3DTWA

Crystal structure of the vegfr2 kinase domain in complex with a benzisoxazole inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
288
Chain Sequence
ERLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of amido-benzisoxazoles as potent c-Kit inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 288
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dtwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dtwA01
2R3LA 1YRPA 1H28A 3MDYA 4FL3A 4FKSA 4U97A 5A3XA 4DHFA 4ZLYA 3QWKA 3RPOA 4ZTMA 4GT4A 4IWDA 4NKSA 2X39A 2GNIA 3QKKA 1IRKA 1WBNA 4QMPA 5FXQA 1B6CB 3HMPA 3ORTA 4DH1A 3OTUA 4O7TA 1OECA 1GIJA 2OICA 3IPHA 3CE3A 5EI8A 2LAVA 2YWVA 5AIRA 3IG7A 4BHZA 4EHEA 4MKCA 1Y8YA 3QTWA 5CF8A 4RQVA 3QD0A 1Q61A 3GQLA 2ITYA 1JQHA 1CTPE 3EJ1A 4FV3A 4QP6A 1OB3A 5AAFA 4LI5A 5HI2A 5LVLA 4XUFA 3MBLA 4FF8A 4RWIA 4TWNA 4TXCA 5EKNA 2XKEA 5JH6A 5HICA 3UBDA 3LFCA 3DDPA 1OGUA 4FTMA 3JUHA 4FGRA 3QRJA 4D9TA 3FI3A 2PVHA 4JXFA 5IA2A 3QUEA 4GIIA 5CEQA 3UTOA 5D7AA 4BWKA 4ZY4A 2PULA 2ZMDA 4BB4A 2QC6A 2X4FA 3EYGA 4NUSA 5E8ZA 4YU2A 4GW8A 4NSTA 2WIHA 2ITZA 1ZMUA 1Q5KA 1KOBA 5B2LA 5J9LA 3FMNA 2J9MA 3GC0A 1Q99A 3DB8A 4FOBA 4QMXA 1XJDA 3CBLA 1G8SA 3MFTA 3TNQB 5CASA 3HUCA 4FSRA 4JR7A 3VS6A 3RPVA 1PYXA 4YO4A 2C6EA 3Q5ZA 1UVRA 3O7LD 4L44A 4USFA 4FTJA 5HX8A 5IQGA 4AT3A 4U81A 3RTPA 3VULA 3CGOA 4U44A 4CRSA 3HMIA 4FTUA 4K1BA 1JAMA 5DNRA 3EFWA 4RQKA 4MVFA 1IASA 3DV3A 4BIEA 1JKLA 2YN8A 2B0QA 2WZJA 5E8WA 2A27A 1RE8A 4R3CA 4EKKA 4G6LA 1XHAA 3TNWA 4DINA 5CYIA 3Q32A 5HBEA 2YM8A 5IQBA 2BAQA 5JMSA 3FZRA 3R02A 5M44A 2ZV9A 3LCKA 4R5YA 5I3RA 1J7LA 2OZAB 4X3FB 3UNJA 3PY0A 2JDVA 3K5UA 4JDKA 4KUJA 3NR9A 3CPBA 4FKTA 2QOQA 4QPSA 3DQXA 3EN6A 3F5PA 1YKRA 3AT2A 3D15A 3MVMA 2JKQA 4YJSA 4CTBA 1LP4A 1Q8TA 1Y8GA 2IPXA 5JKGA 2XIYA 1AD5A 2OZAA 3DOGA 4ZAUA 2VWUA 5AUWA 3ZFXA 4O22A 1SM2A 3W8QA 3TG1A 4FT7A 4ZLOA 5FEQA 4D1XA 3L8SA 3RZFA 3GU5A 3TWJA 4FG9A 3RALA 3UO4A 4EH3A 5HVKA 4MYGA 3KK8A 3RAWA 5A54A 3CEKA 3GCVA 3P1AA 3IQ7A 5I4NA 3BYVA 2F4JA 3ZLWA 1OKWA 4IHPA 2JAMA 4IXPA 5KMJA 4F1MA 5BQ0A 4W4WA 5E1SA 5H8GA 5LMAA 4HVIA 3DGKA 3OZ6A 3AT4A 4Z3VA 5LMBA 3MN3A 3VBWA 4IW0A 2FSTX 3BI6A 3COIA 3FYKX 4XNEA 5CY3A 3U51A 2GQGA 4BDAA 2PY3A 2QOCA 1YW2A 2YFXA 4FNYA 3QZHA 3GOKA 4LGHA 4DCEA 5I9YA 4WUNA 4TYHA 1NW1A 5ANIA 3QZGA 5KBRA 4S34A 1GY3A 1E1XA 2HY81 2I0HA 1Q3DA 2O0UA 3A7GA 2Y9QA 3FL5A 3ET7A 1LUFA 3EZVA 4KKGA 5A4EA 1PXMA 2QOKA 5CQUA 3SXRA 4AUAA 4E6AA 2GTMA 4RWKA 4E4NA 2BMCA 5HE2A 3O0GA 2ZDUA 4GK3A 5EM6A 5FEDA 2XA4A 4NM5A 4QMVA 3VNTA 4BFMA 1ZY5A 2NPQA 3BELA 3E7OA 1Y91A 5J1VA 1O6YA 2R9SA 3QYZA 2ESMA 4FKIA 2OFUA 3SQQA 3VHEA 3U55A 5M06A 1PW2A 3NUUA 3V01A 3VF8A 4HZSA 1NVQA 3L9NA 4AE9A 2XCHA 3A7JA 1FVRA 5J8IA 3R7OA 4EZ5A 3PE2A 3WZEA 4KWPA 5HG9A 4M67A 4GK4A 2HZ4A 3H9FA 4GL9A 5LVMA 4UALA 4J71A 4HOKA 3UIBA 3VUIA 3RNYA 4X6QC 3PIYA 5CLPA 5D12A 3PVBA 4EOQA 2OJIA 3E8NA 4PF4A 2R3RA 2ETKA 4FNZA 3DAEA 3PVWA 3WI6A 4RJ4A 4HVSA 2I6LA 2WKMA 4M14A 3ZC6A 5IF1A 4H05A 1TKIA 5AP6A 2E2BA 3FMHA 5DOSA 3VVHA 2C4GA 2QHMA 4FK3A 4MBJA 4AZEA 3KVWA 3LCDA 3FHRA 3LJ2A 3C1XA 3UMWA 5FUTA 3FLZA 3OW3A 5FQDC 4LGDA 4OW8A 1KE5A 3ZBXA 4GUEA 3C4EA 1M14A 4GFOA 3CXWA 3WYXA 4N6YA 5EYCA 5JGAA 4F0GA 4X2KA 3R7UA 4C7TA 3FI8A 1ZLTA 2QR8A 4NL0A 4G34A 3BV3A 2CGXA 5AM7A 2X2MA 5EQYA 4PNIA 3OWJA 4W9WA 2ITWA 4BL1A 3R01A 3UJGA 4FMQA 3IOPA 4FZDB 2WGJA 4DF3A 2XJ0A 3C7QA 2WMAA 4A9TA 2BKKA 4UXLA 4D58A 3WIGA 3QZFA 1GNGA 5T3QA 4M15A 4NYEA 2FO0A 4FYNA 3WE8A 2XJ1A 4PWNA 3ORLA 5LXMA 5AUZA 3A4PA 1M7NA 5DGZA 5KX8A 3QTIA 4TYEA 3RAKA 4FEQA 2X9EA 4QYGA 4E6DA 4ORKA 1OITA 2JKKA 2XEZA 2BRMA 3G5DA 4RPVA 3UIXA 5K0XA 2VWIA 3GT8A 3NAXA 3EQBA 3ACJA 4A9YA 4R8QA 2EU9A 4MXAA 2ITTA 5BYZA 4MH7A 3VN9A 4GT5A 3WILA 4E8AA 3UOKA 3BLQA 4KA3A 2RSVA 2C5XA 3VJNA 2F2CB 4IVCA 4XV1A 3UVRA 1IEPA 1W84A 3ORMA 2PMLX 3KMWA 1OIUA 4QMLA 3Q60A 2W9ZB 3M11A 4AZWA 4E5WA 2Z02A 2OJJA 1PXNA 4ZSGA 2CN5A 4MNFA 3P9JA 4WA9A 5IZFA 4RC4A 4F0FA 4PNKA 4IAYA 2XUUA 3SRVB 3TL8A 5AUTA 2B9JA 4OTHA 2WTJA 3EYHA 4AT5A 2OSCA 3G15A 3CSVA 4U3ZA 1ZXEA 4FIGA 3QRKA 4BICA 3UQCA 1OL6A 4UYAA 3OOGA 4CZTA 4XV2A 1XKKA 2WFYA 3KA0A 4Y5QA 3JYAA 4UWCA 2R4BA 4M66A 3AG9A 1WFCA 5AP3A 4AN9A 3I81A 4ZIMA 1PKDA 1PMVA 3ORIA 3Q4TA 4O1OA 4WD5A 3K3JA 3SRVA 4ALUA 5HX6A 4V04A 3CLYA 4KNBA 5ETCA 2UW6A 2V5QA 4O7VA 4NCTC 1ZYCA 3FL4A 3COMA 3ITZA 2OXXA 3G9NA 5CT0A 3L1SA 2CNVA 1GZKA 3ROYA 4AT4A 5LMKC 2FH9A 4F9BA 4XRJA 4AW2A 3V04A 4C3RA 3IECA 2ZB0A 4YMJA 3TTJA 3UZPA 2VTNA 3R8UA 1CKIA 3ATSA 4C37A 4PY1A 2O8YA 4TYIA 4DA5A 5BVDA 5FD2A 3ORZA 2B9IA 4DG0E 2YEXA 3RM6A 4YR8A 5CAPA 1IAHA 3Q4ZA 1OBGA 3WF7A 5FXRA 1I09A 4BKJA 4TTHB 2WMTA 5FDXA 3LXLA 5AJQA 4E7WA 1KWPA 1M2QA 3E88A 3B8QA 5T68A 5CXZA 1YI3A 3HKOA 4JIKA 4NM0A 4RIYA 2QONA 4PMMA 5DEWA 3FQEA 4EEVA 4E20A 5EW9A 5EDRA 1H08A 4RFZA 1H24A 3QRTA 2ZM3A 5AMNA 3CTHA 1YOLA 2HXLA 2G15A 2GPHA 2UW7A 1M2PA 5AP5A 5TE0A 1NT2A 3DY7A 2UVZA 5DT3A 4RT7A 3ZSGA 2UZTA 2AC5A 3AC1A 4MD7E 1IG1A 5TR6A 3ZM9A 2UZVA 3CTQA 4CNHA 4CZYB 4MXOA 4D55A 3EMGA 2XKCA 4O7WA 2UUEA 3PZEA 3OXIA 3R83A 4V0GB 4FTCA 1XH5A 3Q9ZA 4OR5A 3U54A 2B52A 2VTIA 2X7FA 3QGYA 