 1KVRA 3FBTA 1GL3A 3DOJA 4CM6A 1DLJA 2C5AA 4D41A 3DZFA 3UN1A 3RUEA 2R00C 1WZIA 1YQDA 1X0VA 4OKNA 2JAPA 2EEZA 2VCYA 4ZGWA 5BSFA 1NPDA 3DBLB 4BMSA 2HSDA 5FFFA 4YCAA 3GRKA 5DBIA 4FFLA 1ZVMA 3ZNQA 3EUWA 2O23A 3LLVA 5JXWA 1HE5A 2C54A 3H9QA 4WLNA 1LXCA 3AUUA 3DBLA 4U7WA 3C1OA 1IB6A 3WQQA 5CG1A 2DFDA 1EDZA 2OOSA 4KUHA 5JAIA 1NVGA 2POQX 1DIBA 4UVHA 3H5NA 3WMWA 1M2WA 4D46A 2PZKA 2FOIA 2Q2VA 3DC2A 3ROMA 5GZ1A 1A4IA 1YWGO 2HQ1A 2X9GA 2J5QA 2BFMA 3RC1A 4A10A 1JN0A 5ILGA 1H2BA 2QW8A 3CKYA 1HSZA 5JPIA 3WTCA 1ML3A 1E92A 4CR8A 1LEHA 5CEEA 4E5PA 1EVJA 1N1GA 2J3JA 2ZQZA 3AM4A 2VT3A 5HTOA 4EYEA 5BSHA 2ZTVA 4XZ3A 2YDYA 4A03A 2ET6A 2GUGA 3DZHA 3RU9A 1D1TA 3MOIA 3DEYX 4L73A 4DA9A 2CDAA 3PQDA 3FTNA 4K1LA 3AOGA 2J5RA 4BB5A 3HUDA 4GLLA 1ADFA 1WNTA 4ZQHA 4P22A 5DN9A 4B8WA 4PZEA 3LF1A 5FI5A 1NYTA 5JW6A 4PGFA 2NWQA 3H3FA 3HN7A 3RFTA 2B5VA 3GAZA 4CLDA 1YBVA 2X5OA 1DC4A 2YYYA 3PIDA 5DOVA 1KYQA 4PLCA 3S1LA 5KCZA 2VYNA 3A14A 1U1IA 3OA0A 4Y9DA 1YQXA 3G1UA 2Y1GA 5AYVA 4FFMA 1DHTA 4BGEA 3NDJA 3PLNA 1LC0A 5EQFA 4ND5A 5A05A 4A27A 4TRJA 4XDYA 3NT4A 3ROPA 1SNYA 1ULSA 1D1SA 3EZLA 4Y6SA 4RDHA 4FOSA 2O7QA 4TKMA 1X15A 4DQVA 1JWBB 2ZQYA 1L7DA 3ZWXA 2OHXA 2FZEA 2I66A 2YQ4A 1GADO 3GVXA 4GMGA 4PCVA 3SJUA 3AY7A 4BHTA 1C0PA 3ITDA 3H5AA 1VL6A 3F3SA 1GPJA 4MPDA 2DTEA 4XGIA 3G49A 2ZTMA 2X86A 4MIEA 3KBOA 3AI3A 3Q0EA 1PWXA 3BA1A 4XJSA 2I67A 4D7AA 3EGOA 2VWQA 1W73A 5GY7A 4E2XA 1TXGA 2GZ2A 1UR5A 2X7HA 1C1XB 1NR1A 6ADHA 3G1TA 1MLDA 3L6DA 4NBRA 4DLAA 1UAGA 2HJSA 5H82A 5B4VA 3U4CA 4OXKA 3FSRA 3AY6A 3RC9A 4E3ZA 2HJRA 2A35A 1F14A 2O3QA 4RPHA 4L76A 2BGKA 5CAEA 2NNLD 2WYUA 1LSJA 1R6DA 2FY8A 1KVQA 2PD4A 3AU8A 2IE0A 4J0FA 3NX4A 1EK5A 1X13A 3O38A 3GDFA 2IYOA 4IDCA 4CLRA 2HCTA 5CPBA 3DBHB 1ZK4A 2DBZA 3GVHA 2W98A 4AJEA 1EE9A 2SCUA 3ZWWA 1HDZA 3VVBA 1NASA 2EERA 4BO1A 1QLHA 1T2CA 4RVGA 3QRWA 4TRNA 3MCVA 1I36A 3EMKA 2NQ8A 3PZBA 3DBHA 4YDRA 2EW8A 5DP1A 1A72A 5IF3A 1PJSA 1EUDA 1NHGA 3RJ9A 4J7XA 1N92A 4BKPA 2EJWA 1L1FA 3SXPA 3ZWMA 1PJTA 1S7CA 5KVVA 2E6UX 1BSVA 1VJ0A 2EG9A 3UFXA 4YWJA 3PFWO 4K26A 4BV9A 3HDHA 1SOVA 2W2KB 3D5TA 1GV1A 2CY0A 4FC7A 3RCBA 1QLJA 4RVUA 3X2EA 1TI7A 2Y1EA 5TJ9A 1GQQA 4CV2A 2W2KA 1U7TA 4B4VA 5I7FA 1TB4A 1YVEI 1VSVA 1HETA 3VH3A 1LDNA 4YAKA 2V65A 4PG6A 4A26A 3FNEA 3FWZA 2P2SA 1GAEO 1F8GA 3KYCB 4XD2A 1LLDA 2H9IA 1DFIA 4R9SA 3MJ4A 2BLLA 3IP1A 1C3VA 3OF2A 2YFHA 4CV1A 1R12A 2FRDA 4R1SA 4ZD6A 3OFSA 2ZYDA 2P5YA 1HDOA 1VJ1A 2ZB4A 1NXQA 2UUOA 1NWCA 4GVLA 4O1MA 2EW2A 4UEKA 1ZSYA 4O59O 5L4NA 3RIHA 4MP8A 4J90A 2OUIA 4GKVA 5AXDA 3GAFA 4A2CA 3WYCA 2FPIA 1JVBA 3MJVA 4RF2A 1Q0QA 4G2NA 4LRTB 3W6ZA 1GUYA 4AJKA 4MO2A 4ND2A 3DONA 2GN9A 1ZNQO 4YJGB 5F3RA 1HSOA 3DHNA 4IUYA 1IHYA 5T5QA 4YXFA 1OI7A 5AVOA 1GCOA 1ZK1A 1ZH8A 2Q2WA 4IQ8A 2FZWA 2NADA 3BMOB 4CODB 4QFCA 1T2DA 2ZYAA 4XIJA 2OXIA 2VYVD 4K6CA 1MV8A 1CQIA 3UF0A 4IDAA 4AJ4A 1JAYA 1DAOA 5CEJA 1CF2O 2R2GA 3LU1A 3BMOA 4PIVA 4E12A 4HY3A 2J3KA 1LDBA 3D0OA 4II3A 1UZNA 1T2EA 5EMHA 1NNUA 3NTOA 3UVEA 3RUDA 2B36A 1K89A 4YACA 1MX3A 2I3GA 4IY1A 4FW8A 1XWFA 1I3MA 3GMDA 5BSEA 4UEOA 3ORFA 3V8BA 5BNIA 1DFGA 4YT4A 2DBVO 3BMCB 1H94A 4XGKA 1ZMTA 4M55A 1I32A 4I9HA 4CMEA 3RSHA 4XRRA 4AJHA 3LLSA 3MJEA 1XEAA 2VWPA 2D8AA 1E77A 4RL6A 4RVDA 3NJ4A 2VUSA 4JP3A 4OL9A 4FFNA 2A92A 2NM0A 1CEQA 5T8KC 3OQ6A 2B5WA 1NFRA 2RAFA 1LQTA 4BB6A 4HKTA 2BHLA 1HE3A 1Y8RB 3RVDA 5AQ1A 1BW9A 1DHRA 3WTBA 4E2YA 3LC7O 1E7WA 3GC6A 1YKFA 2GLXA 1H9BA 1PL7A 4Q3CA 3ZNOA 1MXHA 3QLJA 4CM3A 3QVOA 5T8KA 3PJEA 4UVGA 3O8QA 3DAGA 1D3AA 3W6UA 4FOOA 4JJFA 3OJLA 3OP4A 3QA9A 4XKJA 5CP8A 1HYGA 3E1KA 3WWZA 1Z7BA 4TWRA 2P5UA 4B4UA 3LT2A 3NTRA 1GCUA 2DVMA 2WWRA 1XCBA 2OMEA 3DTTA 4LCEA 3VTZA 4YRBA 2DUWA 2C2XA 1JTVA 3QHAA 3JQ9C 1KY5A 2DTXA 5KJ6A 1PJ3A 1V3TA 1I10A 4GGOA 3AJRA 3UW3A 3DZIA 3IDSA 5JYEA 3GNTA 1PGNA 1KERA 1TVEA 2PKQO 3QW2A 5CDSA 4BNGA 2FSVA 4R54A 3ON5A 4FJ1A 4YRDA 4IZIA 4BO6A 3IKTA 4BV8A 4FDAA 4XR4A 5CDGA 5L7WA 1DC3A 1U3VA 4Z0PA 3DOOA 2HRZA 3ONDA 3H65A 1JW9B 4JNKA 3SX2A 4BMNA 3LT1A 3JQ9A 4ROSA 4MVJE 4NQZA 2B4QA 4NI5A 4L75A 5G0UA 4HNGA 4EUEA 4MOWA 3DFZA 4E32A 3NDIA 2NQTA 3IOYA 5ADHA 3A9WA 3I9MA 4NFSA 2G1UA 