3DTWA

Crystal structure of the vegfr2 kinase domain in complex with a benzisoxazole inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
288
Chain Sequence
ERLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of amido-benzisoxazoles as potent c-Kit inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
total genus 99
structure length 288
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dtwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dtwA01
4DLJA 4AQCA 2J50A 2YIWA 1OM1A 2G15A 2I1MA 2WZJA 3ZLWA 2WTIA 2YABA 3EMGA 4IVCA 4JG6A 4CFXA 4EOSA 4CGAA 4J7BA 4XRJA 1V1KA 4FNZA 4M12A 3KREA 2PWLA 4XMOA 4FKVA 2KULA 4PX6A 3DXQA 4MXOA 5J87A 3QRUA 3NNUA 2YIXA 2W05A 3O7LB 2QONA 4EH6A 4EWQA 2Y0AA 3D4QA 4J95A 4F9YA 4R5SA 3LIJA 1OL2A 2X9FA 4WG3A 1H0VA 3ANRA 4GCJA 3AGMA 4QMLA 4KS7A 4F6UA 3S4QA 3CSVA 1W82A 4FGBA 4GV1A 2OICA 3I5NA 2IZUA 5CYIA 4E4LA 4GJ2A 4A06A 5ITAA 3PRFA 5CQWA 4HGTA 4QTAA 2HYYA 3UZTA 3ACJA 4O83A 3UZRA 3PFQA 3R9DA 2WTVA 4XS2A 2XK6A 3O96A 2VWUA 4OTPA 5DI1A 1H1PA 4PL3A 3QWKA 2OJJA 5IH4A 4EZ5A 4E4MA 4XV3A 3COIA 5J9ZA 4GKHA 2BZJA 4CSVA 4RX7A 3LFCA 3QCQA 5LJJA 4QT1A 3EHAA 4DINA 4G3FA 1WBTA 3D83A 4RIXA 1PMNA 3PVWA 3NAYA 4OTQA 2XCHA 3LCKA 4QMUA 3CQUA 3TXOA 5CANA 2W99B 3BHTA 4EBVA 3F66A 4GG5A 4EC8A 4NFNA 1JKKA 4G1WA 4DG2E 2GTMA 3BHHA 3PY0A 4UZDA 5CS6A 4CZYB 4N70A 1TVOA 4PDPA 1U59A 2V55A 1Q8TA 1WCCA 2PTKA 4NKSA 3BHVA 4RX9A 3UVPA 3Q6UA 4C4IA 4UB7A 3C0HA 3D5UA 5JFWA 4H36A 5KZ0A 5M4IA 5I0BA 1YOLA 5M55A 3G2FA 2YLEA 5DG5A 2C0IA 3BELA 3EZVA 4UALA 3MVJA 5IUGA 1OI9A 2YM5A 4L45A 5HG5A 3Q3BA 3Q9YA 5KHXA 4DAWA 4DGOA 1Q8ZA 4KBAA 2QOBA 1DAYA 3RPRA 3UIMA 5CAVA 2W4JA 4O91A 3BYOA 1OIYA 4JJRA 3MA6A 4NUSA 5L6PA 1FPUA 3EL8A 1TQMA 5FUTA 4WBBB 2XUUA 4IB1A 5E1EA 4KRDA 3D5VA 4QP3A 3JY9A 3QTSA 4EUUA 1KV2A 2VO6A 4KAOA 3SRVA 3FKOA 4AX8A 2CHLA 2WTJA 5IA2A 5L2TA 4LOQA 3UMWA 1ERKA 2QO9A 1YDSE 4NZWB 2B9IA 3MIYA 5DBXA 4QMPA 4EOLA 2J2IB 4IWPA 1BI7A 3NS9A 1AD5A 3QUEA 2H96A 4KSPA 1PXOA 4MHAA 3FLSA 2ITNA 4RJ5A 4IJ9A 1H27A 5ACBC 4M69B 4OR5A 5C01A 4AGUA 5FP6A 4R3PA 4JOAA 4PMSA 3HGKA 4ITJA 4TYHB 5FDXA 2FH9A 2FYSA 2V7OA 4XG7A 5LMBA 5C8NA 5C26A 5C8MA 3B8RA 4MQ1A 3PA4A 5BX0A 1WZYA 3F69A 5AV1A 2VWXA 5E91A 5T68A 5I9ZA 3C0GA 4M84A 2ESMA 3LFNA 4RJ6A 4FZ7A 2RFSA 5EM6A 2VWWA 1OL7A 5EYCA 3R63A 2GQRA 3PIYA 2QI8A 5HNGA 3HUBA 3IECA 3VUDA 5BYLA 4D4RA 4LGGA 2OLCA 2VZ6A 3I7BA 4QYEA 3OWLA 3POOA 3BHYA 5EYDA 1TQIA 5TKDA 3COHA 3TTIA 3GI3A 4DBXA 1OITA 4K18A 4BCIA 5DR2A 3TV7A 4EH5A 1YXSA 3HV5A 4FV6A 1M2RA 2VTRA 2VUWA 3C4EA 3CIKA 2JEDA 3G9NA 4FV7A 4L01A 3SHEA 2XNGA 2O5KA 3H9OA 4MXZA 4GSBA 3H4JA 2PVMA 4UMRA 2OKRA 4DH1A 1YRPA 2QHMA 3OEFX 2XJ1A 3HRCA 3LXLA 3AC1A 1OKVA 3A61A 3OW3A 3A7JA 3FKNA 2J7TA 5EDQA 2V7AA 4O21A 3SQQA 3DTCA 4AZWA 5LVLA 5L8KA 3POZA 3CTJA 4F1TA 3TT0A 3VIDA 5J8IA 3ORPA 3QXPA 4EH2A 4F6SA 3EIDA 4R5YA 4JT3A 4IIRA 5JFVA 3H30A 5IQFA 4QNYA 5GNKA 5IA4A 4YLJA 2QC6A 2H34A 4ZTNA 3O50A 3RI1A 3UO4A 4RVMA 2I40A 3CD8A 4NM0A 3C4ZA 4FNXA 4D55A 2GNFA 3E63A 4OGRA 1P4FA 3DDPA 3DBFA 2UV2A 3G6HA 5HG9A 4YZDA 3ZMMA 3FSKA 4CLIA 4DTBA 1OGUA 3SXFA 1L8TA 5HTIA 3FMNA 4C59A 1JBPE 2ZB1A 4ZP5A 1GAGA 2ZDUA 4Z9LA 3LMHA 3KFAA 3OBGA 4GFMA 3MV5A 4C0TA 3QWJA 2R3NA 5G6VA 5FM3A 2F7EE 5HE3A 3PDTA 4EOIA 5BVKA 3BYVA 3JY0A 4KKEA 4ZSGA 3ZS5A 1JNKA 3GOKA 3W2PA 3VS5A 3PJ1A 2GNGA 4KBCA 1URWA 3BYUA 3TZ9A 4RIWB 4C36A 4ZY6A 4DEBA 5DR9A 2B9HA 4YNEA 2QODA 3LFQA 4UWCA 1IAHA 4O7YA 2W5HA 4E6DA 4BCFA 1XQZA 4W8DA 4G3CA 4EEVA 4DEEA 1VZOA 5CVGA 2KTYA 4O96A 1OL5A 3P86A 5DOSA 1KE5A 4XP3A 5D9HA 3FYJX 4I5PA 4C4JA 1YWNA 3K5UA 5IQAA 3CCNA 3SC1A 4FIFA 2CKEA 3A4OX 4P5QA 4DN5A 2I0HA 2VRXA 3ZO3A 4ZZOA 4KWPA 3TCPA 2JIIA 4YMJA 3BQRA 5I3OA 5HU3A 1ZWSA 2P2HA 5E8UA 4QTBA 