3QTXA 4KS7A 4EK5A 1P4FA 2BFXA 3S2PA 4KBCA 3WARA 4GJ3A 4YNOA 4J1RA 2J0KA 1Y57A 2BZJA 4ZEGA 3P79A 2Z60A 4NIFB 5IDNA 4CYJA 2BALA 3BU6A 3TI1A 5JFSA 3F61A 2Z7LA 3QGWA 3R7VA 3F7WA 5IQHA 3R73A 1U5RA 1YXUA 2VTHA 4V0GA 2VTSA 4LFIA 4EC9A 5CSXA 1Q3WA 3QRIA 3QQFA 1A48A 1YHWA 1UU7A 1GIIA 3LIJA 4C4JA 3EQGA 3LM0A 3BHYA 3NNWA 2PSQA 4RWLA 4C57A 4E93A 5KMKA 3FPQA 3UZRA 2JBOA 4O2PA 2ITXA 3WBLA 1PXLA 4JOAA 2XNEA 4EOIA 1YOJA 4MBLA 2HZIA 2UW3A 4USEA 2BPMA 3BU3A 3KK9A 4X3JA 2VWWA 1VZOA 5IMXA 3K54A 3VW6A 1P14A 2KTYA 2VWXA 4XG7A 1ZY4A 3UOJA 3ZYAA 1CM8A 1MQ4A 2AC3A 3C4FA 4UMRA 1H8FA 4QNYA 1I44A 2ETMA 3PLSA 4QMZA 4QMQA 2F7EE 3FZSA 3AXWA 4I22A 1WBPA 5AV4A 2J4ZA 3QCQA 4NEUA 4J98A 5CEOA 5EM5A 1WMKA 2PMNX 3FLNC 3BYUA 2R3PA 3CKWA 1F5QA 3AOXA 3PFQA 5HHWA 4JAJA 4AS0A 3LKMA 5F95A 3TDWA 4FV9A 4XBRA 1YVJA 2ZYBA 3LCSA 4XLVA 3RPSA 4BDKA 4J96A 5L8KA 2WB8A 4Y72A 1KUTA 4O82A 4IACA 4UMTA 2J90A 1KOAA 1ZRZA 1PRYA 4M12A 4XJ0A 2ZMCA 4FSNA 5C8NA 4FKPA 4L6QA 4I6FA 4C8BA 4BDIA 2J7TA 1AQ1A 4MBIA 4N57A 3E87A 1PXOA 5AUYA 4YC3A 1WBTA 5HVJA 3PZHA 2GSFA 3KB7A 3QF9A 3C4XA 1H26A 3SG9A 3FXWA 2ERZE 5AR5A 4OGRA 2W5AA 3VS1A 4IJPA 3D83A 2B53A 4O84A 3F82A 3KF7A 4IZAA 2W1DA 4USDA 5AR3A 5L2WA 5K5XA 5C03A 2FUMA 3EWHA 1B39A 1OZ1A 3BRBA 2YDKA 3IW5A 4D2SA 5FM2A 2ZV2A 4WKQA 4JDHA 4LL0A 4BDGA 3GCUA 2X7OA 2A4LA 3W10A 4DG3E 5CU6A 3D7TA 4F63A 2BIYA 5L8LA 2YCSA 4FZAB 3HAVA 3PRFA 4X21A 1U4DA 3Q9YA 2W4KA 3NWWA 3ZFMA 2CGUA 3QA0A 1YDTE 1QPDA 4CTCA 1H25A 2YERA 2OO8X 5E8YA 3VS2A 4JQEA 1Z57A 5M57A 2CKEA 4K11A 1R0PA 1OIRA 2SRCA 4FKLA 4I23A 4BCQA 3ID6C 3TUCA 3CD8A 4BF2A 2G2FA 1DS5A 4MWHA 5CXHA 5EYKA 4GS6A 4HGSA 2WTIA 2FVDA 5HO6A 3VRYA 2GHMA 3LHJA 4G3DA 4JI9A 4LOPA 3CQEA 4GU6A 4M13A 2GDOA 3SX9A 4AZVA 2O64A 3V5TA 4OAVB 4HCTA 1OIYA 3O50A 5E90A 3FEGA 1VEBA 1OL1A 2YCRA 3RHKA 3MIAA 4CV8A 4D4RA 4JRNA 3ROCA 4MAOA 3RWPA 5I3OA 3ZS5A 2GMXA 4JX3A 4AA5A 4RLKA 3U6HA 4GKIA 2JDSA 3FLYA 3GU7A 3Q3BA 2WNTA 4B0GA 4Z7HA 4M69A 4O0XA 5K9IA 5C01A 1JWHA 2W7XA 3RK7A 3ZSIA 4D28A 5K4IA 4XOZA 1RQQA 4NWMA 5CI7A 3FJQE 3GCSA 4J53A 4GIHA 3MFUA 4EJ7A 3NW7A 4ANLA 2ZM4A 3SG8A 4QPMA 4EK4A 4QP8A 4R6VA 3II5A 5AR4A 3C9WA 4G3FA 2BDJA 4XG9A 4YJUA 3AC2A 4BI0A 3Q6UA 2C30A 4B8MA 3RK5A 3E3BX 2EXEA 5BVKA 4R3RA 4H3BA 2QCSA 4ONAA 3PPZA 5CNNA 4C02A 5JK3A 3S3IA 4NW5A 3D5UA 2XIRA 4UV0A 3K3IA 5HG7A 3TJDA 3JS2A 4TL0A 5BYYA 5IUHA 4FKRA 4L53A 5EKOA 1Q8ZA 1SVHA 5A4LA 3BHHA 3IDBA 4OTQA 4AZSA 3BEGA 4YZMA 1ZYDA 1KE9A 4CMUA 2JFMA 1SNUA 4R1VA 3PY3A 4I20A 4C3PA 2DYLA 3V6RA 1V1KA 4R7IA 2AYPA 5CAOA 2PZ5A 4P7EA 1U54B 3BLHA 1ZZ2A 4W4XA 5AP7A 5I9WA 5I5ZA 4QMYA 4EQUA 5GJDA 1R3CA 2ERKA 2XYNA 1H1RA 4L43A 4MD8E 3MA6A 3P86A 2PWLA 2BAKA 3KF4A 3QQUA 2WTKB 4FIFA 4HGTA 4II5A 4MQ2A 4UWBA 5TKDA 3VWAA 2Y4IB 3OG7A 2BVAA 4ERKA 4F6WA 2PUUA 3GFWA 2PMIA 3P4KA 4BRXA 2W96B 4CLIA 3P7CA 3T8OA 2VTJA 3NUPA 4ANQA 2Y0AA 2BROA 2R3JA 4EOLA 5IA3A 2GS6A 1WBWA 2XBAA 4CQEA 3FMDA 5M4IA 3UP2A 5BVEA 3F5UA 2IW9A 1PKGA 4I6QA 1YXSA 4IZ5A 4FUXA 4ZZMA 2PK9A 1W7HA 2P3GX 4FK6A 4YZCA 3BCEA 2BDFA 3DBCA 4RMZA 3VS3A 1J91A 3FI2A 3SKCA 4YJQA 2E9OA 5EK7A 5LJJA 4O0RA 4RC3A 2F9GA 4CCBA 4EH2A 3M42A 3OWKA 3ZO3A 3MH2A 3NNVA 3POZA 4AOIA 4DGMA 5KMIA 4EI4A 4E3CA 4O1PA 5CSVA 5CVHA 1JKTA 3H9OA 4DAWA 4UBAA 4ZK5A 1RDQE 3R1QA 3W32A 5FXSA 4YGAA 4RWJA 4B99A 3LMIA 2I0EA 4DG2E 2PZIA 4JG7A 3MPAA 2JIIA 5EM8A 2HCKA 5EOBA 2XM9A 1U46A 2YWPA 2QG7A 4EJNA 3KXNA 3LJ0A 4F70A 5AFVA 4QMOA 2JKMA 2OXDA 3QXOA 5DR9A 4ZTNA 5BYLA 3AMYA 4QP2A 4FVPA 4N70A 4RC2A 2J50A 3QXPA 4ZY6A 4IWOA 3FXXA 4NFMA 4PRJA 3FKLA 4XV9A 1TQIA 3PPKA 3WZJA 3N4VA 1YWVA 3P0MA 4ZTRA 2CNQA 2IZUA 3BKBA 4G2FA 1OVEA 3ORKA 5I9ZA 4A4OA 4EONA 5LVOA 4U8ZA 2VX1A 4O7LA 3HMOA 4BCNA 5JFVA 2VU3A 3C51A 4PV0A 3QYWA 1YHSA 4APPA 4DGGA 3R9RA 2R3KA 3UPZA 2CGVA 5DMZA 2JD5A 3GUBA 3PWDA 3ZFYA 3QUDA 4D2VA 4D4VA 4DT9A 2UZEA 3JY9A 4ZTHA 3TT0A 4JAIA 3DT1A 4EKLA 1XBCA 4JIAA 3ZDUA 4ZS4A 4FSQA 5BPYA 3WF9A 2OI4X 2NNWB 4I5MA 2R7BA 4FVQA 2VUWA 1SMHA 4BN1A 1DI9A 2B55A 3I79A 4FIJA 4FSMA 4P2KA 4DH8A 4HCVA 3RAHA 4AX8A 2G01A 2ITPA 1EH4A 2C6TA 2WPAA 2WMQA 3T9IA 4QMSA 2WU7A 2Y6OA 4GEOA 5LVPA 4K9YA 4CFUA 4DFBA 3KQ7A 4U41A 4WG3A 2ACXA 4Y8DA 2R2PA 3HV4A 2HXQA 1WVYA 2X2LA 4R1YA 4G6OA 2WOTA 5ETFA 1UU9A 4JLCA 4HYHA 2ITUA 2YDIA 3I0QA 4RA4A 4KRDA 4CRLA 3CCNA 5KUPA 4O7RA 3QKMA 1G8AA 5GIPE 2C6LA 3AC3A 4O7SA 2GNFA 4I5CA 5J95A 2OIQA 3CQUA 1KE8A 3MVJA 4CFXA 2OGVA 3R21A 4FTRA 5BUIA 1FGIA 5AUXA 3FWQA 2GHGA 3AGLA 3NLBA 3OXTA 4ZOGA 4UMPA 5AR2A 3RAIA 3CY3A 5HVYA 3W8LA 4AN3A 2I0VA 2RFNA 1YI4A 3GNIB 3QALE 5DPVA 4R77A 1ZYSA 4IB0A 2R5TA 4F7NA 4XS2A 2W5BA 1OUKA 3DFCB 1BX6A 3L8VA 5I9UA 3WYYA 2QHNA 2W1CA 3DBQA 4RVLA 3HV7A 3COKA 3R30A 2GS7A 2XRWA 4YZ9A 2W1IA 5EYDA 5CU4A 4AZTA 3HP5A 3MTFA 3UOHA 2R64A 3MVHA 3E62A 4IAZA 2IVVA 5IQCA 2C6KA 3R0TA 3AD4A 3OCGA 3BQRA 4L46A 5M4UA 3UDBA 3Q9WA 1HCKA 4FKQA 2WQMA 4TY1A 2F57A 4CKJA 3ORPA 5CAUA 4XH6A 4CYIA 3D14A 5D11A 3UO6A 2Q0BA 4O0TA 5A4TA 2QOOA 5FG8A 4FL2A 4FIIA 1R1WA 4GYIA 4LYNA 4AXAA 3BGQA 2X6EA 3QQHA 2IO6A 4HZRA 4JNWA 4K2RA 4OTDA 3UIMA 3ZRLA 4EH8A 3AD5A 4AW5A 4FG7A 3RCDA 1OBDA 1FVTA 4W9XA 4YZDA 4GFGA 