2G76A 3GNQA 1ENPA 1VRWA 4XGNA 3LC2O 4W9NC 3JQ8B 4OKIA 4BKRA 2EF1A 5L7TA 3H9EO 3DDNA 1ISJA 3N74A 4DXHA 3HDYA 5T6BA 5IG2A 2EXXA 4XYBA 1KBZA 3ROKA 1C14A 4PG5A 4AJPA 1F0YA 5ITWA 2PZMA 3JQ8A 4Q3BA 1UDAA 3DMTC 5TT1A 1R37A 1PQPA 3EAGA 4UEJA 4C7KA 4WLUA 5IZ4A 1F8FA 3BXXA 5JAZA 2JCYA 1SB8A 3GDGA 4Q3DA 2C7GA 3Q2IA 3FNFA 4Z3DA 1E3IA 3CIFA 3GN1A 1YJ8A 4BGIA 3GMSA 3S2IA 3TNLA 2FHSA 3U4DA 3DMTA 5IDXA 1QYVA 3DHEA 4QQRA 2Z95A 3ONEA 4U8GA 5CFZA 1N1EA 3T4XA 4O6VA 4YVFA 1A7AA 4BNLA 4ZN6A 4DUPA 1AXEA 5JCJA 4D0SA 2VOEA 1P1KA 2WD8A 3ANMA 3GZ4A 5G4LA 3LC1O 2Y68A 4W99A 1E7YA 4HBGA 3PRJA 3AI1A 2NVBA 3SLKA 4CJXA 4AICA 4GLOA 1ZJZA 4R51A 4OOFA 2PZJA 1NAHA 3G0OA 3G17A 2VT2A 1LSOA 2C59A 2Y1DA 5TNXA 3ZCXA 2ZATA 3ZV3A 1GZ6A 3GGGA 1IOLA 3GPIA 5A04A 3P2YA 1OAAA 1ZW1A 5I8WA 4AFNA 5C7IO 3TZCA 2J3IA 3PQEA 3JV7A 3I9KA 2DKNA 1KVSA 1WWKA 2VN8A 1D7OA 2YHIB 3HE3A 4WLEA 4WECA 1MP0A 2J3HA 3D3EA 2DU8A 3ZHZA 2RBEA 2Z5LA 5U4QA 2YHIA 1MG0A 4BO4A 2BFPA 2RH8A 4ZQGA 4ZVVA 5G0VA 3WGZA 1EBUA 2OP0A 5L4LA 4XYLA 5IN5A 3I4FA 3GPDG 1P77A 1P3DA 3ZWNA 4EUFA 5CPFA 3VVCA 2YUTA 3QVSA 4E6PA 3U9LA 1NWHA 4DREA 5KVCA 5B37A 4FN4A 1XGKA 1OMOA 4RVHA 4ZQBA 3JYPA 3F4BA 1E3WB 4EJMA 3UGKA 3W4JA 1B2LA 2HRBA 3DBVO 2C82A 3VPHA 1BXGA 1ZMOA 1BDBA 9LDBA 3W1VA 1E3WA 1VI2A 3TL3A 4EDFA 5A9RA 2IYPA 5C3MA 4HV4A 1JQBA 4Q39A 1DDOA 5IXSA 4NNJA 4PVCA 4IGFA 3DZGA 3QWFA 1MG5A 3ADPA 3RKRA 1LDEA 5A5EA 3CZRA 1MC5A 3FR7A 4RF4A 1K0UA 1QYXA 2A94A 4DC0A 4MINA 4RZIA 1PQWA 3U5TA 5DP2A 3ZWAA 3DAPA 2GZ3A 3KSZO 5L51A 2NTVA 4NBVA 3DQPA 4TVBA 3UH1A 1S6YA 2QYSA 2CVQA 4JBHA 2DQ4A 4RZHA 1RWBA 5F5LA 4ALMA 2V6GA 4CMGA 4E5KA 1I01A 2VTDA 3PJFA 2HMVA 1P0FA 2EP5A 5KJFA 4PLYA 2D5AA 4GWGA 4PFJA 2NACA 2WJPA 5CDYA 4IJWA 1B7GO 4TRMA 4M89A 1I2BA 2VHXA 2NVUB 5K9ZA 1ISMA 1AE1A 2O3RA 1LQUA 1HE4A 1E7RA 1Y8QB 4RQTA 5JCXA 1RKXA 4ALJA 2ZB7A 3WDSA 2BI8A 3GQVA 6LDHA 1DB3A 3I3OA 3IL2A 5G0WA 3WQRA 2NVUA 4BKUA 5A9SB 1ADBA 2OORA 2FN7A 1PZFA 1Y8QA 4EJ0A 7MDHA 2Y05A 1Q7BA 1X14A 4I8XA 4MVJA 3RWBA 1KVUA 3RUCA 1G0NA 1EUZA 1M76A 3GVCA 1M75A 4BNHA 5A9SA 1JVSA 2Z1MA 3VDRA 1FMCA 1UZLA 2G82A 4FQ8A 1ZZEA 3AWDA 4IIVA 1VL8A 4IDDA 4DIBA 1CDOA 1R0SA 1YB4A 4BNKA 3UICA 1PGJA 4GX2A 4YQZA 1B8VA 3L0DA 2AEFA 2P9GA 5JBIA 2X5KO 4OXNA 3TPCA 4J4TA 2C0CA 3D4OA 3S2GA 4YAGA 1DC6A 2ZTLA 3N58A 4HX5A 1PJ4A 2RH4A 4BQRA 3EK2A 1K2WA 3DMYA 1SEPA 4QUKA 4MIYA 5B4TA 1GUZA 4BNXA 2F1KA 3I83A 1E0DA 2GF2A 4BMVA 2RHRA 4II2A 2OZPA 1T26A 4ZQFA 4CMKA 4DLBA 4XQ9A 3GGOA 3EVTA 4PRLA 1P1RA 1ISGA 2OP1A 1C1DB 5L53A 2G5CA 4Y67A 4NFHA 4IBOA 5L3ZA 3ICCA 4R4JA 4R1UA 4YRAA 4AJJA 1UDBA 1QV7A 4Z9XA 1QKIA 2DTDA 3UKOA 5COBA 3VH1A 1SPXA 4E13A 2FMUA 2EKLA 2P91A 4PZDA 1E5QA 2DFVA 3RC2A 4BNUA 4B3HA 1B8UA 4M49A 1FDWA 3AFNA 1YBAA 5DF1A 5I7EA 1GYRA 2NTNA 3IJPA 1H2HA 3GEMA 4J2OA 3IJRA 1ZFNA 3PTZA 1NAIA 2OGUA 1K3TA 3GH3A 4XQCA 2AW5A 4JXKA 4YAEA 3H8VA 1LX6A 3AFMA 3QY9A 1WXDA 2X4GA 4QSMA 1IPEA 4Z0TA 1R0LA 3TZQA 4WCFC 4J9VA 1DXYA 1V0JA 1I8TA 4YTEA 1WDLA 3AOEA 4YAIA 1FK8A 4BGUA 1YJQA 3D3WA 3LSYA 5HS4A 2BI7A 1Y9AA 4PLFA 3T7EA 4OGWA 1R16A 3RKUA 4Z0HO 3VPSA 1HL3A 1DRUA 2R00A 3TZ6A 4R1TA 2QG4A 3RUIA 5ICMA 1T2FA 1H6DA 3CUKA 3I4CA 3DTYA 3ZWYA 3KYBA 2O3SA 5MGBA 1I0ZA 4E33A 2VUUA 4JK3A 4OQYA 2V6BA 4WCFA 2P9CA 3E5RA 3Q3CA 3WYBA 2Y0DA 3LQFA 2X0JA 3I9LA 1I24A 1N8KA 2AE2A 1IHXA 3C8MA 5IXYA 3HQ4O 3R1IA 3JQ7A 3QVTA 1QR6A 4MVJF 3RFVA 2IEDA 1ONNA 3JQ6A 4JJGA 1PZEA 3MWDB 3GDOA 1GY8A 1JLLA 3A06A 2GSDA 3GVPA 3JYQA 2FR0A 2JFHA 2I76A 4BNVA 4CQMD 1A27A 5G0TA 4RV9A 3OEYA 5KNLA 1ZCJA 3RBVA 4UVIA 2OO5A 2GDZA 2JHGA 1JAXA 2BGMA 2XOXA 3IAHA 1LU9A 4KTVE 3ENKA 3EZYA 3MTJA 1NPYA 1D8AA 2PTGA 4CMHA 1F17A 3QVWA 1T1SA 1KEWA 1PGPA 1EDOA 3VDQA 1HDRA 3V1UA 3PIIA 3A1NA 5JDIC 5J23A 5IJZA 3LDHA 4Y6PA 3GFGA 2HDHA 1QRRA 5F5NA 3C7AA 2ZJ1A 1P44A 4XIYA 3SBOA 1U3WA 2VUTA 4H16A 4P4LA 4R69A 2GN6A 3VPXA 4EZBA 5A9TA 1P33A 3U49A 1Z82A 2QZ9A 4M1QA 1ZEJA 3DZKA 3UCEA 1XR3A 5TS3A 4ZA2A 1PR3A 3M6IA 3ZHBA 3RBXA 2YJZA 4LRSB 2JCVA 1D4FA 3HNPA 3PGJA 3U3XA 3KSUA 4IJVA 4IS3A 1SOWA 3IUPA 4BNFA 4PN3A 2A9FA 2O2SA 4ZRNA 5LDGA 3PGXA 2CSUA 1UUFA 3R0IA 5CDTA 1PL6A 3L9WA 1GU7A 4U5QA 2ZJ0A 4CV0A 