3DTTA

Crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
220
Chain Sequence
GMKIAVLGTGTVGRTMAGALADLGHEVTIGTRDPKATLARAPPFSQWLPEHPHVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIANPLDFSHGMPPTLNPVNTDSLGEQIQRTFPEAKVVKTLNTMNASLMVDPGRAAGGDHSVFVSGNDAAAKAEVATLLKSLGHQDVIDLGDITTARGAEMLLPVWIRLWGALGTANFNFKIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative coenzyme F420H2:NADP+ oxidoreductase (YP_830112.1) from Arthrobacter sp. FB24 at 1.70 A resolution
rcsb
source organism Arthrobacter sp. fb24
molecule tags Oxidoreductase
molecule keywords NADP oxidoreductase
total genus 68
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dttA00
1R0LA 2PR2A 1GZ6A 4D43A 3PDUA 2AA3A 3INTA 4EBFA 1HLDA 2ZB7A 3JYNA 4PRKA 5G0SA 4RLHA 3VDRA 3PIIA 4QFDA 2RAFA 3PFFA 1D7OA 1NPYA 3RWBA 2G5CA 3DTYA 3DBLA 3F5SA 2V6MA 2E48A 4R54A 5ER6A 2PGJA 1TT5A 3RKUA 2Y05A 3FF4A 3TFQA 3E5RA 3VKUA 3JQ7B 2O48X 3CEAA 5JSFA 1R4NB 1QYDA 2X5JO 4FFLA 5L53A 1HZJA 1ADGA 4P22A 1SC6A 4WLNA 1T25A 1BDMA 3AI3A 2PKRA 5IDQA 3OIGA 3RC2A 1HT0A 1RKXA 1GEEA 4O0LA 4RF3A 3GDFA 4DMMA 5K9ZA 3WG9A 1T1SA 1E3EA 3JQGB 4NBVA 3QVWA 4NFSA 5BNIA 2X5OA 2F1KA 3S8MA 4XRRA 1Z7EA 1I2BA 1QORA 5DBIA 4BO9A 4J1SA 1U3WA 4LSMA 4CV0A 2QG4A 1ID1A 3F6YA 1NPDA 2B37A 5A03A 5HWSA 5G4LA 3R1IA 5CFZA 3DOOA 1HE2A 3Q2IA 2I9PA 4TRNA 4EI2A 1CQJA 5TQVA 5KWEA 1Q7BA 2ZB3A 4UVHA 4NK4A 1Z75A 2C2YA 1Y8RA 1U1IA 2NU6A 4O59O 4WNCA 2ZYGA 3GC6A 4I5GA 3EAGA 1E77A 4HNGA 1NQTA 3KV3O 1L7DA 2DUWA 4DPKA 1TXGA 3WYEA 1HE5A 1N1EA 5COQA 2J3IA 5C7IO 4K28A 4MKRA 2DAPA 3GZNB 4WE3A 4WCDA 1HSZA 1LI4A 2NTJA 4PLZA 4INAA 2NM0A 1JLLA 3I23A 4YAEA 2SCUA 1HDRA 2PWZA 3TL3A 4B4WA 4IY1A 1R0SA 3DAFA 1DC6A 4ALIA 4OAQA 1ISHA 5IDXA 2PD4A 9LDBA 4Z6KA 2JFGA 2HK8A 3JSAA 3H2SA 2UAGA 4KOAA 2Q46A 2H1SA 1WP4A 4GLLA 2HMWA 1T2EA 2A94A 4AJ4A 3U3XA 5KNLA 4W9NC 1C0IA 3PVZA 3RKRA 1PSDA 3B6ZA 2AQ8A 3ADOA 4YEDA 1RM4A 2Z1MA 1TVEA 3AUAA 3S2EA 3BMNA 3HQ4O 1FDVA 4OKNA 3INGA 1UH5A 1XEAA 2JAHA 1AHHA 3E48A 1NVGA 3TNLA 1ZW1A 1ZNQO 2RH4A 4W9NA 1QYWA 1LDBA 1KERA 2YDYA 3F3SA 3MOIA 4PLFA 5KVSA 1DFGA 1KETA 2NVUA 3SEFA 5B4TA 4D79A 4CODB 3U62A 1J4AA 1PJSA 1D3AA 1K6IA 1Y6JA 4XIYA 3GF4A 4DBVO 4P4LA 4XB2A 3KRTA 3C1TA 2Q2VA 2WD8A 4XJSA 4BNZA 1T4BA 5AQ1A 1ZEJA 5TSDA 1GYRA 4YJGA 4YBZA 5F3RA 5BSHA 4FOSA 4NJMA 2PA3A 1H94A 3IJPA 4KMSA 4K6FA 3ZNPA 2POQX 1DRUA 3ETGA 1E6WA 1NP3A 1FK8A 1DRWA 3GMDA 4FBGA 1H0KA 1YVEI 3WLFA 3PGJA 1EFKA 2Y1CA 3I9NA 3AUUA 3BHJA 4YJHA 1I3KA 4PLGA 1VKOA 3ABIA 1YQDA 3SLGA 1DLJA 5JPIA 1GPDG 2VUTA 5T6BA 1DC3A 1E6UA 3HE3A 4BNFA 1NXQA 5A05A 3C1AA 1ZEMA 1SOVA 3DBHA 3GFGA 1F06A 4PLVA 1XA0A 2GERA 4FW8A 4EUEA 2Y0DA 4KUEA 3W8EA 5FEUA 1U9JA 1UXGA 3K6JA 4Z0HO 3WFJA 4AJEA 3I6QA 2C82A 2VZ9A 3OIFA 4ALKA 3GG9A 3FN4A 1ZXLA 1UXHA 2PY6A 3DBRB 3PQDA 1HYGA 3FBGA 4RPKA 5MDHA 1YONA 3SVTA 4EGFA 1ZK3A 4DIFA 1P1KA 3KLMX 2OOSA 1KS9A 1HDXA 2CDAA 3G0OA 4XYEA 3RAJA 1P9LA 1V3TA 5I9NA 3OEWA 4IDFA 1VPDA 1EUDA 2FY8A 4BGUA 5HBRA 3W1VA 4B7UA 1P45A 5CPFA 1YBMA 2BELA 5JDIA 3O03A 3TWOA 2B36A 2Q45A 2VRBA 4GVXA 3W8DA 5F5NA 2DBRA 3NKLA 4RLSA 3MJCA 3OJEA 4BV9A 3JYPA 1WDMA 3LYLA 4WCFA 3LDHA 1C14A 1PEDA 1DJNA 2BF7A 3DAGA 5I7SA 3KEQA 4NPCA 5BR7A 3WB9A 1O94A 4NNJA 1GR0A 1N8KA 2Y0CA 3AI1A 3M2PA 2VTDA 1H2BA 3AWDA 3GDGA 4XYLA 1GFSA 2AQHA 2HMTA 2I3GA 4IGEA 5H83A 2P68A 4MVJA 3A06A 4U8GA 1VC2A 4IM7A 3EY4A 1DXYA 1RYEA 4BGEA 2EKLA 1XU9A 3DBRA 3OETA 3G17A 3PWZA 2EV9A 6ADHA 3RFXA 1R66A 2CFCA 3ADPA 2AEJA 2DUUA 2YV3A 3F9IA 3NTQA 3QWBA 4OXKA 4E0BA 4LCJA 5A5EA 1G0OA 3COSA 1HL3A 1ZVMA 1OC2A 2P4QA 4I9NA 4OYRA 2EKQA 5ENVA 1ISIA 4DLAA 5CP8A 3OJOA 4MKXA 1FJHA 3DZBA 5T8KC 3UCEA 2ZCUA 2W90A 4M1QA 3DBHB 1NBOA 4BNXA 4ZA2A 4DWVA 4LW8A 1Z45A 4GWGA 3B20A 4KUGA 2O23A 2QYTA 2Y1EA 2IRWA 3UHAA 1E6EA 3GH3A 3GY0A 3OSUA 4GX1A 4LMPA 4MVJG 4W7IA 4YQZA 1EUCA 4D41A 2D59A 2BD0A 2IE0A 1PX0A 2X9NA 3WNVA 5KJCA 4IQGA 5DOVA 1DO8A 1X1EA 2ZTUA 3I9OA 1YB1A 4OMUA 4L9RA 3LLSA 4IGFA 2HAEA 4HV4A 3JYOA 4FGWA 2OORA 2A92A 3DAPA 3DTTA 3AY6A 4YJFB 1JU9A 4CLXA 4DYVA 4QEDA 2JL1A 5DCYA 3D5QA 3H5AA 1LU9A 2OXIA 3AJRA 4N7RA 4XYBA 1VI2A 1X13A 4I5DA 5COAA 1QG6A 3T7CA 4IXWA 3V1YA 4E3ZA 4B79A 1MB4A 4UUPA 4XWYA 4DTIA 5F5LA 3PQFA 1VJ0A 1LRLA 4N5MA 1SZJG 3RBZA 1NQOA 3TZKA 2NU7A 4DUPA 1LLDA 3OF2A 4O1MA 1F8GA 5H81A 4FN4A 1PL7A 3KEOA 5COBA 5G0WA 4U0JA 5DF1A 4RL6A 4GWKA 3PWSA 3OP4A 4XDYA 3PHGA 3F1KA 1VJ1A 4GKBA 2YQ5A 3CZMA 3LC1O 1SEPA 1VM6A 4B7CA 3MTJA 2XF8A 1H5QA 4OHUA 7ADHA 4I8XA 2DC1A 2FPGA 4I1IA 3VZQA 1E5QA 3JQ8A 1J5PA 1ONPA 2C20A 3JYLA 5L51A 2RIRA 7MDHA 3E6AA 1HWYA 1ZO8A 1ONOA 4CMEC 3GNSA 4BUCA 2ZYAA 1EVIA 4JBIA 2HMSA 4J7XA 4UAGA 4CMBA 3E9QA 1NAIA 4R1NA 4CM4B 1U7HA 3JQGA 4QO8A 1O6ZA 4K26A 4RVHA 5T8KA 1YL6A 1R15A 2FN7A 1I10A 1I30A 1UP7A 5AOVA 1DIGA 1LEHA 2QQ5A 3ROKA 1HTBA 3ZWVA 1U5AA 1GPJA 5JY6A 3GRKA 4MDHA 1LRJA 4CLDA 2JD2A 3DZFA 1GZ3A 4LSWA 2YDXA 4ZQGA 5CEJA 1UXKA 3GNQA 4JBHA 3R0IA 4CMAA 2NVUB 3JQFC 1T2CA 2YHIA 3AM5A 5L4SA 3RUFA 4Z3DA 1E7WA 2GZ3A 3GHHA 2EW8A 1EDZA 4OJNA 4KWHA 4XGKA 2G0TA 2HCTA 3GVXA 4BNGA 4JJIA 1PJLA 4GX5A 3ZV5A 2BGMA 3LC7O 4MP8A 5LC1A 4F3YA 1LNQA 1Q2XA 2VWPA 4CM7A 4DMLA 4RVDA 