1WZYA 5J87A 5AAGA 4ZSLA 2RFDA 3E93A 1QPEA 2H8HA 1QMZA 4OLIA 4BC6A 4PDSA 4FZ7A 3WF8A 3EKNA 3EQCA 2ITOA 1KV1A 4FV0A 4UEUA 3CP9A 5IA4A 3D5WA 4GVJA 3LQ8A 3R7IA 1H00A 2YAAA 3ANRA 1VYWA 4UXQA 4LOOA 3UVQA 5HIEA 3DZQA 4C38A 5M4FA 3QQJA 3SOCA 3LCTA 3LFFA 3P23A 5HE1A 3PJ8A 2UW8A 3RINA 4BDFA 4BI1A 3DFAA 5HIDA 4FNXA 3QTUA 4IFCA 4XCUA 4ZMEA 2PZRA 4O83A 2PVRA 3RI1A 4X3FA 2YDJA 2VTRA 3CC6A 3Q53A 3OBJA 2WQBA 5AV3A 3DXPA 4S31A 2BRGA 1SVGA 4CLJA 4DEHA 2EXCX 3LFDA 5AP4A 4HCUA 3F69A 4J8NA 3R9OA 2WHBA 4H3PA 5CEMA 5DRBA 3HAMA 1Z9XA 3DDQA 3G2FA 4Z9LA 5HO8A 5KZIA 4F9YA 2Y6MA 3S95A 2GCDA 3RPYA 2C3JA 3D4QA 4R7BA 4BDHA 3DB6A 1HCLA 3R2BA 2XK7A 3W18A 3C0HA 2HW6A 4GKHA 3OCBA 3QKLA 2DWBA 3EZRA 4FTAA 4YP8A 3RZBA 5CU0A 4RFYA 3DK6A 4PQNA 3R8ZA 5CEIA 3MWUA 3NDMA 4B6LA 3TJCA 3DKCA 4I1ZA 4N0SA 1H4LA 4PUZA 3ULIA 4FEWA 1JOWB 4C34A 5IQIA 3T3VA 3GU4A 5IG1A 2WEVA 5FM3A 5IH6A 3F88A 2GTNA 4YJVA 5J9ZA 3DXQA 3PY1A 3UNKA 3R63A 4TNDA 3GXLA 2UVXA 2JGZA 2V22A 2IZSA 2UV2A 3L9PA 4TT7A 2PUNA 4IX3A 3FKNA 3W1FA 4ANMA 5IEVA 3SA0A 4ENYA 4ZTLA 2WQNA 3FC2A 3I0OA 1W8CA 4IAAA 4O0WA 4L67A 4Y73A 5JFXA 2DQ7X 4AFEA 5EW3A 1FBNA 4ACMA 2FSLX 3DAKA 4JBVA 5CENA 3TCPA 3TIZA 5FTQA 5HCZA 4K8AA 3VUMA 5HU3A 3QC4A 3NYVA 4NJ3A 5H8BA 4CMOA 2PVFA 4PL5A 5ACBC 3GU6A 1GOLA 2VTQA 3PIZA 4MF1A 5M56A 5C4KA 4BDDA 4BGQA 3AC4A 3OS3A 3EB0A 2XNOA 2CLQA 1U59A 3HECA 1ND4A 4YNEA 4G6NA 4BCFA 4ZP5A 4QMUA 2X81A 4P5ZA 4U3YA 3JVRA 3VUTA 3D9VA 1V0BA 5HCXA 4PL3A 3SVVA 3ZXZA 3G0EA 5AV2A 1OKZA 2WMBA 2YM6A 4AE6A 2HIWA 3SGCA 2XIKA 3RP9A 3VBVA 3MESA 4WBBB 5HORA 2IZTA 3O17A 5LARA 3UOLA 4ALWA 2QU6A 3FLSA 4YO6A 4DE4A 4BCPA 3V6SA 1G5SA 3FHIA 2C3KA 3D5VA 4FZFB 2OJ9A 3CD3A 4B4LA 2A0CX 2CLXA 5L2IA 1G3NA 1XR1A 4CSVA 2C47A 4L8MA 4X3FC 4FV6A 3GCQA 3A7IA 1JVPP 4I4FA 2PU8A 3R8MA 5C27A 3LVPA 1YOMA 2JIVA 1VR2A 2BTRA 2C6MA 2EXMA 2J0IA 2ZVAA 3IOKA 5D1JA 1BI7A 3KMUA 3QCSA 4BTFA 3JPVA 3GVUA 4DCAA 3LAUA 4BCJA 4E5AX 4O6EA 3SLSA 1GZ8A 1NVSA 3KCFA 4L00A 4MK0A 1FOTA 4FIHA 4GFMA 4PMPA 3R8PA 3NUAA 5IPJA 4UZDA 4JG6A 3LMGA 3LFEA 5KKRC 3BGPA 2O2UA 2XKFA 3GOPA 2OH4A 4FEXA 4MEDA 5HOAA 4ANSA 4DFYA 3A62A 4ACGA 4CFNA 5KCVA 3POOA 2YIQA 3DLSA 2X8EA 5K3YA 5BVWA 4CFWA 4Z16A 4I4EA 3DCVA 4QMNA 3UGCA 4FKJA 3VS4A 1X8BA 4IEBA 3ODZX 4QMWA 5ANJA 3FE3A 1PXIA 2BZHB 4BWPA 5HQ0A 1YXVA 2IW8A 1ZWSA 2C3LA 3PE1A 4PTEA 4DGNA 3LFBA 4JDIA 3KULB 3ODYX 3CIKA 3FUPA 4KSPA 2IJMA 4XG6A 2CKQA 5A46A 3DPKA 4KIQA 3R2YA 2VD5A 3PSDA 3HP2A 3FC1X 3I7BA 2BRBA 4NH1A 4PDYA 5I9XA 4A4XA 3R9HA 3FI4A 1H01A 4GG5A 2P0CA 2RF9A 4XMOA 2HELA 1OIQA 4C4HA 2FGIA 4YJRA 4WG4A 4FBXA 1PXPA 1WBSA 3GP0A 4O27B 2XK4A 3PUPA 3KULA 4S30A 4V01A 4C61A 3DZOA 4FI1A 3HRBA 4FSZA 2Y7JA 2JKOA 4H39A 3VF9A 3O71A 3B2TA 1NVRA 4BYJA 4WRGA 5EI2A 5DVRA 3E7VA 2VTPA 3F2RA 2JLDA 5C8MA 2XS0A 5IH4A 2R3OA 3TKIA 1ZZLA 1R0EA 3THBA 2G2IA 2CNUA 4X6RA 4DEEA 3LLTA 3R00A 4Q9SA 2HZNA 5CQWA 3MY1A 2UZDA 5FEEA 3RCJA 1OUYA 4X7QA 5DT4A 4K33A 2HW7A 5EFQA 3V5JA 3BYOA 3SXFA 3HUBA 4AP7A 4H36A 1BL7A 4EOOA 2VGPA 3D0EA 2PMOX 4AZFA 2GQSA 5HE0A 3CPCA 4RX7A 4O6LA 4U42A 5EQPA 3FMMA 2QOIA 3ORXA 3VQHA 3R1YA 4FT5A 5JFWA 5L6PA 1YWNA 3ALOA 3ELJA 1OPLA 3CJFA 4FL1A 2B1PA 1ZYLA 4ASEA 3SW7A 3O8UA 4FKVA 4XHKB 3FZTA 3HMNA 4YHJA 5DHJA 5EHLA 4BKZA 4HVHA 1AGWA 4FUYA 2OF4A 2J0MB 5G6VA 3UQFA 4MWIA 4WNPA 3GI3A 4G9CA 2X1NA 3GU8A 1P4OA 2WMUA 4IB3A 5AR8A 2J0JA 4FEUA 5CSHA 3PXQA 3ATTA 2NO3A 4IIRA 4LG4A 3NUSA 4IZYA 4LUEA 4FODA 3ZXTA 2W1ZA 3BQCA 3EFJA 3BHVA 4FGBA 3WF6A 4LM5A 3F3UA 3VIDA 4FKUA 4AGUA 5IMEA 4DT8A 2F7ZE 2C5VA 4YHTA 4OTIA 4BTKA 2QLQA 3QHWA 4GJ2A 1UU8A 4CKIA 3F3WA 5D7VA 2HOGA 3Q4UA 4EHZA 1Z5MA 3OEFX 5A6NA 3R8LA 3Q52A 3F9NA 4IX5A 5BUJA 3IW6A 3NIZA 2RL5A 1YHVA 4P5QA 4XBUA 2XMYA 5CX9A 4FZ6A 2R3FA 4G5JA 4BR3A 2YZAA 3BYSA 4EH6A 3P08A 2WAJA 3MGYA 4WSQA 4BZNA 4DTAA 5E8VA 2HK5A 4X2FA 3BV2A 4JQ7A 4XP0A 3TKUA 4BGGA 3VC4A 4WNOA 5HE3A 5FBNC 1OMWA 5AA9A 4EOMA 1H0WA 2YAKA 3VUHA 4K0YA 5TOZA 4I5PA 4QMTA 2PE2A 2ZJWA 3DNDA 3NX8A 1NXKA 3EOCA 3TNPC 4NIFA 5KMLA 3C5IA 2CSNA 4GSBA 1MRUA 4LUDA 4RJ8A 3FMJA 5CT7A 3OCSA 4IC7A 4KIPA 2OW3A 2O65A 3I5NA 5EH0A 1FMKA 5AM6A 3FZ1A 3RMFA 3HX4A 2QO2A 2X4ZA 3K5VA 5FLFA 3W16A 3HYHA 3ZLSA 4KKEA 4D4SA 4BCKA 3I60A 1VYZA 4Y85A 3OF0A 3F5GA 3ZUTA 4J95A 1LEZA 3BGZA 3QD2B 4ZTQA 4A9SA 5IISA 4UWYA 2VO3A 3A7FA 4XG4A 5L2QA 5B0XA 1QCFA 5HKMA 3P7BA 4ITJA 2WTVA 2R3HA 5E1EA 4YZNA 3QX4A 3KXHA 5FTGA 2PYWA 2I1MA 1Q24A 2FB8A 2QODA 4J8MA 5EDQA 2C5NA 2W0JA 5GZAA 5HLNA 4YLKA 4IM0A 3RWQA 3Q6WA 2C0IA 4GCJA 4ERWA 2P2HA 1M2RA 5HEZA 3VS7A 2V0DA 3DU8A 2YLFA 2R0UA 4M7IA 4L45A 2W06A 1WVXA 4BYIA 2VX0A 3EQFA 1XWSA 5AP2A 2XNNA 2OJGA 3VUGA 4NT4A 5KBQA 4WIHA 5EQEA 5HTIA 1PHKA 3HRFA 1GZOA 5GJFA 1BYGA 2PVYA 1PY5A 3D7ZA 3WIKA 4F9AA 5IQDA 3NCGA 4BCHA 3UO5A 3LMHA 3OY1A 3MB6A 4XP3A 3FMLA 4J7BA 2FSOX 4QOXA 2QOFA 3FV8A 3IONA 3KMMA 5E92A 3R7YA 4QD6A 3PPJA 4Y5HA 2UZLA 3QTZA 5DE2A 4BIDA 4CVAA 5HD4A 2WQOA 4AN2A 4WT6A 5DI1A 4F7JA 1V0PA 1Q97A 4QT1A 3QC9A 2RKUA 4X0MA 3OWLA 4O0UA 4IJ9A 1SVEA 3RHXA 3TTIA 5M55A 4U40A 4FEVA 5E7RA 5AV0A 5FTOA 4HYUA 3QLGA 4FYOA 4U43A 3NW5A 2EB2A 3O2MA 1NY3A 1H27A 3NUNA 3QCYA 4C33A 4MXZA 