5HX8A 4YGAA 2BRBA 2QOIA 2Z7LA 4J96A 3P1AA 4OTDA 5CQUA 2J0MB 5E1SA 2W9ZB 2OJGA 3PY3A 3KC3A 1JKSA 3UOLA 4BICA 3RINA 2QURA 2O63A 3PWDA 4FE2A 1SVEA 5F1ZA 5M4FA 2AUHA 1YDRE 2E9OA 2ZV7A 4Y8DA 3TUBA 4QYHA 3AQVA 2YJSA 1E9HA 4L7FA 3D2KA 4Q9SA 4U41A 3P78A 4F0GA 3OMVA 3KXXA 3PJ3A 4HYIA 4B0GA 3TDWA 3ANQA 2QLUA 3ORZA 2HK5A 4XV1A 5IQEA 1NW1A 4A7CA 3BQCA 3G0FA 5CT7A 4BBFA 3FMKA 5HCZA 4BDBA 3HVCA 5L6OA 3Q32A 1Z9XA 3WBLA 4MD9E 2Z2WA 4I1ZA 4V04A 2PZYA 5LVMA 4M14A 2Y6MA 5AM6A 4LGDA 3PSBA 4RA5A 4XEYA 1YI3A 2HZNA 3VUTA 5M06A 4BN1A 4HVIA 4M68A 2R3FA 2C6DA 4I5MA 5CU2A 3TNQB 4ASEA 2OXDA 3DDQA 3E7VA 4HVGA 3KK9A 5IQBA 2GQSA 3SLSA 4GG7A 4D5HA 4X6RA 4UMUA 3GCPA 4XP2A 5AUWA 5BVFA 2ITVA 3ATTA 3R83A 3BYSA 3QALE 4I24A 4OBQA 4PP9A 1LUFA 5AA9A 4UXLA 2XKEA 3PPKA 4NW6A 1WBOA 2J51A 2YIQA 1ZLTA 3NZ0A 3VBWA 5BVDA 4WO5A 4YC3A 5JQ5A 4ZEGA 2BKKA 2HZ4A 4DT9A 2BTSA 2HW7A 3RHXA 3FEGA 3EFJA 3H10A 3O17A 1BMKA 1XBCA 4FZDB 4IWOA 1R0PA 3BLQA 5DGZA 4WG4A 4FIJA 3P7CA 3VRYA 3R1QA 2XJ2A 3W2CA 2FUMA 3DY7A 3KXMA 5EM8A 5FWKK 4PRJA 3CXWA 3FKLA 2WB8A 5F20A 1E1VA 2IPXA 2WEVA 4FGRA 5AR2A 4FEVA 3R7OA 3WF7A 4JX3A 2QOKA 3BE2A 4FV0A 3KVWA 1PYEA 4FYOA 2ITYA 5LCJA 3I0QA 5AAEA 3GXLA 3DPKA 4EOMA 1B39A 4D2TA 1CSNA 3W16A 2J0JA 4Y46A 5F4NA 2GNHA 3FAAA 5KBQA 3GU4A 4JQEA 3LXNA 5KE0A 4E4XA 5KCVA 5AFVA 3CY3A 4NT4A 2WGJA 3RPYA 1WAKA 3O0GA 4IVBA 4MKCA 4P5ZA 2OIQA 3E3PA 3IS5A 5JQ8A 4YZ9A 1L3RE 2WTWA 2E9UA 3GC0A 3SX9A 1UU3A 3DK3A 4JBVA 4AFEA 3GU7A 2J9MA 3EN6A 2C6TA 3L9PA 5JFSA 1BX6A 2CCHA 3FLWA 4FTAA 3L9LA 3AC4A 1H1RA 4JG7A 5TF9A 2W1EA 4F63A 4ZJVA 2PULA 3TN8A 1OZ1A 2R5TA 3TIZA 3UYSA 4KA3A 5FXSA 1OKZA 3OCBA 2CGUA 3II5A 5A6OA 3R1SA 4IAFA 4QPSA 3BIZA 2VO7A 1PKGA 4B9DA 3N4VA 3FLYA 4DFUA 4LI5A 2ERZE 3QTXA 3R7IA 4DF3A 3NYNA 1BLXA 3FXXA 4TWOA 4FICA 1SM2A 4CYJA 2CNUA 1ZMVA 2Z8CA 5AAGA 5AM7A 3R21A 3ZC5A 4AGDA 4DH5A 2BFYA 3DJ6A 3EKKA 3OTVA 1Y6AA 4IM2A 5HGIA 4IMYA 1J91A 3WIKA 4A9RA 4NYEA 3DAKA 4ZSEA 4O0VA 4G6NA 1YKRA 4DCEA 4H05A 3IW8A 1JPAA 4BGHA 4O86A 3DKOA 3TUDA 3GU6A 4FYNA 3TV6A 3IDCA 4M8TA 3UNKA 5HVKA 2QR7A 2C69A 2X2MA 4WRSA 4FKJA 5DWRA 5AA8A 4Y73A 3UDBA 3H0ZA 3K3JA 4FG9A 3TNHA 2CKQA 1ATPE 1W0XC 2G2IA 3E8DA 2BRNA 1ZZLA 3PUPA 2X9EA 4O1PA 1OKYA 2AC3A 3F5GA 4U43A 3ORXA 5C27A 1JKLA 3QGYA 4ZSJA 5ANDA 4JBPA 5LVOA 4D1ZA 4JQ7A 1BL6A 2UZEA 3GQLA 5E90A 3VJOA 4FZFB 4ERKA 3QRKA 4IM3A 3UOJA 3NGAA 4UWYA 4ONAA 4HVSA 3FZRA 3GCSA 2VTPA 5C1QB 3PXKA 2CLXA 1ZARA 3C4XA 3KXHA 4OT6A 3NEWA 2RFDA 2RL5A 2F9GA 5E8VA 2UUEA 3NSZA 4YSMA 3FZTA 5I9WA 4TY1A 3FI4A 3MVLA 2NPQA 1A48A 4GK2A 2PSQA 4CQGA 3O8TA 3QU0A 2JKOA 2VTMA 5AP2A 4ANNA 5ANOA 4ALVA 3HP5A 2UZLA 4PL4A 2W1CA 4IFGA 3R7UA 5LXMA 5ACKA 4FKWA 4O7TA 2PUNA 2OGVA 2Z7QA 4EQUA 2XMYA 4FF8A 3IOPA 4XG2A 5AV2A 3SXSA 3CGOA 3ZUTA 3R8VA 4TYGA 4C58A 2GNIA 2JIVA 4YJQA 3EQHA 3R7EA 5EFQA 2VGOA 3R04A 2IW6A 3UO6A 4AOIA 4DGNA 3TUCA 3PPZA 1LR4A 2V5QA 3OXTA 1XBAA 2XNNA 4IB5A 4KIOA 2OO8X 5AP3A 3RVGA 2PPQA 5CZHA 2VNYA 1HCLA 3GVUA 2BPMA 2PZIA 3VRZA 2X7OA 3PJ2A 4MBLA 3NCGA 2CN8A 3BRBA 4DGLC 4I0RA 3EN4A 2GNJA 5FQDC 3LCOA 2R3LA 4YJUA 4BF2A 4C7TA 1Y8GA 1Q62A 4D2RA 4UYAA 3MFRA 5I9VA 4O0TA 3R9RA 2XCKA 3W8LA 4WD5A 4EWHA 3EOCA 1OMWA 4L44A 2V0DA 3QTQA 3RAHA 4EOKA 2Y8OA 3C7QA 4C61A 4FTKA 2VWZA 4J52A 4IZYA 5A54A 2GNLA 4BGGA 4F9AA 1CDKA 1R1WA 3UG1A 3ZLSA 3DT1A 3ORNA 5CNNA 3R73A 4MK0A 4BKZA 3T9TA 4BY9E 3BU5A 3OCSA 3ZM4A 1Q8YA 2JGZA 5B2MA 2JDVA 3Q4CA 3ZO1A 4L7SA 4O2PA 3RPOA 2EXMA 4RVLA 2R3QA 5HO6A 4DFBA 5DLSA 2F2CB 3LM0A 1U4DA 3LAUA 4E93A 4E6AA 1KV1A 3HMMA 3SG8A 4G16A 2C3KA 1SVGA 4OLIA 4ZK5A 4FVQA 4LMNA 5AAFA 4FSWA 4V05A 3M11A 5F9EA 4BHZA 3FLNC 2JBOA 3QHRA 2XK9A 3BGZA 4G34A 2X6DA 3FI2A 4YO4A 4ZLYA 3U6JA 1B6CB 4WNMA 3KL8A 5LVPA 3B8QA 4MNEA 5A9UA 4GJ3A 