4HFRA 5EQDA 3V1TC 2UV8A 2ZB8A 3SEFA 1B15A 3WJ7A 3WNVA 3CE6A 1AHIA 4L4RA 5G0SA 5DULA 1DJNA 2CNBA 1VL0A 3MOGA 4LMPA 2VNAA 4Z9YA 5IDQA 1MC4A 1VPDA 2PLAA 4JLWA 5TX7A 3CTMA 3HZZA 2JAHA 2WD7B 2D5CA 4IM7A 4BOYA 4BO7A 1PTJA 4AJ1A 5JS6A 4CM9A 4MKRA 4NHEA 1XSEA 2WD7A 1LSSA 4CLRB 5BNTA 3OBBA 4UULA 4DTIA 4FSHA 3JQEA 4HWKA 3WS7A 3S8MA 1H9AA 1OC4A 4ND4A 2E4AA 1GFSA 3N7UA 2O4UX 4BVAA 4BO8A 4CLEA 2NSDA 4C4OA 3U62A 1KEPA 4OM8A 2E48A 1DC5A 1LDGA 4WLVA 4WKGA 2X9NA 1LRLA 5I7SA 3K2EA 3NJ8A 4KTTE 1E1LA 4ALKA 1CYDA 4Q3NA 1EVIA 1O89A 2Q46A 4WNCA 2JFFA 4E31A 5JYDA 4I1IA 1GYPA 1FDVA 4UUOA 1NQ5A 2X0IA 3JD1A 2IZ0A 5ILOA 1Y7TA 2J8ZA 2D0IA 3ZHYA 3M1AA 1P1HA 4NJMA 2VYND 4KP7A 4M87A 4EBFA 3E5MA 5AXCA 2WE7A 1OFGA 4YR9A 1EZ4A 1SCUA 2BD0A 1E1MA 1BXZA 4LCJA 3WIEA 3OIDA 4IDBA 3EC7A 4LSWA 1X7GA 5BSGA 4OOEA 2O7SA 4UVEA 5HS6A 3UXYA 3ETEA 4FPXA 4DPLA 1O0SA 1H5QA 4IINA 2UUPA 3RASA 3KHUA 4XQGA 4CR6A 5I9NA 1I5RA 5C7LO 3U09A 1JKIA 2AHRA 3L4BC 4BO9A 4CMBA 1PS8A 2Q4EA 4A73A 3FBGA 3RAJA 1WPQA 2Q2QA 1ID1A 3OJ0A 3HSKA 2FSSA 2GCGA 2D4AA 2NU6A 3CMMA 4DLLA 2NUAA 4R68A 4NH4A 1VM6A 3AW9A 5THKA 1JDJA 3TOXA 1NTOA 3INRA 2VWHA 4WCDA 4W6ZA 2EWMA 1DBVO 2WSBA 1NP3A 5TQVA 5IAAA 2B0JA 3TFOA 1AUPA 2V6MA 4WEOA 1T24A 4E5YA 4YA6A 3L4BA 3B1KA 3PP8A 3ULKA 3R3JA 3DZBA 4TZKA 4B7XA 2X0RA 3KB6A 3V2HA 2QRLA 1A71A 3AM5A 1OOEA 3L9XA 4NBUA 5KJCA 3RFXA 1LBEA 2YHUA 5IDYA 4AJNA 2IZ1A 3PHJA 5CEFA 3JD2A 4P8RA 5JDCC 5L9AA 4GSLA 3PVZA 3OMLA 3DBRB 1O9BA 3OECA 4A5OA 3WYEA 3PHGA 4ZHSA 2ZCUA 4UUNA 1C0KA 2HK7A 5FF9A 4OMUA 4MIOA 4IQGA 2GN8A 3DBRA 2BMAA 2R6JA 2DPHA 3E82A 1NPTO 3HFSA 1ZKMA 2Q1UA 2NU7A 5F1PA 5JDCA 4FFRA 4DYVA 2BELA 4HXYA 3PXXA 1SMKA 3C7CB 2JD2A 4JCOA 4XR9A 1HYHA 2Q4BA 2PZLA 4ALLA 2QRKA 1H6AA 1OBFO 1P74A 4ZQEA 1LDYA 1YS4A 3AI2A 3VPGA 5C7OO 1UXIA 5EL0A 5I9MA 3JQFC 1U8FO 4F46A 1BW9B 1EQ2A 2NV6A 3E9QA 1AXGA 1YQGA 1G0OA 1QXSA 3SLGA 4JIGA 4LW8A 1HE2A 4KMSA 1M6WA 4RF5A 5L40A 4F6LA 2DBQA 3AK4A 5IFLA 4WPGA 4J16A 3FRJA 4QO8A 5AXAA 4E0BA 2QX7A 1J6UA 4WNIA 3O8QB 4DGSA 4YT8A 3E8XA 3QWBA 3I9NA 3NGXA 4F45A 1LLCA 3OETA 4N7RA 1ULUA 2PH3A 1ZUD1 3WGOA 1GQYA 3KV3O 4I9UA 3KOUA 1YDEA 3OA2A 2QZZA 3PEFA 1B26A 4IDFA 3GA0A 4FIZA 2HMWA 1KETA 2I9PA 4R3NA 2CDCA 1HWYA 4A7PA 2AQIA 4IDGA 1IZ0A 1P31A 3OIGA 4CL3A 1CWUA 1IYZA 3F5SA 3MZ0A 1YB5A 2O3UA 4U0JA 2QRJA 4OSOA 1DRWA 1Y81A 2VWGA 4XWYA 5HA5A 1P1IA 2IEBA 3HB4X 1WLYA 4FD3A 7ADHA 1UP7A 3NTQA 2H5LA 5EPOA 5JMWA 3C24A 1KC3A 4ITUA 1PJBA 1UH5A 1ISHA 2NU8A 1NHWA 1ONPA 3JYLA 4R5MA 3EYWA 2W2LA 1MGOA 3PHLA 4DQXA 5MDHA 3I1JA 2C20A 4B79A 1PU2A 4JBGA 4RLSA 2AG5A 3ZHXA 1GQ2A 5DCWA 2GNAA 1JA9A 4TVOA 5A03A 3NT5A 4IZHA 1GTMA 3RD5A 3OEWA 1DIAA 5BQFA 4IIUA 1Q7GA 3ZU5A 4MKZA 4GGPA 2I5PO 3JD0A 4TROA 4IMRA 1EVYA 1WMAA 1X1EA 5BR7A 4J43A 3VKUA 4EW6A 4NBWA 1V6AA 3Q1LA 3F6YA 1OC2A 2VRCA 1F06A 2XXJA 3AUAA 3V1YA 3VOSA 2GPTA 2HLPA 4GVXA 3AUSA 3Q9UA 2ZB3A 4QXMA 5KKCA 2YFQA 3PQFA 4YJDA 4E30A 4I08A 1ZK3A 1I3KA 1SC6A 4JJIA 3ST7A 3L6EA 2ZK7A 4G5HA 4B7CA 1BRMA 4NZ9A 5IZCC 4RORA 4W9NA 2IRWA 3BZUA 3L77A 1O8CA 4MJLA 5H83A 4DL9A 1QV6A 3PZRA 2DAPA 3E6AA 1YBMA 5DZSA 1JWAB 4HFMA 4G65A 3JTMA 3ASUA 1K5HA 3T4EA 4CMIA 1JU9A 5KVQA 3GUCA 4D3DA 4TKLA 4ZICA 2EJVA 2IXAA 1RM3A 4WLOA 4U0KA 3TWOA 5IZCA 1XYGA 4P38A 3NUGA 1E6EA 4J9UE 4QO7A 4J7UA 4AG3A 4CL8A 3ZWBA 2RHCA 3WGGA 2Y93A 4I5EA 3OJOA 1YGYA 4CLHA 4Q3AA 5HBRA 3PI7A 4FGWA 1WVGA 3TFQA 4LSMA 2TMDA 2FWMX 2ILTA 1RPNA 1BWSA 2GO1A 4OQZA 4GL4A 4PG7A 3SJ7A 4D43A 1B14A 3GF4A 2D3TA 2CMDA 2QHXA 2PKQP 2EP7A 4N5LA 2CUKA 4W82A 5KJEA 2J6IA 1EEHA 3D4NA 4ID9A 3H9GA 3VPFA 4C7JA 4BNJA 1U9JA 4YJFA 1GR0A 5GMOA 3RQSA 1QG6A 2GN4A 3CXRA 3Q11A 3FNHA 4XYEA 3IKVA 4D44A 3ZWPA 3AU9A 3HADA 4Y8VA 4DMMA 3H3JA 4IPTA 4JROA 3MJSA 1EQUA 1NM5A 2JHFA 3K9QO 4NJOA 5CDUA 1Q0LA 1UDCA 3PWZA 3P5SA 2PD6A 2PD3A 4TRRA 4IS2A 1PGQA 1E3LA 3BYZA 4IJKA 1Z7EA 3WX0A 2FPPA 3BIOA 3KEQA 4ILKA 3WSWA 4BNNA 2W4QA 3K30A 3KSDO 4FJ0A 2CVOA 3P19A 4BKQA 1VJTA 5TC4A 1ZEMA 2I99A 3TSCA 3ZNNA 2VQ3A 4MP3A 4H7PA 3OQ1A 1NQTA 4ALIA 4BNMA 1BXGB 2HK8A 4I5DA 4DBZA 3VKVA 2P68A 2X23A 2X5JO 2ZYGA 4DBVO 2HKIA 4R9RA 5TSDA 4M54A 5U9CA 3FD8A 3HHPA 1Y6JA 3S55A 