3GN1A 1RPNA 3LT0A 3S1LA 4BHTA 1MA0A 2GDZA 4RVSA 1SO8A 1MFPA 5A9SA 4HXYA 2R00C 2VOJA 4FOOA 1ZCJA 4PLPA 1M6HA 2VWHA 3WR5A 3PXXA 2DKNA 4BO6A 5G4KA 3IS3A 2VYVA 2B5WA 2EGGA 4FCCA 1A5ZA 3B1KA 4U7WA 2OUIA 4JXKA 2HK9A 4QO7A 2R6JA 2J5QA 4ZQEA 3RCBA 1WMBA 4J9VA 3G3EA 5KKCA 3ZWWA 1PZGA 2PNFA 2JHFA 3TL2A 5I9LA 4B8WA 1KVQA 1TEHA 2GPTA 3HDHA 5IAAA 3N58A 1HZZA 3JQAA 1R4MB 4J49A 5THQA 2AXQA 4DA9A 3CIFA 1ZJYA 2QYSA 3BMQB 3QSGA 3FD8A 3AUSA 1HF3A 3E8XA 3HFGA 4WECA 3H4VA 4IIUA 3WGIA 4XR4A 1IPEA 2BLLA 1NWCA 3GVHA 2DBQA 2NSDA 2HO5A 4AJJA 4PG6A 1PJ4A 2NQ8A 2GASA 4NU6A 1XHLA 4OQZA 4L75A 1QV6A 4FS3A 1GTMA 3JQEA 5JAZA 3PTZA 1R16A 1UDAA 3LQFA 1QXSA 1LLUA 3EW7A 3M6IA 2HK7A 2UYYA 4FQ8A 5KVQA 1ADCA 1K3TA 1LQUA 1WVGA 4MVJP 5C5IA 2C7GA 1ZK2A 2WTBA 3GG2A 1M2WA 4BKOA 3ZHBA 1PS0A 2P9EA 2HMUA 3VTFA 1W8DA 2WD7B 3X2FA 3DC2A 4PIVA 2Q1SA 3W4KA 5LDGA 3NEPX 3MJTA 2DPHA 3KBOA 4BKUA 5JBIA 2FR8A 2FR0A 2DBZA 4XCVA 3PHJA 4E32A 5A02A 5A5FA 4G81A 2Z95A 3CMCO 4J1NA 4CM3A 1LSSA 2JFHA 3M2TA 4ZD6A 1CQIA 2D1YA 1DC4A 4TMFA 4XQGA 3D3WB 5HS6A 1NVTA 1ADBA 4PLCA 1P44A 3VZRA 4ALNA 3ZWCA 3SXPA 2LDBA 4I5EA 1T26A 3TZHA 1T24A 4P8RA 4HWKA 3WQRA 5I8ZA 3KOUA 4YJFA 1GUZA 3ZDFA 5IDWA 2Q2QA 4EUHA 3K9QO 2R2GA 3GAFA 4I5FA 3RUDA 3EDMA 3O8QA 3OQ6A 5EERA 2P5YA 4BV8A 2OL4A 5G0UA 2OHXA 4D3DA 4Q3CA 3QWFA 2HDHA 4NR0A 1DHRA 3K31A 4XZ3A 3OIDA 3PGXA 3FR7A 1E3SA 4OL9A 3RJ9A 4XYMA 1TI7A 4LRTB 4QECA 1YJQA 2C0CA 3DFZA 3PK0A 2E49A 3Q2KA 2GYYA 3VZSA 4UREA 3VHRA 3T7EA 5FF9A 4LISA 3T4XA 2QRKA 1AGNA 1AXEA 1B8UA 2DFVA 3JD1A 4R5MA 4BO7A 4DLBA 5MGBA 4BNWA 2E37A 4OXYA 2W2LD 4CLEA 4FB5A 1X7GA 3FTNA 4HFMA 2WM3A 4YDRA 3VZPA 1ZK4A 4RF4A 1V3UA 4ILKA 1RM3A 2UUOA 2OGUA 2XPCA 4PLHA 4U5QA 3K8ZA 3TZ6A 4YT8A 5CDGA 5JYEA 4MIYA 4S1VA 4IQ8A 4IJVA 5IZCC 1MX3A 3NTOA 2IZZA 4EEZA 1MG5A 1X7HA 2XOXA 4ZN6A 1DAOA 2PZKA 1EK5A 3ITDA 1LLCA 4Z0PA 1DHTA 3I9JA 1FXSA 2PD3A 1UAYA 2QZ9A 1U28A 3EMKA 4BKRA 2O3TA 4DBZA 1F8FA 3LU1A 2NU8A 5EINA 5K6AC 3H5RA 1Z73A 1MV8A 4KUHA 4YAJA 5GZ3A 1KEPA 4DQXA 4E33A 4N18A 4MO2A 4L76A 1EBFA 3EVTA 3LT2A 4BGVA 2FPIA 1AE1A 3JQ6A 5AYVA 2A4KA 4FJ2A 4R1TA 1XG5A 4RPJA 3PZRA 3ETEA 4J4HA 3FHLA 2JKVA 8LDHA 4NH4A 2P4HX 2VCYA 4J6FA 4UEKA 2EIHA 3DZJA 1MP0A 4Y98A 4RDHA 1DAPA 1ZXBA 3IQDB 5T57A 1F14A 4MP6A 4TZTA 4PCVA 1PJ2A 2D2IA 3E5MA 4RVGA 5JS6A 4KWIA 3JQAD 1E5LA 4O63O 4B4UA 2Y1DA 4RV9A 1MUUA 2O2YA 1E3LA 1HYEA 3U0BA 2NU9A 5DBFA 5TT0A 3ZU3A 1PGQA 2Q4EA 2R00A 3H6KA 4Q3BA 3RC1A 5AXDA 4D44A 1RM0A 4NIMA 1UP6A 2ZIZA 1B2LA 4W6ZA 1LA2A 4CQMD 2ZKLA 3ZU5A 1MFZA 2CUKA 4MIEA 4I9UA 1P1FA 1YS4A 1PQPA 1SEVA 3GVIA 4M87A 1WZIA 4B3JA 4W99A 4A5OA 4QTZA 1I32A 5JAQA 3ZHZA 3MJEA 2CVQA 4BMSA 6LDHA 1A71A 4RVFA 1TT5B 2WMDA 2FSSA 3K92A 4P4GA 4HX5A 2X4GA 1A4UA 1XYGA 4JCOA 1YJ8A 2E6UX 3RUEA 4D7AA 1A9ZA 3WIDA 1EE2A 2J3JA 1PGPA 3QJ5A 5U1PA 2H63A 4IZIA 3U49A 3NDJA 9LDTA 1ENZA 2PGLA 1MC4A 3UW3A 4AG3A 2DTXA 4Z3KA 3PJDA 2ILTA 3AOGA 2I65A 2GSDA 5ICSA 1E7MA 3QIVA 1DIAA 4OQYA 3AM4A 4LRSB 3ROMA 2C54A 4XGNA 3GQVA 1U4OA 4ND1A 5A06A 4RF5A 3QWIA 3JQAB 3WMWA 3PYLA 4TROA 2PZLA 3LVFO 2J6IA 2DPGA 3IDSA 2VZ0A 2W8ZA 4IDGA 3LC2O 4PG4A 2FWMX 3M1AA 4BNHA 3JYQA 4IDAA 1D1TA 4XKJA 4GAEA 4WLFA 4BQPA 5L9AA 2JD0A 3K30A 1UDBA 1EFLA 1SAYA 2NLOA 4BO4A 3UOGA 4CMIB 5JDIC 2FSVA 1BSVA 3PZBA 2ZQZA 2P9CA 3R6DA 4Y6PA 4YACA 5BSFA 1E1KA 4IJKA 4BOYA 5TJHA 3WGQA 2EGHA 3BHIA 1TA4A 4OOEA 3GZ4A 4IDDA 3E9NA 2D5CA 1O5IA 3P5SA 4IBOA 4J7CA 3VPFA 2P5UA 3IC5A 1S6YA 4RDIA 4U6QA 3B1JA 1JTVA 3OJ0A 5JLAA 3QW2A 2DBVO 3DXFA 1M75A 2BFOA 1V0JA 4AVYA 1A7KA 3QWHA 1KEUA 1D8AA 3DDNA 3HDQA 2HSDA 4ZQFA 1PJCA 4HBGA 2FP4A 4BNMA 1DIHA 4YJHB 4PVDA 4PVCA 5JAMA 4I9HA 1QMGA 4JK3A 4ND2A 2X0RA 1YH3A 2DTDA 3H3FA 1YO6A 1GYPA 1PS9A 2P9GA 4XIJA 1CIVA 1ISJA 1SMKA 1Y5RA 4D3FA 4CL8A 1JKJA 2HU2A 4CM9D 2GF2A 3Q0EA 3WMXA 3GT0A 4CM8B 4YPOA 1X7DA 4PLWA 5T64A 3X2EA 5IZ4A 3CH6A 2ZCVA 5HA5A 1M76A 3JQBC 3LZ6A 4RZIA 1GADO 4YQYA 1I2CA 3ROQA 3ZWNA 3Q6IA 3P19A 4WNIA 3ZV4A 3ZWXA 3G49A 1BGVA 1J6UA 5F1PA 3ONEA 4NU5A 1FDSA 1LX6A 2X9GA 2X23A 4XGIA 2D3TA 4BO0A 3GUCA 1SBYA 3WSVA 2WWRA 3C8MA 5KTKA 4OKIA 1PU2A 4PZDA 4Z0TA 4GQAA 2BFPA 3UF0A 2W2KB 2EP7A 5DNAA 2IXAA 4E2WA 3AK4A 3ICCA 4A27A 4IJUA 4MVJM 5EPOA 1O8CA 1V6AA 3C7CB 3NT5A 4QXMA 4CMKA 5IF3A 1YL5A 4E5PA 2UUPA 1QYVA 3V2UA 2VYNA 2Z1NA 1B14A 5ES3A 2O2SA 2PK3A 3H9GA 3UN1A 4IS3A 4UUNA 4G65A 2Q3EA 3HB4X 3ZWOA 3GEMA 4N54A 1YL7A 1Y9AA 4Q3EA 2V7PA 4L73A 3TFOA 3MWEB 3SLKA 2BMAA 1HETA 3JD2A 4GI2A 4CQMA 3BMOA 1DIRA 3L07A 4RCVA 4MJLA 3LT4A 5AXBA 4BO3A 4AJNA 5FWNA 1WWKA 3RUCA 3FTPA 3FRJA 2Q1WA 3I83A 5DULA 4BIIA 1XSEA 3PFWO 1UZNA 4BGIA 1LDEA 1TT7A 2V6BA 3DZGA 4IINA 4BMNA 3NDRA 4FC6A 4HKTA 3D4OA 3KSUA 4ZJUA 4BNYA 4CMHA 1BDBA 2PZMA 4WCFC 1DDOA 4WPGA 3MZ0A 4J7UA 1PIWA 1XR3A 5JDCC 2B4TO 2D4AA 1IZ0A 1Y81A 4W4TA 2HRBA 2UVDA 3BTUA 3TOZA 1G0NA 4R3NA 3SC6A 4BNJA 4UUMA 2AQIA 1ULSA 4ROSA 3BMCA 3NX4A 3D5TA 2VUUA 1ISFA 5AVOA 3ZWPA 4PN3A 1N7HA 3OA0A 2O7SA 2FPPA 3A28A 1Q7CA 1EVZA 2AHRA 2NVBA 3E82A 5KKAA 1IOLA 3CTMA 5T5QA 3WLEA 3RC9A 3VDQA 3L9XA 1Z74A 4XB1A 4DPLA 1GDHA 3VTZA 4CM4A 3IP3A 1M6WA 1T1RA 3A14A 4JP2A 1W4ZA 5BNFA 3F1LA 4F6LA 3WGZA 1EVYA 2ZATA 