5JGBA 2UVYA 4OUCA 4QTBA 5LQFA 3R1NA 3KY2A 3Q2MA 3Q04A 4R5SA 1IA9A 3C4CA 2XK3A 3L8PA 5M53A 2X6DA 4QPAA 3BIZA 4ARKA 2A19B 1S9JA 3NCZA 3NYOA 4CKRA 1UKHA 4KIKB 4ZMFA 5BX0A 4NJDA 4EH4A 2XYUA 3NW6A 5J5SA 2W05A 2WELA 3PA3A 3RNIA 2YIWA 3SV0A 3UODA 4ACHA 3LLAA 3IS5A 4EBVA 4C0TA 4DEBA 3DK7A 2YM5A 4O86A 4BDJA 4BCIA 4JL9A 4GMYA 5DR2A 4DEAA 5HLWA 3FXZA 1FPUA 4FV7A 4QYYA 2VTLA 3MY0A 3KREA 5IQEA 3KC3A 5KNJA 2IVTA 4IX6A 4KIKA 4QP4A 1PF8A 5HNGA 3ZH8A 1PMNA 5LCKA 2GHLA 4ZXTA 3M1SA 4A7CA 4NZWB 5JT2A 3KN6A 4AF3A 4RJ3A 5EHYA 1YI6A 5AX3A 5B2MA 3HRCA 2C6OA 3E8EA 3AD6A 4IDVA 4F0IA 2WMWA 5TF9A 3BU5A 5IUIA 4XX9A 3C4ZA 2J51A 3D2IA 4IQ6A 4L3JA 3TIYA 4Z55A 3RK9A 2PPQA 5L3AA 2JFLA 1O6KA 4Y95A 5GZ8A 5G1XA 3P78A 3GC8A 4L7FA 4WUAA 4CGAA 1ATPE 2JDOA 2NP8A 3G51A 3L9LA 4O0SA 3PTGA 3W2PA 4ZZNA 1P5EA 2YABA 2YM7A 3NS9A 3PXZA 5F9EA 3NPCA 2HYYA 4KBAA 4QQTA 1DI8A 3EL7A 3IK3A 5HTCA 2PVNA 4OT6A 5T6KA 4HPTE 3UPXA 3VQUA 2UW5A 3LFSA 3ZUVA 4NFNA 4R78A 4A06A 1MRVA 4M84A 3NNXA 2QR7A 3F5XA 5FBOA 3CTJA 2R3GA 4P90A 1JKKA 3PXYA 1R78A 3QD3A 3PJ3A 4FTTA 3R28A 5CF4A 3CY2A 1U54A 3E8DA 1WBOA 4YTHA 2ITVA 2RIOA 4IAKA 3SDJA 4HGEA 2CCIA 4IZ7A 1F0QA 4L3LA 4FV1A 4CG8A 4MD9E 3DK3A 4XYFA 2JBPA 4OBOA 4L52A 3A60A 3HA8A 4KB8A 4RJ5A 5HIBA 2VTOA 2WMXA 2YISA 1V0OA 5KZ0A 2XBJA 2QO9A 2OK1A 3IGGA 4O0YA 2VWYA 4RX5A 4EWQA 1ERKA 2BZIB 4GU9A 3TNIA 3OCTA 2GS2A 5BUEA 1UNHA 3QTSA 5DA3A 4FTNA 4IB5A 4UYNA 2F49A 4L01A 2QKWB 3V5LA 1H07A 3PSBA 4RIWB 3WZUA 4O7YA 5CEKA 5AP0A 3UP7A 5IQAA 3IDCA 3ENMA 4K77A 4L7SA 2X7GA 4IFGA 1UWJA 3HL7A 4AFJA 3U8WA 4JBOA 5KHXA 5GHVA 3UG2A 1O6LA 4E1ZA 1UV5A 3ZSHA 2CCHA 4RIOA 3T3UA 5ANEA 5AA8A 3FZOA 1P2AA 3SHEA 4RIWA 4BIBA 3PRIA 4FKWA 4UB7A 4BY9E 3H9RA 3QTQA 3O96A 3LJ1A 5B7VA 1H1WA 3ZO4A 4ALVA 5BMMA 1FQ1B 2VWBA 2W9FB 4NM7A 4EK3A 4F1TA 3DQWA 5CAQA 3EQPA 3E5AA 3NYXA 5BVOA 3FZPA 3FPMA 5CANA 2V7AA 4UMUA 4O7ZA 3OUKA 1XBBA 4GRBA 3W2SA 2BUJA 4D2PA 4DC2A 3KL8A 4RLLA 5KHWA 4UN0C 3U6IA 4H3QA 3G90X 3I6UA 4L3PA 2I7QA 1UNGA 3O8TA 3U9NA 3ENHA 3Q4CA 3OD6X 2JDRA 3W2CA 2PE1A 3C4WA 4IWQA 3IW4A 1Q62A 5JZNA 4F64A 4E5BA 3NUXA 4N4SA 4PPAA 3AGMA 1XH6A 3H10A 3TZ8A 4AGCA 2OF2A 5H8EA 1ZARA 2WD1A 3CR0A 4IVAA 4QP7A 4E4MA 1IA8A 3MV5A 5HESA 4BGHA 3G9LX 3I7CA 4I0RA 3UZTA 5A4CA 5HBHA 3LPBA 5GIOE 3EN9A 1TQPA 4XG3A 4O21A 3QA8A 4BHNA 4D1SA 4EHVA 3E8CA 4KIOA 1KE7A 3LXPA 3G6HA 4A4LA 4UZHA 1F3MC 2CJMA 4DBNA 1PXJA 4AACA 1CKJA 4CFFA 2PZYA 4E6CA 2J5FA 1XH7A 3MW1A 5DIAA 2ITNA 2O3PA 3MFSA 4YTIA 2J2IB 4QQJA 4DGLC 2QQ7A 2PZPA 2Y4PA 3F2AA 2VO7A 1JKSA 4M8TA 4EOJA 3DAJA 4KBKA 2G2HA 4PP9A 2R3MA 3TXOA 4QTAA 4M97A 4O91A 4WBOA 5D41A 3V3VA 3PP1A 4A9RA 4DTBA 2WTKC 4QTDA 3WF5A 3EQDA 4TPTA 2Y4IC 4FSUA 3QLFA 3BBWA 5E8SA 2AUHA 4MQ1A 2B7AA 4AOTA 4JS8A 2W99B 2YJRA 5HCYA 4RVTA 4ZSAA 4RX9A 2X0GA 4EL9A 1H1SA 4XV3A 1QPJA 1W0XC 2RFEA 2GNLA 2W1GA 2OFVA 3HNGA 3PJ1A 4C36A 4IWPA 3AC8A 2QOBA 2QNJA 4TN6A 4TWOA 2XRUA 2WOUA 4FT0A 4G3GA 4MXXA 3VUDA 5FGKA 1PMEA 5GINE 2BAJA 4O81A 1J1BA 4IVBA 4QTEA 4PP7A 3T9TA 5IKWA 4GV1A 2OH0E 4YBJA 2VN9A 4OTPA 4E26A 3VS5A 3HV3A 4TWCA 2PVMA 3EQHA 4EC8A 5CSWA 3PVUA 5HNBA 4LRJA 5C9CA 4DLIA 5IDPA 5GZ9A 1KE6A 4D4YA 3QQKA 4IVDA 4ASZA 3FDNA 4CFVA 4G9RA 4QYFA 5HBJA 2IG7A 3HLLA 5E91A 3REPA 5KMMA 4FA2A 2VRXA 4I3ZA 4AW0A 1LPUA 1Q8WA 4F99A 2XZSA 5DH3A 4WRSA 4AQCA 4IANA 3KU2A 4JDJA 4U9AA 3W2OA 4CD0A 4EYMA 2JDTA 3ORNA 3VBTA 2V62A 4U45A 5DR6A 3GBZA 4E6QA 5A9UA 1GJOA 4FTLA 4RJ7A 3G33A 4BWXA 4A9UA 5HNIX 2HENA 3LW0A 5J9YA 2RGPA 1GIHA 4FC0A 4RG0A 4GG7A 2BDWA 4ZSJA 5L8JA 3MJ1A 4IH8A 4HVGA 4OAUC 1WCCA 3QQLA 4WSYA 1XQZA 2OWBA 4WNKA 5F1ZA 3VRZA 1NA7A 3ZZEA 5CF5A 3R04A 4RVMA 5CNOA 4FV8A 2ITQA 4LMUA 3SC1A 3GQIA 4AGDA 4FV4A 4O96A 4M0YA 2FA2A 2VV9A 2QO7A 3Q96A 3PA4A 3E64A 5FP5A 1K9AA 2YIXA 5ACKA 3SOAA 3ZZWA 4BCMA 4BDBA 2HZ0A 1STCE 3TUDA 1PYEA 3QTRA 3D2KA 3QUPA 4F9CA 3FSFA 4C4IA 4Z7GA 5JQ5A 3F3ZA 3IW8A 4MCVA 3UMXA 3S0OA 3C13A 5F4NA 2QG5A 1FINA 4C2WA 4F7SA 4TWPA 3UC4A 1Y6BA 2R3IA 4G3EA 4L9IA 1H1QA 1WBVA 3IO7A 3KRJA 4BZOA 4ZTSA 4ASDA 1PMUA 3OHTA 3EQRA 2E9PA 3NYNA 4RA5A 4JRVA 5KKRB 3A8WA 4GT3A 4YSMA 4DEIA 3FBVA 4OTRA 3QWJA 1T45A 3Q9XA 4ZJVA 2X2KA 3OP5A 5L6WL 3DTCA 4QRCA 2XVDA 3NSZA 2JAVA 1FVVA 3ANQA 3ZDIA 2I40A 2IW6A 2IWIA 4DFZE 4TYHB 2PHKA 3CJGA 2WU6A 4J97A 1YDRE 2XIZA 4EQMA 4C4GA 3FQHA 1Q41A 3MH3A 3QAME 3N9XA 3DA6A 3MY5A 3MYGA 1IAJA 4QP1A 4EH5A 2VGOA 3FY0A 4BTMA 2PL0A 1DAYA 1QPCA 2EUFB 2W4JA 4BCOA 2KULA 2QOHA 1LR4A 4ITHA 3QU0A 4ZJIA 4L68A 3KVXA 2G1TA 4I41A 4I0TA 4YURA 4N6ZA 4IAFA 2ZV8A 3OVVA 5E8UA 4CT1A 2XIXA 4FTIA 3S1HA 3PDTA 2XM8A 1OL5A 2WQEA 3PJ2A 2G9XA 4Q2AA 2YIYA 4YHFA 3TM0A 3LE6A 5LCJA 5AWMA 2W17A 2YM4A 4C2VA 5CVGA 4F7LA 4DFLA 4EOSA 4DBXA 3LOKA 1HOWA 4IC8A 5JSMA 2YA9A 2E9NA 4EWHA 1FMOE 2BKZA 4M0ZA 2ZAZA 3B2WA 3H0ZA 2WO6A 4I24A 4EH9A 4O7NA 4EYJA 1U5QA 3ZCLA 4JR3A 4HNFA 2OJFE 4U0IA 2C1BA 1CKPA 4DLJA 1B38A 3IKAA 5ANOA 5F20A 1LEWA 3V5WA 4CT2A 4DITA 3COHA 4EH7A 3A99A 1IR3A 3FKOA 3VS0A 4NCTA 2VO0A 4QP3A 2XKDA 2BHHA 2BR1A 3TNHA 3PG1A 5EG3A 1Q8YA 3G0FA 5EDPA 4OT5A 2W1HA 4CXAA 1BI8A 5LMKA 1MUOA 2W1EA 2XK8A 3HEGA 1L3RE 3KRRA 1REJA 2YCFA 3ZO2A 4CQGA 