5KTKA 1T25A 1BVRA 3STHA 1DRVA 2YV3A 4YJHB 5KWEA 2VZ0A 2BKAA 3DXFA 4PLTA 2VHYA 2AXQA 3JYOA 1GYQA 4NR0A 3FTPA 5F1KA 1UP4A 4TMFA 2X1HA 3WLEA 3G79A 1CRWG 1EMDA 2CFCA 2WM3A 4YJHA 3AUTA 4NFYA 4Z9FA 2CF6A 3KUXA 4CMJA 4NDNE 1MFZA 3GRPA 4HUJA 4J1NA 4CUJA 1HEUA 3INTA 3NDRA 1ISIA 2P4HX 1BDMA 3K2BA 5L7YA 2J5KA 3G3EA 2ZTUA 4U6QA 1YONA 1YL6A 5DCUA 4ZJUA 3LT0A 3NEPX 4WK6A 2DT5A 4KWIA 2PGDA 3PDJA 1U5CA 3DHYA 3H9JA 1C0LA 3QWHA 4J7CA 4OSPA 1TLTA 1N7GA 3HFGA 4WGGA 4A0SA 2D59A 1XHLA 4FB5A 4GAEA 3OJEA 1I2CA 1GUFA 1ADGA 3B20A 4BNYA 4Z3KA 3GY0A 1CERA 4PZCA 2BRUA 3I23A 1K6XA 1V35A 4N5MA 3GHYA 3KRTA 1BHSA 5ES3A 4IJUA 1U3UA 1V8BA 2I65A 5IN4A 4J4HA 1NFFA 4B4WA 3NV9A 4RPJA 1YXMA 1O94A 3GZNA 2OL4A 3ETGA 4GI2A 5DT9A 4IXTA 5JC8A 5TRTA 3O9ZA 1TEHA 3TN7A 4RO0A 4UUPA 2C07A 1I3LA 3KEOA 3TL2A 1LDMA 1WMBA 2PFGA 5KIAA 2DM6A 3FCOA 4LGVA 1HLDA 1VKOA 1V9LA 4J6FA 3ZW9A 3EW7A 2ZIZA 2O3JA 5TIIA 4I5FA 1ENOA 3W8EA 2HMUA 2PWZA 2WE8A 3LF2A 1BGVA 3KM0A 4RLHA 2O50A 4L74A 4BKOA 4J1TA 4DWVA 4UUMA 1A9YA 1V3UA 2HAEA 2Q49A 4FFPA 5JLAA 4RCVA 2X6TA 1HDYA 3ADOA 4NBTA 1WAMA 1MXFA 2OBYA 3KVOA 3FN4A 4N54A 3ZV5A 3ZWOA 4EUHA 4DMLA 3BTVA 1DPGA 2PNFA 3WFJA 3QE3A 4JGBA 3D7LA 1VKNA 3F4LA 3MTGA 3E9NA 1YB1A
chains in the Genus database with same CATH superfamily
1Z2AA 1NFQA 2E1PA 3B3GA 4PSDA 1Z4PX 4IWYA 1Z0DA 4WUVA 2ZYVX 4W5NA 2FP4A 3O8LA 4NESA 1W0JA 1NUUA 4OYLA 3PYXA 1U2RA 4XVUA 1M1NA 1JBQA 1WO8A 3IAS1 4OFXA 2JD1A 1LI4A 4RKWA 1II8B 1R9NA 3WLAA 3E1SA 2YZ7A 5EMNA 2RHMA 3MQFA 3GA5A 4M1EA 1NLYA 5DYTA 3T1OA 1DOZA 1E1NA 1Y33E 1IBKB 1TYEB 3TQSA 1YV9A 4B3JA 4CI0B 3P96A 2DR0A 2FLKA 3O2JA 1DAHA 4M8SA 4TZTA 1UK7A 3ZXUB 5L6LB 2HWXA 3OSUA 3U61B 4OQFA 4Z7OB 4EJSA 3STYA 1ENYA 4RHYA 4E2ZA 5C18A 1GCAA 1SG9A 3FUUA 1YUBA 3KPWA 4NDZA 4X6YA 5LZ8A 1JPJA 2BI4A 4OQLA 3GJYA 5DGCA 4OI1A 4MQBA 4EY7A 5BUCA 4RTSA 3KYDB 2O2YA 4MDFA 4NNOA 1EJ0A 1TW2A 3EGEA 4OHXA 1XDDA 3EDMA 2C2YA 4DWWA 2Q5LA 4R9VA 3G6KA 1J33A 3RI3A 4JXZA 3Q5GA 1P0IA 4EKYA 3I8OA 3D3WB 4MV5A 2JDIA 4IO0A 4D79A 5GZ3A 3FPCA 1VBNA 3TCXB 4OFWA 2GXAA 2XCLA 1MD9A 2EIXA 4GYWA 5HF9A 1OHHA 4JJ8A 2FI1A 5ISMA 1QQ6A 1THMA 4X65B 5I9SA 5HRCA 1YFJA 3AEKB 1UFRA 4AZ0A 2RGGA 3FHLA 4UDYX 2AR9A 1OFHA 1U7OA 1TUEA 2H8KA 3UM9A 4K2HA 1XVIA 4AKTA 4RK7A 1X70A 2NLOA 4MWOA 3NT2A 5LOVA 1YZ3A 2H4XA 3GUYA 4BVHA 2QPOA 1ZA1A 4MVJD 1KPHA 1TX4B 4PLWA 3U48A 2JEZA 2YRFA 5KJ1A 4MWTA 3NHWA 1XMPA 3KFLA 4GKBA 3SHOA 1HZZC 2CXXA 2NXCA 2R6HA 3H5IA 5T3UA 1I4WA 1QFXA 3M34A 1TU0A 1GGVA 3BSWA 2OZLB 2J85A 3IEXA 3KXDA 2ZIXA 3A28A 4L9RA 4RF3A 3TO5A 3FYDA 2OYRA 4YY3B 1VIVA 5G41A 5A1TA 2LDXA 1WDMA 1A9PA 4Z8XA 4MCAA 3UW1A 4UXHA 5K6AC 1PP4A 5BSMA 1J9ZA 5JQGB 3MWFA 4JODA 4MS1B 4C4ZA 2LDBA 1ZO8A 5GADl 4OFZA 5LQUA 1LRKA 1ZUWA 3CSDA 3IIKA 3ESAA 4CPDA 5KYUA 4R8LA 5TR9A 2REQA 4BTLA 1GGJA 5AKGA 1SB9A 3E48A 3OJCA 4EI7A 4Z6KA 4RK1A 1NVFA 3L1IA 4B3IA 2V0NA 3A1EA 4CQLB 2A5FA 3DNMA 2G0TA 3B60A 1NBAA 5EE5B 1GWNA 5FWYB 2XWJI 1QIJA 5A3VA 3ILHA 4J49A 4ZK2A 1N5DA 1O08A 1VB3A 1ZWLA 3I01A 3TQHA 2OAP1 2CF5A 2NZUG 3ENNA 4N18A 4ILEA 4N5IX 4MRAA 5TPWB 2R8PA 4FGSA 1GL7A 1VE9A 4KXMA 1X1SA 1D4OA 3SFVA 1AQNA 1Y9EA 3W3AA 5AW0A 1X7YA 3GFVA 4DA8A 2YRWA 9ATCA 3FOCA 1U2PA 4GDMA 5JPCA 2Q1XA 3P32A 1QOZA 5DLEA 3UHJA 4P5EA 4YEDA 4IGEA 4QA9A 1TMGE 1TU3A 3M2PA 4FOTA 1T2UA 3FI9A 2OM2A 3HKDA 3IT2A 3HDVA 4WZBE 4RWEA 3TX6A 3ZU2A 2AZTA 3A32A 2YINC 4UBIA 3E18A 2FMFA 1RBQA 1PFWA 2FFRA 3I1YA 1DIRA 2VP6A 1XKQA 2YNMA 2FNAA 3EIXA 2I2WA 4IYRA 4ARUA 3KR2A 3FVWA 3CFYA 1KQPA 5IH3A 4OI0A 4DOMA 1QQ7A 3ASZA 3NWEA 4NP6A 4JYCA 1DEOA 1DO0A 1QBKC 3ZI0A 5JAMA 4JN6B 2CWDA 2FEOA 1UANA 2JKVA 3QBTA 4YV0A 1U8XX 3WIDA 3P0HA 4KAFA 4RMJA 3USCS 4KR6A 1UZMA 2DPGA 1Q7TA 1J00A 3HP4A 1RXYA 4OGGA 5FOXA 4J3FA 3RS9A 1E2NA 2XZOA 3L8ZA 4KGVA 5CM9C 3W2IA 4OG2A 1PNTA 1XRPA 4YCCA 3DKIA 5M5BA 3L46A 3OJXA 3ROZA 3L18A 3NIDB 4E7OA 2RK6A 4HOYA 1Z0ZA 3WRXC 4MQFB 1P3JA 2V7PA 1RAFA 3HRIA 4C1NA 3FROA 4JGIA 4QOSA 5BN4B 2L2QA 2ZSFA 3TTWA 3UGJA 1H93A 3TECE 3G9TA 2XRZA 3WGYA 2PMKA 1NSTA 1QRDA 1KBQA 1U99A 4QDTA 3VA7A 5ESXA 3BEDA 4BE4A 4V38A 1ISFA 2KBFA 2V6FA 1JG4A 1FOEB 4WKPA 2AGVA 3QEAZ 1DELA 1U0OC 