3DTTA

Crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
227
structure length
220
Chain Sequence
GMKIAVLGTGTVGRTMAGALADLGHEVTIGTRDPKATLARAPPFSQWLPEHPHVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIANPLDFSHGMPPTLNPVNTDSLGEQIQRTFPEAKVVKTLNTMNASLMVDPGRAAGGDHSVFVSGNDAAAKAEVATLLKSLGHQDVIDLGDITTARGAEMLLPVWIRLWGALGTANFNFKIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative coenzyme F420H2:NADP+ oxidoreductase (YP_830112.1) from Arthrobacter sp. FB24 at 1.70 A resolution
rcsb
source organism Arthrobacter sp. fb24
molecule tags Oxidoreductase
molecule keywords NADP oxidoreductase
total genus 68
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dttA00
5AQ1A 2FWMX 5L51A 1H6BA 3Q0EA 3PVZA 5IXYA 3DOOA 2A92A 2NWQA 3U49A 2C7GA 4QEDA 3VPGA 1LNQA 3OIDA 1G0NA 5BSEA 2BKAA 4CLDA 3L6EA 3D4PA 3OIGA 5TSDA 1ENOA 2Q2WA 2Q4BA 3JYQA 1GQQA 4EUHA 4IDFA 3D3WB 3AI3A 4PLGA 3PI7A 5JW6A 3WSWA 3DBRB 3JD1A 4MVJP 2GNAA 1CIVA 3BTSA 4A26A 3OJFA 4CQMA 5FF9A 5TJ9A 1GUYA 2HJRA 1QLHA 3WLEA 1KVUA 1A5ZA 4XKJA 3NDJA 5BT9A 5COQA 2CVZA 5TRTA 4YJGA 4Y9DA 4E5PA 4WEOA 2UUOA 3VC7A 3SC4A 4D46A 2VN8A 4BO8A 3DEYX 3HUDA 1SNYA 3M2PA 2CVOA 1EK5A 1DBVO 4J7CA 4RV9A 1JQBA 2EW8A 1U5AA 2DC1A 1HDCA 1QSGA 3CMMA 3GGGA 4PLYA 2AA3A 3VAZA 4EJ0A 1UZMA 1DRWA 3TSCA 1BTOA 3CKYA 4HFNA 1ZMOA 4MVJA 3ZWBA 4ND1A 4RVFA 3CEAA 1QYDA 1FDUA 4D42A 3ZN2A 1JWBB 1O5IA 1X1EA 4N5LA 4AVYA 2IZ0A 4JJFA 4O1MA 1I5RA 4TRRA 2BFMA 5L4LA 1C0KA 1LQTA 1MXFA 3KYBA 5G4KA 1E1MA 1P0FA 3GMSA 3DDNA 4BO1A 1U3UA 3BMNB 3WTCA 4EI2A 4LSWA 3C7DB 2YQ5A 4MP6A 2I76A 4PVDA 1KETA 4O59O 3ETDA 3PHJA 4GWKA 5JNLA 2BFAA 1MC4A 1PSDA 4O0LA 4UUOA 3JTMA 4Y98A 2HKIA 2VWQA 4IMRA 4XGNA 1Q7CA 1NNUA 1GV1A 4IZIA 1VKOA 3JYPA 4IMPA 3R6DA 1YH3A 3KM0A 3GG2A 1WAMA 2DU8A 2ZYGA 1KEWA 3RFVA 5B4UA 2FSSA 3NDRA 3RFTA 1T4BA 1LUAA 1MP0A 3PJEA 4OM8A 1NAHA 2H6EA 3RUHA 1X7DA 4NBVA 4O6VA 4IM7A 3I52A 2R6JA 4DLBA 4Q3CA 1PJQA 5FWNA 5HTOA 3ZI0A 4I5GA 3RFXA 2CY0A 5THQA 5BQFA 5IZCA 2A94A 3KV3O 4M87A 1HSZA 1N5DA 1Z45A 1DJNA 4B3HA 1PGPA 1DB3A 2ZYDA 3ZWCA 4HNGA 4WNCA 2F1KA 3AUTA 2CSUA 2GZ3A 3FNGA 3E1KA 2HAEA 1P3DA 5CDTA 2AEMA 1NVMB 2PV7A 1X0XA 2O3SA 3VH3A 2BH9A 3LC1O 1YL5A 4YA6A 1Q1NA 3V1TC 4CQLA 4M8SA 4CV2A 1YL7A 1ZJZA 5H81A 5U9CA 1PGNA 1KC1A 3M1AA 5ICMA 3PDUA 4E3ZA 3WQQA 1N7HA 5ER9A 5K6AC 2V65A 1UXGA 5B4TA 2D0IA 3RUDA 1PZHA 4TMFA 2CDCA 3G1TA 3FBTA 2GUGA 3DHEA 4YT2A 2I6TA 2B4TO 2C5EA 1C0IA 2RBEA 3ZWVA 3U0BA 4AJHA 4IUYA 2XF8A 3ST7A 2POQX 4N7RA 2HCTA 3GN1A 3K8ZA 4U5QA 4WCFC 1ONNA 2UAGA 3IP3A 3S2GA 1LTHR 1EBFA 3I9MA 1U28A 3OA2A 2VTDA 3HADA 4YPOA 1AHHA 1NTOA 1GEEA 4RPJA 4RVDA 1OC2A 1J4AA 1IZ0A 1ZVMA 1DC6A 1NFRA 2DTXA 4ALIA 2QIOA 4R4JA 4RZIA 3PHGA 3AOEC 4CM5A 4LN1A 2OZPA 1M2WA 1XKQA 1LX6A 4BB5A 5I9LA 1I0ZA 2DBVO 4GKVA 2I9PA 1B15A 1LSUA 1YJQA 5IDQA 5DT9A 1JW9B 1U8FO 3EVTA 4LMRA 4MIOA 1E0DA 1TEHA 2ZTMA 4IJWA 2JD0A 1W0CA 1I36A 4LMPA 1NR1A 1HYHA 3GF4A 3WGOA 1LQUA 2ZB7A 4YDRA 1AHIA 5JAQA 3ROMA 3LQFA 4ZRMA 4Z6KA 3NGXA 1HYGA 1QYXA 4OQZA 4L8VA 3FD8A 4B7UA 2P68A 3B1KA 5AXAA 4I8XA 1SO8A 1LDEA 4NBTA 4D44A 2X4GA 3ON5A 2YUTA 4NQZA 1GL3A 4OMUA 1H6DA 4PN3A 4XRGA 5U4QA 4IQ0A 4EDFA 4INAA 1H6CA 4XWYA 5TF4A 1EVZA 2PK3A 1AE1A 1ONOA 4KTVE 4OGWA 1B14A 4ZVVA 2HMUA 4LK3A 1DFIA 3IS3A 5CHEA 2HUNA 3P19A 3A28A 2W2KA 3FHLA 2P4QA 4PLFA 3JQFC 1PZEA 3K6JA 3KOUA 4M89A 5EPOA 2PD3A 2X9NA 1B7GO 2W4QA 5HBRA 3IP1A 3KUXA 4PZDA 2CDBA 2HRBA 4ZJUA 2YFQA 4U8GA 1ISHA 4WECA 3DOCA 2JHGA 3HDYA 1HL3A 2BFPA 2GLXA 4DWVA 1E92A 3UAGA 3KB6A 3I9KA 4EUFA 2JCVA 5G2OA 4JROA 4F45A 1RKXA 1OI7A 1LLDA 4BKRA 2YDXA 3JQCA 1DDOA 4RDHA 3AJRA 1XQ1A 1G1AA 2AEJA 2C7VA 4CM1A 1U1IA 5GY7A 1PJBA 1DAPA 1I8TA 4BGIA 3BXXA 3G3EA 4E4YA 4GL4A 5F5NA 4CMKA 3FSRA 1UZNA 4E33A 2NACA 2ZYAA 4GI2A 5DCYA 3QVOA 2VCYA 1A7KA 3AW9A 3UICA 3UOGA 1RPNA 4Q3BA 4R9RA 2WEKA 2NTJA 1PGJA 4GVLA 2BI8A 4BGEA 2GN4A 1MXHA 4NFHA 4PG6A 1B0AA 3L6OO 5JDCC 1UDAA 2Q45A 3JQ7A 2Y1OA 4IQGA 1JDJA 4MVJF 3RWBA 1JTVA 4MVJH 1EVJA 4BKPA 4QFCA 2PD6A 5JAZA 3GK3A 4J1SA 4AJOA 3MJSA 3ITKA 3U4IA 3GRKA 1GUZA 3PK0A 2I65A 4DRYA 5KNLA 4RLSA 3TJRA 3WGTA 3H3FA 3QE3A 5DBFA 3F5QA 2LDXA 1I3MA 3WOHA 1BXZA 4UVGA 1F8GA 2RIRA 4NG5A 1C3VA 1D8AA 1NVTA 3IOYA 3KLPX 1B8VA 4I5FA 4QQRA 4CL8A 1E3SA 3UCEA 4MOWA 3WGQA 4F46A 3DMYA 2AHRA 5T5QA 4BOYA 1GEGA 5A1TA 5CDYA 5IDWA 3KEOA 1E1KA 4FC7A 4CM8B 2I67A 2JD2A 5ILGA 2JCYA 3HDJA 5JO9A 1ZBQA 1ZSVA 2D5AA 2X0RA 2C0CA 1K6JA 2BLLA 4FR5A 2EKLA 3IKVA 3ZU5A 3PYXA 5EL0A 3QVSA 5A9RA 3GEDA 4RVHA 3EZLA 4NU5A 5KKCA 2X5OA 1TT5A 4JQCA 1IB6A 5F3RA 4J6FA 3OQ6A 1MLDA 4II2A 3W4KA 3S2IA 3IC5A 4FFOA 5BR7A 3GPIA 4BL5A 2Q1UA 2WD7A 3I6IA 5DN9A 2O3RA 1AGNA 3CE6A 3H2SA 2QYTA 5JY1A 4HUJA 4OH1A 1HLPA 1UXIA 2O4CA 3NUGA 4DIOA 3BMNA 3QVWA 4WLNA 2CUKA 3AI1A 3TZKA 3WGHA 2BMAA 3A9WA 4NBUA 1PZFA 2W2LD 4L73A 3G49A 2EKQA 3GNQA 3KEQA 3OHSX 1DPGA 2ZIZA 3H9GA 2FPPA 3ZCXA 4BNMA 2J5RA 1J5PA 3GMDA 1LBEA 3KZVA 4NDNE 3D5QA 3JQBA 1V3UA 1IPEA 1ZXLA 2VWPA 1XU9A 4R5HA 4BO2A 4XX0A 3P5SA 4XB2A 5EINA 4H15A 1TVEA 2V6BA 1RJWA 1IPFA 2Y67A 4BO4A 4CM9A 1OC4A 1NBOA 2QX7A 2GCGA 2WE7A 3QHAA 4WCFA 3SJ7A 3KLMX 1A27A 3AY6A 2IEDA 2ZCVA 2EKPA 4D0SA 