3ULZA 4PQNA 4HPTE 3U55A 2B55A 5L8JA 3OXIA 4BCJA 4MBIA 5JN2A 3FSFA 1ZYLA 5TR6A 4GRBA 3U9CA 1Q3DA 2OF2A 4PPCA 3R8LA 4N6ZA 2GCDA 4YPDA 2QU5A 4FTLA 4ANLA 4EUTA 4RZWA 3ZCLA 5KMNA 4O82A 2WU7A 2YZLA 2PE0A 3NCZA 2PZPA 5J9YA 4MWIA 5C4LA 3I4BA 2GQGA 3ETAA 5BUJA 1J7IA 4FSUA 4RLKA 3VS3A 3MB6A 1Y91A 2DQ7X 4IACA 1XR1A 3VUGA 5IMEA 3BX5A 3TM0A 3AC3A 2WQBA 5DHJA 4HVDA 4FT0A 4ANQA 1UWHA 5AV3A 3PG3A 2J0IA 2UW8A 4U7ZA 1IAJA 3PP0A 4MAOA 3UIBA 4QYYA 1BYGA 3IDPA 2JLDA 3LFDA 4UMPA 2JC6A 3PVBA 4ACDA 5FEEA 2VTSA 4H3QA 5GZAA 3DB6A 3PJCA 3O51A 2QO2A 4AUAA 3R1YA 4CZTA 2YDIA 3DOGA 4FT5A 3SOCA 3F9NA 4EBWA 3N4UA 2CPKE 3DK6A 4IXPA 3RMFA 2Z7SA 3SW4A 4GUBA 1NVQA 4XLVA 3V01A 4BIBA 3NUSA 3EN7A 4I21A 4E73A 3KRJA 4UYNA 3KF4A 4BDHA 3W18A 5AP7A 3P7AA 4L8MA 4WNPA 3HA6A 2HENA 3FQEA 4AA5A 1BUHA 2R3MA 4G17A 3BI6A 1YHSA 3PXYA 3R8MA 4PL5A 4TN6A 4YURA 3ERKA 4M7IA 3Q9ZA 5CSVA 4EOPA 1IR3A 3KB7A 2Y9QA 4EYMA 1QCFA 3NIZA 5HVYA 4CFUA 3OP5A 5JMSA 4U44A 3O2MA 4DGMA 4V01A 3FC2A 4QP1A 4BDIA 3MDYA 5JH6A 2O65A 3P23A 2RG6A 2WMUA 4FSQA 2PUUA 4CEGA 3OROA 1OB3A 2WPAA 4JXFA 4CKJA 3LFFA 1PXPA 4FK6A 2W1ZA 5GJGA 4DFZE 5GZ8A 5GZ9A 3A8WA 3D2IA 3BKBA 3KRLA 5EHYA 3QLFA 2HAKA 5FBOA 3TWJA 2XJ0A 3F3TA 5BMMA 5AV4A 3ZFXA 1YXVA 4D2WA 2A27A 2YM7A 4QP2A 4C4EA 2YERA 4YUQA 3C50A 3H0YA 2WKMA 3H9RA 3W55A 4FOBA 5EI8A 2VAGA 2X4FA 5IUIA 3FHRA 2J4ZA 4GUEA 3ZTXA 1G8SA 2ETKA 2XZSA 3MPAA 4ZOGA 1OVEA 5ETFA 4L9IA 1PXNA 5B2KA 5KMOA 4GK4A 4U79A 5FG8A 4CVAA 4FVPA 1W84A 2EWAA 2JDOA 2YDKA 1CKIA 3D7ZA 3FC1X 3ZZWA 3U51A 4K33A 5KMKA 3BPRA 2I7QA 3VBTA 3HAVA 2YWVA 1WBVA 2UVZA 4ASDA 1B38A 5FLFA 4BWKA 3MFSA 4DEAA 1SZMA 4BI0A 3K5VA 2ETMA 3KA0A 4FV2A 2J0KA 3LMGA 3Q6WA 4XRLA 1WBWA 2ZDTA 2BDWA 3I1AA 3FJQE 3OS3A 5EHOA 3VN9A 3VF9A 2SRCA 4TWCA 1GZOA 5BYYA 3C4WA 3IW7A 5CEMA 4IHPA 2RGPA 5E8ZA 3QD3A 3FZSA 5KMLA 3EYHA 1E1XA 5M07A 3G33A 3MIAA 4DG3E 3C9WA 5C4KA 1FMKA 3GCVA 4M3QA 4BWXA 4ALUA 3C5UA 1FGKA 3KK8A 4IVDA 4D2VA 4HGSA 5BMSA 4WT6A 5CVFA 1ZMUA 4R7HA 4EC9A 1Q5KA 1WMKA 4TKSA 3HRFA 5JFXA 5HCYA 4FT7A 1GIJA 5AUZA 4TPTA 3JR1A 3WZUA 1ZY4A 2YAKA 4D58A 3GOPA 2DS1A 4FKQA 4E3CA 5FM2A 2B7AA 3F3WA 5CF4A 3A4PA 4D4VA 4YTFA 4BDCA 5L2SA 4W9WA 2O8YA 4IQ6A 2JDRA 2XF0A 2B53A 4ITHA 2BR1A 3RAWA 3WF6A 1ND4A 1F3MC 3ENMA 3QX4A 5JRQA 3A8XA 3CS9A 3ZXTA 2NRUA 4EK6A 4ZZNA 3ZM9A 3IPHA 2ONLC 2IVVA 5J5SA 3EQBA 4DEIA 3NRMA 3LXPA 4PNIA 4Y5HA 2BFXA 4JIAA 3PXZA 2XK7A 5CT0A 3UP2A 4PNKA 4FV9A 4NW5A 5HLWA 3AOXA 3E93A 2HWOA 4EK8A 4AW1A 2VNWA 1JLUE 4U0IA 1KE7A 2XRWA 4CV9A 2R0IA 2QNJA 3M1SA 4O27B 4TYEA 4O7ZA 2XIKA 4BZNA 2BRGA 2QO7A 1CKPA 5FGKA 3T9IA 3D5XA 3NAXA 4BTJA 4EJ7A 1PMVA 2OXXA 5CXHA 4FNWA 2OFVA 2R7BA 2JKQA 3BCEA 4KKHA 4M97A 4L3JA 3DLZA 4H3PA 4EK4A 3PLAE 4RT7A 4U3ZA 4L3LA 4EH8A 5IQCA 3M2WA 1PYXA 1WVXA 4FKGA 3R22A 3VNTA 5M56A 2PMLX 1PW2A 3KRXA 2LAVA 3HMIA 3QRJA 3P4KA 3IW5A 1U5QA 4OBPA 2VTQA 3W33A 4FKUA 4UMQA 3PSCA 5HQ0A 5J7BA 3DS6A 3E3BX 4JBQA 3UOHA 2RFEA 3MH2A 4YJRA 5DT0A 2X2LA 2X4ZA 1NVSA 2BAKA 4EZ3A 5HX6A 3LZBA 5KMIA 5FRIA 3QXOA 4ZSAA 4FV3A 2UVXA 5H9BA 3SXRA 3H3CA 3JS2A 1ZMWA 4UZHA 4HYHA 4BDAA 4U42A 3HECA 1ZZ2A 5IMXA 2WQEA 2OZOA 3VHEA 4FA2A 4PTEA 4C4FA 4ACMA 2XP2A 1WVWA 1PHKA 2I0VA 4CT1A 4HW7A 2C1AA 3VVHA 4F7SA 2QG7A 3KMWA 2NRYA 4V0GA 3R6XA 4RQKA 2X39A 3AC5A 3LCDA 4ZXTA 3KXGA 4R77A 2XBJA 1OPLA 4XG6A 1H01A 1J1BA 2YIRA 3D14A 5HD7A 2BRHA 2GS6A 3SDJA 1YOMA 5GJFA 2B9JA 2UW0A 4AS0A 3FPMA 4C33A 1W98A 3I0OA 4F70A 4M0YA 4GIIA 3V6RA 4ACGA 1Q3WA 1EH4A 4RFMA 4FR4A 1H1SA 5C03A 4E6QA 1XBBA 3PPJA 3QUPA 5A46A 1F0QA 4Y95A 1RQQA 3OW4A 5A6NA 3VS1A 4GFGA 3A7FA 3I79A 2RG5A 3OFMA 3I6UA 4RRVA 4X2JA 1AGWA 2B0QA 2C0OA 1JKTA 1MUOA 3FPQA 3ZONA 5IQDA 1OKWA 3I7CA 5BVNA 3CLYA 2UW4A 4CZUA 4IDTA 2C6IA 1OL6A 1I09A 1YWVA 5M08A 3W32A 