5LOVF 4UMDA 1KJIA 3EFHA 4ED9A 4F6RB 1M5RA 4R6WA 5AVYA 2R1VB 3ETCA 4LISA 4WLFA 2GR9A 2X42A 2PY6A 2FPUA 2MSDB 3BKWA 3HJAA 1Y8ZA 1AHHA 3A6LA 2TMKA 4DPKA 3G5LA 5DNWA 3GCGA 4WFIA 3AZOA 3AONB 1SUBA 5K0CA 3MCZA 2G17A 3Q7QA 2YMQA 3RTAA 4BXOB 1KK3A 1ZGZA 4PNHA 2PKRA 2B34A 2Z1DA 1CDZA 3KKLA 4KO2S 1PDWA 3AHCA 4O0MA 1QDUA 1MA0A 3KKKA 1OW3B 3IR7A 3SQDA 4GRIA 3O4JA 4BUZA 1XA0A 1OV6A 4X20B 5DFAA 3OCCA 4NJMB 1P5RA 1FJHA 2XW6A 3AUJB 1N0IA 1Z5PA 4NK5A 3TSZA 3W4KA 3F9CA 4EVQA 4YCSA 4AQ7A 2VYVA 1KY4A 3FDXA 2LXNA 3DCIA 1X77A 4MZXA 4L1KA 3QEOA 1AB5A 1DJQA 4FYYA 4XDZA 3GG9A 4XWTA 2IXBA 1XPRA 3DKRA 2J3MA 3GNSA 3SZMA 3U81A 4ACAA 2AUTA 3WKCA 1XFDA 3VPCA 3VZRA 5KHLB 2ZE6A 3FTDA 3SBEA 1Y3AA 1XCGB 2BBOA 3OURA 1EUCA 3ISTA 3L07A 4DXDA 4L8VA 3HCWA 3NTVA 4BRUA 2J0QA 3OHSX 3S5JA 1TUBA 1JHVA 1WL8A 1ODKA 3KJFA 4NC9A 2WICA 1V5EA 5F2EA 2GPJA 3C4QA 1KTVA 2CLOB 1FP4B 5IKXA 4HVAA 2EJTA 1EFLA 1HFKA 4URUR 1QM5A 5FBVB 2GN2A 3LP5A 2HBYA 3GG2A 2FX2A 3KU4A 3P26A 4YV1A 5LJLA 1XPUA 3NBKA 2JBAA 1Z0SA 4F1WA 3UT6A 5B4UA 3TR0A 2ZUSA 1ULHA 1CE8A 3MT8A 3K09A 5FV4A 1V4VA 3RC7A 3CLHA 5DT2A 1F2VA 3WLFA 1QHFA 1LH0A 3E03A 5LYJA 2FQ1A 1X42A 3TE6A 4OIMA 5TT0A 4BBAA 1PVVA 2FCAA 2O3TA 4E09A 1GZVA 2JFOA 3QJ5A 2P4QA 5FTMA 2AKEA 2EKQA 1YIOA 2GD0A 3GRZA 3H2IA 3KB1A 3QUAA 4TS9A 1OV4A 4LWZA 3S2EA 3BHMA 1N1DA 4GX0A 4N0MA 4ZCMA 4RDXA 4MRPA 7GPBA 1ZSVA 4I9GA 4L9SA 1Z5ZA 1E8MA 4ZOQI 1N5MA 1U8UA 3L79A 3QQPA 3K96A 2EKBA 2ZCVA 1DC7A 1YA4A 3HN2A 3QFSA 4N0PA 4ONEA 1WP4A 1NMXA 3GHHA 1Q0HA 3AHIA 5H1YA 1EJBA 3CLSD 2A9JA 4YRPA 1GL6A 1XQ6A 2BZ0A 4K9SA 3I6IA 3T9BA 3VDMA 1QQ5A 4CM7A 2M6KA 2NVWA 1HFJA 4DRYA 1FXUA 5AICA 1HTWA 2Z30A 2GCOB 1Y34E 3BHIA 1E2BA 5I9LA 4M88A 3A6JA 3S40A 4BNTA 3N5KA 5GWXA 3I5XA 4RD2A 1HF3A 4BCCA 3FMVA 4BX2A 1Z39A 4X7PA 1AKNA 3ESRA 1A7KA 2DY0A 4LC9A 2A1TS 3ZZNA 1OXSC 1WF6A 4LKRA 3WLTA 4I3HA 2P62A 2VP3A 1ULAA 2XNSA 5CTJA 3ZH2A 4ZT3A 4YRGA 3LY7A 4E11A 1F1JA 1R4NB 2G28A 1UMBA 2W6IA 3CN9A 1OUMA 3HDJA 4GM0A 4CTKA 2CFSA 2CJWA 3EWNA 4QECA 5ECYA 3D2AA 1LRJA 1T3GA 3HVKA 4LZNA 4TLDA 4QKQA 2JI4A 2PFKA 5JD3A 3HO1A 4D25A 3TK1A 4LVCA 2ZIWB 1UXJA 5LD2C 5EE1A 2H08A 2L69A 2D1RA 3FNGA 4V0SA 1M72A 4YLEA 3T9DA 2PJZA 1AQ6A 4I9NA 3TCKA 1Q12A 3ESCA 1VLHA 1I4LD 4QQNA 1XNQB 6REQA 2ZRNA 3M1YA 1RPJA 2P3QA 2PX5A 3OG9A 4YJGA 2F3UA 3SSNA 3ZEAA 2ACKA 3S7ZA 2HJVA 3F2IA 1HTBA 1EE2A 5JS1A 4G81A 2JA2A 5DXFA 1KP2A 4CMEC 1Z4QA 3TZHA 1KMIY 3FSGA 1V95A 2BGIA 2G0AA 2IYFA 4KU4A 3I34X 4WDRA 4NQRA 5HF6A 4JLMA 5HZHA 4AY6A 5JFOA 1M67A 2P9JA 3WISA 1UPAA 1OASA 1AGNA 3G9QA 4HQLA 4PPFA 3SQNA 2QPTA 4ZTUB 2Q0HA 3DEFA 3FF4A 1XU4A 2ENWA 4X6UA 3AHDA 4JLPA 5GV8A 5KTYA 4TMKA 3QSGA 2V7BA 3HJFA 4NK4A 4HJXA 2VP4A 3OZVA 4B6GA 4KVFA 1Y37A 3AP3A 3T9CA 3H9UA 4S3MA 3VR5H 2XE6A 4CGZA 3DNFA 1LVUA 1GZ3A 4XCVA 4B81A 3D81A 5IVKA 1DBQA 2ON6A 3BMCA 4GWKA 2WB2A 2O2HA 2PRIA 3DMHA 1HT3A 4J07A 4J1QA 2A0YA 5U1PA 3RAEC 2QYTA 3BKXA 4X85A 4QPNA 3ZU4A 4KIJA 4KOEC 3U7IA 4ND1A 1IQPA 5E95A 4ZARA 4CM4A 5CJPA 3VZBA 2X40A 3B89A 3CEJA 1EUYA 1DAPA 1W96A 1VE3A 1RKVA 2PMDA 2ZKIA 2CLDX 2J30A 1J70A 3N2KB 5J4LA 3TD2A 2ZT7A 1YFZA 4IH1A 5KC8A 2QTAA 1JVNA 4DCPA 4LX8A 1EFTA 3RSOA 2C9MA 5KKAA 3L8DA 4JJEA 5LYJF 1YQTA 1FRZA 2X4LA 4Q18A 4Y1EA 4F1JA 4EUNA 4GICA 4YR7A 3I9OA 3RG8A 5JTUA 2H1FA 2OHHA 1XUOA 5C8YA 3ETDA 4C89A 5JEDA 1ZM2A 4DNPA 1RBZA 1NW3A 1KAOA 3ER6A 5EVCA 3RHZA 4B4OA 2O8EA 4Y7CA 3R5KA 2JI8A 2O4CA 1E2LA 2VNKA 2NOAA 2JATA 2WSSA 3EULA 1SUEA 8GPBA 5MN4A 3ND5A 4IXMA 2GTHA 4EF5A 3LBHA 1U7WA 3JQGB 1QE3A 2Y6UA 5C81A 4Q4AA 1W0CA 4TZ6A 3IUEA 3F8TA 3I6ZA 4RGBA 4JB8A 3KKOA 2IU0A 2YIVX 3TRKA 2BSQA 4R6XA 3D4LA 4Y2GA 2O0JA 5IYZB 1H6CA 4AF8A 3FW1A 4L0QA 4YJKA 2PQ0A 3C6BA 4K5QA 1I1HA 2Q99A 3KL2A 2BFEB 4Y6OA 1U2DA 3A4IA 4O3MA 1ETUA 3JQRA 1U0LA 4L3OA 3HWRA 4LC1A 1K86A 1YOVB 3IUJA 2X9VA 2ZG6A 4AUNA 4D3YA 5JH7A 1JKXA 5DOZA 2O54A 2WJIA 2QR5A 3IEIA 5KOHA 3R0VA 2FUG6 5AW8A 5KX5A 4PICA 3GLFA 1T5LA 4OHVA 4YMIA 5A7HA 3ZHSA 4OXIA 2GM3A 1Z7YA 2V7QD 1NJGA 1PGOA 2UVDA 3CV3A 5A3JA 2F90A 5JT1A 1KKMA 1Z29A 2ODPA 5KYYA 3IQEA 1X7DA 2I9KA 3OF3A 1VSUA 3ZJ4A 2ACEA 4LFBB 2D2FA 4KK3A 1ORIA 1RYFA 3DTVD 3BCHA 3OQBA 