3HDYA 3ST7A 2X9VA 1PJTA 2J8ZA 3PYMA 3F5QA 3VPSA 4D45A 4TZKA 5JO0A 2X8LA 3ZNOA 4CMGA 1GV0A 1RYDA 2UV8A 4ZQHA 1JAYA 4PLTA 1CEQA 3D7LA 4UUOA 3MTGA 1B26A 4A03A 3GPDG 4M55A 5BNTA 4IQ0A 4RPHA 2NNLD 4GBJA 4RORA 2QRJA 4FPXA 1GQYA 4YRBA 4NJMB 2HKIA 2YHUA 3PPIA 4YJGB 1B3RA 2O3JA 3DEYX 5B12A 3GMSA 4IMRA 2YYYA 4X54A 1LDYA 5KVVA 4YCAA 1A4IA 3NGLA 3MWDB 5GY7A 4AJIA 2XXJA 3ANNA 1VJTA 4CV3A 4LN1A 1Y5MA 5TC4A 1YDWA 1GQ2A 2H5LA 1BVUA 1IB6A 1VKNA 2VRCA 1EUZA 5GZ1A 1LDMA 3RU7A 3PWKA 1E7SA 3K96A 5L95A 3FPCA 4H15A 4KQWA 4AFNA 4TWRA 1ZSVA 1LXCA 4UEOA 1JWAB 2RH8A 1PGNA 1IPFA 4YWJA 1VLLA 4KDEA 1GU7A 1BG6A 3KYDB 4K1LA 4QT0A 2Z5LA 2CMDA 3OQ1A 4LCEA 4QX6A 5TRTA 4CR7A 3PJGA 1K5HA 3KUXA 2V6GA 1H9AA 2FMUA 3BA1A 4F46A 2OZPA 2B4RO 2EJWA 3ZCXA 4RPLA 1KY4A 2EW2A 2JFFA 3DHYA 5IJZA 4Z9FA 4FDAA 5L45A 1M66A 2NTVA 3BXXA 1PGJA 5EIOA 2RHRA 4EJMA 1H6BA 4BNIA 3RUHA 1JKFA 2PGDA 4QSMA 4BQRA 4QQRA 3ONFA 4P38A 4OIMA 2NADA 4GX2A 4BNLA 1EEHA 2EJVA 3GGOA 5KJ6A 2PV7A 3ETDA 3EZYA 1G1AA 4JIGA 2G1UA 2IEBA 4ESOA 5JY1A 2ZB4A 3HDJA 4ND4A 1XWFA 3GEDA 1PJBA 4ONEA 4IJWA 4CM1A 4KTTE 4Q3NA 3VH1A 3PJFA 4DLLA 2IODA 3QY9A 1F12A 5HTOA 4ZHSA 1P77A 1P0CA 1Q7GA 2WYVA 1RWBA 5DBGA 3CUKA 3PHIA 3ZV3A 3DHEA 3PDJA 3U4HA 4GMGA 2DT5A 1U8FO 1L1FA 1N2SA 1C1XA 3D64A 3VOSA 3HJAA 4A10A 2B83A 5L7YA 3DHNA 2VHYA 4RJTA 1H93A 4TVBA 4E31A 3C3XA 1NFFA 4TKMA 4BS9A 8ADHA 4R9SA 1U3VA 1SPXA 2TMGA 1Q0LA 1R37A 5A9SB 3WQSB 1KBZA 1D4FA 4BNVA 2VOEA 3A1NA 4JGBA 4OOFA 1X0XA 1CRWG 1DC5A 3RBXA 3RU9A 2Y1FA 1JW9B 5B1YA 1PR9A 1HDGO 2ZK7A 5JFOA 4AL4A 2FR1A 1TLTA 4BO8A 2OBNA 3UKOA 4NBUA 1HEUA 2O3SA 3ZV6A 3WGTA 3EYWA 4ZGWA 2X7HA 5TF4A 4J1TA 4AJ1A 2JAPA 1ZSYA 3Q9NA 4A2CA 1DB3A 4DIBA 3V8BA 2AEMA 3ONDA 1WW8A 4TKLA 4B8ZA 1LC3A 4J0FA 3DQPA 1BXZA 2NACA 3I9KA 5DZSA 2YY7A 4FFPA 5CG2A 3INRA 4WLEA 2EERA 2YW9A 4Q3DA 4U6SA 4YR9A 4DPMA 1HYHA 2VT2A 1X15A 4XX0A 1ORRA 2VRCD 4PRLA 3AY7A 3LLVA 4YXFA 2PLAA 4RQUA 3DFUA 4FJ1A 3JQ7A 5L4LA 4HNHA 3D4NA 2AMFA 3HWRA 5JYDA 1ARZA 3FCOA 4Q39A 1PQUA 5ENDA 3S2GA 4DQUA 2G76A 5TLSA 2GN4A 3RI3A 1E7RA 3O38A 3GEGA 1H9BA 4EJ6A 3JQ9A 4R69A 3RIHA 4MIOA 2X0JA 5KIAA 4DXHA 2I99A 4H16A 4GPD1 1XGKA 1ML3A 4WEQA 5G4KB 4XD2A 2CVOA 2WSBA 1C1DB 3FNHA 4MKZA 2OP1A 2E82A 2VHVA 4XQCA 5JAIA 3EVNA 2PKQO 1KOLA 2WE7A 3E9MA 5J23A 4J4BA 2AG5A 4FSHA 4II2A 4AJPA 4XYGA 4CMEA 1LQTA 4CMJA 3W4JA 4UULA 3AI2A 4IS2A 3MOGA 1HDZA 4GGOA 1NHWA 1Y9EA 1U2DA 5TGDA 1I8TA 1B8PA 1P74A 2O50A 2GN8A 1XU7A 4J2HA 2G17A 4JLWA 1PZFA 5IXYA 1ISMA 5CPBA 2NV6A 1PZEA 4IIVA 4CJXA 1HKUA 3VVCA 3UH1A 5IXSA 2D0IA 1XELA 3FBTA 4A26A 3WYCA 4TRMA 5JNLA 4HY3A 2TMDA 1N7GA 5ILGA 3HADA 1NM5A 1PWXA 1WLYA 3HNPA 3DMYA 4GMFA 1UAGA 1TB4A 1GCUA 3QA9A 4LK3A 4BO1A 2AE1A 5DP2A 5L3ZA 3BYZA 1I3NA 3OEYA 4YJDA 4J90A 2VWGA 4YTEA 1QR6A 4Y6RA 1V35A 2J5RA 2Q99A 2I66A 2A9FA 2ZQYA 3HFSA 1CF2O 3I4FA 1X0VA 3K5PA 4NBRA 4WOKA 4JROA 1MLDA 4FFMA 3P2OA 3QLJA 4ZVVA 1ZK1A 2HUNA 3ZWAA 3C1OA 1YGYA 1P3DA 1P1HA 3CMMA 1WMAA 1A9YA 1XCBA 3I5MA 1K6XA 3U4IA 1JQBA 1GV1A 2B0JA 3SC4A 5L40A 4YAGA 4W82A 4GLOA 4XQEA 1GCOA 3H5NA 1KEVA 1CYDA 3CINA 4DC0A 2O4UX 3RVDA 2VTEA 1PZHA 5HM8A 3ANMA 4H3VA 4UVIA 2VHWA 4E12A 5ILOA 2Y99A 5KJEA 4D3SA 3PYXA 1Q0HA 3ZI0A 3FWZA 4N5LA 4BKQA 1DOHA 2B4QA 3C7AA 3C7DB 4TRJA 2BFMA 3FNFA 3E1KA 3FR8A 5ADHA 5CEFA 2X0NA 4EEXA 5I7EA 3L4SO 5C7LO 1I01A 3BMNB 1ZMTA 3ZWMA 3JQ8B 3EHEA 2BH9A 2NQTA 1FDUA 5JCXA 1JWBB 5ICMA 4NQZA 2VT3A 2GCGA 4GGPA 3WIEA 4ZICA 4NMHA 4F6CA 3WQQA 4B7XA 4EJ0A 2VHXA 4W7HA 3P2YA 4QFCA 4YVFA 3DBLB 3I9MA 4CL3A 1KVTA 3KXDA 2VNSA 5C3MA 3D1LA 5B4VA 3GPIA 4M54A 1NVMB 2Y1GA 2VUSA 3H2ZA 5EL0A 2ZTMA 4G2NA 3AFNA 2Y66A 4JJGA 1U7TA 3BTSA 1E1LA 4FC7A 5AXCA 1JA9A 2WYWA 4L8VA 5GZ6A 4R4JA 4BNKA 3CZRA 3WBFA 3TQHA 1XLTA 3PP8A 4RGBA 5L7WA 4Y67A 2AW5A 3IAHA 1LBEA 4CM8A 3FPLA 1Z7BA 2FHSA 2EEZA 5DOZA 1FMCA 5TT1A 1DEHA 4EDFA 3OJFA 1WPQA 4NK5A 1HDCA 4PZCA 5BT9A 3NJ4A 3S2FA 3ASUA 3TF5A 2DLDA 3LF1A 4OGWA 1Z6ZA 4Y8VA 2ZTVA 1DJQA 4R1UA 3HHPA 1E92A 5DCWA 2P2SA 2GUGA 1N9GA 1NQ5A 4FJ0A 4S3MA 5TIIA 1O0SA 2HJRA 4IDCA 1MXHA 3S55A 1JAXA 2GRAA 4TRRA 2BKAA 1YBAA 2CY0A 2YFHA 2QX7A 4R3WA 3I1JA 5G2OA 3PIDA 2CZCA 4L4SA 1EQ2A 5LDHA 4YT4A 4CV2A 1RM5A 3IKTA 1WDLA 2ZB8A 4MVJI 3WSWA 3I6IA 5K6AA 4OXNA 1ZSNA 3DWFA 4GKVA 1C1DA 2CDBA 5BQFA 3ULKA 3JQBA 1CWUA 5JCJA 1UUFA 1NYTA 4WGGA 2X22A 1N5DA 2W98A 5K0ZA 1QP8A 1SB9A 3IMFA 1NFRA 2C2XA 3JD3A 1ZKMA 2IYPA 3OQBA 3DZIA 3TN7A 1OBFO 3GHYA 1NASA 3O26A 3NAQA 1V8BA 3GGGA 5CG1A 3WGGA 1PJ3A 3GK3A 2EHDA 4BB5A 5FI5A 2JCXA 1YOVA 1BW9A 3BZUA 3HUDA 3QWAA 4BB6A 3UGKA 2CF5A 4CUKA 3AW9A 1T2AA 3IKVA 1PGOA 5BSGA 2C59A 3AOEC 3GR6A 3KO8A 1OMOA 2UDPA 4I08A 3DBVO 1Y1PA 2C07A 1U2GA 1U5CA 3L77A 3KHUA 3Q9UA 1VE9A 2X5KO 4R01A 2GLXA 5KJ1A 2Y93A 4PFJA 1CJCA 2Y1OA 3WWZA 3KZVA 3Q1LA 1HXHA 4KTVE 1BRMA 2EP5A 3GOHA 3A4VA 3Q3CA 3RQSA 1O89A 4IPTA 4R5HA 3OHSX 3VH4A 5KVCA 1F17A 1HLPA 1R0KA 3UFXA 1K0UA 1ISGA 4MVJE 1PS8A 1IHYA 4YB8A 2ZJ0A 3AU9A 1O9BA 4YYZA 3IUPA 2PH5A 4II3A 1MXFA 3DMTC 2GR9A 4WOJA 3ITKA 5IFLA 1ZMOA 2Q1TA 3JCZA 4KP7A 5G0VA 1ENYA 3ZWYA 2E4AA 4ALMA 4TQGA 1B0AA 2PD6A 1Z82A 3VH2A 3WXBA 1VSVA 3WTCA 2PKQP 4JX8A 3ZNQA 4CUJA 1OC4A 5THKA 1P1RA 