1REKA 1CMKE 5KKRC 4AWIA 4DA5A 4IX5A 2XBAA 3V5PA 4FUYA 4LRKA 4P90A 4CFNA 3KULB 4FG8A 3VUHA 4CKIA 2CDZA 3EQPA 4N57A 1Z57A 3MH0A 1K2PA 4K2RA 1XH4A 2GHMA 3KY2A 2UVYA 5IQIA 4DE4A 3WE4A 3C1XA 5K5NA 1P2AA 4UEUA 4ZY5A 3DNDA 4JNWA 3BWFA 2XIZA 3DQXA 4LOOA 3V6SA 4BBEA 4BCHA 3OT8A 4ZJJA 5K3YA 3VHKA 5HESA 1Q24A 2PZ5A 4IAYA 4TXCA 4R7BA 2W06A 3AD4A 2R7IA 3OWKA 4FEUA 4OTWA 2FGIA 2ZB0A 4I6BA 5CI7A 2C68A 4K9YA 5KUPA 3VS7A 2B54A 4IAKA 3IKAA 2WAJA 4FUXA 4AZVA 2FB8A 4V0GB 3HV4A 4MXAA 3R2YA 2UW5A 4FTIA 2I0YA 3NW6A 3ZU7A 5LWMA 3DZQA 4AFJA 2WU6A 5EW3A 5CASA 3OD6X 3U9NA 3EN9A 4X2KA 4JAIA 4CCBA 4GT3A 3SKCA 2X8EA 4KS8A 4WSQA 2GFCA 4FEXA 3G90X 2UZNA 4U9AA 2X81A 4MTAA 3GCQA 2OU7A 3IW4A 1GIIA 3KULA 4IC7A 1A9UA 2UZBA 4FTTA 4FVRA 5HIEA 4USFA 1VYWA 4MD7E 2ZV8A 4FSZA 4IZAA 1UU9A 2EXCX 3FXWA 1P4OA 2UW6A 1MQ4A 4RWJA 3NIEA 3QQLA 3EQGA 4RFZA 5CAOA 3LJ1A 4AZTA 1NT2A 2ZMCA 3PLSA 3R28A 1WFCA 4O6EA 3VBYA 2C3JA 5ETIA 2O0UA 1NVRA 3HKOA 5T3QA 4ZIMA 3UOKA 5JSMA 2J90A 4LMUA 3I60A 3ULIA 4BWPA 3Q4ZA 2VX0A 4LL5A 5HTCA 5TO8A 3E62A 4K8AA 4XP0A 4Z55A 3GC9A 3DLSA 3IW6A 4HZRA 2QOLA 3NNVA 1H4LA 4AW5A 4X3JA 2ZV2A 1YVJA 3OWJA 3R7GA 2WMWA 4DEDA 5FTQA 2OWBA 2WHBA 4A4LA 3GENA 3ZFYA 4EHGA 2Q0NA 4I6QA 3U4UA 4MWHA 3MH1A 4A9YA 1JSVA 4RZVA 4BDFA 3R9HA 2A2AA 2VX3A 4HYUA 4QP4A 3TIYA 3A60A 5HIDA 1KUTA 2PU8A 4JDKA 3A2CA 2EXEA 3GGFA 3E87A 2YEXA 5HKMA 4TYJA 3QC9A 5LQFA 4QP8A 2HY81 1Q99A 3NMUF 2FSOX 4IEBA 2XIYA 5A3XA 3VQHA 4BRXA 4Z16A 4X2FA 3OG7A 4C38A 5CENA 3F2RA 4K77A 3W2QA 2ERKA 4D2SA 2C6EA 5IDPA 5KZIA 3FE3A 4KABA 3VW8A 1K9AA 4C34A 3WIGA 5AADA 4NL0A 2GMXA 3SRVB 1ZRZA 3CQWA 1PXJA 4GK3A 4OW8A 4UN0C 2PZRA 5FXRA 4L46A 1PXKA 4LUDA 4OBOA 2JDTA 2IG7A 3ZBXA 3OHTA 2BHEA 2PE1A 1YHVA 2ZVAA 4F0IA 3QQHA 5E9EA 2HZIA 3HLLA 1P14A 4G9RA 3OT3A 4UBAA 3RWQA 5CI6A 3UNJA 2J5EA 3OF0A 3LFEA 4FSRA 4LL0A 4O7RA 4RGJA 3VBVA 3ZRLA 5HG7A 3FDNA 4QQ5A 3ZO4A 4I94A 4EKKA 3HP2A 2R0UA 5I5ZA 4BC6A 3FWQA 3BE9A 4ACHA 4Y83A 3QQGA 5T6KA 3DA6A 4NWMA 1R3CA 3I81A 4QQJA 4CRLA 3OOGA 4AG8A 4BKYA 2UZDA 3FUPA 3CPCA 2R64A 2PVKA 2R4BA 4NFMA 4ZJIA 4CQEA 4A07A 3V5LA 4G5JA 3RGFA 3Q5ZA 4DFXE 4DHFA 3CC6A 1H08A 3GU5A 4N0SA 1H8FA 4QPAA 4X21A 4AGWA 4HVHA 3FZPA 4NTSA 3ZUUA 3F61A 3ZOSA 2WD1A 2XM9A 4AT4A 5J79A 3V5WA 2HOGA 4H3BA 1R0EA 3EKNA 4KNBA 1XO2B 1CM8A 3LXKA 4QMQA 5DFPA 4R7IA 2ZM1A 4YZNA 5AP6A 1YW2A 5AJQA 2XYNA 5CAPA 1JSUA 4GW8A 4QP6A 2LGCA 4U97A 4D4SA 5HD4A 3R9OA 5IF1A 2C5XA 5ANJA 3NUUA 1R78A 4J98A 4RVTA 4O7WA 4QNAA 4FSMA 4O0YA 3ZC6A 4YSJA 4KIKB 4D1SA 4BCQA 3LOKA 5C8KA 1T46A 5AP1A 2BDJA 3RBWA 4EK5A 2Z7RA 4FKPA 4BKJA 3D5WA 1H07A 4R1YA 4DEGA 3P08A 2HY0A 3CQEA 4UY9A 1O9UA 3EFLA 3S95A 1OL1A 3RP9A 3F5UA 3PVGA 2QU6A 2WMXA 1HCKA 2J6MA 2XS0A 2Z02A 2AC5A 4QOXA 5AWMA 2RFNA 3D94A 4CFWA 5L8LA 4ZMEA 3P5KA 3CTQA 4B6LA 2EUFB 3QTWA 4W4WA 3DJ7A 1M2PA 2DUVA 2ITWA 3EQFA 3NR9A 2X7GA 4XV2A 3QA8A 3ORIA 3PRIA 4LV8A 4MEDA 4TYHA 1P5EA 4D28A 5BYZA 4E20A 2FA2A 4TWNA 2VN9A 4PMMA 4PPAA 5AUVA 5GIPE 4GVAA 4ANOA 3RJCA 2PE2A 5J9LA 4IX3A 4GFOA 4ZTLA 4JDHA 4R3RA 4P2KA 4IB3A 4JAJA 4EYJA 4UMTA 3L9MA 5CU6A 3Q4UA 2GDOA 2ZM3A 2PVNA 2HW6A 2W1IA 2GHLA 3DV3A 4G3GA 4J99A 5EOLA 1W8CA 3IQ7A 2CGWA 3DTWA 3VO3A 1FOTA 4ANSA 4CD0A 2PVFA 4MQ2A 1H26A 3TNIA 3V5JA 1AQ1A 3TV4A 5DRDA 4I3ZA 2BUJA 4LFIA 4G6LA 4IW0A 3RZBA 4ZY4A 3UJGA 3LLAA 2ZJWA 3FI8A 3DGKA 4RVKA 3L8VA 1CKJA 3L8PA 4DFLA 3U4WA 3BHUA 1NY3A 3UODA 5AUTA 3S3IA 4K0YA 2GFSA 2JFMA 3P79A 3UYTA 1OPKA 4PWNA 5AR4A 3F3ZA 5EHLA 5AX9A 4O7LA 2WOUA 3AC8A 2W1HA 5HHWA 2WFYA 1O6KA 4ENYA 2IVUA 3RK5A 4DH7A 3OY3A 4I6FA 3ZYAA 2WEIA 2W4OA 3AMAA 3DBDA 2XH5A 4FTUA 4BFMA 5K4JA 2FO0A 5GJDA 3V8SA 5HICA 4FTNA 3DBEA 2VTHA 5B2LA 3JVRA 3ZLXA 3MESA 1QPEA 5C9CA 5KMJA 4ERWA 2QR8A 4XV9A 4O6LA 4PDOA 3ZBFA 