3V6MA 1FFAA 3O94A 4JL5A 1Q1EA 2PS1A 3BRWD 3NP9A 4GGMX 4ISCA 4M6WA 2FEXA 3OLXA 2ADFA 4DMUB 2WKSA 3F97A 3OCZA 3T8YA 5K3FA 2PS9A 2V97A 5FPYA 1T9HA 3B9QA 4DRZA 2FEAA 2P9EA 4HN9A 1M34B 1OXMA 3O8DA 3DM9B 3C2QA 1DX9A 3THSA 4WZAB 1JHMA 4KLRA 4R1QA 5A3SA 5GZ6A 1K9SA 1OYOA 1X2BA 4X24A 5FTLA 1J2TA 1Q1QA 3COSA 2ZIAA 4C04A 4HRVA 5KSZA 1Z75A 4IEEA 4CKEB 1L7OA 1LGYA 1U6KA 5K0ZA 3M6MD 3TBFA 1HDCA 3OLZA 4B44A 2UUCB 2YW9A 1OLSB 1UBCA 2ZJ4A 3DSRA 2P77A 1S0UA 3H6KA 3RB8A 4GKJB 2EHJA 5EP3A 2Z56A 1XMQB 2Z98A 1A88A 2HSWA 1TRHA 1AHNA 4ES6A 2XJ9A 1CP2A 1F8YA 3E3NA 1N34B 1ECCA 1R4MB 3K8ZA 4YJFB 2IGTA 4E21A 1XTKA 1TYCA 2F8MA 3OT4A 4HAIA 4BFCA 5LDDC 1EXMA 2JHPA 2XKBA 5EINA 5JNTA 1OH5A 1AGRA 3GBPA 4YQYA 1N25A 5LYYA 1RCUA 2WU0A 1NVVR 2DQKA 4GPD1 1WE2A 3OT1B 1ORHA 3F73A 1RYDA 3S99A 3SG0A 1N5OX 2ZCJA 4J1SA 3S4YA 3UUWA 3W2FA 5LQAA 2FR8A 1NVUQ 4V1CA 5C8YF 1DIHA 1TJ3A 4I0WB 4M98A 5DBGA 1DIGA 4ZQIA 4KUGA 2DULA 1JSCA 3HL4A 4PLGA 1QH0A 1UZAA 3SC6A 4C3UA 2FPPB 2KMLA 3WLNA 1C81A 4J0HA 4EB8A 3MNFA 1BX0A 3DOIA 3TEJA 3I04A 3KT8A 3VDXA 3ZGYA 4Q9JA 4H7FA 4C2UA 4NCXA 1KBOA 2WOOA 2W00A 1KRHA 4AMBA 2HCJB 2IXEA 4JLOA 1P5FA 3KJNA 4PLZA 4TMWA 3IMCA 4B6JA 5LFAA 4HSGA 2HU2A 3N75A 4FHCA 4L8GA 1LA2A 2O1WA 5KOIA 1GEEA 4DG5A 3E61A 1QP8A 1V5GA 4X90A 1J99A 3CU5A 1CJKC 2FWNA 4MHSA 5BSUA 4KMMA 3X0DA 3ZD6A 1RRFA 1OLUA 3OIVA 5CFRA 4HEA1 1EU1A 1JEDA 1MTZA 2XXAA 5JI3E 3WK9A 2QN6A 1P19A 2Y67A 1RWQA 1JS1X 5KX5F 1CIPA 1TOAA 1UM9B 2Q4OA 4X3PA 2OFPA 2YVQA 1ZRHA 4HH0A 3A1FA 4YT5A 3QFCA 2C95A 2BEKA 3DLCA 3ROQA 3BRSA 2VDPB 2IYSA 2WJGA 2NSJA 3JD4A 1L5FA 4HJRA 4IDEA 2WTXA 3PD1A 4DIEA 2PUAA 2RCYA 4LV5B 3WRYC 4HXEB 3KOOA 4KG7A 4FHEA 2JAOA 4OP2A 1MKYA 5JG7A 1WX1A 4RE6A 3L02A 2Q5FA 3I1FA 4CLXA 1ORRA 1I7SB 3WLIA 3HBJA 3PXAA 2C77A 1CZUA 3SPXA 1U4OA 1J5PA 1CY4A 3I45A 3NANA 3OWOA 5DH9A 2I7VA 1OA1A 1TKBA 2VHTA 2ZYTX 3HSYA 4JQCA 3SU8A 3Q3JB 3ZJTA 2X13A 4OA8A 5TPZD 2C03A 4BE9A 1KR2A 5C35A 1HDXA 2XNCA 3EXG1 2HK9A 3DYIA 5EGNA 4Z2AA 1PSDA 1KFJB 4CR7A 4UU8A 1KHHA 1A5ZA 3WBBA 4N8SA 4BFWA 4CE6A 4JR0A 4RLQA 3TOVA 2DB3A 4LTMA 3WNQA 2NSHA 3WSVA 4UCXA 3CJQA 3P7MA 1Z35A 2EC5A 2H63A 1GUAA 3LT5A 4JH0A 3OQIB 5THQA 3EIUA 3ROTA 3Q2KA 3WICA 3MSXA 5JC1A 3VX4A 3IVAA 3QLVA 1BQEA 5LQNA 3TXAA 4Z8YA 4P54A 2C7QA 2H1HA 3RQIA 3UYKA 3V48A 3FMIA 3NEYA 2E82A 3A3YA 3HVIA 3V4LA 1AA9A 1HG0A 3DXYA 2CYAA 5FEUA 3DG9A 1X74A 3O0DA 1XQWA 5D8DA 4LQ4A 5FBZA 4P33A 1LC3A 1OT3A 2GJ4A 3L04A 1JU3A 1S2LA 5AHXA 4P4NA 2GBPA 1V96A 1PL8A 3HB1A 2J32A 3HJCA 1ZP6A 2O48X 3KDPA 3AX6A 2AOWA 4EJFA 3RWOA 3D6FA 2WDZA 4HDMA 4ZANA 2MSLA 3F67A 1AVTA 3OUUA 4G86A 3HBAA 5EWMA 3D2BA 4OUKX 4ZVKA 3QPVA 4COOA 5HUHA 1MEJA 1XDZA 3D6UA 5E9QA 3TG2A 1DMRA 1SHUX 1W36B 3HR7A 2R7LA 3ORSA 4I4LA 1ORWA 2H51A 3AHGA 4IAOA 5LLDA 1JDTA 1XMVA 2XUOA 3LHSA 3B6ZA 2VDMB 3W4IA 1PR5A 4NYJR 3KAJA 4MYHA 4EZIA 4R71A 2ZKLA 5IT4A 2DSNA 4QPJC 3DHWC 4EA6A 5DNCA 1RJ9A 4HNHA 2ETVA 1F6WA 4JEMA 2CUNA 1ZQ1A 1E2MA 2GAFA 4LBYA 4QYWA 3TM4A 2XUGA 5HK8A 1UJ2A 4MNTA 3ZX5A 1USKA 1UBSB 4DEYA 4E15A 1A98A 2II6A 4G6ZA 2Q1WA 3IUYA 1XTIA 1DLIA 2F62A 3UK0A 2YXBA 3L7BA 4JOSA 3ZWVA 3ORQA 5B3JA 2JLUA 1Y5NA 5FO1A 3WGIA 1E4EA 3F7TA 3WRVA 1XD8A 1RE0A 2CCJA 2GLTA 3PXGA 3T41A 3D3NA 1A0OA 3LK7A 3R7WB 5I3ZA 4LK3A 3DP9A 1XZCA 2ZI4A 2VDUE 4WE3A 3JQBA 3LBAA 5TGDA 4EFKA 3BB3A 1GTRA 1HKUA 2VKQA 2CXHA 3KQVA 4HFNA 3O8CA 1GQSA 4HDCA 3GRAA 5CLJA 5IANA 3UUGA 4IH9A 3KOWA 3WDKA 3AVWA 2EV9A 1FNBA 1RWKA 3MFYA 3SC2B 2JCGA 1QIKA 3H5WA 1YT5A 5FEMA 3GEBA 4QXOA 3REQB 4CM8A 5MN5A 1HZJA 5TLSA 2GZ1A 4EM6A 3TQFA 1ZY2A 2ODTX 2YHSA 5I5GA 4EW2A 2D6FA 3OHMA 2G09A 3RSGA 2BDTA 2H1SA 3L0IB 1HL7A 1BVUA 2FUKA 5HQ3B 3MF4A 1R88A 1GPYA 3FFTA 1C3OB 3ICPA 2WEKA 4C2TA 4JL8A 1FJGB 1HURA 2CXNA 5JXWA 2RHTA 2JGIA 2GX6A 2XKKA 4F85A 5JS8A 3UTCA 1X7ZB 3O1JC 1VHQA 4HDKA 2CDBA 1QH1B 1NVVQ 2VHZA 2OCBA 1WSAA 2N47A 1GL3A 3DOJA 1DLJA 2HIHA 3E7DA 1JQJC 2FW7A 4J3NA 1XJQA 3UN1A 4OLAA 4P3NA 4B82A 4PFSA 1YQDA 1X0VA 3DL7A 4MROA 4OKNA 4ZGWA 4EB6B 1TUGA 3RAFC 1NPDA 2SKDA 1DADA 1Z4NA 4GZ6A 4RHEA 3NBQA 2GXSA 2HSDA 5FFFA 2PEZA 4YCAA 3GRKA 2GCEA 5DBIA 4ZT7A 3ZD8A 1RP7A 1SVOA 2O23A 3FCSB 3MUNA 