1GYQA 1NFFA 4DPLA 5I7VA 3PTZA 4L75A 3W1VA 2NU8A 2GD1O 2AQ8A 2Q49A 3DBHA 4IPTA 4R9SA 2O3JA 1F8FA 4CR6A 5ENDA 5DZSA 1P31A 1BGVA 1MFZA 4O5OA 3E8XA 3NT2A 3WJ7A 5JY6A 3TQHA 3PJFA 4UEJA 2PY6A 3JQDA 1RYDA 3QP9A 4BMVA 1B2LA 4EZBA 2X0NA 1SMKA 1HE5A 1XYGA 2HRZA 3QWIA 3C85A 1EBUA 3ITDA 3OJ0A 3RQSA 3OH8A 4A0SA 1X1TA 3V2HA 3KYDA 4MJLA 4XB1A 3GDGA 5JDCA 1VJTA 3QWHA 3SXPA 1ZXBA 3KYCB 3RUCA 4HFRA 3KRTA 3VHRA 3GEGA 4OSOA 1A4UA 3E9NA 1I10A 1CETA 1SEPA 3MCVA 4RF2A 1A7AA 5L7TA 3ROQA 3GZ4A 5K6AA 1VJ1A 1JA9A 2Q1TA 2DTEA 2RAFA 2AG5A 3IAHA 4XGIA 2Y1DA 3FNEA 3HJAA 5BSHA 1ZH8A 1OBFO 3LC7O 2F00A 4CPDA 4BNWA 4NJMA 1U9JA 4L74A 3PP8A 3V8BA 1TA4A 1ZNQO 1PR3A 1GR0A 3FRJA 4MVJE 4I5DA 3RUIA 4YJFB 1PTJA 3BMCB 5KJ6A 2G76A 3DAGA 3VPXA 2YV3A 3GQVA 1V6AA 3PQEA 4CM8A 3E5RA 5DBIA 1F17A 4DBZA 5KJCA 3RKRA 5A06A 1GADO 3IL2A 3BMOB 4GVXA 4C7JA 2BGMA 2X8LA 2ZB8A 1WW8A 1T2FA 3OICA 3BTOA 3QY9A 1F14A 1KY4A 3GT0A 3U5TA 4A7PA 3DO5A 1UP6A 4J43A 1ULUA 2VTEA 4EEZA 2BELA 1ID1A 3EUWA 4ID9A 4EBFA 1DRUA 1XGKA 1QV6A 2NM0A 5TS3A 5CG2A 2QZ9A 3ZWNA 2AEFA 1CJCA 1J49A 2O7QA 4RF4A 4YRBA 4XYLA 3V2GA 5L95A 5B1YA 1Y8QB 4CQLB 2Z95A 4BNXA 2Z1NA 1Z6ZA 3L77A 4D3FA 1YO6A 3ZNOA 4RJTA 3O03A 4GLLA 3ZU2A 4E2XA 4I9UA 4XYBA 2CF6A 3PLRA 4J2OA 1MV8A 3FBGA 1NQAO 2ZTUA 3LF1A 1XWFA 2O4UX 3E82A 2HMVA 2Q50A 5COAA 2X22A 3K31A 1WZIA 2QRKA 3DMTA 4TKLA 3ADOA 3Q2IA 3DFUA 4H3VA 5T64A 3V1UA 3BZUA 2AQIA 2JFHA 1OOEA 1MX3A 2AE1A 3LZ6A 2VZ8A 5JFOA 3LC2O 1PJ2A 4K1LA 2FZWA 2ZB3A 4XRRA 5T8KC 3ICPA 4BQPA 3OF2A 2V6GA 3HFSA 4XJTA 4YQYA 5MDHA 1ZCJA 4J90A 2YV2A 3OFSA 3WGGA 1ORRA 2I3AA 1XEAA 3GVPA 2RH4A 1TI7A 3R0IA 5ADHA 3WGZA 3VPSA 1WDLA 4R3WA 3T7CA 5KTKA 2DLDA 1H2BA 4MDHA 1T4DA 3ENKA 1SAYA 4IDCA 4BNLA 5BSFA 5IF3A 3OA0A 3ZU3A 2D5CA 1ARZA 3K9QO 2OP1A 1IOLA 5JMWA 3CTMA 5IJZA 4HFJA 1LJ8A 1HWYA 2C82A 2D1YA 2NVBA 3ENNA 3ICCA 2DT5A 3R3SA 4E5KA 3UCXA 4KUEA 1Z73A 3EHEA 4Q3AA 2CMDA 2VYVA 4E31A 3MOGA 1DFHA 3D0OA 1PQPA 1D7OA 2CNBA 4QXMA 1NHWA 1HLDA 4RDIA 1Y8QA 1VJ0A 1Y81A 2O3UA 3L4SO 5G4LA 1ZW1A 2HLPA 1D1TA 5JPIA 2AQKA 1H5QA 4XA8A 4OKNA 3S2FA 5F1KA 1X7GA 1YB1A 4YAEA 2NSDA 1KEUA 4XYGA 2P5UA 4RPGA 5I7SA 1T2EA 1PGOA 3W4JA 1WMBA 3W6UA 1Y7TA 1AN9A 2HMTA 3WBFA 4WCFB 3UFXA 5ES3A 4Y8VA 2A9FA 3PIIA 3PRJA 4J0EA 3AM5A 3O8QB 4GX2A 4BQRA 1ZIDA 3JQFA 1GPJA 4UVEA 4EGFA 3PZBA 4HNHA 3FPLA 4YVFA 4R41A 4IDAA 4NI5A 1CDOA 1PL7A 2YV1A 1VL0A 1YBAA 1A9YA 1NPTO 3FCOA 4DUPA 4L9RA 3H9UA 3JV7A 1FK8A 4PG7A 3LU1A 1LRKA 4HX5A 4DGSA 5JCJD 3GHYA 1HDZA 4BNIA 1LA2A 5IDYA 1AUPA 2Z5LA 5JDIA 1EVIA 3EVNA 1CRWG 3VOSA 5I8WA 4MP3A 1E6WA 3JCZA 3B70A 4IDBA 1M76A 3ADPA 2ZJ0A 4DYVA 4KMSA 1F0YA 1XG5A 1Z74A 1I33A 4MKZA 2X1HA 3CIFA 3ZWMA 4NH4A 1PJSA 1S7CA 3WWZA 2EERA 1P1KA 4M86A 4ZQGA 4R1NA 2J6IA 4PG5A 4YJDA 3UGKA 3LLSA 2VZ9A 1EDOA 1RM0A 3AUSA 1CF2O 1G0OA 2LDBA 4FFRA 1KEPA 2ILTA 2WYWA 4KDEA 1E3WA 3RU7A 5GMOA 4EJ6A 1PJLA 3DFZA 5A02A 4FOSA 3FR8A 1SCUA 1QRRA 1YB5A 2J8ZA 2ZATA 1SZJG 1WDKA 3GZNA 4IINA 4N5MA 4A10A 1QYCA 1YONA 2O50A 3F3SA 4D0RA 4YCAA 1PS9A 2IRWA 3DBRA 8LDHA 1LDBA 4CMEA 1XDWA 4D45A 3RCBA 3ZV4A 3TFQA 1I2BA 4ITUA 1BW9B 3T4XA 4PG8A 1V0JA 1G6KA 4CMHA 5A04A 5KWEA 4KOAA 1CQJA 1DC4A 1ZSYA 3SC6A 2J5KA 1U3VA 2GO1A 1NFQA 1UXHA 1ADBA 1O6ZA 2Y1CA 1H93A 2VRCD 3RBXA 1Y6JA 5JCJA 2NV6A 3A06A 4B8WA 1T1SA 3X2EA 3UH1A 2VOJA 3DAFA 4PLTA 1LDMA 5IDXA 3OP4A 2E4AA 4CMAA 4OXYA 1AXGA 4E21A 4K6CA 4WE3A 3UN1A 2VNAA 3MOIA 2D2IA 1ISFA 5JMPA 2BHLA 1H94A 1QG6A 2IZ1A 4HY3A 1JU9A 4UVHA 2EEZA 4YAKA 4H16A 1ZJYA 1C0PA 3GVXA 2O23A 4Z3DA 2A35A 3WSVA 1QKIA 4L76A 4DPKA 3BMQB 3D3WA 3GC6A 5THKA 1ADCA 4CMIA 1DIGA 3AUAA 1WP4A 3K2EA 1NYTA 2NVUB 1MB4A 1XIVA 2JHFA 4WJZA 3E6AA 4LVUA 4TQGA 1YQXA 4R51A 1XU7A 3SVTA 4NBRA 2W2LA 3WR5A 3I1JA 2AXQA 1T25A 3I9JA 3VDRA 1C0LA 1GY8A 3OSUA 4E2WA 4J1NA 2EWMA 3NYWA 3CZMA 4JP3A 2Q46A 4GBJA 4RQUA 4BO9A 3O38A 4JN6B 2WYVA 3GDFA 3DBHB 1EQUA 5JXWA 2VUUA 4PLCA 4QT0A 2E82A 1GQ2A 4ZICA 3ANMA 3RJ5A 4BMNA 3IDSA 2WM3A 5AYVA 3NJ8A 4WGGA 4ZQFA 1JVSA 4AJ2A 1E7MA 3DWFA 1KY5A 4MIYA 3F46A 4J4HA 4WASA 5DOVA 2BRUA 1K6IA 2BI7A 3U4HA 1A4IA 4TRNA 1I3KA 1GZ3A 4J3FA 3NV9A 2J3HA 3KXDA 3PFWO 5FEUA 1U2GA 3GPDG 4HADA 3W8EA 4BHTA 1VL8A 5I9MA 5IG2A 4ALLA 3SX2A 1DXYA 1E3LA 3W4IA 4CV1A 1CWUA 4B7CA 2PNFA 1QYVA 4CLRA 1DLJA 4JBGA 2DBQA 1ADGA 4RPKA 1LU9A 2I66A 4CMCA 3RVDA 1U4SA 1M66A 1GD1O 1P0CA 4JCOA 5TC4A 3KSDO 3GUCA 1K6XA 1HT0A 2ZJ1A 4NJOA 4CQMB 5B4VA 4XYMA 4LRSB 4Y67A 3A1NA 4IGEA 4CLRB 4A2CA 1QP8A 4IIUA 2CDAA 1DAOA 1QYWA 2NTNA 5DBGA 3NJ4A 4ZHSA 3DB2A 5AXBA 5U1PA 1YXMA 4NIMA 1EUDA 1W73A 3ZNPA 2C20A 3GUYA 4CMIB 4GMGA 4C4OA 2OGUA 3H5RA 3H2ZA 2HJSA 4UVIA 3AOEA 3G17A 1O9BA 2X9GA 1R6DA 2G0TA 4NU6A 4HFMA 4JNKA 4NJMB 4HV4A 4OOFA 1YBMA 5C37A 3V1YA 1U7TA 1KYQA 5DOZA 1Q0LA 5KJFA 4RCVA 3BHMA 1UUFA 2IZZA 3B1JA 5G0VA 4UUMA 2QQ5A 3HN2A 1PQUA 1ISGA 3OBBA 1U8XX 3RBZA 3U4CA 3TZ6A 2FR8A 4FJ0A 3WJAA 3SLGA 1M75A 2JAHA 4ALJA 2QZZA 1P77A 4GSKA 3ASVA 1GQYA 4Q9NA 1N9GB 3RUAA 4NFYA 1ISMA 4AG3A 5IZCC 3E9QA 1UXJA 5KOIA 4E32A 3TF5A 1KBZA 2YDYA 1E5LA 4NZ9A 1IZ9A 5L53A 4MKRA 3EK2A 3Q9NA 1B3RA 2D3TA 1Z82A 2YHIB 4P22A 5G0WA 3WQSB 3H5AA 3M2TA 3JQGB 4WLVA 1MA0A 3ZWXA 4JP2A 3DC2A 