5BQ0A 4NEUA 4TTHB 4DTAA 2QVSE 3K3IA 3RZFA 2WQOA 3R02A 2YAAA 5B7VA 4YHFA 4YTCA 3QRTA 4YNOA 3ZDIA 4CRSA 4EONA 4FMQA 3WYYA 4PDYA 1QPDA 4WG5A 4D9TA 4Y72A 5CU3A 3JPVA 2W5BA 4S32A 3FY2A 2YM4A 4Q5EA 5JGBA 3GUBA 3T8OA 2XNMA 4FKRA 4NIFA 5ANGA 4U6RA 4OT5A 4E26A 1SYKA 4FV5A 1FVVA 4IBMA 4F08A 2OJFE 4F65A 5KKRB 3BLRA 2R3JA 4DH3A 2GPHA 2Y4PA 4QTDA 4C3PA 3QZHA 2OH0E 1OUYA 5D12A 1JSTA 4MBJA 4ASZA 5ETCA 4O38A 3PA5A 4B8MA 4TZRA 2EU9A 2BVAA 4RPVA 4APPA 4FI1A 4CG8A 2DYLA 5A4QA 1Y57A 4ZS4A 1KE8A 2Y6OA 1XWSA 3AT2A 5K0KA 4AZFA 5I9XA 2ITOA 4L43A 1R39A 4D0XA 2NO3A 4X3FC 3RK7A 2ZM4A 4U5JA 3W1FA 3U6HA 4D9UA 5HG8A 3VS4A 5CSHA 4TNBA 3ZHPC 4YR8A 5CXZA 5CF6A 3FY0A 3CGFA 3NW5A 4RBLA 3UQCA 5E4HA 5I3RA 3THBA 1NXKA 4CYIA 3C4FA 1QPCA 4QMVA 3BYMA 4YLLA 5L2IA 3CJFA 2UW7A 2O64A 1OPJA 3B2TA 3FQHA 4II5A 5DH3A 5DPVA 3BGQA 4AE9A 4J8MA 4JRVA 5CF8A 3UVRA 2EVAA 2C1BA 5HE1A 1U46A 1YQJA 1IA8A 4AU8A 3HAMA 4I93A 2BRMA 3MI9A 5A4LA 2WTDA 2PL0A 4KSQA 5EW8A 5HNBA 4IAAA 2JAMA 4IC8A 4TRLA 4PF4A 4RIXB 2P4IA 2VGPA 3BGPA 3HMPA 3Q52A 4M66A 3DAEA 5AV0A 4I22A 2XNOA 5AUXA 3WZEA 3BU3A 2Z60A 3ELJA 4MD8E 3ZZEA 5M4CA 3QKMA 4DTKA 3IONA 1UV5A 3BEAA 5IZFA 1YWRA 4OTGA 5K0XA 3HUCA 3Q9WA 4FK3A 4I20A 4A4OA 4NTTA 4I0SA 4QMYA 3ORMA 4ANBA 2QHNA 1PKDA 5AUUA 2ZMDA 2PMNX 3QTIA 5EOBA 3DNEA 5DA3A 3PIXA 4HPUE 4AT3A 4DFYA 4ZLOA 3NW7A 5CSXA 3LFAA 4O2ZA 5AR3A 1FINA 2H9VA 3EH9A 3MB7A 2F4JA 4ZTRA 5L2WA 5IEVA 3K54A 2X8DA 5DEWA 3FI3A 2WELA 4JL9A 4P4CA 5AEPA 4ZMFA 3UIUA 4QMSA 4GIHA 4S2ZA 3E88A 2VU3A 3KU2A 3QKLA 4X2NA 2WTKC 3WZKA 2X2KA 2YCQA 5IEXA 4BZDA 1YI6A 4W4VA 4GKIA 1Y8YA 1YHWA 2PVLA 4HYSA 3T3UA 2RIOA 2RSVA 4EQCA 2HIWA 4QMMA 1ZOEA 3W2RA 2HWPA 5HLPA 1IEPA 5HBEA 4EH9A 2Q83A 3FQSA 1LP4A 3RPVA 4FL1A 2PYWA 4YZMA 4C2WA 3AMBA 3LMIA 3QQUA 4ZTHA 1OBGA 5J1VA 1XH6A 3ZSHA 2OW3A 4FNYA 1FBNA 1MRVA 2WOTA 4J53A 4X3FB 3DXPA 3BEGA 4FTQA 1YDTE 3D0EA 3JUHA 3NYOA 1WBNA 2OBJA 2JDSA 3R01A 4IDVA 4IWDA 3R71A 2VX1A 3FMEA 2WMBA 4K6ZA 4C3FA 4FKIA 5CEQA 5BVEA 2YHVA 3MTFA 4G2FA 3SD0A 3ZFMA 4CMUA 1XHAA 5H8GA 2ZV9A 2PVJA 2R3GA 3DXNA 4AN9A 1MRUA 2BTRA 3V5TA 3G5DA 2Q0BA 3QZGA 3JVSA 4ALWA 2E2BA 2VTOA 3U8WA 3VUKA 4G31A 3UBDA 3LQ5A 4OUCA 5IEYA 3FZOA 2YCFA 1V0OA 4RWLA 5DRBA 1G8AA 4BR3A 3GP0A 5IH6A 3D7TB 5E8SA 4BCGA 3WOWA 1OIRA 4IX6A 5IU2A 2XIRA 3ALNA 2ITXA 2V62A 3A7IA 3MA3A 1M52A 3EYGA 5DN3A 4CKRA 4GU9A 2XRUA 4GMYA 2YCRA 2XEYA 3RCJA 3VS2A 3LM5A 3E92A 5EYMA 4EI4A 2C5NA 2P0CA 1UNHA 1RJBA 3MJ2A 1GZ8A 2B4SB 2VWYA 1FMOE 1FVTA 3R1NA 3ZO2A 1VYZA 5EKNA 1Q8UA 5JZJA 3O8PA 2UW3A 4MF0A 4YTIA 5LMAA 4NCTC 3VW6A 5KBRA 4C02A 5ICPA 1H28A 2BILB 3D7TA 3QD2B 4GU6A 5ANKA 5IA3A 5JK3A 1GZNA 1REJA 3HDNA 5IPJA 3D9VA 1KE9A 2C6LA 5HO7A 4FZAB 2REIA 4IE9A 1JOWB 1O6YA 4W9XA 3U54A 3CE3A 3O7LD 4ZLZA 2QKWB 2VWBA 2YZAA 2PVHA 4BDKA 1PMEA 4F9BA 5DYJA 3OUNB 4DCAA 4O0SA 4RMZA 3F3VA 3RM7A 3P7BA 4BIDA 4Z7HA 4B99A 2PMIA 2OF4A 3AMYA 4UX9A 3A7GA 1WVYA 2C6MA 2OZAB 4O22A 2RKUA 2OK1A 2XA4A 3G9LX 4TW9A 4E5AX 5H8BA 5CSWA 5BUIA 4BVUA 3GNIB 4KUJA 4S33A 2ITQA 2VTLA 4M0ZA 5AP4A 4RQVA 3V8WA 4WA9A 4FL3A 4O7NA 5AMNA 4YJPA 5EH0A 1XH8A 2YWPA 4DLIA 5EI2A 4FKSA 2F7ZE 1PXIA 3M42A 1M7QA 5I9UA 3DQWA 2HXQA 3ZRMA 4D1XA 3GT8A 1SNXA 2JBPA 2ZOQA 3FMHA 2IWIA 3Q2JA 3F2AA 4O0WA 2FVDA 1GOLA 3S2PA 2C5VA 5HI2A 2ACXA 4RFYA 3QTZA 5HCXA 4AZEA 4DH8A 3ORLA 2BROA 3RHKA 4XG9A 4L68A 4C8BA 5ETAA 2FSLX 4NH1A 2A1AB 2IW8A 3AXWA 4BDEA 3HV3A 4E1ZA 4E5BA 4MXXA 4IAZA 4AF3A 3QCYA 4YC6A 4E7WA 5D7AA 3UPXA 1W7HA 3BV2A 4JS8A 3COKA 3R9NA 2XIXA 3SV0A 2UZVA 2XNPA 3L9NA 5TOZA 1TQPA 1UA2A 4D0WA 3FV8A 1RW8A 2JITA 2V22A 5JGDA 4ARKA 1KSWA 3N4TA 5HORA 4DEHA 4G3DA 3PSDA 4RC4A 1OIUA 3P0MA 4XBRA 4JQ8A 3MVHA 3A62A 3QHWA 4Q5HA 4W4XA 4R78A 4RC2A 4EQMA 4LG4A 3TKIA 5CLPA 5AIKA 5AR5A 5BVOA 