3JV7A 1DFHA 2DFDA 2JJYA 1C0PA 4BO5A 3PI7A 4DRYA 1QYXA 2H6EA 1JDJA 2BFAA 2EKPA 1WNTA 2Y0EA 3UAGA 3W6UA 1CDOA 1E7YA 2C5AA 3KTDA 5EMHA 4D0SA 4AJOA 2VN8A 2GO1A 4CR6A 5JXWA 2YHIB 4CLOA 3Q11A 3LSYA 4FR5A 3D4PA 2QRLA 2JCYA 1RJWA 1KEWA 3UVEA 1R12A 3HN7A 3KVOA 2YUTA 4XEHA 5CHEA 4XJTA 4R68A 2WDZA 3WNQA 3L0DA 5ER9A 3WBBA 4E5KA 1WAMA 5A1TA 2C29D 3MCVA 4A0SA 4DIOA 5F21A 3STHA 4GX0A 1H6CA 3HZZA 2YV2A 4K9DA 5TS3A 1KYQA 3RUIA 2YV1A 1KC1A 1LC0A 3HG7A 3K73O 4AICA 3EC7A 1I5RA 4E5MA 3L6EA 5JC1A 4DL9A 2G82A 1IE3A 1T4DA 5H82A 4NZ9A 1X14A 4E30A 4LVCA 4J2OA 2VYND 1FF9A 2IXBA 2B69A 3TRIA 1EBUA 4ALLA 3ZWBA 1R4NA 1O95A 1QV7A 4PG7A 3ZZNA 1UZMA 3FNEA 1LSOA 3JD0A 3ZW8A 3NGXA 3QHAA 4KZPA 5TNXA 1H2HA 4GVLA 1A27A 4E5NA 4MINA 5T67A 2AG8A 4FFOA 4WLOA 3V1TC 2GNAA 3UCFA 5ITVA 1GL3A 3V5NA 3CSDA 1YE3A 1PWZA 4D0RA 3PLRA 4MVJF 3VH3A 1LJ8A 1SCUA 4R9RA 3B70A 4NJOA 1UXIA 5JW6A 3UICA 3WFIA 5A04A 2VNAA 2DQ4A 1JVBA 2EXXA 3WYBA 4CR8A 2I76A 3W8FA 1T2FA 4J0EA 5JO9A 1KY5A 5JMWA 1XIVA 1NHGA 3AOEA 4OH1A 1W73A 1LSUA 2DU8A 2IZ1A 3GVPA 3OA2A 5EESA 3S2IA 3UXYA 2WEKA 4M8SA 5AXAA 1E3IA 1U3UA 1UR5A 1I24A 1NAHA 4E2ZA 4E4YA 4LGVA 5B37A 4NHEA 4ZU3A 1EK6A 3RSHA 4CPDA 3L9WA 4GSKA 1I3LA 1GYQA 5CDUA 1KVSA 1E3WB 3GNTA 3JQDA 1FDWA 4IXTA 5U4QA 3IIEA 4O6VA 4YA6A 3WTBA 4OSPA 1GUFA 1C0LA 2CSUA 3AY3A 1AXGA 5DCUA 4H7PA 1BXGA 2RCYA 1AHIA 3K2BA 3G1TA 4Y9DA 1IHXA 3C24A 1NR7A 2FRDA 3H9JA 4IDBA 1DBVO 2DVMA 1B16A 1BMDA 4EITA 1XDWA 3QRWA 1VL0A 4RVUA 4BMVA 5L7TA 4B4VA 3BAZA 3SJUA 2OP0A 4NDNE 3WGOA 1AN9A 2ET6A 3H3JA 3ZHXA 1GY8A 3OECA 3IJRA 3OFSA 4NFYA 2WYUA 3PHHA 4UVEA 3AU8A 1UJMA 2ZTLA 3KSDO 4RPGA 2QIOA 1Y8RB 3JTMA 4MPDA 3L6DA 1LTHR 3GLQA 4J91A 4TVOA 1MGOA 2RHCA 5A3VA 4NBTA 4CLHA 3NRCA 1VRWA 2RBEA 4CUZA 4L0QA 4JN6B 4Z9YA 1N1GA 3QVXA 4J9UE 4OM8A 1MG0A 1ZH8A 1SB8A 2OMEA 3AUTA 1JN0A 3DO5A 4FIZA 2NUAA 1M67A 4BO2A 3BHMA 3QQPA 5A9TA 1B8VA 2O7QA 4ZQBA 3ZGYA 3SBOA 4C4OA 4BVAA 2CNBA 3QVSA 4L4XA 1QYCA 3QV1A 4HADA 5U9CA 1VL8A 4DYDA 4G5HA 2I5PO 5FYDA 3BMOB 1NWHA 3L6OO 5JMPA 1QSGA 3DMTA 1K6JA 1LRKA 4YT5A 4HFJA 1V3VA 1QKIA 5IG2A 1YWGO 2GGSA 3H9UA 1GQQA 3M1LA 2AEFA 1C0KA 3KYCA 2A35A 2EG9A 3WJAA 3WGHA 1OOEA 4B3IA 4NG5A 4CQLA 1BXKA 3GGPA 2O4CA 2IEDA 3AM3A 3RASA 4RQTA 1IYZA 4MVJH 3QP9A 4NBWA 2BGKA 5EJ2A 4C7JA 4E5YA 2W2KA 4MOWA 1NNUA 4XDZA 2FZWA 2VZ8A 1HE3A 5TJ9A 4ID9A 1PJQA 3KM0A 4UEJA 2YJZA 3O9ZA 2DM6A 1J0XO 2VQ3A 3V1UA 4DREA 5CEEA 4YRDA 1I3MA 1YRLA 4J16A 1E3JA 1OI7A 1ZUD1 5A9RA 3OICA 4QUKA 4R51A 1E1MA 4MVJD 3DZKA 2BHLA 1ONNA 4KQXA 3A9WA 1ADFA 5C7OO 1UDCA 1IY8A 1IULA 2IDZA 4CQMB 2X0IA 4AJ2A 3F4BA 2ZJ1A 3CXRA 2HLPA 3IL2A 3CPSA 4KDFA 1OZAA 1Y7TA 1T2DA 3F46A 1BW9B 3K2EA 3BMQA 1U4SA 5IN5A 2CVZA 4DQVA 4YAKA 4L74A 1NTOA 2WJPA 2HQ1A 3IUSA 1HDOA 1PQWA 2O3RA 5IZCA 5L4NA 2YZ7A 2V6FA 1BWSA 5FFFA 1LSJA 2GD1O 4B3HA 4OO3A 2HJSA 3NJ8A 3IOYA 4AJLA 1EZ4A 2QW8A 4TSKA 3QE3A 4IZHA 5F1OA 5GMOA 3NDIA 5DDIP 2I6TA 1LDNA 4WJZA 3V2HA 4J4TA 1SNYA 1W0CA 1G6KA 4GSLA 2Q2WA 4YRAA 4PG5A 3VPXA 2GN9A 3E03A 5KOIA 2O3QA 3R3JA 3I4CA 5ITWA 3H65A 3KB6A 4FD3A 2PTGA 1XQ1A 3RROA 4YT2A 3NT4A 5DP1A 3GDOA 3ZW9A 3HB5X 1ENPA 4R41A 1P0FA 3N74A 3B1FA 2YQ4A 3GRPA 4B4OA 4EW6A 1E0DA 3WDSA 4CQLB 3JQFA 1MC5A 4P4NA 4Z9XA 3SX2A 5EN4A 3BIOA 3FWNA 1W6UA 4D46A 2FZEA 5I9MA 3H7AA 4A7PA 2JCVA 1GEGA 2GZ2A 1K2WA 2IZ0A 4PGFA 3RD5A 1D1SA 3OBBA 2VWQA 4MP3A 4URFA 3CKYA 3D0OA 4JQCA 2OFPA 1R4MA 1I36A 3TJRA 3CE6A 1ZIDA 1Y8QB 4Q3AA 4EZBA 5JC8A 1ZFNA 4JJFA 4U0KA 5G0TA 5CDYA 3DR3A 4RF2A 2O3UA 3AFMA 4A73A 1IZ9A 4FGSA 4DVJA 1EVJA 2CDCA 4E2YA 1LLQA 2B5VA 1NX6A 3ZN2A 1HE4A 1E7QA 1HDYA 1P1JA 3VAZA 3PEFA 4GH5A 3ANLA 1IL0A 1DSSG 1UXJA 3KSZO 2X1HA 3P7MA 3RUAA 1P1IA 3BTOA 4JNKA 4OSOA 4L4RA 4E6PA 3MEQA 4BKPA 3ZU4A 2NWQA 3D3EA 3T4EA 3KETA 1H6AA 2Y67A 3HSKA 1YBVA 1ZK0A 2J3KA 3JQ9C 2AE2A 3LF2A 2BI8A 3JD4A 2X6TA 1EQUA 1HRDA 3DONA 5JCJD 3GUYA 1WZEA 3L4BA 3I3OA 3TZQA 4CM6A 1YOVB 5I7VA 1BHSA 2D8AA 3IP1A 3DB2A 3NV9A 5BSEA 2J5KA 4RZHA 5KCZA 1YQGA 2AQKA 1OFGA 2C5EA 3DZHA 3MJ4A 3O4RA 4J1QA 1SOWA 4BNNA 5EQDA 1Y8QA 3PJEA 2Q4BA 1WDKA 4BNTA 2W2LA 1K89A 4FFNA 4ND3A 4CLRB 3WICA 2OBYA 1NPTO 2X58A 3WWYA 1C3VA 3ZNNA 3BMCB 3G1UA 4PG8A 4XRGA 3TOXA 1P33A 1F0YA 2DTEA 1PR3A 3ROPA 4C7KA 4CM5A 2X86A 3QVTA 4FFRA 4K6CA 4AJKA 4RO0A 1QRRA 3FSRA 4WCFB 3DOCA 3U9LA 3W4IA 1VSUA 3OJLA 1HSOA 4UVDA 1N92A 1JKIA 5HS4A 1UP4A 1X1TA 2VYVD 1DRVA 4WASA 3VPHA 1R6DA 3JQCA 4LMRA 2YFQA 3H9QA 3KYDA 4J43A 3F47A 4F45A 4XR9A 4WK6A 3MJSA 1NR1A 4CMIA 3FNGA 3KLPX 3TDKA 1S7CA 1YQXA 1KIFA 3HN2A 3ZHYA 3SJ7A 4Q9NA 1YKFA 3TPCA 1A7AA 1KC3A 3KYCB 5TX7A 4M49A 3WGYA 3TZCA 4CV1A 3VC7A 3EGOA 1U8XX 2I67A 3ZH2A 1GD1O 1QLHA 3GZNA 1ZBQA 1E3WA 3OMLA 1KVRA 4PLYA 4O5OA 1GZ4A 3RFTA 5CAEA 2PFGA 4CM9A 4E2XA 1AUPA 1H6DA 1PL6A 3GN2A 1ZZEA 1OAAA 1DFIA 3WOHA 2NVWA 2PH3A 4ITUA 4R1SA 1PL8A 1XKQA 3OM9A 1YXMA 3H9EO 3W6ZA 3GVCA 3WX0A 5B4UA 4AJHA 1DPGA 3VKVA 5JDCA 4J3FA 4N5NA 1A72A 2GN6A 1VL6A 3KYBA 3RFVA 3ENNA 2GZ1A 2Q1UA 4BL5A 4GL4A 2NTNA 3GA0A 3EUWA 1NFQA 2VHZA 3I52A 1GUYA 3O8QB 2FOIA 3PQEA 3PLNA 4M86A 5F1KA 4WLUA 3LK7A 1CERA 3OH8A 4ALJA 4CLRA 2IYOA 5KJFA 2J3HA 2PZJA 3C85A 3ICPA 3R3SA 4HP8A 4CLOB 1LDGA 