4NW6A 2P55A 3SXSA 3EN7A 4HGLA 4TRLA 2WMSA 4D2TA 1J7IA 4QTCA 4U6RA 4ANOA 4AA0A 5A14A 5LVNA 4WO5A 5CVFA 3DNEA 2YITA 5AR7A 2CGWA 5EW8A 4EOPA 3NVKI 3A8XA 5KMNA 3DXNA 5CI6A 2PUPA 2WIPA 4LRMA 3EIDA 2WMVA 4I21A 3D5XA 3OBGA 2J6MA 4R3PA 3V5PA 2DS1A 3FQSA 4X2GA 5JRSA 5J5TA 1K2PA 5LOHA 2B9HA 2XNPA 4PL4A 3I4BA 3OTVA 3VBXA 3A7HA 3AT3A 5DYJA 3MB7A 3AMAA 3MH0A 4NK9A 4JQ8A 5H2UA 1ZOHA 4XG2A 5FWKK 4CV9A 4RFMA 3O51A 2VZ6A 5ANKA 3VJOA 3DBDA 4TYGA 3TACA 5CSPA 5L2SA 3GGFA 4E4LA 2OZOA 4I6HA 4G3CA 3H4JA 2VTMA 1VJYA 2GNHA 2C0TA 1OL7A 2A1AB 3E3PA 1E1VA 3FYJX 4I5HA 3KXGA 4IB1A 4BBFA 3TDVA 3QZIA 4D2RA 2WMRA 4NU1A 1K3AA 4J52A 5FRIA 4E73A 3L9MA 2CKOA 1M7QA 3U9CA 4C59A 3FLQA 5C1QB 3WZKA 4I92A 3R6XA 3ZRMA 4YPDA 2BIKB 2XF0A 4QYHA 1FGKA 4AG8A 2HWOA 4KABA 3FLWA 3F2NA 2OIDA 3KRXA 2BHEA 3AQVA 4J99A 5HU9A 5LWMA 3VAPA 1SZMA 3O7LB 5DBXA 2C1AA 3N51A 5M07A 3BBTB 5KMOA 4D9UA 4WOVA 2C6IA 4EZ3A 3MJ2A 2Z8CA 4I0SA 3E63A 2YLEA 1OM1A 1YWRA 4F09A 3QRUA 4NKAA 4YC6A 4JT3A 4E4XA 2XCKA 4ID7A 2QURA 4IBMA 3MH1A 1W83A 3BE9A 1CSNA 3EH9A 4GK2A 4IM3A 4ANNA 4C62A 1UNLA 5CF6A 5BNJA 3FMKA 2R7IA 2WTCA 2YIRA 3ZONA 2UZWE 3LQ3A 4FTOA 2Q83A 2B9FA 5F94A 5EI6A 1ZAOA 4OTGA 2ZM1A 3IGOA 4FSWA 5ETAA 4AA4A 4EORA 3FAAA 4FE2A 2C5YA 3DBFA 4S2ZA 3PSCA 3HA6A 4G17A 5M08A 2YACA 4MTAA 4YPSA 2UW4A 2X9FA 4FX3A 4DGOA 2HY0A 3FMEA 1MQBA 3KRLA 4PTCA 4ZS0A 3MIYA 4ZJJA 5J7HA 5KO1A 1URCA 1UU3A 1YDSE 2JC6A 2QI8A 3KXZA 4D1ZA 3U6JA 3CQWA 3KN5A 4FV2A 5AP1A 3R7GA 4UMQA 3TV6A 4CCUA 3BE2A 3WZDA 2QOLA 5DRDA 4A07A 1O9UA 4RIYB 3UVPA 3E92A 5DN3A 4NTTA 3ETAA 4TW9A 2H9VA 3F66A 3TV7A 2XP2A 1ZOGA 4HYIA 3HVCA 3LZBA 4KRCA 1J3HA 3PA5A 4RBLA 4YTFA 3N4UA 4NM3A 3PP0A 3EN5A 4K18A 1YQJA 4HW7A 4KSQA 4JX7A 2CHLA 3OWPA 5EM7A 1JLUE 3WE4A 2P2IA 3C50A 5C26A 4EOKA 4LRKA 1Q4LA 3I1AA 4DYMA 4MXYA 3EFKA 4AU8A 3QL8A 4GUBA 5ANDA 3C5UA 2FYSA 2XEYA 3OC1A 5HLPA 1SNXA 3MSSA 3RJCA 4HJOA 2QD9A 3LM5A 4I93A 4V05A 3RPRA 2NRUA 3HV6A 5IU2A 4XEYA 2OKRA 1ZYJA 2PVLA 1DAWA 4IE9A 4PMSA 2GU8A 3V8SA 5AUUA 1JPAA 2O63A 4PX6A 4DH3A 2ZB1A 4RX8A 5FDPA 1OPKA 5HGIA 2OXYA 1QL6A 4FT3A 2PVJA 4RZWA 4DEDA 3Q2JA 3P5KA 2H6DA 3S00A 4OBPA 5AAEA 3R22A 4MF0A 5CTPA 3BWFA 2PTKA 4IADA 4FT9A 4FKGA 4BDEA 5IEXA 2BCJA 2P33A 1XBAA 3F3TA 3OEZA 4I94A 2GQRA 4UX9A 5C4LA 3DKFA 2WTDA 2GNJA 2XNGA 4B8LA 2JITA 2XNBA 3VW8A 2YCQA 3NAYA 2VNYA 3BEAA 3GCPA 1OKYA 5EOLA 4D5KA 3LCOA 3JR1A 4YBKA 5AIKA 3KXXA 4F9WA 5B2KA 4G31A 4GH2A 1Y6AA 4LV8A 1H1PA 4DEGA 3JY0A 1XH8A 4JBQA 4GYGA 5CWZA 3LXKA 5CAVA 4EK6A 5J79A 3BZ3A 5ICPA 4LOQA 4XG8A 3F3VA 5JQ8A 3NGAA 3R71A 4BTJA 3GEQA 2VAGA 3HDNA 3MVLA 3OY3A 3NMUF 4B7TA 5AUVA 4M3QA 4CZUA 4YJTA 1RW8A 3VBQA 4D0WA 3KGAA 5CEPA 1KSWA 4W8DA 3HMMA 2H96A 2XJ2A 3CS9A 3L8XA 2Z2WA 1JSTA 4DFUA 4K6ZA 3W55A 4DTKA 4ENXA 5TO8A 5JRQA 3UYSA 2YZLA 1BUHA 3ZEPA 4O38A 4YSJA 5L2TA 1MP8A 2A2AA 1M52A 3R8VA 4M68A 4WHZA 1CDKA 3NUYA 1OI9A 4OTFA 2Z7SA 2NRYA 3LFAA 2WTWA 2F2UA 3KRWA 3NNUA 3DBEA 1BMKA 5GJGA 3W2RA 2C0OA 2Y8OA 5ANGA 4H1JA 3EFLA 2BZKB 4YUQA 4OBQA 2W5HA 4F6UA 5J1WA 2WXVA 4APCA 1ZMVA 3H3CA 2REIA 3ZUUA 5IEYA 1APME 3HDMA 2LGCA 1W98A 2CMWA 5IA0A 1OL2A 3MTLA 4BBEA 5CZHA 5DT0A 2C69A 3DTWA 3BHUA 4U79A 4AAAA 5HO7A 3I5ZA 4CEGA 4DN5A 5DEYA 4ZZOA 5IA5A 3AMBA 4RIXB 2WEIA 2O5KA 5A6OA 4LGGA 4F65A 1RJBA 1BKXA 3QFVA 1T46A 5EYMA 2EWAA 3QX2A 3V5QA 2V55A 5E4HA 3W2QA 3NEWA 3PG3A 2E9VA 4AWIA 3G6GA 5KE0A 3QQGA 4F4PA 4F1OA 4AW1A 2GNGA 3NRMA 2P4IA 2ZOQA 3QD4A 4X2JA 1URWA 2C68A 2F7XE 4MXCA 5ITAA 3U4UA 2JIUA 4F6SA 4RIXA 1KV2A 3OW4A 4EHGA 3MI9A 4EUTA 4FICA 3D7TB 5E9EA 5L6OA 2C5OA 2XH5A 3EN4A 4IM2A 5IA1A 4D5HA 2PUIA 3A4OX 4D0XA 3DKOA 5K0KA 4ZLZA 4DH7A 2UW9A 1M17A 4FSTA 1MRYA 3IW7A 4KINA 2EB3A 5AEPA 1L8TA 5CALA 5IH5A 2CN8A 3OMVA 4Y83A 3TUBA 1A9UA 4I6BA 4BVUA 3LFQA 1UWHA 3GB2A 3SW4A 4FG8A 4C4EA 2CDZA 1ZMWA 3GFEA 2VTTA 5BMSA 2UZBA 5JZJA 5JEBA 5IQFA 1JSUA 2RG5A 5HG5A 4IX4A 2ETRA 4H1MA 3U4WA 5E8XA 2GFSA 4QO9A 2XB7A 3HV5A 3ZM4A 3ZOSA 4FTQA 4EQCA 2IVUA 4Y46A 3H0YA 4YTCA 4AGWA 3PIXA 1W82A 2PVKA 3PLAE 4G16A 3CGFA 3OXZA 5M09A 4LL5A 4NTSA 3SAYA 4CG9A 5CU3A 3PXFA 4TNBA 3F7ZA 3ULZA 3CKXA 4HYSA 4ITIA 4FKOA 4QMMA 5HTBA 3V51A 4M69B 2V7OA 2OBJA 4GVAA 2OU7A 2BRNA 1WVWA 3TZ7A 1XO2B 5LWNA 3TEIA 4DFXE 4EBWA 5IUGA 3BX5A 1JBPE 4BDCA 3FY2A 4QP9A 2CPKE 1YXTA 3R1SA 3N4TA 1PXKA 3OOMA 4O0VA 3C0GA 4PTGA 4QQCA 2YHVA 3BYMA 3FSKA 4ASXA 3VHKA 3R7EA 3W33A 4C35A 2GFCA 5J7BA 3ERKA 3NVMB 3MS9A 3KKVA 4ZSEA 4WNMA 4YC8A 2BFYA 5HG8A 3QCXA 1H0VA 3WOWA 1OPJA 2VTAA 4CFMA 5A4QA 1TQMA 3VBYA 4B9DA 5I0BA 5FP6A 4JVGA 4C58A 4ZY5A 4WG5A 1Q8UA 3TV4A 4QYEA 2VWVA 3RBWA 2HWPA 3H30A 2DUVA 4MHAA 2OIBA 3UNZA 4W4YA 5BVFA 3C0IA 5I9VA 3OT8A 5AV1A 3DJ5A 4JBPA 4RJ6A 4Q5HA 2J5EA 5DFPA 3NZ0A 4JG8A 2Z7QA 4PMTA 2BTSA 5H9BA 3UIUA 3UE4A 3TZ9A 4LV5A 3VUKA 1PJKA 3BLRA 3DKGA 4YJPA 3S4QA 4HVDA 2R3NA 4OTWA 5E8TA 4XP2A 5JGDA 3B8RA 4LMNA 4LQMA 3UQGA 4IDTA 2R0IA 4YJNA 3ZLXA 2UZUE 2VWZA 4XOYA 4EUUA 1REKA 2CKPA 3MPTA 4PDOA 3HGKA 4U80A 3D94A 2ONLA 3A61A 3I6WA 4RGJA 2QLUA 4YJOA 2JEDA 3VO3A 2BILB 4ACDA 3GC7A 2J0LA 4ANBA 2XK9A 2IVSA 4MNEB 3GENA 3R9DA 3GC9A 1BL6A 3PXKA 2QVSE 2C3IB 3NIEA 2C6DA 2QU5A 2B4SB 