4QUKA 1N92A 4U6QA 1P44A 1GDHA 3ETGA 4DMMA 4Q3NA 1VSVA 2WJPA 1LLCA 3Q2KA 4Z0PA 4KZPA 4WLFA 1EFLA 3ZWWA 1VC2A 3F5SA 4Z9YA 2VZ0A 2VYNA 5KIAA 3PFFA 4J4BA 1GAEO 4UULA 2PGJA 1R15A 1T26A 5TJHA 4CMBA 1FDVA 2X0IA 1JWAB 1IULA 1I30A 1R0KA 1FDWA 2RCYA 1E6EA 3BYZA 5EN4A 4XIYA 1V3VA 1R4NA 3AOGA 3BA1A 2V6FA 5KJEA 5JO0A 5A5EA 1OAAA 1E3JA 5GZ1A 2WDZA 3D64A 2FHSA 4BIIA 3QRWA 2O3TA 4C7KA 3OIFA 5L4SA 1GTMA 2FMUA 4RF5A 3MEQA 3OQ1A 2XXJA 2OMEA 3CMCO 5ENVA 3WNQA 5L40A 4IIVA 4DVJA 4IBOA 3W6ZA 2X0JA 3C3XA 4OHUA 2FRDA 4BO0A 5JDIC 4AJJA 1KS9A 5C7OO 1KVQA 4CUJA 4UUPA 1IUKA 3EGOA 5LCXA 2B4RO 5K0ZA 1PJTA 2GZ1A 3NT5A 5C5IA 4ND2A 2FY8A 3TL2A 4XEHA 1HDRA 2X6TA 1YDEA 4BKUA 1NQTA 2GERA 4DREA 5C7LO 4FFLA 3WICA 2QHXA 4PLVA 3KHUA 5GZ6A 1L1FA 3GZNB 4DC1A 3ZV5A 4AJKA 4CLXA 4JK3A 3RASA 3C24A 3SJUA 4A03A 4ROSA 1PQWA 1JKIA 5TGDA 3BTUA 5LC1A 3WGYA 1O8CA 3UCFA 1W6UA 2Q2VA 2C2YA 4IS2A 2VUSA 2Q4EA 4CR8A 2GN9A 4BS9A 3VH1A 1GYRA 3BIOA 4YTEA 2ZKLA 4Z0TA 3QQPA 2TMDA 3FTPA 1E1LA 2EJVA 3HB4X 4YQZA 5JBIA 2Y0CA 1WNTA 3K2BA 2DQ4A 4S1VA 4DTIA 1BW9A 2UUPA 2X23A 4YB8A 2WSBA 4K6FA 3EMKA 5A3JA 1LSJA 3WIDA 5JS6A 1ZK1A 1LDNA 1JAYA 4TZTA 4BO7A 4WOKA 2FP4A 3PWKA 1D1SA 2HK9A 3EY4A 3MJ4A 3TNLA 2C2XA 1EFKA 1B26A 4UREA 1NX6A 2AE2A 3PYLA 2J5QA 3HSKA 3JYOA 3MZ0A 2GN6A 3ANNA 4B3JA 2FZEA 5JYEA 3RROA 3HFGA 3DXFA 2YZ7A 4BO3A 1SOWA 1YB4A 2YJZA 4LGVA 4IZHA 3CUKA 4G5HA 4AICA 6LDHA 1M6HA 4IDGA 5EMHA 5ER6A 4EW6A 1DOHA 4XR4A 4K9DA 5CPBA 4MVJD 1Y1PA 4JJIA 4W4TA 4Y6RA 5G0TA 2OOSA 5TQVA 3UUWA 4KQXA 1I01A 1Y9EA 1HEUA 3SEFA 4UEOA 5EERA 3ROPA 2DPGA 5CDUA 1QR6A 1LLUA 2PKQO 1F06A 2PZJA 4JBHA 3TOXA 3H9QA 3WS7A 5CFZA 1I3LA 1XELA 4W7IA 2FPIA 5A9SA 5JLAA 3TDKA 1SEVA 4TZKA 3NT4A 3WXBA 3HN7A 3QVTA 2GSDA 3T7EA 1HRDA 3FR7A 2RH8A 3HZZA 3MJEA 1L7DA 1XHLA 3K73O 1NM5A 3A4VA 1R12A 2EG9A 5LDGA 3LDHA 3IKTA 4YWJA 5CAEA 1R4MA 1N2SA 1UJMA 2VT3A 3CZRA 4FN4A 4QSMA 1C14A 1DIRA 4CUKA 1BSVA 1BDMA 3AY7A 3FPCA 4J2HA 1ISJA 1LC3A 3IUSA 1GYPA 2OBYA 2OUIA 3DONA 4KWIA 4RZHA 4LCJA 1E7RA 1XCBA 3VKUA 4QFDA 2B5VA 2OL4A 2CD9A 3VKVA 3L4BA 1BXKA 3GA0A 2JFFA 3U3XA 4M54A 1UP4A 2X5JO 4IXTA 4WLEA 3TL3A 1QMGA 5H83A 4R16A 4YXFA 1R37A 4J1QA 4CV3A 4Y6PA 4AJPA 2X58A 3JQ9C 1BG6A 1M6WA 1SBYA 1R16A 3A14A 3WDSA 1UXKA 3Q9UA 3GVHA 3IMFA 4MIEA 3VVBA 1YE3A 1B16A 4BO6A 4DBVO 4P4LA 2EGGA 4HBGA 4R1UA 4ZQBA 4DIBA 5I8ZA 3ZWYA 2DFVA 2VRCA 3ZWOA 4EEXA 3E48A 1LRLA 3WB9A 5A03A 2Y05A 1FDSA 4B4OA 3K30A 1V9LA 2OORA 2FOIA 2AW5A 3L9WA 2HSDA 2Q1SA 5TT1A 3G79A 2Y1GA 2ZQZA 1HE2A 4BNKA 5ITWA 1F12A 1QXSA 3S55A 2I3GA 3H9EO 3JD4A 4FS3A 1DIAA 1KVRA 4WNIA 4JLWA 3GVCA 1GUFA 5CDSA 1OFGA 1H2HA 1VPDA 4CQMD 1UDBA 4L0QA 2HMWA 1S6YA 1BVUA 1PL6A 4FJ1A 4IJKA 2Y0EA 3DL2A 1IY8A 5CDGA 3OECA 1EK6A 4W7HA 5IXSA 4QTZA 5KKAA 1SB8A 2B37A 4YJHB 5CG1A 2PZKA 4W99A 1ZSNA 3LT1A 1E77A 5DDIP 5F5LA 4XQ9A 2VYND 2G17A 2CFCA 4GQAA 1C1XB 3RSHA 5L4NA 2O2SA 1EMDA 3GH3A 4FQ8A 4KTTE 4TWRA 4XIJA 3U62A 3ZHXA 2BGKA 4ESOA 1H9AA 2GF2A 4PLWA 4XGKA 1ZMTA 1ZK0A 1HTBA 4WKGA 3UHAA 4CM3A 4I08A 4PFJA 1LEHA 1EUCA 3KO8A 1RYEA 1P1HA 2O3QA 4B4UA 1RM3A 3PYMA 2P9CA 4XYEA 2BD0A 4BV8A 3I3OA 4E6PA 3NTRA 1X13A 1N9GA 2G82A 2ZK7A 1U3TA 2ZTVA 3GFBA 4RQTA 3VPHA 3WBBA 4YRAA 3ZDFA 3TFOA 3X2FA 2CZCA 2NU7A 3C8MA 3WWYA 4E5NA 4HKTA 3VDQA 3TRIA 3AU9A 1N1EA 5JE8A 4J9UE 1HYEA 1M67A 2PZLA 1HSOA 1EVYA 1UZLA 3PQDA 4ALMA 4DA9A 2VHWA 3RAJA 4B79A 1PJCA 3O26A 3VH4A 3I9OA 3PJDA 4W6ZA 3MTGA 1HZZA 1NWHA 5A5FA 1HDGO 4JXKA 2FR0A 4I1IA 3N58A 5TX7A 3AI2A 3JQBC 3K96A 4F3YA 3JYNA 1LLQA 4OSPA 5L7WA 3GG9A 1DC3A 4CJXA 3D5TA 4PG4A 3HE3A 1MG0A 5T6BA 2HK8A 4HWKA 3E9MA 3INRA 4DPMA 2UYYA 3PGXA 2FN7A 2V7PA 1OZAA 3EYWA 2IXAA 1T2DA 4AFNA 2G5CA 1IL0A 4FIZA 5K9ZA 1GZ4A 3IJRA 4PIVA 3ZV6A 4BNZA 2VHXA 4KUHA 3RU9A 3AM4A 3DOJA 3RBVA 4ZD6A 1VRWA 4RGBA 5CEFA 4Z3KA 2DAPA 4FC6A 4LVCA 3ABIA 4YT8A 2WD7B 4DXHA 1CERA 2E48A 4MPDA 1UAGA 3DBLA 5ICSA 1W8DA 4R69A 1UP7A 3PHIA 4PZEA 1H6AA 1Q0HA 1SB9A 3CPSA 3D3EA 3LT2A 3HB5X 4CLOA 3GR6A 2PLAA 3ZNNA 3UW3A 2BF7A 4J7XA 5T67A 1HDXA 2YHIA 3OEWA 1R0SA 2V6MA 4QO8A 5H82A 3TOZA 3G0OA 3MJTA 2G1UA 2JJYA 2R00C 2ZTLA 2RHRA 3DZKA 4NHEA 3UKOA 2P9EA 4UAGA 3D1LA 4FCCA 4DC0A 4B8ZA 3ONEA 4TSKA 3RKUA 2GDZA 4CMEC 1R0LA 1CEQA 5AXCA 3MWDB 1I2CA 3Q11A 4AJ1A 5JCXA 1ULSA 4PZCA 3JD3A 4Q39A 2H5LA 5B37A 1K89A 3Q6IA 4PLHA 4W9NC 3WGIA 4DMLA 4XJSA 1DSSG 2NNLD 1Y5MA 3DZFA 3NTQA 3KSZO 3HDQA 3UXYA 2HDHA 1K2WA 1PS0A 2XPCA 4YYZA 2NVWA 5TT0A 1P1IA 4YJFA 1DIBA 4P8RA 3V2UA 1HZJA 4XQCA 3O9ZA 5CEEA 4WOJA 4TKMA 5F21A 3L6DA 4GPD1 1BRMA 3NEPX 4PVCA 2PR2A 3JQ9A 3BTVA 4GAEA 2Y0DA 4RLHA 4P38A 1NHGA 1E3IA 2FSVA 5F1PA 9LDTA 3O8QA 3WYCA 1JAXA 4LW8A 5G4KB 1ZK4A 3NRCA 5DP1A 1ZO8A 4HXYA 3F47A 4NMHA 5KVVA 5AXDA 5I7FA 1EUZA 3ZHZA 5JAMA 3KTDA 4XQGA 2CF5A 3UVEA 3EC7A 3I9NA 1XLTA 5TNXA 3U4DA 4WEQA 3L07A 2O48X 4ZQHA 3GEMA 3HNPA 2NU9A 3PDJA 3WYBA 1BVRA 2YW9A 4FB5A 3F6YA 1VLLA 1NWCA 1VSUA 4FBGA 4R3NA 3I9LA 4B7XA 2VWHA 4YRDA 5FFFA 4A27A 4E5YA 2AG8A 1U3WA 1AXEA 1I24A 4NPCA 5DULA 3TZHA 2GZ2A 1T2AA 5KVCA 3QJ5A 1FMCA 4GX5A 1A72A 1MC5A 4QECA 2HQ1A 2PWZA 4PCVA 1JVBA 3D4OA 4IGFA 3BAZA 2J3JA 4MVJI 3K5PA 3H9JA 1PU2A 1HF3A 5IN4A 1ML3A 2W2KB 