3TSCA 3ON5A 2H9IA 4IUYA 3U5TA 4M89A 3F4LA 2W4QA 3V2GA 1BTOA 5C37A 4WKGA 4BNUA 2Y68A 1EE9A 3H8VA 4JP3A 2JHGA 5EQFA 1ULUA 1QLJA 3GFBA 4E13A 1NQAO 3FI9A 4WUVA 1YB5A 1PTJA 4EYEA 2BI7A 1B15A 3UCXA 2HMVA 2V65A 5CDSA 2WE8A 3QVOA 4WLVA 5JE8A 3NYWA 5DN9A 3BTVA 4EUFA 4CMCA 1V9LA 1BVRA 5I7FA 3I9LA 1JVSA 3ENKA 4LVUA 1B3BA 3PRJA 1XQ6A 1FDTA 3ORFA 2BGLA 3RC7A 2JD1A 2BRUA 2P91A 1I0ZA 1L7EA 2WD7A 2ZYDA 3L4BC 3ZU2A 5A3JA 3RBVA 1YB4A 1LUAA 2F00A 3VPGA 2QHXA 3E18A 1E1NA 5DT9A 3U4DA 1ENOA 4UVGA 3UUWA 2LDXA 1YDEA 1EDOA 1Q0QA 1P31A 2EWMA 3NT2A 4D42A 3DL2A 1DIBA 2XAAA 4ZRMA 1ZJZA 3WS7A 3GAZA 5IDYA 3ASVA 3N7UA 4HUJA 4R16A 1BXGB 1EMDA 2EF1A 1CETA 5LCXA 1GAEO 2QZZA 4XQ9A 1B7GO 3EZLA 1DLIA 3U09A 4DGSA 4JBGA 1KVUA 3NUGA 1C1XB 2I3AA 3D3WA 2OO5A 3G79A 5FI3A 3MJVA 1U3TA 1N9GB 4NI5A 1UZLA 1Q1NA 1J49A 4NFHA 5IN4A 3WJ7A 4Y6SA 4XA8A 4DC1A 4ZRNA 2C7VA 2D5AA 5CDTA 5A4DA 4PZEA 4YAIA 4ND5A 4IDEA 4HFRA 5I8WA 1I2ZA 2CF6A 3RJ5A 1I33A 3DOJA 5HRUA 3PHLA 2Q49A 3LT1A 1WXDA 3NTRA 4E21A 2XXBA 3EK2A 2HRZA 4WEOA 4HFNA 2CD9A 3U4CA 1IUKA 2B35A 4IMPA 2Q50A 3VVBA
chains in the Genus database with same CATH superfamily
1GOTA 1R0LA 5K8LA 1F9EA 3INTA 3RVOA 4EBFA 2HU5A 2ZB7A 1LTQA 4MMZB 5IEJA 3GIDA 3DW3X 3AUYA 3PFFA 4BMCA 2OSVA 3W0LB 4MPPA 3RWBA 1ADYA 3CLKA 4AWXA 2G5CA 4UTNA 2GEVA 3ZD8A 4BXOA 3DTYA 3BT7A 1MAAA 3F5SA 2E48A 3HR4A 5LA6F 1Z25A 2GK3A 1W4LA 1TT5A 3IFSA 4N7MA 1JXMA 1VQ1A 2G70A 1DQSA 4DKJA 3VKUA 1GPMA 1IHPA 1RI3A 2C2BA 2O48X 1CD5A 1SVLA 2QQFA 3B6MA 3IRVA 4FILA 3SZLA 1Z4KA 5AW6A 2VJCA 3KFXA 5CB4B 2PZ8A 4CKZA 4FK8A 1Z68A 2AH5A 5HRCA 5K4GA 2X5JO 1A5AB 2XMCA 1AVTA 1HZJA 2Z43A 2ZETA 1T15A 2C3OA 1ADGA 3CEHA 2DQSA 2QRUA 4OP3A 4A4DA 4J0IA 1VRVA 1ZN2A 4BMPB 3HEBA 1GRVA 4LNUA 5MFPA 1Z2PX 3RC2A 2AEEA 1WV0A 1V7ZA 3RRZA 2ZFUA 8AT1A 1GEEA 1PO7A 3COVA 3H86A 4LRUA 4O0LA 1KI3A 4EHBA 4L8LA 3GDFA 5AW1A 2G36A 4M0DA 4MGHA 1D4OA 3R5XA 2FPXA 4HAXA 3JQGB 1XUOA 1TA0A 2ICAA 4NBVA 3T06B 4ZGGA 4RSRA 3MB5A 3S8MA 4GL2A 2R1ZA 1D1PA 1Z7EA 2FMTA 4I1YA 1QORA 4R1MA 4BO9A 4J1SA 2CYBA 4D02A 2OD2A 4LSMA 4CV0A 4OBWA 2F17A 2PT6A 1ID1A 2JCGA 1IJBA 1NPDA 3F6YA 4G9BA 2DSTA 4ON9A 1N2BA 1JTFA 2XCRB 5G4LA 2X9QA 3B1XA 3W6OA 1HE2A 2GS9A 2PGIA 1T0IA 3WIBA 1PWEA 4P58A 3RSGA 1Q3TA 2DPMA 3ENZA 4REMA 2ZB3A 4UVHA 2QJRA 4AKGA 2Y9MB 3T3MB 3VHXA 1Y8RA 4EVQA 2PUWA 1GPLA 3K32A 3O2QB 3L3BA 2CHEA 1NY6A 3FOCA 3GD7A 5EOVA 1UMKA 1SUIA 3HM9A 1EK1A 3TSAA 3ESZA 1NF2A 5CIYA 1NQTA 4WIAA 4JI5B 4H6PA 3KV3O 1B1AA 2DUWA 2EGUA 1REQA 1TXGA 3WYEA 1IU9A 5DM60 1MF7A 2C9YA 5EMKA 1W0KD 4E6EA 5C7IO 4WACA 1C2YA 2DAPA 3GZNB 3ZXIA 1MW8X 1SA0A 4U2FA 4JNCA 4WGFA 1L5RA 2P40A 4KN6A 3SI7A 2NTJA 3F73A 2AJBA 4MKGA 1JLLA 1JMKC 3I23A 1YDFA 4L72A 2CLSA 3B1VA 4X1IB 3QMMA 5C5CA 4YAEA 3LP5A 1HDRA 2PWZA 3PC6A 1K7CA 4B4WA 3MHPA 1KRWA 1R0SA 3DAFA 5DYIA 1FSGA 1PQ4A 1SVNA 4NE9A 1G3QA 1V6SA 4OAQA 4QDZA 3ZWKA 2ZJAA 1TEZA 3GCGA 3GGSA 1VPVA 4ESEA 2IHKA 1CYEA 4E7OA 2B5OA 2HK8A 1UEJA 3O0DA 3FBWA 4UJ3A 3EXHB 1QAMA 4JD5A 3WOVA 2RGDA 3L6BA 3GJ6A 1NXXA 3BWBA 4DCNA 4R83A 1W2WB 3OKPA 4MRMB 4LFCB 5A0VA 3PQ2A 2HY7A 4MEAA 4K87A 4EB8A 4MR7A 4TV9B 1G8PA 2H1LA 5HKKD 1PT8A 2FMKA 1R00A 3RKRA 4BLRA 4BQOA 5K0CA 1L7QA 2GUWA 2KMLA 2XLBA 2AQ8A 1YNSA 4NABA 3NHMA 4M83A 4WA7A 3ZJYA 3UB2A 1C30B 4GRDA 2AN9A 5FR1A 1QMPA 2FZCA 1TVEA 4HZGA 1PLLA 3EQ7A 3N8DA 2UZ0A 2QA5A 4UHFA 3AUAA 2PRSA 3BMNA 3HQ4O 4RY9A 3ZGNA 2OO7A 4W1SA 4B34A 4YRMA 4LC0A 3CZPA 4GYJA 2AFHE 1N25A 3HMQA 4PYKA 1NVGA 3KR2A 2CUTA 4ID3A 5I3ZA 5IJWA 1QGAA 4W9NA 1UBMS 2Q5CA 1LDBA 4D3XA 3RS8A 3D4IA 3F3SA 3OLXA 2ZI4A 5C2JB 3FGZA 3PXCX 1SWVA 2AX4A 3FGOA 1DFGA 4XLLA 5AM3A 3UJ8A 1DKLA 4OA5A 2OFXA 3VNSA 1JQEA 1Q20A 4FMCF 3FMGA 1JI3A 4Z4EA 1YVDA 4XIYA 5DNDA 5WRFA 3PXGA 2G72A 5LQKA 4P4LA 4XB2A 3KRTA 4QUEA 5AW9A 1CZKA 4FWBA 2KW5A 4NLLA 4PZUA 3SKVA 3IQHX 3GLTA 2O1SA 1T4BA 1B43A 2JFYA 4ZALA 1FUEA 5F3RA 2NT4A 4GI7A 2IP4A 2R7MA 4GEGA 3IT2A 3E27A 4QOFA 1UBRS 3L82B 3RRBA 3ZNPA 3ETGA 4F72A 4UZEA 1FK8A 1DRWA 1MTZA 1XP8A 1H0KA 3GMDA 3MVEA 1IUOA 3OAAA 2XRMA 3OMWA 4P33A 1DBSA 5DASA 3VZCA 1BKSB 1YNOA 3F96A 3V2IA 3L0PA 1UODA 1VKRA 3OBIA 4DA0A 1WKVA 1VKOA 3R5HA 5JS1A 3DMPA 1YQDA 5AT1A 3V8EA 4WW0A 5HUJA 3PPYA 1DLJA 5JPIA 5K0TA 2F59A 4TL7A 5T6BA 1ML4A 1DC3A 2Q4RA 4BNFA 1OYOA 1RAGA 4JT2A 1GPAA 1LK5A 1OXSC 1ZEMA 1GGKA 3GFGA 2J07A 3PLAE 4QE3A 3RTBA 1RLIA 4PLVA 5KOHA 1XA0A 2IXGA 4MLDA 2FWBA 4RD3A 5F73A 1DEOA 1UIMA 4GYYA 3EEFA 5FEUA 3ZVMA 3ZXYA 1U9JA 4CKBB 2BUBA 2BCGY 4NYJR 4Z0HO 2O6HA 2WB4A 3TTSA 1SIWA 3EWAA 2WIBA 1UJ2A 4J29A 3TTWA 3WL6A 5KKNB 4AJEA 3I6QA 4ALKA 2VZ9A 3QNUA 4KSCA 4Q47A 3FN4A 3L84A 1BGXT 3UJCA 1A97A 3IDFA 1EFCA 1Y6ZA 4LFBB 1UXHA 1PQYA 3PQDA 3LGAA 2ACKA 2YWBA 1D2NA 2H16A 3BRWA 1ST2A 1Z34A 1P4AA 1P0MA 3M6AA 3UOAB 3AJEA 4MW1A 1P1KA 4KE6A 2FTKE 1M2OB 4WK2B 2OOSA 1AF7A 1BA3A 1KS9A 3ORYA 3VX3A 5I4BA 1HDXA 3B53X 1QHSA 3G0OA 1NVXQ 4Q4LA 1WEKA 3SHTA 4XYEA 4EHFA 3UJ3X 5DTJA 5I9NA 4IDFA 2UUAB 2GVNA 4D99A 5LYJB 5BURA 3F5FA 3WKDA 1ODKA 5DHFA 1T8YA 2D1RA 1YBMA 3ZQKA 2OGSA 2OOKA 2BELA 3ZE9A 5JDIA 1C7JA 1U1FA 5A5DA 4HGZA 2B36A 1Q92A 1BEEA 2VRBA 3DL0A 3L8CA 3TG2A 5F5NA 1H05A 4NAHA 3IA2A 2DBRA 