1J3HA 2X8IA 4RX5A 3ITZA 3BBWA 4XCUA 3BU6A 2WIHA 3NWWA 3AC2A 3O23A 3Q60A 4L42A 2PVYA 2VO3A 2OG8A 3PG1A 4QPMA 4C57A 5KNJA 4ZZMA 1OECA 2ONLA 3SW7A 3C5IA 3WI6A 3LFSA 3I6WA 4M13A 3WF9A 3CJGA 3RAIA 4UXQA 5A4TA 4FODA 3QYWA 5DVRA 4F7JA 1ZYSA 4AOTA 4FTOA 3RWPA 4F0FA 1UU7A 4QD6A 3RTPA 2XYUA 3MSSA 3MW1A 4YZBA 5DT4A 1UNGA 2PMOX 3N9XA 2PUIA 2C5YA 3MS9A 3QCXA 4BI1A 4XLIA 5M51A 2B9FA 4F6WA 4OTRA 2HZ0A 3TZ7A 1FGIA 5E8TA 4TYIA 1X8BA 4YC8A 4B4LA 1PXMA 2GTNA 4MF1A 5IG1A 3MY0A 4M69A 3RALA 3DZOA 4C37A 1H25A 4FTCA 5TE0A 4CTBA 5J1WA 4BCOA 1UU8A 3F3UA 3TZ8A 5EQPA 4BDJA 2QOOA 3FL4A 2R3RA 1M17A 5E8XA 3ZSGA 2WQMA 4FV8A 3TACA 4I23A 3HMNA 4R6VA 3CTHA 4MX9A 3IG7A 4C3RA 4DFNA 3A7HA 4QMNA 3AD6A 2VTTA 3DB8A 1BKXA 3FZ1A 4Q2AA 3S1HA 1PRYA 3VJNA 3G51A 3KGAA 1IA9A 3QKKA 3C13A 4LUEA 4E4NA 2C47A 5H2UA 4YTHA 3ORTA 3QBNA 2JKKA 4WNOA 1J1CA 5LVNA 1H1QA 1K3AA 2RF9A 4J97A 2YITA 3LFBA 3RKBA 3UMXA 4CNHA 5A4EA 1LEWA 3P9JA 4QP7A 5JEBA 2UW9A 3LPBA 3UTOA 4FIHA 3VS0A 3EB0A 5K5XA 3MH3A 4AT5A 3TKUA 3U87A 1OUKA 3O8UA 4MYGA 5HOAA 2PK9A 3MPTA 3BBTB 3EQDA 3EFWA 5ANIA 4JDIA 2WQNA 4QRCA 5E8YA 5GHVA 4OAVB 3E64A 3E8NA 4CTCA 2C0TA 2JAVA 3ET7A 4F1MA 3NUNA 4BBMA 3MN3A 4RWIA 4BZOA 2C4GA 3Q53A 2G2FA 4Q9ZA 2EB3A 3UNZA 4CFFA 5G1XA 3F5PA 4NM3A 2QCSA 3QTRA 1XH9A 3AT4A 4DG0E 1PXLA 3GFEA 4I41A 4JVGA 4F99A 4FL2A 3FMLA 2B1PA 4EJNA 2WTCA 4GVJA 2BALA 3R2BA 2VTJA 5AUYA 4MH7A 4F64A 5L2QA 2NNWB 2R9SA 4USEA 4OAUC 1OIQA 3UP7A 3WARA 1GZKA 2WNTA 3UQFA 3OY1A 3QGWA 3Q96A 3WYXA 5A14A 4F4PA 1ZAOA 2E9PA 3F2NA 2BDFA 4QP9A 4F7NA 1STCE 2ITTA 3DU8A 4JRNA 5FD2A 1QMZA 3ZRKA 3TG1A 3EZRA 5FTGA 3VAPA 5IQGA 3PP1A 1H0WA 1YXXA 3OCTA 4KKGA 2VWVA 2AYPA 4GH2A 2UZTA 3FMJA 3QQJA 4QTCA 5EK7A 4R8QA 3ROCA 4DC2A 2C5OA 2WO6A 3HNGA 5AR8A 4RIWA 2DWBA 2VTAA 1IG1A 1YOJA 4TNDA 4G3EA 4GT4A 4IX4A 5EDRA 4RX8A 4X0MA 3VUIA 3ZEPA 3LKMA 4XOZA 2BAJA 3NNXA 3WF5A 5CEIA 3TKHA 2P3GX 3I5ZA 2EB2A 3PE1A 4U40A 3MFTA 3FL5A 3UZPA 3CEKA 3CKWA 4FKLA 1U5RA 5IA5A 3ODZX 5J5TA 1WBSA 4HNIA 4X7QA 3CKXA 2A4LA 3EQRA 4IB0A 4BHNA 2OIBA 2I6LA 2YM8A 4ANMA 4LYNA 4NK9A 3E8EA 2WMQA 3VULA 1PJKA 3H9FA 4YP8A 2W1DA 3REPA 2VTIA 3ODYX 1ZOGA 1ZXEA 3AG9A 3K2LA 4RJ8A 4HOKA 4XG4A 1MQBA 5LMKC 4A9TA 4YU2A 3S00A 3MFUA 3L8XA 4LRJA 2YA9A 4ENXA 3L8SA 5LARA 3IDBA 3HMOA 2XM8A 5IUHA 3IO7A 4AACA 2HELA 3OTUA 2W17A 3PJ8A 4MVFA 3DBCA 2BZIB 3R8UA 4AN3A 2GHGA 4EHEA 5HTBA 3F7WA 3TDVA 1F5QA 4DBNA 4NIFB 2BIKB 4KBKA 3CR0A 4JBOA 1HOWA 4I5HA 4XJ0A 5AX3A 5HNIX 2QOHA 5LWNA 3CP9A 4BCKA 3TTJA 4QMTA 3V51A 4TWPA 4EKLA 1APME 2JKMA 3TEIA 2QOFA 2WMTA 4I5CA 4FBXA 4S31A 1QPJA 3W10A 2B52A 2QKRA 3IK3A 3OXZA 2VWIA 4FSYA 1KE6A 2HXLA 3QQFA 1GNGA 2G1TA 2UZUE 4I6HA 2PUPA 3PXQA 2IJMA 5D1JA 3R8PA 3DCVA 3BLHA 1MP8A 4YLKA 4QMZA 4XUFA 1DI8A 5J7HA 3NVKI 4MXCA 2YJRA 4PY1A 3SA0A 1DI9A 3HZTA 1GY3A 1LPUA 4CFMA 2CGXA 2BZKB 2HCKA 3E7OA 2ITPA 4RLLA 2CLQA 5CU4A 3HYHA 4N6YA 4EOQA 4JLCA 3PA3A 4EK3A 1PY5A 5EKOA 1Q8WA 3L1SA 4K1BA 4YO6A 4FG7A 4KB8A 5E7RA 4RC3A 4JR7A 1TKIA 3TZMA 2E9VA 2W5AA 4G5PA 3HV6A 2Y4IB 2XKFA 3C0IA 4IFCA 4FTRA 3QLGA 2A19B 2XK4A 4AA4A 1WBPA 3O71A 4BIEA 4BYIA 4AZSA 4BGQA 4WNKA 4RJ4A 5LCKA 2IVSA 3HA8A 2CMWA 1XH7A 3MGYA 3C51A 1JAMA 2F49A 5CEPA 3GCUA 2F7XE 3QQKA 2ETRA 3VWAA 3HL7A 5IA0A 1ZOHA 4RG0A 5FEQA 3OWPA 3QF9A 3ORKA 5IKWA 2R2PA 3VS6A 2ZAZA 3OEZA 5HVJA 3KQ7A 2CKPA 2W96B 3GC7A 1VEBA 2YDJA 4AAAA 4WBOA 4CMOA 3ZDUA 3ATSA 3G0EA 4WUNA 3E8CA 4IZ5A 4PMTA 1ZYCA 3PE2A 4UWBA 4F9CA 2G9XA 2BIYA 1JVPP 3FXZA 2XKDA 3DK7A 4LM5A 4QO9A 3NYVA 1UWJA 4DGGA 2BCJA 5DT3A 4C4HA 1I44A 4I4FA 3N51A 3PTGA 4IAIA 4JR3A 4IVAA 1ZY5A 4FV1A 5F95A 5HO8A 4WRGA 3IGGA 4WSYA 5LMKA 1SNUA 3NDMA 2GSFA 3AD5A 3OOMA 4H58A 4XOYA 5M4UA 5JGAA 4ZTQA 3KMMA 2OIDA 4CCUA 4CLJA 4XYFA 3KEXA 4HJOA 4C2VA 