3ALNA 2OLCA 4TYJA 3RGFA 4KKHA 4PPBA 3UC3A 3ZRKA 5CU2A 3ZC5A 5M51A 4FOCA 5AADA 2OG8A 4MNEA 4QNAA 4XLIA 3PVGA 2ZV7A 4S32A 4BBMA 2EVAA 3PXRA 1JSVA 4S33A 3ZEWA 4KS8A 4YZBA 2FSMX 1SYKA 3EKKA 4IAIA 1J7UA 3V8WA 2UW0A 3EL8A 3ZTXA 3F6XA 3P7AA 5D9HA 2YJSA 4F08A 3V8TA 5BVNA 4ACCA 3ZU7A 3RKBA 3K2LA 4U5JA 4BZDA 4U7ZA 2E9UA 4MX9A 3LFNA 4TZRA 3UYTA 4BI2A 4O2ZA 1UKIA 3MA3A 4W4VA 4YLJA 2XNMA 3AC5A 3ACKA 4FVRA 3M2WA 4RRVA 5DLSA 1R39A 4EZ7A 3MPMA 2RG6A 3KCKA 5CZIA 3U87A 4Q5EA 1GAGA 2X8DA 1BLXA 4D2WA 3QHRA 3KXMA 3PYYA 2I0YA 4RVKA 3ZHPC 3KFAA 3OT3A 4R7HA 4G5PA 4G1WA 1A06A 3Q5IA 1TVOA 3OUNB 3R9NA 3BWJA 3HZTA 4X2NA 5HD7A 3O23A 3EHAA 4RZVA 3DLZA 3KEXA 3OFMA 4W8EA 4P4CA 5CS6A 5H3QA 3LQ5A 3ZLYA 4KD1A 5K4JA 3QBNA 2B54A 4HNIA 4IMYA 1GZNA 3SD0A 5GNKA 4TKSA 4KAOA 2IZRA 2Q0NA 2W4OA 5AX9A 1ZOEA 3ZBFA 3O8PA 2VO6A 5D10A 1DM2A 1J1CA 3BPRA 4PDPA 4C4FA 2YM3A 3DJ6A 4H58A 3TKHA 4UY9A 4YLLA 3ZMMA 5HZNA 2PE0A 2R3QA 2VNWA 2UZOA 4QQ5A 1YXXA 3A2CA 5ETIA 3TN8A 4DH5A 5DG5A 3ZO1A 2IN6A 3EQIA 4DFNA 1JNKA 4FTKA 4Q9ZA 4EK8A 2ZDTA 3IDPA 3OROA 3TZMA 3UG1A 3LXNA 4FR4A 4AOJA 2HAKA 5C8KA 5K5NA 4CMTA 3DS6A 2BRHA 2H34A 3DJ7A 3BHTA 3PWYA 4FV5A 2QKRA 2VX3A 5JN2A 1CMKE 1S9IA 1WAKA 3PJCA 5TT7A 4JJRA 2RFSA 2Z7RA 4HPUE 1E9HA 4FNWA 1UA2A 4C3FA 4FIEA 4L42A 5M4CA 2X8IA 4XRLA 2ONLC 4PPCA 5EHOA 3RM7A 2W1FA 3JVSA 3RVGA 5DWRA 4BCGA 4BKYA 5L4QA 2XK6A 4RSSA 3JXWA 1OKVA 1XH4A 2UZNA 1XH9A 4FSYA 3MFRA
chains in the Genus database with same CATH superfamily
2R3LA 1YRPA 1H28A 3MDYA 4FL3A 4FKSA 4U97A 5A3XA 4DHFA 4ZLYA 3QWKA 3RPOA 4ZTMA 4GT4A 4IWDA 4NKSA 2X39A 2GNIA 3QKKA 1IRKA 1WBNA 4QMPA 5FXQA 1B6CB 3HMPA 3ORTA 4DH1A 3OTUA 4O7TA 1OECA 1GIJA 2OICA 3IPHA 3CE3A 5EI8A 2LAVA 2YWVA 5AIRA 3IG7A 4BHZA 4EHEA 4MKCA 1Y8YA 3QTWA 5CF8A 4RQVA 3QD0A 1Q61A 3GQLA 2ITYA 1JQHA 1CTPE 3EJ1A 4FV3A 4QP6A 1OB3A 5AAFA 4LI5A 5HI2A 5LVLA 4XUFA 3MBLA 4FF8A 4RWIA 4TWNA 4TXCA 5EKNA 2XKEA 5JH6A 5HICA 3UBDA 3LFCA 3DDPA 1OGUA 4FTMA 3JUHA 4FGRA 3QRJA 4D9TA 3FI3A 2PVHA 4JXFA 5IA2A 3QUEA 4GIIA 5CEQA 3UTOA 5D7AA 4BWKA 4ZY4A 2PULA 2ZMDA 4BB4A 2QC6A 2X4FA 3EYGA 4NUSA 5E8ZA 4YU2A 4GW8A 4NSTA 2WIHA 2ITZA 1ZMUA 1Q5KA 1KOBA 5B2LA 5J9LA 3FMNA 2J9MA 3GC0A 3NFGB 1Q99A 3DB8A 4FOBA 4QMXA 1XJDA 3CBLA 1G8SA 3MFTA 3TNQB 5CASA 3HUCA 4FSRA 4JR7A 3VS6A 3RPVA 1PYXA 4YO4A 2C6EA 3Q5ZA 1UVRA 3O7LD 4L44A 4USFA 4FTJA 5HX8A 5IQGA 4AT3A 4U81A 3RTPA 3VULA 3CGOA 4U44A 4CRSA 3HMIA 4FTUA 4K1BA 1JAMA 5DNRA 3EFWA 4RQKA 4MVFA 1IASA 3DV3A 4BIEA 1JKLA 2YN8A 2B0QA 2WZJA 5E8WA 2A27A 1RE8A 4R3CA 4EKKA 4G6LA 1XHAA 3TNWA 4DINA 5CYIA 3Q32A 5HBEA 2YM8A 5IQBA 2BAQA 5JMSA 3FZRA 3R02A 5M44A 2ZV9A 3LCKA 4R5YA 5I3RA 1J7LA 1OGYA 2OZAB 4X3FB 3UNJA 3PY0A 2JDVA 3K5UA 4JDKA 4KUJA 3NR9A 3CPBA 4FKTA 2QOQA 4QPSA 3DQXA 3EN6A 3F5PA 1YKRA 3AT2A 3D15A 3MVMA 2JKQA 4YJSA 4CTBA 2ZFYA 1LP4A 1Q8TA 1Y8GA 2IPXA 5JKGA 2XIYA 1AD5A 2OZAA 3DOGA 4ZAUA 2VWUA 5AUWA 3ZFXA 4O22A 1SM2A 3W8QA 3TG1A 4FT7A 4ZLOA 5FEQA 4D1XA 3L8SA 3RZFA 3GU5A 3TWJA 4FG9A 3RALA 3UO4A 4EH3A 5HVKA 4MYGA 3KK8A 3RAWA 5A54A 3CEKA 3GCVA 3P1AA 3IQ7A 5I4NA 3BYVA 2F4JA 3ZLWA 1OKWA 4IHPA 2JAMA 4IXPA 5KMJA 4F1MA 5BQ0A 2A98A 4W4WA 5E1SA 5H8GA 5LMAA 4HVIA 3DGKA 3OZ6A 3AT4A 4Z3VA 5LMBA 3W0NA 3MN3A 3PUFC 3VBWA 4IW0A 2FSTX 3BI6A 3COIA 3FYKX 4XNEA 5CY3A 3U51A 2GQGA 4BDAA 2PY3A 2QOCA 1YW2A 2YFXA 4FNYA 3QZHA 3GOKA 4LGHA 4DCEA 5I9YA 4WUNA 4TYHA 1NW1A 5ANIA 3QZGA 5KBRA 4S34A 1GY3A 1E1XA 2HY81 2I0HA 1Q3DA 2O0UA 3A7GA 2Y9QA 3FL5A 3ET7A 1LUFA 3EZVA 4KKGA 5A4EA 1PXMA 2QOKA 5CQUA 3SXRA 4AUAA 4E6AA 2GTMA 4RWKA 4E4NA 2BMCA 5HE2A 3O0GA 2ZDUA 4GK3A 5EM6A 5FEDA 2XA4A 4NM5A 4QMVA 3VNTA 4BFMA 1ZY5A 2NPQA 3BELA 3E7OA 1Y91A 5J1VA 1O6YA 2R9SA 3QYZA 2ESMA 4FKIA 2OFUA 3SQQA 3VHEA 3U55A 5M06A 1PW2A 3NUUA 3V01A 3VF8A 4HZSA 1NVQA 3L9NA 4AE9A 2XCHA 3A7JA 1FVRA 5J8IA 3R7OA 4EZ5A 3PE2A 3WZEA 4KWPA 5HG9A 4M67A 4GK4A 2HZ4A 3H9FA 4GL9A 5LVMA 4UALA 4J71A 4HOKA 3UIBA 3VUIA 3RNYA 4X6QC 3PIYA 5CLPA 5D12A 3PVBA 4EOQA 2OJIA 3E8NA 4PF4A 2R3RA 2ETKA 4FNZA 3DAEA 3PVWA 3WI6A 4RJ4A 4HVSA 2I6LA 2WKMA 4M14A 3ZC6A 5IF1A 4H05A 1TKIA 5AP6A 2E2BA 3FMHA 5DOSA 3VVHA 2C4GA 2QHMA 4FK3A 4MBJA 4AZEA 3KVWA 3LCDA 3FHRA 3LJ2A 3C1XA 3UMWA 5FUTA 3FLZA 3OW3A 5FQDC 4LGDA 4OW8A 1KE5A 3ZBXA 4GUEA 3C4EA 1M14A 4GFOA 3CXWA 3WYXA 4DHZA 4N6YA 5EYCA 5JGAA 4F0GA 4X2KA 3R7UA 4C7TA 3FI8A 1ZLTA 2QR8A 4NL0A 4G34A 3BV3A 2CGXA 5AM7A 2X2MA 5EQYA 4PNIA 3OWJA 4W9WA 2ITWA 4BL1A 3R01A 3UJGA 4FMQA 3IOPA 4FZDB 2WGJA 4DF3A 2XJ0A 3C7QA 2WMAA 4A9TA 2BKKA 4UXLA 4D58A 3WIGA 3QZFA 1GNGA 4BJJB 5T3QA 4M15A 4NYEA 2FO0A 4FYNA 3WE8A 2XJ1A 4PWNA 3ORLA 5LXMA 5AUZA 3A4PA 1M7NA 5DGZA 5KX8A 3QTIA 4TYEA 3RAKA 4FEQA 2X9EA 4QYGA 4E6DA 4ORKA 1OITA 2JKKA 2XEZA 2BRMA 3G5DA 4RPVA 3UIXA 5K0XA 2VWIA 3GT8A 3NAXA 3EQBA 3ACJA 4A9YA 4R8QA 2EU9A 4MXAA 4BJJA 2ITTA 5BYZA 4MH7A 3VN9A 3TMOA 4GT5A 3WILA 4E8AA 3UOKA 3BLQA 4KA3A 2RSVA 2C5XA 3VJNA 2F2CB 4IVCA 4XV1A 3UVRA 1IEPA 1W84A 3ORMA 2PMLX 3KMWA 1OIUA 4QMLA 3Q60A 2W9ZB 3M11A 4AZWA 4E5WA 2Z02A 2OJJA 1PXNA 4ZSGA 2CN5A 4MNFA 3P9JA 4WA9A 5IZFA 4RC4A 4F0FA 4PNKA 4IAYA 2XUUA 3SRVB 3TL8A 5AUTA 2B9JA 4OTHA 2WTJA 