3N1UA 1YJXA 3NKLA 2D2EA 4NWIA 1QE5A 2GK7A 3MUNA 4RLSA 1MJ5A 2P67A 2LZ0A 2AWNA 2G3YA 1R0YA 1DJNA 2IGBA 2BF7A 2FSFA 4ZYXA 4Y1GA 5I7SA 1JQJC 3L5OA 3QXCA 3WB9A 3IEUA 2IUSA 1O95C 4NNJA 1GR0A 3ZY6A 1KBOA 3VR6D 4GLJA 2V9CA 4X66B 5BSVA 2AQHA 2I3GA 5H83A 1ISPA 5ALHA 2P68A 2IXEA 3ILHA 4MVJA 1EJBA 1MB0A 1XN1A 4Q9JA 2BFCA 3T52A 1UFOA 2FPGB 3EY4A 1RYEA 5F2NA 5BN4B 3I39X 3RBAA 2GCNA 1GUDA 3OETA 3WO0A 5K05A 3K70B 3AETB 4PO1A 3PWZA 1U8EA 3RFXA 4JU8A 1JG6A 2CFCA 2AEJA 4TYNA 2WA2A 4KR3A 4LF8B 4W5TA 3ZZ0A 3OTOB 5JASA 2WDPA 2CK3D 3AKYA 1HL3A 3CCCA 1FQWA 3A4YA 1QH1B 2QVLA 2AJCA 2WM2A 4N65A 2EKQA 2ZB2A 2WF7A 2WFMA 6REQB 2GTIA 3T61A 1TM4E 2ZAMA 3MWKA 2JJ2D 4G84A 4O2BF 1LNZA 4E94A 1N6KA 4EA9A 4KQ9A 1USWA 1XZCA 2NO0A 4AY2A 2P9FA 3DEAA 3TKLA 1NUUA 1C81A 1DGQA 3TM5A 2Q8QA 4EAQA 4BATA 4P2GA 3GY0A 4GX1A 4LMPA 2XWSA 2WYIA 2B20A 4V0OA 1EUCA 3IR6A 2DH5A 2PQ2A 2F55A 2X9NA 4Q16A 4YPVA 5DOVA 2RGYA 3Q15C 1XTBA 1DO8A 2BHNA 5JNWA 4X62B 1YB1A 4NATA 1O77A 5AKGA 4IGFA 3C7TA 5JZ9A 4PRZA 1CRQA 2QAGC 3CT4A 4A6EA 4ZDWA 2OORA 2A92A 3DAYA 2WFZA 1WQ1R 3AY6A 4DSAA 4CEHA 2IDMA 1JU9A 3OU2A 1LS6A 2WSLA 3AEYA 1J22A 1QH8B 1VP9A 1LU9A 3LY8A 4YUVA 1U0HC 3ACDA 2AWOA 3SSMA 3GYBA 4JUIA 1VI2A 1XKXA 1IZYA 1MB9A 5H3HA 3LO5A 1QG6A 1U2QA 3THXA 1KA9H 3V1YA 4XWYA 4LOJA 5F5LA 4M0UA 4C6RA 1LRLA 2QPLA 2ECFA 1K4MA 1SHLA 2VC2B 1SZJG 1G3UA 3F9CA 2Y1LA 3TZKA 4DUPA 1LLDA 1FPMA 3OF2A 4O1MA 4DIEA 3CN9A 1F8GA 3O1JC 3O94A 3RTDA 3SR4A 2HD4A 1E2PA 4Q7QA 5TS2A 4NX2A 3F5MA 4LXXA 2QVGA 3PWSA 3ZVRA 2L0XA 1NRIA 2HV9A 4QEKA 2XECA 4PSKA 2PX0A 4QYMA 5IT0A 4M1EA 3CZMA 2QNBA 3LC1O 1SEPA 4B7CA 4EPWA 1AZLA 1H5QA 4OHUA 5TDHA 4ZWNA 1MU0A 3T3OA 3SK0A 3SX0A 1FJXA 2P8SA 1T0UA 1H8ED 3K4HA 1IONA 5GWXA 5J4LA 4RD4A 4CTJA 1Z15A 3EPLA 2WWHA 1YS6A 3THSA 1E5QA 1L7PA 4MS1A 1R88A 3A1DA 1IQ0A 3E23A 3JYLA 4LHWA 1R4ZA 3NIBA 5AJWA 3THYB 1SUEA 4GPIB 3VNRA 1NATA 2FP4B 3LFUA 3PNQA 2LNDA 4O33A 1ZO8A 1ONOA 4B3TB 2CXXA 3NHZA 4RQAA 1Z0SA 4K8RB 2J33A 3GXOA 3MWJA 4MEJA 3KUDA 4FS8A 1JP7A 4L5BA 1WJGA 2MT9A 2ZP1A 4R1NA 1NAIA 4W5QA 2BSQA 3I9V1 3JQGA 1AU9A 5FLYA 4JSYA 5D5HA 4K26A 2GT1A 4RVHA 3DOHA 3JARA 1R15A 2FN7A 3ED1A 5BSWA 2J09A 5C1BA 1E20A 1LEHA 1ZIOA 5KPJA 1OX4A 4M99A 4BMYA 1U5AA 1ZGZA 3VU8A 4BX9A 4LJ9A 3AESA 1K06A 1QQ7A 2OV3A 4RCYA 5C5DA 1CB0A 3CX6A 3E81A 1U8ZA 1GZ3A 1P7PA 2YDXA 1AKVA 2EFDB 1YA8A 3BMXA 2YXLA 3GNQA 4JBHA 1RSZA 4NYIQ 1E5DA 1V2HE 3VU1A 1T2CA 4U7DA 2EX0A 1NKSA 5L4SA 3BE5A 1ZINA 4RIGA 1DTWA 4AYTA 3H8WA 1EDZA 1UWCA 3IE0A 2G0TA 3GVXA 3QUCA 1D2EA 1HRKA 5CVUA 2V96A 4BNDA 4BNGA 1PJLA 2RHMA 1OR8A 2GCOB 1KDYA 2X4LA 1J99A 1T10A 1ULAA 4BJ3A 1Q1ZA 3KQOA 5IX8A 1EXMA 4CM7A 4DMLA 1D03A 1XZEA 4BHTA 3CSSA 3S1LA 4D1YA 1MA0A 1SZCA 1T8RA 1RVV1 4RVSA 4A82A 1O0CA 1G3IA 1SIOA 3NHSA 3RIEA 1RMQA 1Z26A 3RQIA 1EH5A 2IV3A 1V37A 4CKWB 3KE8A 5BYAA 5TPWA 3GJQA 4GC9A 4RSHA 3R8CA 4M8NE 1EGHA 3LDAA 2DKNA 4MS3A 4BO6A 1GNQA 1LPBB 3ZD7A 2VLIA 3NBAA 2B5WA 4KRFA 4FCCA 3B1KA 3RB8A 1LTKA 2LIVA 3OM0A 1ZUHA 2J5QA 3FKSD 5K2OA 2C5HA 1X9HA 3RC3A 2H31A 2PNFA 3TD6A 3M4NA 4AJ9A 2CLLB 4O4LB 3WLRA 2WPNA 3PPXA 1VHLA 2GPTA 4ASUD 1U2TA 4MWTA 4PW0A 2OAP1 1EWTA 1K5DA 4JITA 4Y0NA 3IAEA 5THQA 1Y5LA 4RFSB 2VPWA 2C92A 4UTRA 4DA9A 2C57A 3CIFA 3COYA 3JYHA 4LXUA 3L0SA 5F51A 1CSEE 1H42A 4W1QA 1Y6GA 5K3DA 3AUSA 2P69A 3WRYA 1YT5A 3E8XA 5THXA 4AS2A 4WBNB 2XMPA 5LMUB 1SKAA 2HZ7A 4Q21A 1V4BA 4RHCA 5K45A 2D7DA 1N2CE 1UBNA 5FV4A 5AO9A 1EVLA 1RW4A 2CVFA 1B6TA 1B6GA 3EMBA 4WZAB 1P2SA 4EHHA 4PG6A 1FLNA 5DIZA 2FEOA 2HXYA 4NU6A 4OQZA 4L75A 4UBKA 1WQ4A 3A1EA 2JIZA 3C3YA 4XLTA 3HC7A 1R16A 3E9EA 5JAZA 1QXSA 2HNKA 4N48A 4O4LA 2CCJA 2HK7A 1OXUA 4HPJB 5KVQA 2OCLA 4LGMA 1RJ9A 5HDBB 5JBNA 3A2LA 2Q5OA 2YIDA 4IH4A 1E79A 5C5IA 2FGJA 4KFUA 1G17A 1KXJA 2VEOA 2HMUA 1FLVA 4AZSA 1BE6A 5CMLA 1BYUA 1L7OA 1CP2A 4QNMA 2Q1SA 1KQFA 5H5JA 3VNQA 2F1HA 5TMBA 3ZXXA 3SGLA 3BSWA 3HU5A 2YYAA 5JXGA 4C4TA 4AMZA 4KJXA 4R9VA 3M82A 4BKUA 3C15C 4ZOCA 5BR8B 2RG7A 3I1IA 4DSNA 3G0IA 2FR0A 1DQRA 3H5LA 3PHJA 3QX8A 3FVVA 2B82A 3U48A 4CM3A 4KAFA 4L95C 5C31A 1JSLA 2IKQA 3ANYB 3AO0B 1RQXA 1KO4A 2HA3A 2ADMA 3S7ZA 3ZDAA 3WMEA 3QPBA 4JT9A 5HS6A 1SXIA 3VX4A 4ARVA 5IC4A 5LYJF 1RADA 3GEEA 3BEDA 4GFDA 5GP1A 2RE8A 4PLCA 2IBTA 2VI5A 1XVUA 3MIZA 4A6DA 2ZSEA 3SXPA 1ECBA 1EP2B 4CGYA 1T4CA 4W63A 4HSEA 1T26A 2X40A 1T24A 4IXNA 1XCPA 2OCAA 4HWKA 3TZHA 2OHGA 3CB2A 3SG0A 3B12A 1TZMA 2QBYA 5CBKA 3RUDA 4TMYA 5EERA 2NV0A 1WSAA 2OL4A 4H60A 2C2ZA 4HWSA 5G0UA 2HDHA 4Q05A 1Z07A 1DHRA 3MW8A 4ZTBA 3O73A 3GJ4A 3OIDA 4YMHA 1W85A 3FR7A 1KKLA 1NMEA 4UATA 1TIPA 1V5EA 1EQAA 3L0YA 3K70C 1YJQA 3DFZA 3ZU6A 1OVMA 1Z4QA 3Q2KA 3AKEA 3AERB 1MOQA 3VZSA 1YZUA 3D3JA 3WK5A 4F3RA 2EZ8A 3REOA 1AN0A 3AHJA 4QDXA 4DLXA 3WI7A 4LISA 4DG9A 1AGNA 5MGBA 3JD1A 2E2WA 2J85A 1E18A 1TEVA 3VI4B 1O57A 2W2LD 1Y4UA 2XADA 4FGLA 4YDRA 1Q3KA 2ONCA 2B61A 1ZK4A 1VYUA 2WM3A 2F43A 3CLTC 4O3MA 4AWAA 2BJHA 1Z5ZA 2UUOA 1PWHA 3A1UA 2REOA 3TZ6A 1MPXA 3K8ZA 5DXAA 1PHRA 2BGTA 3H4TA 5IZCC 1K27A 1MX3A 5B58T 4E7PA 5I8PA 2IZZA 1L4MA 2C00A 5D5QA 4DV6B 4OLBA 5EUBA 3ITDA 1M0SA 4Z0PA 2VT7A 4X61A 3I9JA 2FETA 2KLBA 3P0HA 1KZ9A 3VAAA 4DBZA 4PAQA 1GGFA 