3FBVA 3LJ0A 4FSTA 4HCVA 3NLBA 4IJPA 5FP5A 5LOHA 4DYMA 1KOBA 2XNBA 3WF8A 5JT2A 4RWKA 1O6LA 4WKQA 4BB4A 5BUEA 3EQCA 5CNOA 5HU9A 3V8TA 3RNIA 3DKGA 3E5AA 2WMRA 1KWPA 3KMUA 5GIOE 1IASA 4EH7A 3MVMA 4FEWA 1S9JA 3SGCA 3DBQA 5D10A 5EG3A 3OCGA 5D41A 4E8AA 2CNQA 2XKCA 3V5QA 3Q5IA 2IO6A 4AP7A 4F9WA 3PIZA 5CZIA 3NYXA 5CTPA 3LCSA 4HCTA 2C6KA 4AN2A 3QX2A 4XBUA 3KN5A 1UVRA 4U8ZA 3QUDA 3SG9A 4F1OA 2O3PA 4QMOA 4D2PA 3DFAA 4BDGA 3KN6A 4MNEB 3ZH8A 4YJNA 5E92A 1OBDA 3R30A 4PP7A 4CG9A 4FC0A 3QD4A 2W9FB 5IISA 4WOVA 3QZFA 4PDSA 2OZAA 3EFKA 4EOOA 2BHHA 2C3IB 2R3OA 4EHZA 5AIRA 3UQGA 3DJ5A 3UIXA 4NM5A 2WIPA 2UZWE 4NM7A 3LE6A 3MY5A 2BMCA 1H1WA 3GEQA 5KO1A 4LQMA 3GFWA 1UNLA 3QRIA 5B0XA 3W8QA 2X7FA 2UZOA 4LV5A 1IRKA 5JKGA 1M7NA 4JG8A 3MPMA 3QYZA 4LGHA 4CV8A 4ID7A 4BCMA 3GU8A 4C62A 4QYGA 2CKOA 2WXVA 3KRRA 4I92A 5EQYA 3QD0A 4L53A 5FBNC 4YJOA 4OTHA 4S30A 4WHZA 4GT5A 4JIKA 5HIBA 5L6WL 4RJ7A 1YXUA 3F6XA 4CFVA 1FQ1B 4QTEA 3WZJA 2XK8A 1UKHA 3U6IA 4FIGA 4L3PA 4O84A 3T3VA 4A9UA 2BKZA 3AT3A 4OTFA 4W8EA 4X2GA 3QAME 2BAQA 1A06A 2YM3A 3QL8A 3TJCA 3V04A 2IZRA 2PVRA 3TI1A 3V3VA 5FEDA 1M2QA 4QQCA 5BPYA 2Y7JA 3ACKA 4ZTSA 3R7VA 4BDDA 1Q4LA 3UC3A 3LLTA 3S0OA 3R7YA 4U81A 1JWHA 3KF7A 4PTCA 3SVVA 1PF8A 4K11A 5FXQA 2CJMA 3Q04A 4OTIA 3UG2A 4HGLA 4IM0A 4W4YA 3VC4A 1FVRA 3PXRA 4GYGA 4A9SA 4BTFA 3HX4A 4FEQA 2X1NA 3Q4TA 2X0GA 3QTUA 2P55A 5DNRA 4AW0A 5H8EA 2JIUA 5L4QA 4QMWA 2YM6A 1G5SA 1VR2A 3F82A 4FTMA 3DAJA 5I4NA 2W4KA 3SAYA 4ASXA 4KIKA 4CT2A 4E6CA 4FIIA 4YJSA 5FTOA 3HEGA 2OJIA 4XG3A 4IWQA 3UPZA 5CAUA 4PPBA 5EM5A 4WIHA 3NX8A 3ZXZA 1JQHA 4ORKA 2OH4A 5HEZA 4Y5QA 4IH8A 5CSPA 3QFVA 3MBLA 4KD1A 3ZLYA 3BZ3A 4AOJA 5CEOA 1NA7A 2X6EA 3OZ6A 3QA0A 3QZIA 5DR6A 3KXNA 2WMAA 2W0JA 4RA4A 3Q2MA 4YJVA 1G3NA 4DITA 3LQ3A 2J5FA 5H3QA 4CMTA 1YI4A 3EJ1A 4JI9A 4EHVA 1KOAA 5IQHA 2OSCA 4X6QC 3IGOA 1W83A 1YXTA 5M09A 3COMA 1V0BA 2R3IA 3KRWA 4J8NA 4I0TA 4PMPA 2GU8A 2YACA 2A0CX 5CEKA 2BZHB 2IN6A 2NP8A 2E9NA 3EN5A 5D7VA 5EI6A 5CY3A 2R3PA 3GC8A 1CTPE 5KHWA 4O81A 5F94A 4PV0A 4BTKA 4G9CA 5K4IA 3UC4A 4ZTMA 3G6GA 3NUAA 1M14A 1VJYA 5EDPA 4R1VA 2YFXA 4L67A 3KXZA 4AXAA 3DFCB 1ZYDA 1J7LA 3RPSA 3ID6C 2W7XA 2QD9A 2VTNA 3F7ZA 1U54A 4QYFA 3QC4A 2C6OA 1Y6BA 5BVWA 4YZCA 5JZNA 3NUYA 4H1JA 4NSTA 4MCVA 1V0PA 3UE4A 1PMUA 5DMZA 5GINE 2ZYBA 3C4CA 2ITZA 3VBXA 3UVQA 4CXAA 3B2WA 4XNEA 2QG5A 4U80A 4EZ7A 4NKAA 4RSSA 4FTJA 3TJDA 3VQUA 5EQEA 3TL8A 3WE8A 2XVDA 2FSTX 4Z7GA 2GS2A 2CCIA 1LEZA 4Y85A 3RM6A 4KIPA 2Y4IC 3F5XA 5BNJA 2CNVA 3RCDA 4HZSA 1H00A 2H8HA 3VUMA 1SMHA 2QOCA 5AP5A 3MY1A 4YBJA 4L00A 1U54B 3CY2A 5CWZA 4FZ6A 2JFLA 3RK9A 3SOAA 3NUXA 4J1RA 3JYAA 5EM7A 3ZUVA 3KCFA 4EH3A 4BCNA 3RNYA 4AW2A 3G15A 3AGLA 5HE2A 2R3KA 4GL9A 3FYKX 3PYYA 2YN8A 2IZTA 4XX9A 3NVMB 4FT9A 1Q97A 1RE8A 3CD3A 4FIEA 5HLNA 3TNWA 1URCA 3OVVA 4M15A 4ITIA 2FSMX 2O2UA 4S34A 3KVXA 4FX3A 3W2SA 2H6DA 3FMMA 4RIYA 1DAWA 4YHTA 3FHIA 4ZS0A 2P2IA 1Q61A 4C35A 4P7EA 4L6QA 1DM2A 5L3AA 4IADA 2OJ9A 3GBZA 1Z5MA 2W1GA 5HE0A 4L52A 3NUPA 4O7VA 3EWHA 5AP0A 5DIAA 5TT7A 5IH5A 2VV9A 4KINA 1Q41A 4ACCA 3A99A 1QL6A 4R3CA 3LQ8A 2IZSA 3OC1A 4GEOA 4TL0A 3CBLA 3PVUA 4F09A 4TT7A 2OI4X 4FV4A 2G2HA 3HV7A 2C3LA 2P33A 5AR7A 5DE2A 2WMVA 5EYKA 4RIOA 2OXYA 4BTMA 4BCPA 5CX9A 5K9IA 1UKIA 2QQ7A 4G6OA 4ZSLA 1H24A 2CSNA 4NCTA 3DKFA 1GJOA 1SVHA 2F57A 3Q9XA 3FLZA 5D11A 5I9YA 4EL9A 4AGCA 2JD5A 4KIQA 4I4EA 4D5KA 4BYJA 4Z3VA 3ZEWA 1BL7A 2CGVA 2C30A 4X3FA 2F2UA 3LCTA 4NJ3A 2CN5A 4B7TA 5E8WA 1XKKA 1RDQE 3R8ZA 4RIYB 4GYIA 4FSNA 4PUZA 5IDNA 1ZYJA 3BV3A 4YBKA 4O0XA 4AE6A 5CALA 1BI8A 2I0EA 2J0LA 4APCA 5CF5A 4HNFA 4C4GA 5CAQA 5DEYA 2VD5A 4NJDA 4RJ3A 4O0RA 4E5WA 4FKOA 2PY3A 2XB7A 3UO5A 3PY1A 3GQIA 5CVHA 4AA0A 1T45A 2XEZA 3MYGA 1MRYA 4M67A 3W2OA 1J7UA 