3EYHA 4AT5A 2OSCA 3G15A 3CSVA 4U3ZA 1ZXEA 4FIGA 3QRKA 4BICA 3UQCA 1OL6A 4UYAA 3OOGA 4CZTA 4XV2A 1XKKA 2WFYA 3KA0A 4Y5QA 3JYAA 4UWCA 2R4BA 4M66A 3AG9A 1WFCA 5AP3A 4AN9A 3I81A 4ZIMA 1PKDA 1PMVA 3ORIA 3Q4TA 4O1OA 4WD5A 3K3JA 3SRVA 4ALUA 5HX6A 4V04A 3CLYA 4KNBA 5ETCA 2UW6A 2V5QA 4O7VA 4NCTC 1ZYCA 3FL4A 3COMA 3ITZA 2OXXA 3G9NA 5CT0A 3L1SA 2CNVA 1GZKA 3ROYA 4AT4A 5LMKC 2FH9A 4F9BA 4XRJA 4AW2A 3V04A 4C3RA 3IECA 2ZB0A 4YMJA 3TTJA 3UZPA 2VTNA 3R8UA 1CKIA 3ATSA 4C37A 4PY1A 2O8YA 4TYIA 4DA5A 5BVDA 5FD2A 3ORZA 2B9IA 4DG0E 2YEXA 3RM6A 4YR8A 5CAPA 1IAHA 3Q4ZA 1OBGA 3WF7A 5FXRA 1I09A 4BKJA 4TTHB 2WMTA 5FDXA 3LXLA 5AJQA 4E7WA 1KWPA 1M2QA 3E88A 3B8QA 5T68A 5CXZA 4QDEA 1YI3A 3HKOA 4JIKA 4NM0A 4RIYA 2QONA 4PMMA 5DEWA 3FQEA 4EEVA 4E20A 5EW9A 5EDRA 1H08A 4RFZA 1H24A 3QRTA 2ZM3A 3ML1A 5AMNA 3CTHA 1YOLA 2HXLA 2G15A 2GPHA 2UW7A 1M2PA 5AP5A 5TE0A 1NT2A 3DY7A 2UVZA 5DT3A 4RT7A 3ZSGA 2UZTA 2AC5A 3AC1A 4FJVA 4MD7E 1IG1A 5TR6A 3ZM9A 2UZVA 3CTQA 1TZDA 4CNHA 4CZYB 4MXOA 4D55A 3EMGA 2XKCA 4O7WA 2UUEA 4AXCA 3PZEA 3OXIA 3R83A 4V0GB 4FTCA 1XH5A 3Q9ZA 4OR5A 3U54A 2B52A 2VTIA 2X7FA 3QGYA 3QTXA 4KS7A 4EK5A 1P4FA 2BFXA 3S2PA 4KBCA 3WARA 4GJ3A 4YNOA 4J1RA 2J0KA 1Y57A 2BZJA 4ZEGA 3P79A 2Z60A 4NIFB 5IDNA 4CYJA 2BALA 3BU6A 3TI1A 5JFSA 3F61A 2Z7LA 3QGWA 3R7VA 3F7WA 5IQHA 3R73A 1U5RA 1YXUA 2VTHA 4V0GA 2VTSA 4LFIA 4EC9A 5CSXA 1Q3WA 3QRIA 3QQFA 1A48A 1YHWA 1UU7A 1GIIA 3LIJA 4C4JA 3EQGA 3LM0A 3BHYA 3NNWA 2PSQA 4RWLA 4C57A 4E93A 5KMKA 3FPQA 3UZRA 2JBOA 4O2PA 2ITXA 3WBLA 1PXLA 4JOAA 2XNEA 4EOIA 1YOJA 4MBLA 2HZIA 2UW3A 4USEA 2BPMA 3BU3A 3KK9A 4X3JA 2VWWA 1VZOA 5IMXA 3K54A 3VW6A 1P14A 2KTYA 2VWXA 4XG7A 1ZY4A 3UOJA 3ZYAA 1CM8A 1MQ4A 2AC3A 3C4FA 4UMRA 1H8FA 4QNYA 1I44A 2ETMA 3PLSA 4QMZA 4QMQA 2F7EE 3FZSA 3AXWA 4I22A 1WBPA 5AV4A 2J4ZA 3QCQA 4NEUA 4J98A 5CEOA 5EM5A 1WMKA 2PMNX 3FLNC 3BYUA 2R3PA 3CKWA 1F5QA 3AOXA 3PFQA 5HHWA 4JAJA 4AS0A 3LKMA 5F95A 3TDWA 4FV9A 3BL7A 4XBRA 1YVJA 2ZYBA 3LCSA 4XLVA 3RPSA 4BDKA 4J96A 5L8KA 2WB8A 4Y72A 1KUTA 4O82A 4IACA 4UMTA 2J90A 1KOAA 1ZRZA 1PRYA 4M12A 4XJ0A 2ZMCA 4FSNA 5C8NA 4FKPA 4LDTA 4L6QA 4I6FA 4C8BA 4BDIA 2J7TA 1AQ1A 4MBIA 4N57A 3E87A 1PXOA 5AUYA 4YC3A 1WBTA 5HVJA 3PZHA 2GSFA 3KB7A 3QF9A 3C4XA 1H26A 3SG9A 3FXWA 2ERZE 5AR5A 4OGRA 2W5AA 3VS1A 4IJPA 3D83A 2B53A 4O84A 3F82A 3KF7A 4IZAA 2W1DA 4USDA 5AR3A 5L2WA 5K5XA 5C03A 2FUMA 3EWHA 1B39A 1OZ1A 3BRBA 2YDKA 3IW5A 4D2SA 5FM2A 2ZV2A 4WKQA 4JDHA 4LL0A 4BDGA 3GCUA 2X7OA 2A4LA 3W10A 4DG3E 5CU6A 3D7TA 4F63A 2BIYA 5L8LA 2YCSA 4FZAB 3HAVA 3PRFA 4X21A 1U4DA 3Q9YA 2W4KA 3NWWA 3ZFMA 2CGUA 3QA0A 1YDTE 1QPDA 4CTCA 1H25A 2YERA 2OO8X 5E8YA 3VS2A 4JQEA 1Z57A 5M57A 2CKEA 4K11A 1R0PA 1OIRA 2SRCA 4FKLA 4I23A 4BCQA 3ID6C 3TUCA 3CD8A 4BF2A 2G2FA 1DS5A 4MWHA 5CXHA 5EYKA 4GS6A 4HGSA 2WTIA 2FVDA 5HO6A 3VRYA 2GHMA 3LHJA 4G3DA 4JI9A 4LOPA 3CQEA 4GU6A 4M13A 2GDOA 3SX9A 4AZVA 2O64A 3V5TA 4OAVB 4HCTA 1OIYA 3O50A 5E90A 3FEGA 1VEBA 1OL1A 2YCRA 3RHKA 3MIAA 4CV8A 4D4RA 4JRNA 3ROCA 4MAOA 3RWPA 5I3OA 3ZS5A 2GMXA 4JX3A 4AA5A 4RLKA 3U6HA 4GKIA 2JDSA 3FLYA 3GU7A 3Q3BA 2WNTA 4B0GA 4Z7HA 4M69A 4O0XA 5K9IA 5C01A 1JWHA 2W7XA 3RK7A 3ZSIA 4D28A 5K4IA 4DHIB 4XOZA 1RQQA 4NWMA 5CI7A 3FJQE 3GCSA 4J53A 4GIHA 3MFUA 4EJ7A 3NW7A 4ANLA 2ZM4A 3SG8A 4QPMA 4EK4A 4QP8A 4R6VA 3II5A 5AR4A 3C9WA 4G3FA 2BDJA 4XG9A 4YJUA 3AC2A 4BI0A 3Q6UA 2C30A 4B8MA 3RK5A 1ST0A 3E3BX 2EXEA 5BVKA 4R3RA 4H3BA 2QCSA 4ONAA 3PPZA 5CNNA 4C02A 5JK3A 3S3IA 4NW5A 3D5UA 2XIRA 4UV0A 3K3IA 5HG7A 3TJDA 3JS2A 4TL0A 5BYYA 5IUHA 4FKRA 4L53A 5EKOA 1Q8ZA 1SVHA 5A4LA 3BHHA 3IDBA 4OTQA 4AZSA 3BEGA 4YZMA 1ZYDA 1KE9A 4CMUA 3W0PA 2JFMA 1SNUA 4R1VA 3PY3A 4I20A 4C3PA 2DYLA 3V6RA 1V1KA 4R7IA 2AYPA 5CAOA 2PZ5A 4P7EA 1U54B 3BLHA 1ZZ2A 4W4XA 5AP7A 5I9WA 5I5ZA 4QMYA 4EQUA 5GJDA 1R3CA 2ERKA 2XYNA 1H1RA 4L43A 4MD8E 3MA6A 3P86A 2PWLA 2BAKA 3KF4A 3QQUA 2WTKB 4FIFA 4HGTA 4II5A 4MQ2A 4UWBA 5TKDA 3VWAA 2Y4IB 3OG7A 2BVAA 4ERKA 4F6WA 2PUUA 3GFWA 2PMIA 3P4KA 4BRXA 2W96B 4CLIA 3P7CA 3T8OA 2VTJA 3NUPA 4ANQA 2Y0AA 2BROA 2R3JA 4EOLA 5IA3A 2GS6A 1WBWA 2XBAA 4CQEA 3FMDA 5M4IA 3UP2A 5BVEA 3F5UA 2IW9A 1PKGA 4I6QA 1YXSA 4IZ5A 4FUXA 4ZZMA 2PK9A 1W7HA 2P3GX 4FK6A 4YZCA 3BCEA 2BDFA 3DBCA 4RMZA 3VS3A 1J91A 3FI2A 3SKCA 4YJQA 2E9OA 5EK7A 5LJJA 4O0RA 4RC3A 2F9GA 4CCBA 4EH2A 3M42A 3OWKA 3ZO3A 3MH2A 3NNVA 3POZA 4AOIA 4DGMA 5KMIA 4EI4A 4E3CA 4O1PA 5CSVA 5CVHA 1JKTA 3H9OA 4DAWA 4UBAA 4ZK5A 1RDQE 3R1QA 3W32A 5FXSA 4YGAA 4RWJA 4B99A 3LMIA 2I0EA 4DG2E 2PZIA 4JG7A 3MPAA 2JIIA 5EM8A 2HCKA 5EOBA 2XM9A 1U46A 2YWPA 2QG7A 4EJNA 3KXNA 3LJ0A 4F70A 5AFVA 4QMOA 2JKMA 2OXDA 3QXOA 5DR9A 4ZTNA 5BYLA 3O5AA 3AMYA 4QP2A 4FVPA 4N70A 4RC2A 2J50A 3QXPA 4ZY6A 4IWOA 3FXXA 4NFMA 4PRJA 3FKLA 4XV9A 1TQIA 3PPKA 3WZJA 3N4VA 1YWVA 3P0MA 4ZTRA 2CNQA 2IZUA 3BKBA 4G2FA 1OVEA 3ORKA 5I9ZA 4A4OA 4EONA 5LVOA 4U8ZA 4I6LA 2VX1A 3NFFB 4O7LA 5BV3A 3HMOA 4BCNA 5JFVA 4QEBA 2VU3A 3C51A 4PV0A 3QYWA 1YHSA 4APPA 4DGGA 3R9RA 2R3KA 3UPZA 2CGVA 5DMZA 2JD5A 3GUBA 3PWDA 3ZFYA 3QUDA 4D2VA 4D4VA 4DT9A 2UZEA 3JY9A 4ZTHA 3TT0A 4JAIA 3DT1A 4EKLA 1XBCA 4JIAA 3ZDUA 4ZS4A 4FSQA 5BPYA 