4M1WA 3SCZA 4MDEA 2UVPA 1TZCA 1KDTA 3UBTA 5EJFA 1F2UA 3BKXA 1VE5A 2JI4A 3D43A 2LPMA 3LT2A 3OZDA 2G0AA 3PDIA 2F3UA 3QPCA 3X1KA 4BGVA 2WP8J 4F5ZA 4ZK6A 3PE4A 1KIMA 4QXPA 4FJ2A 5KQLA 4R1TA 1OX6A 1FLDA 4RPJA 4G4GA 2V58A 3PZRA 5FYQA 2OM6A 1OJLA 3ETEA 2NT3A 2PH7A 2GEKA 4J4HA 4ZAVA 2JKVA 1HLFA 3EBPA 1J8QA 4NH4A 2HTEA 2P4HX 4DCSA 3PFIA 5BWMA 4LZAA 3F90A 4FYJA 1PL0A 4UEKA 2EIHA 5HFAA 3L4JA 1FFYA 2O8BB 4RDHA 4LTMA 2ZUSA 3BILA 1PF7E 1Z0KA 3ABQB 1YS1X 2FRXA 2VDWB 3FJOA 5G3YA 4G8BA 1SXJA 1E5LA 3PC7A 4FDUA 4S12A 3IVAA 2EQBA 1JR3D 3B7GA 1E2KA 3WKCA 5FAKA 4MRAA 5TT0A 1DAHA 3IAS1 3RIYA 1UM8A 2EKZA 2R00A 2VP9A 1M2VA 1ORWA 1DADA 1NBWB 3NDPA 5AXDA 3RC1A 4YJ3A 3PA6A 1W1UA 4BU0A 2ZTHA 4KXFB 3W2TA 2ACEA 1J09A 1OLSA 4KFTA 2O8FB 1MD9A 4W6ZA 1LA2A 1X42A 2OQVA 4CQMD 4RHTA 2ZRHA 4QU5A 1MFZA 4ZQCB 3ZU5A 3EAFA 3CVXA 1XROA 4MYCA 4U7GA 1T1GA 5DN6A 2R5NA 3OWXA 1PR4A 1WZIA 4MPRA 2MMGA 4BUZA 2HCBA 4W99A 3ABOB 3PNLA 1I32A 3BFXA 1UDWA 3HYCA 5J2UF 2PSHA 3KKEA 3MAGA 5JJ5A 2K7FA 4BMSA 5I9IA 2JFWA 2WVAA 2YFYA 3A3KA 3GDWA 3SHWA 4RVFA 3DYIA 4R8SA 2XCSB 3K92A 3D81A 1VBNA 2W43A 2X4GA 1DXHA 3A4MA 3ZS8A 1A4UA 3W1EA 2E7ZA 3IPAA 3L04A 4U9UA 2E6UX 3DE5X 2GEJA 4TS4A 4D6PA 3P9CA 3BZBA 3QJ5A 3F2IA 5AVJA 3UAWA 2WPDD 3U49A 1CVIA 1R0CA 2XB8A 3EVDA 4WAUA 2XA2A 1Y3HA 2R25B 3TQRA 3RF7A 4MB2A 5LB2A 1E61A 3T7RA 3ZUGA 4BQEA 2RG1A 1DQPA 4KPUA 9LDTA 2PMDA 1SRQA 3I6ZA 5BP7A 3PJDA 5ICSA 2GSDA 1PX2A 1Q16A 2V9ZA 3ND7A 4OQYA 1WUHS 3AM4A 4TLBA 1BVYF 1M5TA 5DW0A 1V7PC 2A9RA 1O94D 4JEUA 4PGMA 5AUNB 1RJEA 5DSZA 4HGOA 2ACVA 1OGJA 3BCSA 2J6IA 3IDSA 2H5JA 1L1RA 3DEIA 1P0QA 1KI7A 2VQSA 3GBSA 2A14A 3HU2A 5EHIA 2WIKA 4LWPA 5KOJB 3L8GA 2BFFA 4ZCQA 1U2GC 5LMCA 4IV5A 2GVDC 4IDAA 1D1TA 2BIFA 4XKJA 4RE6A 3A58B 3SHQA 4OYYA 4ND6A 3ES9A 4F9GA 5L9AA 4QYXA 1UDBA 4B6PA 2NLOA 5IXJA 3MAJA 3L8FA 1BSVA 2N1MA 3EXHC 4KXYA 4Y6PA 4N0EA 5IANA 5CFMA 1VIAA 4N4AA 4PANA 3LMKA 4D4LA 1WPGA 2XD9A 4FUQA 4M8KA 4P32A 2EGHA 1SQ5A 2XYRA 1DWQA 2VBCA 4B2IA 5F3WB 3VPFA 4OI0A 2AR9A 3PBKA 2IK8A 4CCYA 4CIDA 4OXQA 4U6QA 4QOIA 3B1JA 2X2EA 5TQ2B 3VR4H 2EKDA 4EGJA 3U56A 2A5LA 3DXFA 1WQ3A 1O6FA 1V0JA 1SD2A 2I7DA 4HB2A 4IIBA 4ACBA 1A7KA 1RXCA 2GTPA 3DDNA 1D8AA 2P79A 5HK8A 3AVTA 2FQYA 3LBYA 1ZR4A 2CKMA 1Q77A 4G5QA 3GL9A 3HXMA 1L9XA 1PJCA 2OAEA 3UANA 1N36B 1DIHA 4YJHB 5FUMA 2NXWA 5JAMA 3B51X 3EISA 4CG2A 1EK2A 1YMVA 4I9HA 2OHOA 4P3PA 4DAOA 1N6OA 4ER3A 4JK3A 3H3FA 1TAHA 2DTDA 4IW3B 4BN0A 3DUWA 1JIUA 2IZ7A 5DLEA 4V0ME 1Q17A 1H22A 1CUDA 4XIJA 2V4MA 1AQUA 1G2QA 1X7ZA 4KX5A 1U8YA 3CG0A 4ZMSA 3DVAA 5LXTA 4D3FA 3ZDRA 2GQ0A 3LX4A 1ZC3A 1JKJA 1Z8HA 2HU2A 3BWMA 2XT6A 3QE4A 5D01A 1YDGA 1JPNA 4A92A 4CM9D 4MWDA 4CM8B 3T5GA 1IM2A 1MO5A 1X7DA 2E9SA 3S99A 3LCJA 1XO1A 3X2EA 4YCMA 5IZ4A 2DFNA 3CH6A 5IJXA 4YJ3B 5CAEB 5HA5A 3ZWQA 3ROQA 1GADO 1YZ3A 4WJKB 2B8TA 4HJXA 3Q6IA 3P19A 3Q12A 1J6UA 5FPQA 3CX3A 3EQ8A 4IV0A 1V8DA 4NU5A 4WN3A 2PCJA 1MAUA 1LX6A 2KE5A 4N6OA 4B4KA 3Q3VA 1G38A 5C8XA 4CIWA 3UGJA 4J0JA 4W8GA 1VLMA 4UFOA 1JB9A 3WSVA 2P5SA 2IYRA 1N0WA 4X97A 2UVQA 2PVPA 5EJ5A 3IKLA 5HE8A 2V55B 2BFPA 3UF0A 3MN1A 2KBFA 2W2KB 4LNHA 4A0RA 3IODA 3QVUA 5LN1A 4E2WA 4BCBA 1XDZA 1P18A 1GA1A 1U8AA 4J6EA 10MHA 2QU7A 2VF5X 1R27A 2OB2A 2X76A 1O8CA 4N01A 3NT5A 4QXMA 4X6XA 5EPOA 5K1ZA 5CDFE 1NUAA 1OSNA 2UUPA 4KE9A 3RS7A 3JVEA 1QYVA 3V2UA 5LQAA 2B99A 1LKZA 4OQPA 1GSAA 3NYIA 2Y9PB 5ES3A 2EP8A 4K9NA 4R7ZA 4OV6B 2HU8A 1WF6A 2MTBA 4LY6A 2IOYA 3N7AA 5D85A 2NZVG 3V8NA 3AVVA 1E0AA 5E3IA 1J06A 2FZKA 4B35A 3QJGA 1Y9AA 4M3NA 2IQ5A 3EG5A 4X5OA 2V7PA 4L73A 5IJ0A 1JFTA 3CUYA 2FKNA 2C8LA 2BMAA 4C6SA 4O25A 2ZJ7A 4ZVSA 4M36A 1K88A 4RCVA 4MJLA 3PNYA 5E1BA 5A2GA 3GLFE 3GPLA 2IS4A 1QZUA 2I3BA 3LT4A 5AXBA 1WU8A 3E05A 4AYWA 4BO3A 2O0JA 5FL7A 4C4YA 5FWNA 1JX6A 1ZBDA 2QL9A 3N3BC 2QL6A 3ZE6A 3QXSA 1E6LA 2A5YB 1PR6A 3DLPX 1X7WB 5E6UB 3TIXB 4A8TA 2VJOA 1XSEA 4GOKA 1UZNA 1L8LA 1XZ8A 1TUIA 2RI0A 4P7KA 2OC4A 1ESDA 3QPAA 3K5HA 3S44A 3T3EA 4BMNA 4EHNA 4M37A 4ANFA 1AB5A 1P5FA 2F1RA 4RV5A 3B1YA 3EOBI 5JVDB 5HKOA 4W5RA 3DKKA 4ZJUA 1TUBB 4BNYA 1BDBA 4KW7A 2VDWA 3DE6X 4QRHA 1K08A 2PZMA 4WCFC 5T7BA 3VNVA 3H13A 2Z08A 4RVOA 4J7UA 2VH1A 4ZMRA 5JDCC 3AKDA 4BFLA 1TLLA 2HQOA 2Y6VA 2B4TO 2D4AA 1IZ0A 2RI1A 1OV4A 2RJ3A 2UVDA 3BVPA 3FZQA 1UBKS 1YB6A 1Q0PA 3BTUA 5ED4A 4DIKA 3TOZA 1YRHA 1ICEA 5K3AA 3NOQA 1MNQA 1VGQA 4NBLA 3R74A 3DHWC 2QJFA 1SWWA 4R2IA 3D5TA 2G5TA 2VUUA 3KYJB 4HR7A 4PGGA 1KZ6A 2Q9AA 5AWFC 3ZWPA 2Z6VA 5CT6A 4PN3A 3SVLA 1M1ZA 2D1TA 1WZNA 1E9CA 3FMPB 4DM4A 5ANRB 2PE5A 3AF5A 5KU7A 4N7BA 1IK4A 2ANBA 4ROTA 1IOLA 1ZJ5A 2PZBA 2ZE8A 3LG2A 2IU6A 2BHSA 5JLJA 4JX9A 2RBGA 1Z74A 1JBEA 3U60B 1I7NA 4L6IA 1AK2A 1QG4A 2RHLA 3GFOA 1KDVA 5HZHA 3TSYA 2G63A 2WFAA 4JP2A 4MQMA 1AKWA 2NU6B 4OGFA 1GAQA 1VLQA 3F1LA 3NEAA 4F6LA 3WGZA 2GKGA 1EVYA 3HDYA 3LDGA 3LWBA 2X9VA 1NW4A 5JQGF 2ATEA 4TZKA 4A5SA 1WV1A 1P9WA 3UW1A 2JLUA 2UV8A 1NMYA 1YASA 2ZBVA 4ZQHA 4KEAA 4IHJF 4PLTA 5EGSA 4MI1A 4J3NA 4UQLA 4BQNA 3MTGA 1UXOA 3SJAA 3U4QA 3FLMA 3FPJA 4B6FA 2OV8A 4GBJA 4Z53A 1Z2DA 2W2VA 2IW1A 2OM2A 4AY4A 1P2DA 4RORA 2QRJA 3GQBB 4NJMB 2XNKA 3D02A 2H4ZA 4BAGA 5C8YF 3AL2A 3KJGA 4LTDA 