3R1IA 4ND3A 4J49A 3ZW8A 4B4VA 4ZGWA 5A9SB 2TMGA 3C7AA 4NK5A 3FWZA 3RUFA 3QWBA 4EYEA 1Z75A 3I23A 1Q0QA 1C1XA 1YOVB 4ILKA 1PS8A 2PH5A 4TVBA 4P4NA 4BNNA 5BNTA 3ZNQA 1TB4A 1XSEA 4IJUA 4BGVA 2ET6A 3KBOA 3H3JA 4B3IA 4N5NA 1YDWA 4BB6A 4OL9A 3GFGA 3OM9A 1YBVA 4J4TA 3GN2A 1A71A 1KVSA 1K3TA 1BDBA 2C29D 3PHHA 4Q3DA 4U0KA 4UEKA 4YT5A 5HA5A 3WLFA 2HU2A 2Y1EA 3M6IA 4BVAA 4D43A 3DQPA 2NLOA 4FGSA 4JX8A 3SLKA 4QO7A 1GU7A 4CMGA 2ZQYA 2JAPA 3HG7A 3ASUA 1DO8A 3I4FA 2QRLA 1YVEI 3DAPA 4PLZA 4XQEA 3PWSA 5I9NA 1NAIA 2DBRA 3GOHA 1P1RA 4GMFA 4AJEA 1HDYA 2H9IA 4XR9A 4BKOA 2VNSA 5DNAA 4YR9A 3L4BC 1Q2XA 3GRPA 2X5KO 5B12A 4OKIA 3GY0A 2D4AA 3WIEA 1PJ3A 1LSSA 5IZ4A 3ONDA 1YJ8A 5EIOA 4OOEA 2DBZA 2X9VA 3VVCA 1CYDA 3F4BA 3I6QA 2GR9A 4MP8A 2JD1A 3W8DA 2YFHA 1DC5A 1E6UA 2ZCUA 4BNYA 5DP2A 2VHZA 2EIHA 3RC9A 3VTZA 4CV0A 4LCEA 3MTJA 2VHYA 1ZK3A 3VPFA 4F6LA 2R00A 4RVGA 1GV0A 4BUCA 1EEHA 5KVQA 1WPQA 1ENYA 2UDPA 5TLSA 4U0JA 1KIFA 2IE0A 3GHHA 3AU8A 3JQ6A 3DHNA 4B4WA 3B20A 3WG9A 1MGOA 1SC6A 1RM4A 1WMAA 1DHTA 1RM5A 2IYOA 1O94A 2EGHA 2NQ8A 2GASA 2Q3EA 3JQAA 2B35A 4UVDA 2W98A 4E13A 5JC1A 1B8PA 1YS4A 1YQGA 1NP3A 1JN0A 4JJGA 2BGLA 2X7HA 1P1FA 3RD5A 3B6ZA 2W90A 4CM4A 4CM4B 1EDZA 4YJHA 2OO5A 5BNFA 2D59A 4D41A 1ZEJA 1E7QA 3T4EA 4NBWA 2O7SA 3ANLA 5DCWA 3H8VA 3INTA 4G65A 3U09A 1HE3A 2FR1A 4E30A 2PKQP 3F1LA 4GKBA 4ZRNA 4DQVA 1KVTA 2IDZA 2I99A 5FI5A 3TPCA 4FD3A 3KSUA 2QG4A 4I5EA 3AFNA 3ONFA 2AQHA 4H7PA 4HP8A 3C7CB 2PTGA 2E37A 4R54A 4CL3A 1NQOA 1KC3A 3JQEA 3H6KA 3GNSA 5A3VA 2PGDA 4A73A 1D3AA 1VKNA 4R1TA 1NPDA 5IFLA 4RO0A 1ZKMA 3JQ8A 4OXKA 3QSGA 3JQ8B 3P2OA 3AY3A 4UUNA 2RHCA 3KYCA 1LRJA 2NADA 4CM7A 1IHYA 1HXHA 2JCXA 3LT0A 3L9XA 2VQ3A 1JKJA 1WDMA 1IE3A 3PHLA 1E7YA 5JSFA 3Q3CA 2DKNA 4OYRA 3NDIA 2Y99A 1PZGA 1WZEA 5JC8A 4U7WA 2EV9A 1UH5A 5BSGA 3TZQA 1GFSA 1N8KA 5L9AA 3QLJA 1E7WA 4BNUA 1LXCA 4L4RA 1X0VA 4CM9D 3OETA 2DPHA 5TIIA 1TT5B 1Q7GA 2OP0A 1ZEMA 4LISA 4BGUA 4DIFA 2PH3A 4GLOA 3P7MA 2B36A 4RL6A 2OFPA 4AJ4A 1V35A 3PPIA 3M1LA 3H65A 1XQ6A 3AUUA 4J16A 4J9VA 4OAQA 1NASA 1IHXA 1EE9A 4GSLA 1O0SA 3TWOA 4KQWA 4OIMA 1O95A 3DMTC 3BMOA 4MKXA 1NQ5A 4IDEA 4MVJM 1I2ZA 5EQDA 2W8ZA 1PJ4A 3FWNA 1EE2A 3CXRA 3PGJA 4TRJA 1J6UA 3ZGYA 2I5PO 5DF1A 1YGYA 3HDHA 3HWRA 3RI3A 1NR7A 1EZ4A 3LVFO 2NTVA 4L4XA 4MVJG 4ND4A 4Y6SA 4BMSA 5HS6A 3FI9A 4FFPA 3RC1A 1MG5A 1P1JA 1FJHA 3LK7A 2C59A 4DYDA 4OO3A 1VE9A 2D8AA 3QWAA 1FXSA 1E3WB 4DL9A 4G2NA 3WNVA 5A05A 5IN5A 2OXIA 4M49A 2EJWA 3TZCA 2IYPA 1L7EA 1FF9A 4FDAA 1NPYA 4RVSA 4YACA 3WQRA 9LDBA 3KETA 1BHSA 2B83A 1LDYA 3VZPA 2PA3A 4ZN6A 1DIHA 4EUEA 3DR3A 4AJIA 1HETA 2JKVA 1R66A 3MJVA 5T57A 4FJ2A 2VHVA 1DEHA 3H5NA 5JYDA 4FW8A 3GAFA 3E5MA 4E0BA 3HQ4O 4BNTA 1LI4A 1R4NB 3D4NA 4K26A 5A4DA 2E49A 4RPLA 2CVQA 2EF1A 4CODB 3GLQA 7ADHA 1FDTA 1ONPA 2DFDA 4M55A 5BNIA 1BXGA 3GVIA 3R3JA 5G0UA 4ND5A 2H63A 4ZQEA 4CLOB 4AL4A 4BNGA 2Q1WA 4XCVA 3OJOA 4OQYA 4Z0HO 2VRBA 5C7IO 3V5NA 3ZU4A 5HRUA 1B3BA 3EDMA 4LSMA 4NK4A 3WYEA 1HE4A 1GPDG 1X15A 4YEDA 2E6UX 3WX0A 5CEJA 1U2DA 2QYSA 1VL6A 1Z7BA 4IQ8A 3OQBA 4YAJA 1UAYA 1JKFA 5EJ2A 1X14A 2IEBA 3LT4A 2NU6A 3COSA 5IAAA 5J23A 3MWEB 5LDHA 3C1AA 1T1RA 3RC7A 3SBOA 6ADHA 1ISIA 2WD8A 3N7UA 1UR5A 1MFPA 4II3A 3FNFA 1E3EA 3I4CA 1XA0A 4R1SA 1TT7A 3F9IA 2Z1MA 2EW2A 5AVOA 2JL1A 1PIWA 2XAAA 3H7AA 3ZWPA 4A5OA 1YWGO 3JSAA 1KEVA 4TRMA 2VOEA 2GGSA 1N1GA 1WLYA 1H0KA 3PIDA 2EXXA 4KDFA 4RPHA 1BMDA 1C1DB 1Q7BA 3ZH2A 3S1LA 4WLOA 5G0SA 3BMQA 5KCZA 2PZMA 4PRKA 4Q3EA 2Y1FA 4LRTB 3ROKA 3NTOA 4IJVA 4U6SA 4YJGB 1PR9A 4FPXA 1YOVA 1VI2A 1MUUA 1DLIA 2C5AA 2NVUA 3GGOA 3I5MA 3EW7A 1ZFNA 3BMCA 3UF0A 1Y8RA 2GRAA 5AOVA 2JFGA 3FTNA 3AM3A 1EQ2A 1KERA 4Z9XA 3AWDA 1OMOA 1PWZA 1RWBA 2HMSA 3JQAD 3P2YA 4G81A 5T8KA 1ZUD1 2QW8A 4AJNA 5L3ZA 4J91A 4W9NA 3B1FA 4BNVA 3IQDB 2QRJA 5F1OA 3RJ9A 3AK4A 4BV9A 4I9NA 5DCUA 3KVOA 3E03A 1SPXA 4IY1A 4MINA 5CPFA 3DZJA 2VUTA 1P45A 2DUUA 3OMLA 4JIGA 1H9BA 3G1UA 5L45A 4I9HA 2HO5A 2P5YA 4RORA 8ADHA 3QWFA 3JQGA 1PWXA 1Y9AA 3Q1LA 3F1KA 3TN7A 2P9GA 3DTYA 5ILOA 3NKLA 2J3KA 4CMJA 4BNHA 2P4HX 2VYVD 5COBA 4BO5A 4DQXA 4XZ3A 4TROA 1PX0A 1Y5RA 1WVGA 2GN8A 5C3MA 1YL6A 2WYUA 4WUVA 2P2SA 4NR0A 4E5MA 1E7SA 1NVGA 2EHDA 3PXXA 2NQTA 4PRLA 4XDZA 1D4FA 4JGBA 4R5MA 3ULKA 2OHXA 2BFOA 4MO2A 3STHA 2ZB4A 3ETEA 3W8FA 2DTDA 3VZSA 2Q2QA 3C1TA 2OBNA 4GX0A 1BWSA 4R68A 5EESA 2VWGA 3FN4A 4E12A 3H4VA 3DZIA 2C54A 2R2GA 4DQUA 1GCOA 2XOXA 1DHRA 4YAIA 3VZQA 1ENZA 1I3NA 3IIEA 4BKQA 4NNJA 4F6CA 3FF4A 1TXGA 4GGOA 5L7YA 4FFMA 1GZ6A 4O63O 3AFMA 1YKFA 3F4LA 1KOLA 3PWZA 1Z7EA 3NX4A 1VM6A 3DHYA 2Q99A 2B0JA 3IUPA 4ZA2A 5KVSA 1U4OA 4ALNA 1NXQA 3PLNA 1ADFA 1K0UA 2PFGA 1QV7A 4URFA 3ZW9A 1QORA 4IXWA 4TVOA 3INGA 3GGPA 1X7HA 3O4RA 2Y68A 4PGFA 3LSYA 3QIVA 3BHJA 5HM8A 3HHPA 4N54A 3WFJA 3RC2A 1ZK2A 4OJNA 2X86A 1T2CA 1LSOA 5CP8A 2YQ4A 3ZV3A 4YT4A 1P9LA 3QW2A 5HWSA 4DLLA 1YRLA 1E1NA 1U7HA 3PJGA 2XXBA 3OEYA 5FYDA 1E5QA 3ZWAA 2SCUA 5MGBA 2WWRA 3WMWA 3DZBA 2NUAA 3CSDA 4KWHA 2FPGA 1U5CA 5EQFA 1PEDA 4WK6A 5KJ1A 3QV1A 3D7LA 3KYDB 4DLAA 4RVUA 4D3DA 1LDGA 4FGWA 4IDDA 3GNTA 4GWGA 2PKRA 1HKUA 4K28A 2GPTA 4M1QA 3WMXA 1V8BA 3PZRA 4D79A 4CM6A 2B5WA 3LLVA 3OJEA 3JD0A 