3WF9A 2OI4X 2NNWB 4I5MA 2R7BA 4FVQA 2VUWA 1SMHA 4BN1A 1DI9A 2B55A 3I79A 4FIJA 4FSMA 4P2KA 4DH8A 4HCVA 3RAHA 4AX8A 2G01A 2ITPA 1EH4A 2C6TA 2WPAA 2WMQA 3T9IA 4QMSA 2WU7A 2Y6OA 4GEOA 5LVPA 4K9YA 4CFUA 4DFBA 3KQ7A 3W0OA 4U41A 4WG3A 2ACXA 4Y8DA 2R2PA 3HV4A 2HXQA 1WVYA 2X2LA 4R1YA 4G6OA 2WOTA 5ETFA 1UU9A 4JLCA 4HYHA 2ITUA 2YDIA 3I0QA 4RA4A 4KRDA 4CRLA 3CCNA 5KUPA 4O7RA 3QKMA 1G8AA 5GIPE 2C6LA 3AC3A 4O7SA 2GNFA 4I5CA 5J95A 2OIQA 3CQUA 1KE8A 3MVJA 4CFXA 2OGVA 3R21A 4FTRA 5BUIA 1FGIA 5AUXA 3FWQA 2GHGA 3AGLA 3NLBA 3OXTA 4ZOGA 4UMPA 5AR2A 3RAIA 3CY3A 5HVYA 3W8LA 4AN3A 2I0VA 2RFNA 1YI4A 3GNIB 3QALE 5DPVA 4R77A 1ZYSA 4IB0A 2R5TA 4F7NA 4XS2A 1G8JA 2W5BA 1OUKA 3DFCB 1BX6A 3L8VA 5I9UA 3WYYA 2QHNA 2W1CA 3DBQA 4RVLA 3HV7A 3COKA 3R30A 2GS7A 2XRWA 4YZ9A 2W1IA 5EYDA 5CU4A 4AZTA 3HP5A 3MTFA 3UOHA 2R64A 3MVHA 3E62A 4IAZA 2IVVA 5IQCA 2C6KA 3R0TA 3AD4A 3OCGA 3BQRA 4L46A 5M4UA 3UDBA 3Q9WA 1HCKA 4FKQA 2WQMA 4TY1A 2F57A 4CKJA 3ORPA 5CAUA 4XH6A 4CYIA 3D14A 5D11A 4MUQA 3UO6A 2Q0BA 4O0TA 5A4TA 2QOOA 5FG8A 4FL2A 4FIIA 1R1WA 4GYIA 4LYNA 4DDGA 4AXAA 3BGQA 2X6EA 3QQHA 2IO6A 4HZRA 4JNWA 4K2RA 4OTDA 3UIMA 3ZRLA 4EH8A 3AD5A 4AW5A 4FG7A 3RCDA 1OBDA 1FVTA 4W9XA 4YZDA 4GFGA 1WZYA 5J87A 5AAGA 4ZSLA 2RFDA 2NYAA 3KIOC 3E93A 1QPEA 2H8HA 1QMZA 4OLIA 4BC6A 4PDSA 4FZ7A 3WF8A 3EKNA 3EQCA 2ITOA 1KV1A 4FV0A 4UEUA 3CP9A 5IA4A 3D5WA 4GVJA 3LQ8A 3R7IA 1H00A 2YAAA 3ANRA 1VYWA 4UXQA 4LOOA 3UVQA 5HIEA 3DZQA 4C38A 5M4FA 3QQJA 3SOCA 3LCTA 3LFFA 3P23A 5HE1A 3PJ8A 2UW8A 3RINA 4BDFA 4BI1A 3DFAA 5HIDA 4FNXA 3QTUA 4IFCA 4XCUA 4ZMEA 2PZRA 4O83A 2PVRA 3RI1A 4X3FA 2YDJA 2VTRA 3CC6A 3Q53A 2IF8A 3OBJA 2WQBA 5AV3A 3DXPA 4S31A 2BRGA 1SVGA 4CLJA 4DEHA 2EXCX 3LFDA 5AP4A 4HCUA 3F69A 4J8NA 3R9OA 2X0QA 2WHBA 4H3PA 5CEMA 5DRBA 3HAMA 1Z9XA 3DDQA 3G2FA 4Z9LA 5HO8A 5KZIA 4F9YA 2Y6MA 3S95A 2GCDA 3RPYA 2C3JA 3D4QA 4R7BA 4BDHA 3DB6A 1HCLA 3R2BA 2XK7A 3W18A 3C0HA 2HW6A 4GKHA 3OCBA 3QKLA 2DWBA 3EZRA 4FTAA 4YP8A 3RZBA 5CU0A 4RFYA 3DK6A 4PQNA 3R8ZA 5CEIA 3MWUA 3NDMA 4B6LA 3TJCA 3DKCA 4I1ZA 4N0SA 1H4LA 4PUZA 3ULIA 4FEWA 1JOWB 4C34A 2X0PA 5IQIA 3T3VA 3GU4A 5IG1A 2WEVA 5FM3A 5IH6A 3F88A 2GTNA 4YJVA 5J9ZA 3DXQA 3PY1A 3UNKA 3R63A 4TNDA 3GXLA 2UVXA 2JGZA 2V22A 2IZSA 2UV2A 3L9PA 4TT7A 2PUNA 4IX3A 3FKNA 3W1FA 4ANMA 5IEVA 3SA0A 4ENYA 4ZTLA 2WQNA 3FC2A 3I0OA 1W8CA 4IAAA 4O0WA 4L67A 4Y73A 5JFXA 2DQ7X 4AFEA 5EW3A 1FBNA 4ACMA 2FSLX 3DAKA 4JBVA 5CENA 3TCPA 3TIZA 5FTQA 5HCZA 4K8AA 3VUMA 5HU3A 3QC4A 3NYVA 4NJ3A 5H8BA 4CMOA 2PVFA 4PL5A 5ACBC 3GU6A 1GOLA 2VTQA 3PIZA 4MF1A 5M56A 5C4KA 4BDDA 4BGQA 3AC4A 3OS3A 3EB0A 2XNOA 2CLQA 1U59A 3HECA 1ND4A 4YNEA 4G6NA 4BCFA 4ZP5A 4QMUA 2X81A 4P5ZA 4U3YA 3JVRA 3VUTA 3D9VA 1V0BA 5HCXA 4PL3A 3SVVA 3ZXZA 3G0EA 5AV2A 1OKZA 2WMBA 2YM6A 4AE6A 2HIWA 3SGCA 2XIKA 3RP9A 3VBVA 3MESA 4WBBB 5HORA 2IZTA 3O17A 5LARA 3UOLA 4ALWA 2QU6A 3FLSA 4YO6A 4DE4A 3UDTA 4BCPA 3V6SA 1G5SA 3FHIA 2C3KA 3D5VA 4FZFB 2OJ9A 3CD3A 4B4LA 2A0CX 2CLXA 5L2IA 1G3NA 1XR1A 4CSVA 2C47A 4L8MA 4X3FC 4FV6A 3GCQA 3A7IA 1JVPP 4I4FA 2PU8A 3R8MA 5C27A 3LVPA 1YOMA 2JIVA 1VR2A 2BTRA 2C6MA 2EXMA 2J0IA 2ZVAA 3IOKA 5D1JA 1BI7A 3KMUA 3QCSA 4BTFA 3JPVA 3GVUA 4DCAA 3LAUA 4BCJA 4E5AX 4O6EA 3SLSA 1GZ8A 1NVSA 3KCFA 4L00A 4MK0A 1FOTA 4FIHA 4GFMA 4PMPA 3R8PA 3NUAA 5IPJA 4UZDA 2X0OA 4JG6A 3LMGA 3LFEA 5KKRC 3BGPA 2O2UA 2XKFA 3GOPA 2OH4A 4FEXA 4MEDA 5HOAA 4ANSA 4DFYA 3A62A 4ACGA 4CFNA 5KCVA 3POOA 2YIQA 3DLSA 2X8EA 5K3YA 5BVWA 4CFWA 4Z16A 4I4EA 3DCVA 4QMNA 3UGCA 4FKJA 3VS4A 1X8BA 4IEBA 3ODZX 4QMWA 5ANJA 3FE3A 1PXIA 2BZHB 4BWPA 4QDVA 5HQ0A 1YXVA 2IW8A 1ZWSA 2C3LA 3PE1A 4PTEA 4DGNA 3LFBA 2XALA 4JDIA 3KULB 3ODYX 3CIKA 3FUPA 4KSPA 2IJMA 4XG6A 2CKQA 5A46A 3DPKA 4KIQA 3R2YA 2VD5A 3PSDA 3HP2A 3FC1X 3I7BA 2BRBA 4NH1A 4PDYA 5I9XA 4A4XA 2XARA 3R9HA 3FI4A 1H01A 4GG5A 2P0CA 2RF9A 4XMOA 2HELA 1OIQA 4C4HA 2FGIA 4YJRA 4WG4A 4FBXA 1PXPA 1WBSA 3GP0A 4O27B 2XK4A 3PUPA 3KULA 4S30A 4V01A 4C61A 3DZOA 4FI1A 3HRBA 4FSZA 2Y7JA 2JKOA 4H39A 3VF9A 3O71A 3B2TA 1NVRA 4BYJA 4WRGA 5EI2A 5DVRA 3E7VA 2VTPA 3F2RA 2JLDA 5C8MA 2XS0A 5IH4A 2R3OA 3TKIA 1ZZLA 1R0EA 3THBA 2G2IA 2CNUA 4X6RA 4DEEA 3LLTA 3R00A 4Q9SA 2HZNA 5CQWA 3MY1A 2UZDA 5FEEA 3RCJA 1TFFA 1OUYA 4X7QA 5DT4A 4AXEA 4K33A 2HW7A 5EFQA 3V5JA 3BYOA 3SXFA 3HUBA 4AP7A 4H36A 1BL7A 4EOOA 2VGPA 3D0EA 2PMOX 4AZFA 2GQSA 5HE0A 3CPCA 4RX7A 4O6LA 4U42A 5EQPA 3FMMA 2QOIA 3ORXA 3VQHA 3R1YA 4FT5A 5JFWA 5L6PA 3TYKA 3W0MA 1YWNA 3ALOA 3ELJA 1OPLA 3CJFA 4FL1A 2B1PA 1ZYLA 4ASEA 3SW7A 3O8UA 4FKVA 4XHKB 3FZTA 3HMNA 4YHJA 5DHJA 5EHLA 4BKZA 4HVHA 1AGWA 4FUYA 2OF4A 2J0MB 5G6VA 3UQFA 4MWIA 4WNPA 3GI3A 4G9CA 2X1NA 3GU8A 1P4OA 2WMUA 4IB3A 5AR8A 2J0JA 4FEUA 5CSHA 3PXQA 3ATTA 2NO3A 4IIRA 4LG4A 3NUSA 4IZYA 4LUEA 4FODA 3ZXTA 2W1ZA 3BQCA 3EFJA 3BHVA 4FGBA 3WF6A 4LM5A 3F3UA 3VIDA 4FKUA 4AGUA 5IMEA 4DT8A 2F7ZE 2C5VA 4YHTA 4OTIA 4BTKA 2QLQA 3QHWA 4GJ2A 1UU8A 4CKIA 3F3WA 5D7VA 2HOGA 3Q4UA 4EHZA 1Z5MA 3OEFX 5A6NA 3R8LA 3Q52A 3F9NA 4IX5A 5BUJA 3IW6A 3NIZA 2RL5A 1YHVA 4P5QA 4XBUA 2XMYA 5CX9A 4FZ6A 2R3FA 4G5JA 4BR3A 2YZAA 3BYSA 4EH6A 3P08A 2WAJA 3MGYA 4WSQA 4BZNA 4DTAA 5E8VA