1W19A 2HLDA 2C54A 1FPQA 2PL1A 3LIPA 3BC1A 4WLNA 5AKXA 3DUFA 3V7FA 3OD5A 3OU6A 1IVNA 4JJZA 3UWDA 3QTBA 2B2CA 3ZV7A 2DFDA 2MTBA 4X8OA 1UBLS 4ARVA 4WZ6A 1DI0A 1GCGA 2Z6VA 3NKVA 1GAWA 3H5NA 2PZKA 3PRYA 4AKGA 3DC2A 3D6VA 4Y1FA 4S1NA 2MMCA 5TQ2A 2YX1A 5LZ7A 3T1HB 1ZESA 3QG1A 4A10A 2VPQA 1Z17A 2ZAGA 1Z6AA 2A9KA 5ILGA 3CKYA 3E3MA 4QLOA 4MI3A 2TRSB 5JPIA 4ZYVA 5EIAA 1ZNWA 1S1CA 4AQDA 5B55A 2C5HA 4N47A 1X8KA 4EUSA 3O2QB 2IYAA 2DFKB 3DE0X 3WAKA 2QLLA 5J1SB 1R0BA 3E3OA 4K40A 1CULC 5EJ5A 2AG6A 5AKYA 1W0JD 1XJ0A 4K81B 1M1YE 5HTOA 5A5DA 4XZ3A 5HDBB 3RRYA 4F5DA 4JC8A 1SWVA 2ET6A 5HJ5A 2BZ1A 3WGLA 4E14A 1P8JA 3RU9A 3EVGA 3HTXA 3DEYX 2A57A 1OBCA 1MT0A 4BP3A 4MAMA 3FTNA 3HY3A 3K9CA 5E6SB 2OCDA 2HDWA 2YXDA 3NASA 3OZFA 4UBLA 3EX7C 3ENZA 4BB5A 3HUDA 1PQ4A 1WNTA 4KR7A 1ST2A 4BTVA 1RLJA 4ZQHA 3V34A 4OVKA 3QU5A 1C7FA 3LY5A 1AS2A 5CX1B 3HL0A 1EXDA 4PZ0A 2NWQA 4FNMA 1MCZA 4MUXA 2O8DA 1XCJA 2Q7DA 3DBOB 4ZQCB 2X5OA 3AHJA 5DGIA 5K01A 2B9EA 1NV8A 4PLCA 2QA5A 4CHTA 1C9JA 3ZPXA 4N41A 4NYMQ 2HQBA 2QE7A 3R40A 4MWEA 3MWGA 4ON9A 3FXAA 2GAIA 1U2EA 5DLPA 5GQSA 2JDID 4HWOA 3C70A 2J41A 4FNGA 5CU7A 3HO8A 1P17A 1RZVA 4XDYA 1Q0PA 5EP4A 1OHHD 3ROPA 1SNYA 1ULSA 2CYCA 2VA9A 3CKKA 4IIBA 5LU9A 3EZLA 4Y6SA 4N48A 1F8UA 3N2GA 5D2CA 3M3DA 4TKMA 4R31A 2VQFB 3ZWXA 2CW5A 5FX2A 2AWOA 4JVMA 2OHXA 2UZ4A 5ALIA 2G0NA 4EMTA 3OPMA 2QL7A 1XYYA 2O14A 3G2OA 1TZCA 4N3AA 2QK4A 1A5TA 2GK4A 4PCVA 2O5CA 3SJUA 3S1SA 2PL3A 5CJJA 1V16B 3AY7A 1TADA 2QZJA 3H1AA 3JAWA 2PX4A 5HFJA 4RQBA 2PUFA 4G24A 2DTEA 5FUMA 5EZYA 2X86A 1PTJC 3KBOA 1C7RA 5EFZA 4QNRA 1G8KA 1PWXA 2HDNB 3BA1A 3K8OE 1JXAA 4XJSA 3FPGA 2I67A 4RZQA 4D7AA 1C30B 1FJ2A 1W73A 5TS2A 3LY9A 2EVWX 4E2XA 3KJQA 4KYVA 1TJ4A 4HNRA 1NXWA 4RABA 1C1XB 3S44A 2OM6A 1KJWA 2JIBA 1DKLA 1K63A 2PWAA 3OPYB 4NYJQ 4D4JA 1M6VB 5FH9A 2HJSA 5LMZA 2AOTB 3LZDA 4KXQA 1J24A 3ZCTA 4BIMA 1NRIA 5JSZB 3SSMA 3O84A 2XA9A 3GT3A 3KZMA 1RAAA 3RVRA 4E3ZA 2HJRA 3L49A 2A35A 2AC7A 2H65A 2O3QA 4QT4A 2BGKA 3V4OA 1SZCA 1LSJA 1R6DA 2FZGA 1GOTA 2GS9A 1C7QA 2EWWA 2FY8A 5D6OA 5AW6A 3AU8A 3RYHA 2QN8A 1L5VA 5FA5A 5K3BA 1NVDA 1ZXXA 2AW3A 3NX4A 5DEIA 5KNCA 2GJ9A 4CLRA 1OVGA 4MJ3A 1M2NA 1Y98A 2DBZA 3KOYA 5E3JA 3HM9A 5I3CA 4NS1A 2ENUA 2SCUA 5DWVA 2PZAA 1WZUA 4MYSA 5EQTA 3VMFA 5GJBA 3W3AD 2XEXA 2EERA 3IOEA 4FYXA 4RXUA 4EUHA 2V9ZA 3BQNB 4TRNA 2KE5A 4JUCA 1WVMA 4CT4B 2BZSA 1RI2A 5C8ZA 1B6RA 5AM5A 5DP1A 5FOVA 2Q6VA 1EUDA 1NHGA 1AZLA 2REBA 4ZALA 5JNWA 1L1FA 2ZRHA 4E1VA 1PJTA 1S7CA 2FWAA 4IRXA 2ZM5A 3GZTB 2R6ZA 4K9NA 4Q4DA 3GJ6A 1ZOLA 4K26A 1G20B 2D4HA 2HJWA 3TIGA 2Q5JA 4Y2RA 2EF0A 3AJEA 1EIWA 3W2EA 2YNMD 1M74A 2NGRA 3WRWA 4CEJA 3KJGA 4RVUA 1SH7A 3TBKA 3LHDA 1YULA 3CCBA 1U7UA 1EWKA 3L1UA 1OB2A 1VJGA 4CV2A 2W2KA 1I13A 2WBLC 2C58A 1YVEI 5J2TF 3R5HA 1G8AA 1JQLB 4CTNA 5HGJA 4JB2A 3N28A 2IUUA 1A3CA 3E5HA 3U19A 2X4IA 4JI0B 4BRSA 3ZC3A 3FWZA 3Q40A 2H31A 2PXAA 1QBGA 4RL4A 2QW1A 4AU1A 4R2MA 1F8GA 4BMPB 3KYCB 4U4AA 1LLDA 1GITA 1YZVA 2PAAA 1Z8NA 1DFIA 2HA3A 5HDQA 4G0UA 4LWQA 1NY6A 1OI4A 3U31A 1Y8CA 2JLZA 3Q15C 2AOUA 3GDHA 2WVGA 2IV3A 5JHGB 4PX3A 4YP6A 3THYA 1DEXA 2YFHA 4NULA 2FRDA 3ESYA 4EK9A 1IVYA 1IY0A 2Z2ZA 4R1SA 4ZD6A 2IZ7A 4D9MA 2FPWA 1NMSA 1OZGA 1YKGA 1OXUA 2FZ5A 3N5CA 2WU3A 1MB2A 1FLDA 3GGSA 2QTTA 4KH0A 4NPHA 4XFJA 4C05A 2ZB4A 6YASA 2J7KA 2WSMA 2P0EA 4GVLA 1N32B 4IHAA 2F7SA 2NZXA 3A2LA 2RI0A 3OPVA 5IJ9A 1IRXA 2I80A 3KNZA 3SMQA 5KSOA 5GM1A 3N3BC 5LP6A 4E51A 1QQAA 1XEWX 1W29A 2Q27A 5EZYF 3QU4A 5FBKA 2QD4A 3MJVA 3D3JA 4NICA 1R10A 5JXJA 5KPJA 2JZOA 5D00A 3EDOA 4M3NA 1D0VA 4MV0A 4XFDA 3EEBA 4ND2A 1ATIA 3DONA 4X84A 3CZCA 2GN9A 1JEQB 2DFTA 1SKAA 4PTLA 2EZUA 2ZT5A 4HB0A 1FZQA 1SKMA 3C16C 4IQ8A 5JUWA 4LOJA 5J4KA 4PCAA 2NADA 4JKOA 4GOLD 2GEVA 2ZYAA 4RY0A 2AWNA 3N6XA 5HIIA 4KR9A 2OXIA 2VYVD 4EARA 4EOGA 4W7SA 1TAGA 4QBFA 3JSXA 1DWQA 1XVAA 3NOXA 1Z63A 2R2GA 3JVIA 4WZBB 4E12A 1ECFA 1UXOA 1SQSA 1T2EA 5EMHA 1IFXA 5H5JA 4D8WA 5KUTA 4YACA 3AF2A 4KFTA 3HVJA 2IPOA 2O19A 1F0KA 3FG9A 1K27A 4L2IA 1I3CA 3CR3C 3DKVA 5BSEA 4Y9RA 4D6XA 3LBFA 3OZDA 4UEOA 1K68A 2P30A 4UU1A 5EJ7A 1ZC4A 3Q8MA 3V8BA 3IUMA 4YT4A 1C9KA 1H94A 2XUDA 2Q07A 