3I83A 4EITA 3JQAB 4WPGA 4J7UA 3DBLB 4D7AA 1BXGB 1QLJA 3DTTA 4JBIA 4XDYA 4R01A 2AMFA 4L4SA 1Y8RB 3S8MA 2IODA 3VTFA 2A4KA 3DZGA 1R4MB 1I32A 2EP7A 4XD2A 4BNFA 3GAZA 3PQFA 2YHUA 3LYLA 4AJLA 4PLPA 4CUZA 4J1TA 1V3TA 3RIHA 1JLLA 1P74A 1DFGA 4QX6A 3JYLA 2UVDA 3BHIA 5GZ3A 1WWKA 2Y93A 3QVXA 4OXNA 3E18A 1DJQA 4X54A 3LF2A 3JQ7B 3VZRA 1WXDA 1A9ZA 4RF3A 4EJMA 1ENPA 1HDOA 2PGLA 2DVMA 4NFSA 2HK7A 1DRVA 3DBVO 2Y66A 4Z9FA 4GH5A 1N7GA 4FFNA 1P33A 1B8UA 4KP7A 4WCDA 2WE8A 5JAIA 2EP5A 2VT2A 3L0DA 1GCUA 4CR7A 3QA9A 4CLHA 1J0XO 3K92A 4D3SA 5HS4A 4ALKA 2YYYA 2UV8A 3ORFA 4GX1A 2DM6A 3C1OA 4KUGA 3ZZNA 4S3MA 4CLEA 2PD4A 2GYYA 3CINA 1C1DA 3N74A 1K5HA 4GGPA 3PEFA 4BNJA 4YBZA 3WTBA 1IYZA 1YQDA 1SOVA 1T24A 1W4ZA 4W82A 1PL8A 4FSHA 2IXBA 4N18A 2J3IA 2WTBA 3NGLA 1TLTA 2DUWA 1XR3A 4E2ZA 1ZZEA 2C07A 3S2EA 1CQIA 2O2YA 3ZHYA 5ITVA 5I7EA 5FI3A 3EAGA 3DZHA 3FNHA 5A9TA 3IJPA 4ZU3A 3RUEA 4E2YA 3OJLA 1O89A 3NAQA 4WLUA 3MJCA 7MDHA 2H1SA 4P4GA 2P91A 1UDCA 4ONEA 2WMDA 3CH6A 4IS3A 4J0FA 2YY7A 3U9LA 1LC0A 3VH2A 3EZYA 3ZHBA 1PGQA 3JD2A 3GDOA 3WFIA 2B69A 4YAGA 4FOOA 2B4QA
chains in the Genus database with same CATH superfamily
2X8BA 2II6A 3PVZA 1ZG3A 1L1QA 1PKXA 3F3YA 2AEEA 4YC7A 1TK3A 4TS3A 4QEDA 4AG5A 2Q3JA 4LY9A 5BSEA 1R74A 4C08A 4CLDA 3GB9A 2JI6A 2ZWIA 1X7XA 3L6EA 1J25A 1CT9A 1FTGA 4WDRA 5TSDA 4TXLA 1VMAA 1G5HA 2I0FA 1ENOA 1GAXA 3SHVA 1C41A 3AL2A 2WUVA 2P9HA 1GQQA 2X14A 2ZEJA 4EUHA 4H77A 4IDFA 4L9WA 5J47A 3AI3A 3NTLA 3JD1A 4OL0A 2BPOA 2CZQA 4MVJP 2GNAA 1FX1A 3KZKA 4A26A 4DE5A 2OGWA 2DUJA 2QTVB 3EDCA 5TJ9A 2AN3A 3H7IA 2P6UA 2NT3A 1S2MA 5FWYB 2ACVA 1RT9A 1Z15A 3DOHA 3DVRX 1N4DA 3W3AA 2VNJA 3LUGA 5JHGB 3G85A 5J4HA 1A5ZA 3QX9A 2HTFA 2CLMB 4RHTA 5AJXA 5COQA 3EGIA 2IWHA 2IFTA 1T1GA 3H1FA 1ECGA 1L4MA 1GCGA 2UUOA 3MT9A 2FW9A 4RKRA 1PG2A 4MEAA 4ZVOA 2HGSA 1ZN8A 1PRYA 3QGMA 4RSHA 4KFRA 3K1JA 3A9TA 4X65B 1XTZA 3LS2A 2ENUA 2CVOA 3LJKA 1YB7A 3PE3A 3FNQA 2IEZA 4MTCA 2EW8A 2X5XA 3T7TA 1QSGA 4DDKA 2IUTA 2G7ZA 3GGGA 2AA3A 3VAZA 4KV7A 4EJ0A 5JNVA 1SKMA 2GD6A 4PS0A 2ERXA 4X63A 1XXHE 2PL3A 3A1WA 2C96A 4P54A 4C0KA 9ATCA 2BP7B 1SIBE 3KQYA 1A9PA 3OLYA 1ZAKA 2NW6A 2HQOA 1L0BA 3ZCPA 3C5EA 1QYDA 1AZSC 1T0IA 3RS5A 3NVKI 4DS3A 3MA0A 1EP9A 2YV4A 2IZ0A 2A5GA 4JJFA 1I5RA 1Z4PX 2VTBA 3TLYA 3GFRA 1MW9X 2HQSA 4WXMA 4NAUA 5E2IA 3FMFA 5CNJA 3RF7A 2CLEB 1QF6A 2MR6A 1LQTA 2OWDA 4LX8A 3FZEA 1E1MA 1NJ8A 5G4KA 1L5HA 3ZDQA 1JI0A 1P0FA 2YWEA 4TS9A 1I4OA 4EG8A 2QP4A 2NU9B 2H2DA 5C81A 3IAM6 5F2OA 4TT3A 1TC1A 2QUAA 5LUAA 2C1ZA 3AP1A 3SIPA 3IYLW 1V47A 4YUWA 4BO1A 4ARSA 2BWJA 4IIYA 5LZ2A 1NE2A 2OV6A 3S81A 2CD7A 1QTRA 1VRVA 4Y2RA 2EWVA 4RAQA 1E4YA 3TSAA 3CZ5A 1ZI9A 3U61B 5FWYA 1QGOA 1V8ZA 5EVCA 1Y4SA 1NJ6A 3AR9A 4MRNA 5DU2A 3SICE 4B2YA 4A15A 1MC4A 1ZVKA 3IAEA 1QV9A 2RMKA 3JTMA 4PAQA 2VWQA 3ZG6A 5H5JA 4CG3A 2PTHA 3DDHA 3TBKA 3QE0A 4H6XA 2O5RA 4IZIA 3D2AA 4BV3A 2XWBF 3V7YA 3UMFA 2AVNA 1K5PA 1D2NA 3G1WA 1CXZA 3GG2A 1C30A 1JEAA 1VCHA 2ZYGA 1J9GA 2E85A 2PWYA 4IHJA 3DEJA 3RFTA 3RFVA 4AO7A 5B4UA 1EFDN 4R81A 5ALNA 3KKLA 1X7DA 3HYSA 2HGZA 5BN4B 3EIUA 2FQWA 5L3SB 1S2NA 4Q3CA 4K0KB 5FWNA 1VG9B 2ZIXA 5EGSA 1Z38A 3P9IA 5HIJA 1MAHA 3ZI0A 5BORA 3UXHA 5BP7A 5IZCA 5JXIA 4FCTA 3VHXB 1N5RA 4G9EA 4URZR 3FRIA 1QIIA 1Y7PA 4BRSA 3F0TA 3BKXA 5GIOE 1DJNA 4B3HA 1PGPA 1DB3A 1QFZA 1X8LA 2W93A 2MYPA 3T38A 4A0QA 2HHJA 1UF9A 2B4KA 2GZ3A 3KJGA 2PQ2A 3ORSA 4HZUB 2PBRA 3LDFA 5CDTA 1REQA 1NVMB 3N2GA 4GI3A 1SVNA 2PV7A 2GCPA 3WIVA 2FP4B 1OF1A 2BH9A 4RTSA 1K6EA 2QPOA 4W1QA 4YA6A 2A78A 4PCUA 5F2KA 4RZ3A 3W5HA 1XWWA 1EFPB 2GBCA 1YL7A 1ZJZA 2OXCA 3DDUA 3DV2A 2YWHA 5H81A 3T3NA 1V11A 3QEAZ 5ALZA 3O1HB 1CY7A 3C6BA 3IV9A 3P0EA 2VFAA 1CUBA 3HYTA 4M98A 5DX8A 1IMOA 3OTQA 5ER9A 5SYNA 4P82A 1VHJA 1WSWA 5E6UA 4Y6LA 2JI8A 3NTVA 1PZHA 3RUDA 1SURA 1I7SB 2DY1A 2FWRA 2GEVA 4CKCA 2PUDA 2CDCA 3T4PA 3KVYA 3FBTA 5EKXA 3VU8A 1QYRA 4YUAA 2GUGA 5DCLA 5KX5F 2RBEA 2C5EA 3D3JA 5FTKA 3ZWVA 1PDOA 8GPBA 4OXQA 1SQ0A 2OA0A 4BPBA 2UZ1A 4N7RA 1TDJA 2X3YA 2HCTA 2R62A 3PKJA 1ZJJA 2ODNA 1ONNA 2QAGA 3L92A 1N0WA 1LTKA 4HAIA 1L4UA 4GE3A 5HMLA 1R2QA 4J3NA 1L7XA 1JPUA 2VAPA 1FVFA 4HDNA 2AOXA 1XCJA 4TKZA 4JB0A 3ROTA 4BB0A 2WSMA 1YTLA 3OY7A 4MPJA 4BMOB 5K3SA 1AHHA 4QDJA 4URXR 4BE4A 2BJHA 1OC2A 5DNVA 3SEAA 4B17A 2WK1A 3TQOA 1ZVMA 1GUDA 2DTXA 2IXFA 1YIOA 2PBLA 4ALIA 5CURA 1EWKA 5GM2A 3TKLA 3PHGA 3JAWB 3NLLA 1H69A 4MRPA 4M7PA 4PCLA 5HZKA 3FVTA 3A05A 4ZAZA 2P9JA 2OZPA 2EDCA 2WMNB 5I9LA 5FLYA 4BB5A 4AKGA 2B99A 2DBVO 3AUFA 1B15A 4C14A 2F9MA 5JHHB 1YJQA 4NXNB 5DT9A 2GK4A 2XGSA 3QMMA 4QQNA 1IBCA 5IU6A 4IJWA 3K3PA 2EJBA 4GM4A 1QM5A 2PYZA 4H1TA 1X80B 1D2MA 5EPUA 1W0CA 3DYVA 3HP4A 3GP8A 4ZYXA 2VK2A 2PAAA 4P34A 1B8OA 4YDRA 2PPLA 2XWSA 2GBLC 1T1JA 3ORQA 4Z6KA 2FZGA 5KPDA 2AC2A 3NGXA 1HYGA 1DOZA 4G8DA 3JVUA 5E3IA 4EHKA 1P2FA 2DULA 3B1KA 1O6GA 3E7FA 4U2KA 4I8XA 1SO8A 1SXJD 3R3UA 3DOFA 2OV4A 3UATA 4DEXA 1XDUA 3H4TA 4NQZA 3U2QA 3W9YA 3P1JA 4OMUA 4QU8A 3DE1X 4PN3A 2UYCA 1ZGBA 3SJCA 2DPMA 2PS9A 4L15A 3GUHA 1X7WB 3UT5A 5BWMA 4HQ6A 2ZRBA 2VHEA 1B14A 3E3AA 2HMUA 2YZNA 3HCOA 4LK3A 4D5EA 2QG9A 5AVXA 4NS1A 4ZFNA 3RKSA 1ZUWA 3AGPA 2W2KA 2YJ3A 4WQMA 