2B8NA 3MJRA 1P5JA 5L3SA 1FUIA 2GHTA 3IQWA 4P98A 5ED0A 3EX7C 5LP6C 1IRIA 3FOZA 1F2DA 3SKXA 3CX7A 4HXEB 3U7EB 5KVVA 4YCAA 5AI5A 4PFQA 3VTAA 3MAAC 3B3JA 4BJ6A 4D25A 3BXOA 1KMCA 2IGTA 3NETA 4HQKA 1J2EA 3EXHA 1N0HA 2BZSA 4V1CA 3F7NA 2EATA 2QLNA 3N6RA 2Y0BA 4QDOA 2WICA 4RA6B 1ODIA 2OBBA 2AC4A 1NG1A 4CHTA 4QDTA 5C34B 3GPBA 4H0NA 1SCDA 2JJMA 4GW3A 1RQPA 4PFSA 4PPQA 1U9YA 5CCDA 1LDMA 3PWKA 2N1BA 3ICEA 4MLPA 2OILA 3K96A 5L95A 1CR2A 4UEOA 1DKUA 2RH8A 5LXTB 1PTKA 1NJ2A 3RGWS 1PJRA 1XEWY 4JY7A 4MJ3A 4NP6A 2W2XA 3COWA 4V0RA 5FAXA 4YYEA 4I50F 4KN5A 4K1LA 2ZI7A 2QLBA 3KZKA 1KO1A 4RFSA 3ZCXA 2AKAB 2EW2A 3CRNA 4UFNA 4EKGA 2DCUA 5IJZA 1SK9A 2IHUA 2ZI6A 4Z9FA 2XWQA 1AA6A 1J7KA 1NYLA 3EGDB 2P3LA 4EOGA 4DIOA 1DQZA 3RUHA 4DARA 3UK2A 4WZZA 4BQRA 4BTVA 5TQ0B 2WWTA 3PRHA 5G02A 1KE2A 3LHDA 5KREA 3OQMA 4GX2A 1XDSA 3OLCX 2ESRA 4EWLA 4Z4GA 1OWPA 3EVZA 3PDIB 4GSYA 5F35A 1BJRE 2P9HA 4JYAB 2IEBA 4WWHA 4ESOA 1TO6A 2GKSA 4OPMA 1LFAA 1UQRA 4OHPA 2RHBA 4ND4A 1JHDA 1QYIA 2HYDA 3BWDD 4G1MB 1T6YA 3GEDA 1PJBA 3NP7A 3QX7A 3H2BA 4ONEA 2RKOA 1Q1EA 1SG0A 2A59A 1I4WA 1FQKA 2B34A 4RPCA 1UKAA 2XEDA 2GA8A 3QY9A 4H7EA 1NUTA 1U7DA 5F9MA 3UKJA 3LRTA 1P77A 1NZDA 2WV7A 2ASEA 2OGTA 3U3KA 3E0XA 1OI2A 1PTJC 3PHIA 4WFIA 5E9QA 1CRLA 1LWNA 3ZV3A 4V02A 4M0FA 4Z4CA 2REQB 1JPUA 1NSYA 5ALQA 3I62A 1K92A 2B83A 5K4AA 2C7BA 5CTAA 5ALZA 2OSBA 4ZI5A 1HMPA 2VHYA 4AO8A 3WRYC 3DLAA 3F3YA 2JLQA 2SCUB 5JXHA 3TW4A 4P3XA 4TKMA 3SAJA 1RIFA 2QRMA 5HQ3B 1V1MB 2TMGA 1KQPA 3CBGA 2CN1A 4NNPA 1D4FA 4WBSA 3VJMA 4DTCA 3KTAB 1CRWG 1DC5A 5IBQA 4ZI7A 1ZD4A 1RD4A 2QAJA 1PR9A 1RXIA 2LKCA 1QFZA 2E6KA 2F1IA 1NXOA 5CVCA 3L49A 1T0PA 2P6MA 4Q93A 4AL4A 1TLTA 2WR8A 3KVRA 2OBNA 4BO8A 2ODEA 4NBUA 1HEUA 1G21E 2PX5A 4J3JA 4B1FA 4CFZA 1ESEA 2I9KA 4U4AA 2OBXA 1TIKA 1ODTC 4GM4A 1U7PA 4S05A 1TUBA 5TF4A 4AN0A 4J1TA 3ZBUA 4AJ1A 1GGHA 4AYXA 4I99A 3Q9NA 2WA1A 1TVMA 1QZTA 2R62A 3AEQA 1USKA 5BN5A 2AEMA 2LIPA 1RYBA 2JGDB 3IBTA 5LDDC 1X70A 5KQMA 4Q02A 1M5RA 4B8ZA 4WK4B 1BXZA 1DAIA 4ZVOA 4DLVA 1L5FA 1P5ZB 2NACA 4PBSA 2G80A 3UXHA 2HFKA 1A96A 3VVMA 1IEWA 1SURA 3INRA 2IDKA 2MDTA 3GFVA 4LV8B 4M1KA 4IO1A 4XX0A 3DPSA 1X15A 4E1BA 1ORRA 4F4CA 3IIJA 2AF3C 3LLVA 2PS0A 3WMFA 2P8JA 3W7BA 4JASB 4BRSA 1KPGA 3HCEA 3FETA 1X8LA 4HNHA 3OZ7A 1SC9A 2ZRKA 3NRJA 3DT8A 1NSTA 4DLZA 2J3LA 5ENDA 4V1CI 2GD6A 2WW8A 3NNDA 2ZTSA 2JLWA 2QG6A 5KS2A 2BM0A 4N5IX 4UMFA 1MIOB 1PG2A 4UTZA 4FOTA 3N2KA 2HDNB 2WJZB 1WCWA 3PHBE 4WOCA 4EJ6A 4G0VA 2W2MA 3RIHA 3P9KA 1J8DA 2VRNA 3PFCA 4H7JA 3W5HA 5KIAA 3TGPA 4UDNA 1OX4B 2PJZA 3K72B 1BWPA 4GPD1 1Y3FE 2Z4SA 3RHSA 3HCPA 2J46A 5E4YA 3T1QA 2VXCA 4PXSA 4MKZA 1RQLA 4O3FA 4AX4A 2ALJA 3PD7A 2CXSA 4IVQA 1DTSA 2ONZA 3I58A 4RANA 2R8YA 1KOLA 3E9MA 5JARA 1Q0TA 2VP6A 4AJPA 1LQTA 4CG0A 4Y3UA 2V7GA 4CMJA 5DI3A 2QPOA 1YTUA 3K0FA 3G0DA 1HDZA 4PPFA 1NHWA 3E3LA 5DHAA 1U2DA 5BR4A 3ONVA 4AF8A 1ZAKA 1QDEA 2H4JA 2H1OA 2HPVA 2XB4A 3ITEA 2V8BA 4EFKA 2E0IA 2NV6A 4O08A 1BFDA 4IIVA 1RLTA 3AF3A 5D3ZA 1KE1A 1NI4A 4AQDA 3FPSA 1EM8B 4JUCA 5IXSA 3FBTA 5DJ5A 3UHFA 5IRCD 3TECE 1Z37A 2OZLA 1Z2OX 1GJRA 3GJ5A 4KVFA 5ILGA 2ID8A 1JNXX 1NM5A 4JCCA 3SIPA 3RAFC 2YVUA 1PWXA 1WLYA 1XFAA 2AUNA 2ZAOA 2B98A 5J5VA 1UAGA 2ORWA 3DMDA 2C2MA 1GCUA 3V7YA 4C4SA 2FG5A 4LK3A 5A0FA 1XRJA 4BO1A 3U7QA 3FWHA 3W5CA 3F7OA 1IOZA 2DPYA 4HLCA 3OEYA 3U4AA 5FUXA 1KK3A 1G8AA 3M5WA 2HL6A 5M29A 4MW4A 5H80A 2FJUA 4Y6RA 2J5RA 1PEYA 2ZQYA 1E4VA 3I4FA 4UNQA 2GN1A 3Q8KA 3DLHA 3C74A 2IPOA 2O0KA 2W6PA 3P2OA 4FFMA 4U3JB 4ZVVA 3RADC 3BD8A 2PPVA 3A31A 1TVCA 4IX1A 4KI7A 4R05A 3JVUA 4H1WA 3BG5A 1N6NA 1YGYA 3C1OA 4E51A 5HJ7A 1M83A 1P3DA 2P11A 3R5JA 4ARCA 1XCBA 2VAXA 5HCUA 4HNAB 3SC4A 1I0LA 4GLOA 4G5GA 1AOXA 1TD1A 3UK6A 5J4KA 4KXQA 1HDIA 3T9DA 3RVDA 3GB9A 3GJTA 1ZWKA 3TZEA 2VTEA 3SQDA 1H1TA 5KDDA 5EKDA 4YCLA 4RQBA 1FFDA 1SVMA 2FW7A 3EOAI 4MW9A 4QICA 1H2RS 5K3EA 3SJCA 1LH0A 2DYKA 4U8HA 1EKXA 3DE2X 4D3SA 2YJ5A 4KVZA 3UATA 1Z6PA 1W36D 1FSSA 4CIVA 3FX2A 1L5GB 5C35A 3FOBA 3Q9SA 4GO1A 3E58A 3BL5A 4NYIR 4N5LA 3QH4A 4OX9B 1DOHA 4B9AA 3C7DB 4JC5A 4TRJA 1SKMA 2BFMA 4F4HA 2I4LA 1NJ1A 2OVFA 2XV1A 3HUTA 3VPBA 1T3SA 3UAOA 4PYJA 5ADHA 2IV2X 3AKCA 4RTRA 4LTNA 3ZK8A 2W4IA 5J5AA 1ONSA 4FXPA 1T9HA 4F85A 5FPHA 3N39C 4EEXA 4M53A 2IVZA 5C7LO 1F7VA 2BI4A 3UAYA 3BMNB 3KU4A 1ZMTA 3EEBA 3L7KA 1CLEA 5E8JA 3RWOA 1BQ4A 2PX2A 3SYMA 3EHEA 2P65A 3W7VA 1JJAA 3QLUC 4TXLA 5ICMA 5LP6B 1RRCA 2ZU6A 2C95A 4AG6A 1JH9A 1F0NA 1RKBA 2Q2NA 3SZGA 3EQ6A 3CW8X 3HM2A 4KQEA 4EFDA 4QFCA 3ZLTA 1KP2A 4CL3A 3NQ41 4Q24A 5EVJA 1WXEA 1GKIA 3NASA 5C3MA 4YY3B 3EZ2A 4FDLA 3FKQA 3HVKA 4UHHA 2Y1GA 1B42A 2C1XA 2VUSA 4ND8A 4C0SA 5EL0A 2ATXA 2ZTMA 1DL5A 2Y66A 3RVRA 1VGRA 1IBCA 4FC7A 5AXCA 1JA9A 2QS9A 2ZUUA 4FFWA 5TE9A 2E5LB 3CZRA 2AOUB 3WBFA 3LTNC 1XD9A 4AC9A 3W7AA 2AK2A 2AW5A 1Y9DA 4K3VA 3R6WA 1QZ3A 3ZBTA 2FHSA 3ZHQA 1ZGHA 1O4WA 2EEZA 3M5DA 4WCVA 2IHYA 3SNKA 1W52X 5TT1A 1I94B 2DXIA 1C2TA 3OCJA 1S5PA 3AIOA 4LJAA 2PUJA 1K5GA 1TKBA 5BT9A 4CT5A 3ZD6A 1YZVA 2JFXA 3ASUA 1UFQA 3DO8A 3LQ1A 2ZSJA 1JHPA 2F3RA 2A5JA 5FWXB 3ZY2A 1DJQA 4RACA 1FP7A 3URKA 2YW2A 2GWHA 4R1UA 4C7BA 5DH9A 3IOBA 3G1WA 1L5KA 4DDKA 1K6MA