1BIFA 3L7YA 1KKLA 4RTLA 3LLSA 2D5LA 1E9CA 3K0HA 2J9FB 2VP2A 3NBXX 1HNNA 3W6OA 1K75A 4DEVA 1X8JA 3NJ4A 4M9QA 1XRLA 4FFNA 3VYSB 4F06A 2A92A 5T8KC 4US2R 3U3KA 2HB6A 3BREA 1MJFA 3ANSA 3AY0A 3OQ6A 4BFUA 2G40A 3OOEA 2O9JA 4LI3X 3GUUA 4EF6A 2ZW9A 1U3CA 1LQTA 2RAFA 2LTAA 3GCDA 1V1MA 4DV7B 2B8TA 2J3EA 3CX7A 3NFYA 1Y8RB 4PPQA 3UOWA 1ZM3A 4B6PA 2A58A 1F2DA 3LC7O 3SOPA 3BD7A 1YKFA 3I42A 2GLXA 4M1YA 5I7OA 4KJXA 3ILSA 2VDNB 4BZXA 1PL7A 2A0KA 1GGNA 2OQIA 1KO8A 1SFRA 1NZJA 2BFCA 1IK4A 3MCTA 1NVBA 3ZNOA 3L43A 4AULA 3QLJA 3KQNA 4TWAA 3AHEA 5A4JA 2CV1A 3VNVA 4MB0A 3KXLA 4YFVA 2E4WA 3O75A 2P8SA 3B9BA 3O8QA 3PJEA 1D3AA 3PV0A 3ETLA 3FYUA 3N0XA 1Z6YA 4I46A 2W8BA 3W6UA 1UC8A 1WCWA 3AF5A 2PKCA 4NVRA 1SCJA 1EM8A 1VYVA 3OMWA 4N6NA 4RD1A 3EQ7A 3GMIA 4JJ6A 4M8IA 4W1QA 2M6RA 4MMYB 1GCUA 1XXHA 4XVRA 4F84A 3AV0B 3DTTA 3EVZA 4LCEA 4YRBA 2VJNA 2DUWA 2NSLA 4XE5A 2EFGA 3G8CA 3IMGA 4KX3A 1E3MA 3QKSB 1C4WA 4MDEA 2P3OA 5DHUA 5KJ6A 1I10A 1NZDA 3IDSA 4Q7MB 2W6ID 1PGNA 1KERA 5EJFA 5C5DA 4BZQA 1Y1QA 3NCTA 5CDSA 5AVQA 4BNGA 1G3MA 1W48A 4OXXA 4Q1AA 3Q88A 2FSVA 16PKA 1J8DA 4NE9A 3ON5A 4FJ1A 4R54A 5FA8A 3U7QA 3P4UA 4KBFA 5LP6F 3IKTA 1YTUA 3UWPA 3R8FA 2IYRA 3IKJA 1NBME 3H6GA 4M0CA 4Z0PA 3HFJA 1JLRA 2WVAA 2YUIA 2FZLA 4ZAXA 3SX2A 1THGA 1TZBA 4KNVA 2OFXA 2B4QA 3OZIA 2V9CA 4O02B 1AHPA 4L75A 5BT8A 3DVAA 5HIAA 2PWPA 5AOBA 4E32A 3NDIA 4HEJA 4RKQA 4HZIA 4CIWA 1IONA 1EG2A 3HMQA 3FSGD 3I9MA 4O4IB 3IP5A 2P6UA 1QNFA 3G59A 1NJFA 4I1VA 2DHQA 1J2JA 2HH9A 2G1UA 2HWYA 4RTKA 4HZUB 1GFWA 1D7AA 2WT8A 1XZDA 5E0OA 4DV4B 1ENPA 3BE5A 1XEWY 4W63A 4XGNA 4HHEA 4Q9AA 4W9NC 5IXJA 4NXNB 3WIOA 4KXLA 2PNJA 2QDKA 1KARA 2R79A 1DG1G 1XNRB 4J0CA 3N74A 1EHCA 3HDYA 2NT4A 2R97A 4EW1A 2HRCA 3ROKA 3BGVA 3UWKA 4CKYA 3JQ8A 4Q3BA 1UDAA 5KCMA 2B1RA 2BFDB 4D81A 3INNA 3KPYA 3DO6A 2P79A 4L50A 5FAXA 1YQEA 3LCVB 3VKHA 4BLRA 2ZSAA 4ENQA 1M2VB 4X93A 1K5DA 1CY8A 3WDMA 5DPMA 1SB8A 3GDGA 2C7GA 3Q2IA 3QX9A 2YQZA 2O1XA 1LBSA 3W5VA 3WC4A 4G5OA 3GN1A 3O47A 4FHGA 1TIPA 3AETB 3OC6A 2PGNA 3OZRA 3M4XA 4YMHA 5IMBA 2EYUA 2HLHA 1NC1A 3DMTA 1M9NA 3NHMA 3L41A 4GBED 3SZOA 1ZZGA 2PZ8A 4TSRA 1KSGA 4QQRA 1L9XA 4BBJA 1QIEA 1IN7A 4TTAA 4ZZIA 3T4XA 1LPAB 3ND9A 3ICQB 1NBEA 1A7AA 2VDOB 4YVFA 5CCBA 4BNLA 1SVIA 4OJMX 5F5XA 4JELA 2GT1A 2B8WA 4D0SA 1P1KA 1M5UA 3ANMA 2HV9A 4FTWA 2Y68A 4HAZA 3WFZA 3UH0A 4BVGA 2WSSD 1YAHA 1XCPA 5AIAA 1E60A 5HYVA 3SLKA 2J7PA 1U0JA 2VPTA 3INYA 2WUDA 4R51A 1EJ2A 4OOFA 1U7ZA 3QPAA 2HN9A 1EB9A 2PL9A 3G0OA 4PC6A 5GP1A 2GPYA 2YOGA 3P9RA 1D6MA 2Y1DA 4LVOA 3DT6A 1FRFS 2ZATA 3ZV3A 1GZ6A 4U9IS 2XSZA 4FQ5A 1KK2A 2G04A 2JS7A 3GGGA 4O2RA 5EE0A 3RODA 3TAUA 2LD4A 3CJRA 2CL6X 3GPIA 2GQ0A 3K0FA 4AKSA 3P2YA 5F35A 5I8WA 3JAKB 2I7TA 4JY7A 4DF3A 2K7FA 3E22B 1C8KA 3ACBA 2AUNA 2UYHA 2XZLA 2BSAA 2A88A 2J3IA 3KUKA 3JV7A 3VSEA 3DEIA 1WWKA 4DMKA 3VR0A 1T8WA 1WABA 3T94A 4X8MA 5A6VA 2YN4A 2BIFA 2Y92A 5BSRA 4LJRA 4JHXA 3D3EA 4URHA 3L3BA 3HXOA 4DIKA 4U1RA 3H0EA 3M4JA 2IJGX 2Z5LA 1CJMA 4GFDA 4YC7A 2HGZA 3C1UA 3NBUA 1MG0A 4YO7A 2PX0A 4MW7A 4BX3A 5B6JA 4ZQGA 2JLVA 3UBTA 5F4BA 2BL4A 4XYLA 2BTEA 2ZXEA 5IN5A 3K15A 1I0LA 1OYWA 2PZGA 1P3DA 2ZEJA 3PQ7A 4Q4CA 1JWLA 2WHXA 1BVHA 3THXA 1W47A 1Y1TA 3GAMA 3ZK8A 1E5DA 4E6PA 2O57A 3IIJA 1NWHA 3E9EA 3BFXA 5B37A 1XGKA 1OMOA 2V5UA 3FGZA 1XHEA 4ZQBA 4DLWA 2QN9A 3NIFB 3JYPA 4H27A 1U1DA 4E94A 2ISSD 2SKCA 4K6MA 4DSTA 1Q3KA 4JEIA 3WK6A 3FDJA 2OGZA 2RJ3A 1EFPB 3OE7A 4MUIA 1H0RA 4TKVB 1NXTA 1UBFA 3TZEA 4I3FA 1IXYA 1W46A 1BFDA 1TZ2A 1VI2A 3HCFA 4KB5A 4MRMA 5FORA 3RNOA 1JXMA 2B25A 1PX2A 4O2AB 5A9RA 3HK2A 1Y4SA 2A7XA 4ZVQA 4GMKA 1XMSA 2WLTA 1K7SN 2YIMA 2ZYIA 2O6LA 3C5VA 4I1RA 4KPUB 4KV7A 1A9RA 4PVCA 5DN6A 1EUQA 3AH8A 1RJGA 3A3NA 2DH6A 2OKGA 3ADPA 4K88A 3RKRA 5CB4B 5ICCA 1JAZA 1TF7A 2A67A 2RI1A 2E4VA 1K0UA 3LP6A 4FILA 2BRUC 3MRXA 4G8CA 4MINA 4RZIA 4ZAFA 3T54A 3JW8A 1CJSA 1E1CA 3U5TA 1OPXA 5EEGA 2GZ3A 2HSGA 3TZLA 3KSZO 3ZZ1A 5KOYA 4Z2YA 1WEKA 4XPZA 3UH1A 2IX9A 1WETA 1S6YA 2ZWAA 4QPZA 4NMWA 4P3PA 1KQ3A 2RH5A 2I3DA 1I01A 4YMVA 5GTDA 2CV2A 4KR3A 4R1LA 3DZCA 5ALPA 5DYIA 5IF9A 2V55B 1CUJA 1P0FA 1GKIA 1B23P 1C2TA 5JAPA 2XF2A 1V7QA 2XBUA