1FCJA 2CJFA 4PC2A 3M6XA 3VV3A 1CW2B 1E96A 1PZEA 3ILXA 2A3RA 2AL7A 3HDVA 1WCXA 3H1PA 5EPOA 4EPRA 2PD3A 4HUTA 4C7MA 4GRDA 1Q19A 2CDBA 4EQZA 4BAGA 1O97C 1TQHA 1UFQA 5JNTA 4LGCA 3EIEA 4YJ2A 3VNVA 1E92A 1BKYA 4L4YA 5HKLA 1YAHA 2OHOA 4GEGA 4IDQA 4RFVA 4RACA 1SELA 5IVDA 3H42B 2HW8A 5LP6F 3B38A 1U0SY 3GRCA 2VF8A 2IUUA 3V00A 1RKXA 4E09A 2R6GA 4F45A 5ALRA 3EARA 2Y9MB 4BKRA 4DHWA 2F90A 2P9ZA 1DDOA 3CGGA 1AD2A 3ZLTA 2VKTA 3D8BA 3V7WA 1T29A 2AEJA 3LSTA 1TU4A 2Z6QA 3GJ8A 4CM1A 5GY7A 1SZCA 2EYQA 4UHCA 1DAPA 1EG2A 2XVAA 4EI7A 5HG0A 5FPPA 1SRQA 5IFKA 1GGKA 3H2BA 1SC4A 4HX2A 3VKFA 5F9MA 5ABPA 5F5NA 4C22A 2R8BA 3FSRA 4PU0A 2CV1A 1UZNA 2XW6A 3NEAA 1JHDA 4RSRA 3GPBA 2IZ6A 2NACA 3F4KA 4NCNA 4LRQA 5CA0F 3QVOA 1Y5NA 2VCYA 3AW9A 2W6CX 3UOGA 2O9JA 1BWQA 2RIPA 3PXCX 4X24A 1PGJA 5SV2A 5J4LA 5EY5B 1YR9A 4BGEA 1FNSA 2COEA 4KRGA 2HWWA 4HDSB 4PG6A 4ZO4A 5JDCC 3RGWS 3VYTB 4DA7A 5L6LB 1UKYA 3JQ7A 1TOAA 1JDJA 1ZGAA 3H2GA 3OI7A 1CUCA 4MB0A 2X77A 5G1PA 6REQA 4EJ2A 3JWEA 1G6OA 1XBTA 3PC6A 5DWDA 4BKPA 4J1SA 1E94E 2BI4A 2Z4TA 3L6UA 5HCUA 2NZ8A 5EJ8A 3EQ2A 3JATA 4MLDA 2F8LA 2QBYB 1XVTA 1B1AA 2ZBGA 3NM4A 2IY7A 1BH2A 4HCJA 5DHAA 3QE3A 4IH9A 4N3BA 3LY5A 1UZAA 1Z0JA 1F4LA 1DAFA 4INZA 4M1YA 3G89A 3C5HA 3REGA 1F8GA 2BGJA 4G0MA 3EOZA 2VTVA 3AKDA 1ZUIA 4TYPA 4PZ0A 4QQRA 4CL8A 4JDPA 2VQFB 4MOWA 2JDID 4LJAA 3HKDB 1S4QA 4FHFA 3ZD7A 3ZKWB 4OF4A 2RHLA 5IXJA 3F2IA 1JU3A 2GBIA 2ZBFA 3MIZA 3QELA 5DGHA 2JIBA 5A1TA 3KEOA 4FC7A 2I67A 2LE0A 5F1YA 1ZBQA 4FQ5A 3VYWA 1Y80A 1QP0A 1GZHB 2BLLA 3ZE8A 1TLFA 3HY6A 1KJ9A 1UFOA 1ZHFA 3KHTA 2IU3A 4HPWA 4RVHA 1S02A 3B78A 2KWIA 5KKCA 5LPNA 3AQ4A 2GNPA 1P5FA 1TW2A 3SR0A 1YDMA 1AV7A 3OPMA 1CULC 2E4WA 1H66A 1VCNA 2LKDA 4L6AA 4II2A 2FP3A 1GGVA 1KZ9A 2ECQA 4IGIA 3RRZA 4BX8A 5CFRA 3L06A 4FFOA 1NYRA 3GPIA 1G66A 2X7JA 2OBFA 3V6LA 4RENA 3CW9A 4KQEA 4ZGBA 5DN9A 3S4YA 1HL7A 4DWOA 3PQ3A 2QYTA 1CY1A 5BWOA 3UPUA 4HUJA 4OH1A 4UMVA 1UXIA 4WA7A 1AKUA 5JJ5A 3RH0A 3AVYA 3K05A 4BUZA 4DIOA 2JGDA 3II6X 5EJIA 4GD3Q 3TI7A 3UWDA 4U7TB 5KSYA 3CVXA 4WLNA 2RK3A 3OZBA 5CLIA 2GAIA 3TX2A 2GQ0A 1XZ8A 2V54A 3WGHA 2LVBA 4XH9B 1V39A 2BMAA 3A9WA 4NBKA 1AGPA 4L9AA 4Y7DA 2WWGA 3NM6B 3OFVA 3OOSA 2W2LD 3O1LA 2R97A 4MJ7A 1ITZA 5FJIA 5IX8A 2Q5JA 2V9CA 1OU0A 2E4ZA 3HXKA 1LVGA 1PNOA 1RPTA 1SVWA 1XJQA 3KJQA 3OHSX 1TO2E 2AZMA 2W5UA 2ZIZA 3MRVA 3B9PA 1ULAA 3H9GA 1KQNA 1U0HC 1G42A 3CKLA 2FMKA 3WRWA 3ZCXA 2WLTA 1B23P 2J5RA 2ARKA 3QMPA 1J5PA 1U0GA 1LBEA 3BD6A 3IP5A 3KZVA 4HO1X 4CEHB 3JQBA 3NOOA 2XZOA 4GPTA 4O4LA 4XFKA 2HLHA 1MQSA 1XU9A 2W6IA 4R5HA 1U11A 5FPTA 5H70A 5LOVF 2D2VA 4GSYA 1RJWA 1IPFA 1Y42X 1JJ7A 4CKBA 4E7PA 3LL4A 1Z0AA 2F67A 3BSFA 3HDGA 2YN0A 1IWOA 4BEVA 1PEYA 2QX7A 4DUZB 2N75A 1UINA 1Y8AA 1D6JA 3DUFB 3KLMX 4PSCA 1U2DC 3OVMA 1B0UA 3U16A 1K68A 5DBOA 3QFSA 3AY6A 1W4CA 1XN4A 3OAAA 2C1EA 3QKTA 2GEFA 4ZKDA 4KHPB 1GYQA 1NFFA 3OOEA 5I7VA 2WZQA 3KYJB 5LQMA 3F49S 3QHPA 2QSYA 1A9OA 4B8YA 2UUAB 2AQ8A 2H7XA 2VTBB 4RNCA 4WFKA 3RV3A 2C2BA 1L5GB 2Q7DA 1GZSA 2ZDGA 1BGVA 1XD9A 5DISB 5C0OE 4WH0A 3WRYA 1PE0A 3EYAA 3ML1A 5AW0A 1L5KA 2ZUCA 3VTKA 2PY6A 1OZGA 3IEVA 4P3NA 4BMVA 5JWHA 4OLJA 4F06A 4DR6B 2P0AA 4CF6A 3HU1A 1FXWA 2HWXA 2V6JA 4EKIA 5CW1A 1H85A 3LW7A 3WGLA 1ZH4A 4CW7A 1FFXA 2CXTA 4GP9A 3N0TA 4YK7A 3W6PA 5JD6A 4GMKA 5M04A 3FWPA 5K8CA 3QWHA 4CFZA 1A9XA 2CCGA 3RUCA 2JA1A 1BS9A 3CFYA 4RTQA 1T1EA 2REQB 1ZJ5A 3GEGA 4XPZA 1NNSA 4M7OA 1Q17A 1VSQA 2C94A 3Q7IA 4JLJA 5EUBA 4AROA 3PEYA 2FF5A 1C7QA 3H4IA 2SCUB 4ZJZA 3D1VA 3EA4A 2OKCA 1JA9A 4PYNA 1M1YE 1VKRA 3CLTC 4UU8A 3VSDA 3QPDA 4LMBA 3C45A 4RD2A 5FL7A 3M3HA 3QUQA 4QLOA 1HDEA 1ZH8A 1RADA 1N0IA 3C8HA 4IFIA 1CR2A 5KNCA 1FIUA 3GLGA 4C0BA 1SKQA 4NDAA 4NLLA 5C8YB 3D43A 5B1IA 4K88A 1G64A 1ZD4A 4X7PA 5ICGA 3PP8A 4KMRA 1TA4A 1ZNQO 2JHAA 2WC1A 2PH1A 2CZGA 2ZG6A 3RUIA 4A82A 1SXJA 4BQFA 3BWBA 1PTJA 3BMCB 4DOMA 3DAGA 5L8VA 3A1TA 3G2HA 3T52A 4DY4A 1SCQA 1ZH2A 2FSIA 5CFNA 2HV9A 4Q9HA 3NHLA 3PQEA 4CM8A 3E5RA 3OOJA 3E5HA 2QRZA 5C8VA 1UOEA 2WJVA 1X86B 1XKXA 3RKRA 5KJCA 1AKTA 1GADO 4CI0B 4GVXA 4QHTA 2WVJA 5TF0A 2ZB8A 3UMCA 1A82A 1SQ5A 3IA7A 5LUBA 1WW8A 1JXQA 1Z2CA 2ZWAA 3BTOA 3EFOA 3LOPA 3NEJA 1N6RA 3OICA 4AP5A 5AVVA 1F14A 1UM9B 2QMEA 3GT0A 1EIZA 2GRUA 2JJ2A 2QY9A 1OE0A 4UOZA 3JWGA 3DD1A 4DXDA 4ZTZB 2IHTA 1SQFA 2F1OA 3QXGA 4LF7B 4OHKA 3KG2A 4D0LB 3UHOA 1Z5VA 1XGKA 2AUNA 1JECA 3CRMA 3T5BA 5TS3A 4BJ6A 1N8NA 5KMGB 2QZ9A 4MRMA 2AEFA 3M6LA 2C4TA 4RF4A 1E8NA 2F8MA 4R8KA 1WJGA 1H22A 1Y82A 3FHCB 3N7AA 1VJDA 1XZDA 2FVYA 3L7NA 4CQLB 1CRQA 4CU2A 2ZS7A 1Z6ZA 1YO6A 4IIGA 3O03A 3P2MA 4E2XA 3EGWA 4ZI5A 3THXA 1V1MB 1N6HA 2F3QA 4GO1A 2ZTUA 1FNBA 2R1UA 4AS2A 1XWFA 3KZNA 4KAXA 4CCAA 4GXRA 4JGIA 1LFDB 1X1AA 2HMVA 2ZROA 3KR2A 3NM5A 4O4JB 2QRKA 4Z2AA 1A8IA 1F8XA 2WSYB 3TOCA 3DFUA 3FE2A 3THYA 5BPFA 3QBJA 3V1UA 3BZUA 3GRFA 2JFHA 1VKZA 1MX3A 1Y8ZA 4XD7D 4P7FA 2NYUA 4J0KA 4P08A 1VKJA 3GPLA 2O07A 1XHFA 1N5KA 1TJ3A 3THYB 2C7RA 1ONSA 2ZB3A 4E1BA 3M8KA 3CM0A 1CJSA 1OIVA 1R8QA 4Q93A 4Z49A 1LV7A 2DJIA 5HNKA 2XDWA 1X80A 3OF2A 3D6TB 3HFSA 3KOYA 2VO1A 3M89A 4HWTA 5AUNB 5BN3A 4F91B 5IUNC 1Y6GA 3HC7A 5MDHA 1ZCJA 1IY1A 5DW0A 3Q15C 2QU8A 2YV2A 4QYWA 4YXWD 4FYYA 2WWFA 3AJAA 2IIPA 3AG5A 1ZNZA 3AZPA 1IN6A 1NTRA 2VF2A 3WGZA 2EZ8A 4FYVA 1WDLA 1QFJA 2C98A 1KF0A 2Q3MA 4WL0A 3T7CA 3D4LA 3NHJA 4F72A 5ALVA 1UXOA 2YMMA 3BGIA 4IDCA 2PBZA 4N49A 5F52A 4UHKA 4BNLA 1G6Q1 4CCWA 5BSFA 5IF3A 4RNDB 4EB6A 4YFYA 4D5GA 1ARZA 4NULA 4Y2HA 1KJQA 5JMWA 4PAGA 1XF9A 3ZJUA 2H29A 1KHTA 2O8VA 3BXEA 2IY8A 1LJ8A 2H17A 3WNDA 2C0PA 4X6LA 5DGIA 1MORA 1B42A 2CFOA 2OHFA 4H7HA 4Q3AA 2FRDC 4QSHA 1J22A 1J7KA 3BSYA 3OJCA 3UCXA 3W9UA 4RHUA 4E31A 2G1AA 2R5FA 3C16C 3WLHA 3RSOA 3D2LA 1D7OA 4F5DA 2RJNA 3L8HA 1HLDA 5LBUA 4BFWA 2O6LA 5KI6A 2RGYA 2Z5FA 5CJ2A 1GLVA 1GPBA 2O2EA 4O4JA 5G4LA 1ZW1A 3K70C 4OU5A 1HQKA 1FTQA 2ZJ3A 4FP9A 4DCTA 3BFVA 4KXLA 2D5BA 4XA8A 3LY9A 1FYXA 1N8SA 4O2BB 4AX4A 1OY1A 1ZGCA 5EAIA 1YB1A 4YAEA 5HKKD 2VPXA 2SKDA 2C3UA 3T9FA 1YE8A 4WXEA 1IN1A 6NULA 4QVIA 4CZ2A 2AKYA 3QX7A 4NCXA 5DHPA 5I45A 1PGOA 2FF7A 2H2WA 1P1CA 4OK3A 4G1BA 2NSJA 3UT6A 4EL5A 1E2BA 1GO2A 3ER6A 3GCWA 1MT3A 3GA5A 1ML4A 5D87A 2O5EA 1WUTA 4AKEA 4KNWA 1MOSA 2YH2A 1KDZA 3PRJA 3AM5A 1UQTA 4GX2A 3UA3A 2OCAA 3JQFA 4Q4LA 4XLZA 3A1VA 1Q0TA 3W7AA 3EF0A 1P0QA 4IDAA 2W37A 5EIEA 1PT6A 2YV1A 1T10A 1NOIA 1SQSA 1C5KA 3F3MA 1YBAA 1A9YA 1NPTO 5CJPA 3T7RA 1PZXA 1PJZA 2IYVA 3M5CA 2C83A 4TLAA 4Q1EA 3H9UA 4ZEMA 1NMSA 3DOUA 3GLVA 3LUFA 1ADYA 2FEWB 3B6JA 3BGOS 5AESA 1TYCA 4HX5A 5JCJD 3TZEA 1EDEA 1RW4A 5IAGA 3UANA 4FOLA 4BQEA 4UAJA 3THOA 3H0KA 2FG6C 1XVVA 4G85A 4TXHA 1VHLA 5JDIA 3VOSA 1K92A 1Z4JA 2VP9A 3N2LA 3P2JA 1VE1A 1TAHA 1PFYA 3FCXA 4IDBA 4BP9A 4EZEA 2FPUA 2PSSA 1F0YA 3CPJB 3F97A 4Q05A 4OAPA 2HIHA 2VXYA 2ZJ7A 4B3CA 2ISCA 3CIFA 1JIKA 1A2QA 4NH4A 3ZWMA 3LNTA 3GEHA 2EERA 3W77A 2YYSA 3FRHA 4ZQGA 2ZM5A 4M4SA 2CMGA 1V95A 2J6IA 5HMMA 4R0VA 4ZHQB 4EY7A 4F38A 2BTQA 3A0UA 3L79A 3QOYA 4ZO8A 1N9KA 2LDBA 3DH0A 2HCJB 1Q1QA 2GRJA 2CJWB 1EG7A 1NW3A 4W1SA 3TQTA 2ZYRA 2ZZNA 4EA9A 1KAOA 5A02A 3FR8A 3M6FA 5BQPA 5BRJA 4O4IB 3AONB 2ZATA 1GJRA 3NP9A 1WDKA 1RXIA 5KYWB 1G8KA 4X44A 3AP3A 4IINA 4N5MA 4A10A 4IICA 1QH0A 1YONA 4DCCA 2E1RA 4YMSA 2IRWA 3PDCA 4RJKA 2FW6A 4BVFA 1E1RD 2NO7A 4CMEA 2I4OA 1ZLYA 2XLBA 3K0AB 3BZWA 1ZM9A 3K1TA 2C2ZA 1UPAA 5TDHA 2NO6A 1I2BA 1X92A 4ITUA 1THGA 4F56A 5AVTA 4HPXB 3KPUA 2AI2A 1EGHA 3ZYCA 2OHVA 5M3BA 3QNWA 1OGIA 3FUCA 4HQFA 5WRFA 3WZLA 1CQJA 3HDTA 4FLFA 4HVCA 1R4AA 1DEAA 2DGDA 1RRFA 2J5KA 2MSKA 3EHDA 5AK0A 5HEKA 2H0AA 3BCRA 4HWGA 1TIPA 3FBWA 1LVHA 1IVNA 2NUTB 3KKQA 1QBKC 1H93A 2Y27A 2C4KA 4TSRA 2NV6A 3A06A 3SYTA 1DAGA 4C7OA 4LE1A 1ZUNA 1T1SA 3UH1A 1UL1X 4RESA 2IQIA 3LBIA 4KSBA 1DDIA 2XUPA 5CT8A 1JJBA 3VX4A 4AN0A 3L8ZA 1ECCA 4Z0NA 4F7DA 2ONZA 4YNBA 4ENUA 1ID8A 4LJSA 3KDPA 1EA5A 4OXYA 3C6MA 4UHDA 1UJ2A 4F3RA 2I87A 6Q21A 1EXMA 2KMLA 4PIMA 1D2AA 1T15A 4WE3A 2DBYA 3LA8A 3HTXA 3PWTA 1XL1A 2D2IA 4RZ2A 2ZT7A 5JMPA 5JJCA 1H94A 2J6HA 3IEPA 4ZVMA 1JU9A 4M0CA 5FBHA 1EE1A 2EEZA 4AY3A 1BC5A 4OY3A 1TKAA 2GBFA 2QLLA 3ANYB 4BWFB 1E9VA 4P4SA 3C39A 2CK3D 1SU7A 2HYDA 1X8XA 1CQWA 1HEYA 1O8BA 3G2OA 3MWJA 2BGTA 4Z3DA 2FW0A 1QKIA 4R98A 4C04A 4L76A 4LV6A 4NE9A 1DO0A 1FTWA 4FR2A 1DELA 2AJBA 4DPKA 4IYRA 4RVNA 2XITA 4L2IA 2JK0A 2IDKA 1ADCA 3WWDA 4Q1FA 3E22A 4IF4A 2OGTA 4KI0A 5P8WA 3SZ3A 1GUBA 2C4UA 2P6OA 4TYNA 1NF9A 3NIFB 4LZOA 5ELMA 1KQOA 2D74A 3ISVA 4H6WA 2CYCA 3KQMA 2JIDA 4MMZB 2A0YA 4Q4HB 4CT0A 4JJ8A 3EGDA 2IYAA 4WJZA 2WTAA 3E6AA 3NFYA 1GPH1 2CJXA 4Y9UA 1XU7A 2FZCA 2YNMD 4Q1BA 4RELA 1MAVA 3ESXA 4I50B 3B82A 1I4TD 4KIGA 2V7EA 3GV0A 3OSUA 5KQLA 1H3FA 2AI1A 4J1NA 4UBLA 3TLMA 3COWA 3SCZA 2X40A 3G9UA 4GBJA 4RQUA 2OT3B 3DV0A 3O38A 3GDFA 2WUFA 1G2PA 2A5JA 4UOEA 3ZHCA 1SBIA 1CQZA 1KMIY 4RLFA 1ZMXA 3ONNA 4HT3B 2X2OA 3L41A 3QYAA 1CEYA 3E9RA 1UJCA 3LQKA 2FZ5A 3GRVA 3RJ5A 3G0CA 4BMNA 1JLKA 4ZICA 1QBGA 5AYVA 2O1WA 2OPBA 1BE0A 4DWWA 2Q07A 1JVSA 4ZQFA 2GA8A 5DM60 1TVKB 4Q66C 3ICQB 4ZC8A 2YVUA 5IUJC 3E7XA 3GLSA 4LZAA 3F46A 3KQLA 3HB1A 1BOOA 4WASA 1QGAA 1VLMA 2ZOSA 4MDYA 4ER3A 5K0JA 1A1VA 2BRUA 1QKJA 5I7OA 3JTEA 4DJDC 1SUBA 4I4TF 4QDXA 5FEUA 1U2GA 4DV7B 1VL8A 2EFHB 4ALLA 3W4IA 5IG2A 1E3LA 3G8BA 3M82A 1TZCA 4FFBB 2ZI7A 2Y71A 1C3EA 2JFUA 1RI4A 2DRIA 2LXNA 4X90A 1DLJA 4O2BA 2DBQA 3K53A 1ADGA 3IUMA 3SF8A 2F8TA 1LU9A 2I66A 3IOCA 4DV5B 2N9UA 5TC4A 4V0QA 5F23A 3CVUA 1K6XA 2ZJ1A 1P4GA 1VG8A 1TA0A 3I58A 2P41A 4MUAA 3P71T 2AG6A 4IGEA 2KLBA 3KOOA 4CLRB 2DETA 4UUBA 1BCRB 1DAOA 4YXWA 1QYWA 3P5BA 4PBTA 1CEEA 2QMZA 1KI2A 4KNVA 4G1UC 3STXA 4BC1A 1W73A 3W3AD 3GUYA 4WESA 4LPKA 4F8YA 3H5RA 1MW8X 4X8HA 2OSVA 3QMVA 3SGLA 3ORRA 5KVAA 2X9GA 1NE7A 5IJWA 5EJ9A 4NU6A 1OA1A 4DV6B 2RBKA 1X1RA 2B1RA 2GXQA 4NV0A 3BUSA 3WAKA 1DKPA 5AKGA 4EH1A 4C89A 5CT9A 1T3ZA 4I5IA 4JVSB 3W2FA 5LQKA 5C8XA 4C0XA 4HDCA 1NM5C 3MFYA 4V3BA 5G53C 4AZ3A 2VDWA 2ZT8A 3QK7A 4YJ3F 4BU1A 2FLVA 4LTDA 3MBKA 4UUMA 2QQ5A 4BBZA 3OBBA 1I1HA 1TVKA 5F3WB 5JS1A 3SS9X 2FR8A 2O52A 3WJAA 2F43A 3MTIA 3SLGA 2I1QA 4IOKA 1V5WA 5CLQA 3O21A 1ZR4A 5BSMA 4NYJR 3U39A 5AVJA 1TUEA 4ALJA 4QZVA 3GJ6A 1P2SA 1WCYA 5FADA 1GQYA 3ZIAD 2MYTA 5BN5B 3TW8B 1QHXA 5TPZD 3BM5A 5HKKA 1IM2A 2W6JA 3CUTA 1KIAA 1VIDA 1K63A 4BU0A 1UJNA 5F2NA 5L53A 3HP7A 3RVKA 3ZJ4A 5DI3A 4E11A 3EK2A 5AVQA 2Q6KA 5BURA 2O54A 1EX9A 2Y1LA 4KCGA 1Z82A 2XNJA 4EB0A 3EULA 4GUDA 1NXWA 1RPAA 3CN9A 4QPDA 3ZWXA 4KHZA 2X4IA 1IY0A 2FLKA 3SMVA 3AYXB 2X42A 1N92A 4AXXA 4K5QA 2P9BA 4EJSA 2FUG6 2XJ9A 4Q3NA 3N0XA 5HIMA 1V26A 4TN1A 5FWDA 2H2HA 4FHZA 3WLOA 3HSYA 4JUFA 1RHUA 2XCUA 4O2LA 5KIAA 5DX0A 4MS4A 1ETHA 1GAEO 1NJGA 4F6RA 1W5SA 3BS4A 1MOPA 1VIAA 2O6HA 1X77A 2QTAA 5TJHA 1KZYC 1FDVA 3ZPXA 1VL2A 1FDWA 1ACLA 2PAFA 3IX7A 3PNSA 5KEIA 4KX3A 1C8VB 2WFAA 3KQKA 4URHA 1WEKA 2AX4A 3ABOB 1GITA 3AOGA 2FEAA 3G68A 5KJEA 5JASA 3R7LA 5GZ1A 1KH2A 2VF7A 3ND9A 4L5BA 2PMFA 1AS3A 3WA6A 3WKAA 4DT1A 4FW9A 3C4VA 4BIIA 3QRWA 4Z8YA 1GTMA 2AJ8A 1V8FA 3DCJA 3MEQA 4FUQA 2XXJA 4IIJA 5D3MB 3UMJA 4KZKA 4YRLA 3CMCO 5JSZA 2ADOA 5L40A 1JSCA 1JFSA 1QR2A 2YXNA 1MX1A 4IIVA 2WUWE 4OHYA 1WW3A 4RL4A 1MH1A 3KQVA 5E6SA 1JT9A 2X0JA 3DG9A 5DHQA 2HHAA 1MB2A 3DVLA 5JDIC 2I2WA 3EF3A 2YC4C 5IKEA 1OFUX 3Q87B 5EJ7A 2V9ZA 1NN0A 3CEJA 3M3PA 2BM1A 4E6EA 4WK2B 3D6JA 1KO7A 1Y7HA 3LZCA 1KVQA 4LJYA 1U9IA 4WKOA 3LKVA 4EVQA 5LQRA 1IUKA 3D6HA 2EZ9A 3EGOA 4JOBA 4KGVA 5DHTA 4AAYA 3A25A 2QL5A 1PJTA 2XTMA 1V8OA 1MMFB 3JZDA 3GJTA 2ANBA 3NT5A 4OJYA 3DE6X 3COPA 1N3BA 1G291 2P0EA 4ND2A 4QPNA 5AICA 4HYTA 5EE0A 1M2EA 3MWGA 4XEHA 2AC7A 3IQIX 1E62A 4LJ7A 2BJVA 2WUGA 3UUGA 2JI4A 2QN6A 4WN9B 2XKKA 2VHQA 2FFJA 4XJXA 1L1FA 3RT1A 1EXDA 5BNTA 2B61A 3K16A 3SLRA 5EJ6A 1PK8A 2IP2A 1YQWA 4UHEA 2RGBA 3RASA 3C24A 5KQPA 2GZDA 1T9HA 3FYCA 2EHJA 2EZTA 1NNEA 3MCWA 1JKIA 1MJGA 4D4IA 3H1TA 1VIYA 4KVGA 4QASA 2X8JB 5H3HA 4A2PA 1O8CA 2BTQB 4TM8A 4D3XA 3Q8MA 3OF3A 4IS2A 2QYHA 3SZUA 2VUSA 2Q4EA 5CTAA 3U37A 1XAGA 3VH1A 1EINA 1KWGA 3H5IA 3R6LA 3EVZA 4YJKA 4B46A 4YTEA 4ARZA 5IM4F 1H2RS 3N0RA 1YJAA 3VC3A 3QQPA 2TMDA 4QUJA 3RBAA 3VYSB 2BCJQ 2JGRA 5IKMA 4UNSA 1F4VA 1V8PA 4YQZA 1PJRA 1DCMA 1PP4A 2PZAA 3NORA 1XTQA 4S24A 2BZ0A 3H1EA 4S1VA 2UUPA 2NOAA 4GMXA 3I72A 4K6FA 2GLUA 1IN7A 1K97A 2O57A 3A4TA 4DMGA 1ZK1A 1LDNA 5JS6A 3HGTA 2GI4A 4TZTA 3EGXA 3VJMA 2FEPA 3MJ4A 4UPDA 1I5OA 3TNLA 3RW9A 4RHFA 1AJEA 3JR3A 1WULS 2NYAA 3GLIE 1NX6A 2PT5A 2KM1A 3WLPA 3PYLA 3HSKA 2IYWA 1ULTA 3JYOA 4R7GA 5CXXA 4RIIA 1J0AA 1NUPA 1PR6A 2YZ7A 3H2YA 3ZDCA 2ES4A 1E1CB 1GHTA 2R6HA 3RRFA 3IULA 5C5CA 1YVDA 1XD2B 1FZTA 2VH2A 4AKTA 2PSJA 4LSZA 2GZSA 1K8QA 5ICEA 2P79A 4EHBA 1M6HA 3B6KA 3EISA 1JQKA 4IDGA 4R6WA 5ER6A 5FWAA 4BFUA 4XR4A 3E2PA 4JA0A 4K9DA 5CPBA 1M2OB 3ANXA 2EFGA 2IOYA 4RIHA 3LUHA 3EGCA 3O4HA 5KNCH 4KQXA 1NDQA 2Q1XA 5AM0A 1A9XB 2PUJA 1YULA 3AV3A 5EIHA 5CDUA 3BILA 4EHJA 2ZWOA 4U9IS 2HA6A 2PKQO 2TMKA 3Q3IA 1FDIA 3DKIA 2HX1A 2YHBA 4H0FA 4IMIB 1MGPA 4K81B 1I3LA 4W7IA 1NU6A 3QXXA 5A9SA 1E5XA 4C30A 2FDXA 5BV0A 3NHKA 1HI9A 4TV8A 2I4NA 2P90A 4Q4HA 2RH8A 2D1SA 2I80A 2H8KA 2OAEA 2O7NA 4XOUA 1Z63A 3HB0A 4Y1GA 2B92A 3GARA 2FXVA 1R4MA 2C9BA 1XZCA 4O5AA 5IVPA 3CZRA 1G8YA 1TECE 4K6HA 1C14A 1Y6RA 4JXJA 2QJRA 3CNLA 1DIRA 2DQKA 3HKEB 1BDMA 1WHSA 1DAHA 3WJ1A 5KQMA 1RD4A 5JRJA 2IF2A 3IUSA 3UT0A 2OGZA 1IM5A 3S1AA 4B76A 1E7RA 5IWCA 4KAAA 5KB3A 1U3DA 2C4WA 1UEJA 4BLRA 3NIBA 2OWEA 4A9AA 2MHCA 4UKDA 5M29A 2YZ2A 2R6R1 4G0ZA 3VKVA 1U1GA 3L4BA 4EB3A 5JZOA 3U3XA 2JFFA 1QC5A 2HDOA 3IB3A 3TE7A 5AHXA 1ZRHA 3KLBA 5H83A 4R16A 4YXFA 1AIPA 4J1QA 5DLDA 3N39C 3S28A 5FORA 1BG6A 4H7IA 2HFKA 3WDSA 1GPNA 1P62B 3C5CA 3CUSA 3IMEA 1RS0A 3IMFA 3P9QA 3SR4A 4DBVO 1YE3A 2N1MA 4F7WA 5KYKA 2IEGA 1GGFA 2ENWA 3IVMA 4LIPD 4ZQBA 4F9GA 1LW7A 2CWDA 1R0BA 3GUUA 3ZWOA 2FUCA 3BH6A 5EEHA 3RK1A 3UXEA 1YQ9A 3E3MA 1ACMA 1AK9A 5DIZA 4BTVA 4DAOA 1LW6E 2J0SA 1OHHA 2W22A 5JI3E 1QGYA 2HSDA 1YZ3A 1FNNA 1GRQA 1NXVA 2J0VA 1V25A 2ZQZA 4O02B 5F33A 5ITWA 5EHZA 5FH9A 2Q41A 2I3GA 1CUSA 2HADA 1V1MA 4I1SA 5FLXA 2XV1A 4WNIA 2K87A 4Y1RA 4EGJA 2QI9C 4JLWA 1A5AB 1GUFA 5J43A 1VPDA 1KBQA 3OCWA 3Q5DA 3ZX5A 4TM7A 1TLLA 1UDBA 2WU0A 2IPLA 4BEJA 1US8A 5CAEB 4OHBA 2JLAA 3H75A 5A1JA 3OE7A 4FJ1A 1E4VA 1U5BA 3U31A 3TTSA 4ZI7A 1EP3B 3VYUB 4DADA 2KB0A 2RGUA 2Y0EA 4ZEWA 3OECA 2P6RA 3S2UA 1DKNA 4MWGA 4ZZ2A 2RGCA 3TLZA 5L3VA 5F78A 1SB8A 2B37A 2DFNA 5CG1A 2VJMB 3HUFA 4WZBA 3DO6A 4HRAA 3F3KA 4OTZA 2DPYA 3EUAA 4KRXA 2O2DA 3H9CA 4JLPA 5EXEA 3BIXA 2C4VA 4QXOA 3OJXA 3TR0A 4IUCS 3SZGA 2W11A 1EMDA 4FQ8A 1TQ4A 4DA4A 4LNUA 3QE4A 4G6ZA 2V7UA 4XGKA 2IELA 1EUCB 4KGXA 1PQYA 3KO8A 4B80A 1ZVVA 2PDAA 1DEXA 4OHXA 1RM3A 3RLFA 4MITA 2P9CA 3QFCA 5BYJA 4BV8A 4WBNA 2Z5GA 3I3OA 1BEUB 4E6PA 4JQYA 4E94A 1CUYA 3NHSA 3EZ6A 2G82A 2ZK7A 4OM7A 1K8ZB 3EEQA 3WBBA 3Q9LA 3L01A 1JF8A 3X2FA 2NU7A 2F7SA 1JIIA 4KPFC 4HWPA 4HKTA 4QOEA 1USWA 1BS1A 1YT5A 2HQBA 5JE8A 4HNRA 1IN4A 1JKMA 1D4ZA 4U2EA 4GP7A 1EVYA 1KORA 4FGUA 3HCFA 2IU4A 4L7QA 3GPCA 3L6RA 3H1GA 2ZRGA 2CE2X 4MQUA 4RHYA 5AKKA 5ALOA 4JJ7A 1NVEA 4MKIA 2V7QD 3IEIA 3PJDA 1WZNA 4XWAA 1Y7LA 3D8SA 4MI9A 3DKKA 1OKKD 4TGLA 3AFOA 1Z0KA 4HEQA 1HDGO 1N2ZA 1WG8A 5JJIA 2PS1A 4I1IA 3N58A 5TX7A 3AI2A 3E7DA 1ZVQA 2CBXA 2Z2XA 1EVKA 1MO5A 7REQB 5L7WA 1DC3A 3I09A 5LZ8A 1ZR2A 1PR5A 1GIAA 1GKUB 3D5TA 3RJZA 4YGXB 4MV9A 2HK8A 4M76B 2R8YA 3ZV7A 4GBGA 1RYNA 3WDKA 2PHZA 2UYYA 3PGXA 1Z9BA 1Q6YA 2VKQA 4G1CA 4DGQA 3QX3A 1OZAA 4OUDB 4RKWA 3ZY6A 9ABPA 2WF7A 1OLOA 2I91A 5IABA 2C42A 4I4TB 1CR1A 3DNPA 2UZ1B 3S27A 2E4VA