4FOCA 3ROYA 4YJTA 4PTGA 4LRMA 2QOQA 3IOKA 4UV0A 3R0TA 3LVPA 4O0UA 4QQTA 2WTKB 3TNPC 1XH5A 3D15A 3EQIA 3PWYA 4DT8A 3LW0A 4XHKB 2PHKA 4H1MA 5HBJA 4MXYA 5KMMA 4FT3A 3CPBA 3LJ2A 3HRBA 5J95A 2R3HA 2W1FA 4H39A 4GS6A 3NNWA 3ALOA 2G01A 3PXFA 4LOPA 3UGCA 4EH4A 4IZ7A 3QCSA 4NU1A 5HZNA 1XJDA 4J71A 2YIYA 4O7SA 3FLQA 1GIHA 4BL1A 4U3YA 2QLQA 3GB2A 3JXWA 3PZHA 2XNEA 3F88A 2YCSA 3WILA 3EL7A 3PZEA 2GS7A 2YISA 3FMDA 3LHJA 3NPCA 3ZSIA 4D4YA 2XK3A 3DKCA 4USDA 4WUAA 4HCUA 4U45A 5JRSA 4MNFA 5ANEA 4O1OA 4XG8A 4EOJA 4B8LA 3MTLA 3VF8A 2YLFA 2ITUA 3MJ1A 4ZAUA 5A4CA 3VBQA 3MWUA 2OFUA 4IANA 3BWJA 3KKVA 5CU0A 2WMSA 2IVTA 3OBJA 3OUKA 4N4SA 5FDPA 5KX8A 4JDJA 4A4XA 4EORA 3WZDA 1S9IA 4BI2A 4FKTA 5HBHA 3ENHA 5M53A 5M57A 4HGEA 3RAKA 2VO0A 5M44A 4F7LA 4YPSA 4KRCA 3KCKA 5EW9A 4JX7A 4XH6A 3HDMA 3R00A 4QMXA 4YHJA 2IW9A 5IA1A 1DS5A
chains in the Genus database with same CATH superfamily
4DLJA 4AQCA 2J50A 2YIWA 1OM1A 2G15A 2I1MA 2WZJA 3ZLWA 2WTIA 2YABA 3EMGA 4IVCA 4JG6A 4CFXA 4EOSA 4QEBA 4CGAA 4J7BA 4XRJA 1V1KA 4FNZA 4M12A 3KREA 2PWLA 4XMOA 4FKVA 2KULA 4PX6A 1G8KA 3DXQA 4MXOA 5J87A 3QRUA 3NNUA 2YIXA 2W05A 3O7LB 2QONA 4EH6A 4EWQA 2Y0AA 3D4QA 4J95A 4F9YA 4R5SA 3LIJA 1OL2A 2X9FA 4WG3A 1H0VA 3ANRA 4GCJA 3AGMA 4QMLA 4KS7A 4F6UA 3S4QA 3CSVA 1W82A 4FGBA 4GV1A 2OICA 3I5NA 2IZUA 5CYIA 4E4LA 4GJ2A 4A06A 5ITAA 3PRFA 5CQWA 4HGTA 4QTAA 2HYYA 3UZTA 3ACJA 4O83A 3UZRA 3PFQA 3R9DA 2WTVA 4XS2A 2XK6A 3O96A 2VWUA 4OTPA 5DI1A 1H1PA 4PL3A 3QWKA 2OJJA 5IH4A 4EZ5A 4E4MA 4XV3A 3COIA 5J9ZA 4GKHA 2BZJA 4CSVA 4RX7A 3LFCA 3QCQA 5LJJA 4QT1A 3EHAA 4DINA 4G3FA 1WBTA 3D83A 4RIXA 1PMNA 3PVWA 3NAYA 4OTQA 2XCHA 3LCKA 4QMUA 3CQUA 3TXOA 5CANA 2W99B 3BHTA 4EBVA 3F66A 4GG5A 4EC8A 2IEWA 4NFNA 1JKKA 4G1WA 4DG2E 2GTMA 3BHHA 3PY0A 4UZDA 5CS6A 4CZYB 4N70A 1TVOA 4PDPA 1U59A 2V55A 1Q8TA 1WCCA 2PTKA 4NKSA 3BHVA 4RX9A 3UVPA 3Q6UA 4C4IA 4UB7A 3C0HA 3D5UA 5JFWA 4H36A 5KZ0A 5M4IA 5I0BA 1YOLA 5M55A 3G2FA 2YLEA 5DG5A 2C0IA 3W0SA 3BELA 3EZVA 4UALA 3MVJA 5IUGA 1OI9A 2YM5A 4L45A 5HG5A 3Q3BA 3Q9YA 5KHXA 4DAWA 4DGOA 1Q8ZA 4KBAA 2QOBA 1DAYA 3RPRA 3UIMA 5CAVA 2W4JA 4O91A 3BYOA 1OIYA 4JJRA 3MA6A 4NUSA 5L6PA 1FPUA 3EL8A 1TQMA 5FUTA 4WBBB 2XUUA 4IB1A 5E1EA 4KRDA 3D5VA 4QP3A 3JY9A 3QTSA 4EUUA 4DDGA 1KV2A 2VO6A 4KAOA 3SRVA 3FKOA 4AX8A 2CHLA 2WTJA 5IA2A 5L2TA 4LOQA 3UMWA 1ERKA 2QO9A 1YDSE 4NZWB 2B9IA 3MIYA 5DBXA 4QMPA 4EOLA 2J2IB 4IWPA 1BI7A 3NS9A 1AD5A 3UDSA 3QUEA 2H96A 4KSPA 1PXOA 4MHAA 3FLSA 2ITNA 4RJ5A 4IJ9A 1H27A 5ACBC 4M69B 4OR5A 5C01A 4AGUA 5FP6A 4R3PA 4JOAA 4PMSA 3HGKA 4ITJA 4TYHB 5FDXA 2FH9A 2FYSA 2V7OA 4XG7A 5LMBA 5C8NA 5C26A 5C8MA 3B8RA 4MQ1A 3PA4A 5BX0A 1WZYA 3F69A 5AV1A 2VWXA 5E91A 5T68A 5I9ZA 3C0GA 4M84A 2ESMA 3LFNA 4RJ6A 4FZ7A 2RFSA 4MUQA 5EM6A 2VWWA 1OL7A 5EYCA 3R63A 2GQRA 3PIYA 2QI8A 5HNGA 3HUBA 3IECA 3VUDA 5BYLA 4D4RA 4LGGA 2OLCA 1W2CA 2VZ6A 3I7BA 4QYEA 3OWLA 3POOA 3BHYA 5EYDA 1TQIA 5TKDA 3COHA 3TTIA 3GI3A 4DBXA 1OITA 4K18A 4BCIA 5DR2A 3TV7A 4EH5A 1YXSA 3HV5A 4FV6A 1M2RA 2VTRA 2VUWA 3C4EA 3CIKA 2JEDA 3G9NA 4FV7A 4L01A 3SHEA 2XNGA 2O5KA 3H9OA 4MXZA 4GSBA 3H4JA 2PVMA 4UMRA 2OKRA 4DH1A 1YRPA 2QHMA 3OEFX 2XJ1A 3HRCA 3LXLA 3AC1A 1OKVA 3A61A 3OW3A 3A7JA 3FKNA 2J7TA 5EDQA 2V7AA 4O21A 3SQQA 3DTCA 4AZWA 4O4EA 5LVLA 5L8KA 3POZA 3CTJA 4F1TA 3TT0A 3VIDA 5J8IA 3ORPA 3QXPA 4EH2A 4F6SA 3EIDA 4R5YA 4JT3A 4IIRA 5JFVA 3H30A 5IQFA 4QNYA 5GNKA 5IA4A 4YLJA 2QC6A 2H34A 4ZTNA 3O50A 3RI1A 3UO4A 4RVMA 2I40A 3CD8A 4NM0A 3C4ZA 4FNXA 4D55A 2GNFA 3E63A 4OGRA 1P4FA 3DDPA 3DBFA 2UV2A 3G6HA 5HG9A 4YZDA 3ZMMA 3FSKA 4CLIA 4DTBA 1OGUA 3SXFA 1L8TA 5HTIA 3FMNA 4C59A 1JBPE 2ZB1A 4ZP5A 1GAGA 2ZDUA 4Z9LA 3LMHA 3KFAA 3OBGA 4GFMA 3MV5A 4C0TA 3QWJA 2R3NA 5G6VA 5FM3A 2F7EE 5HE3A 3PDTA 4EOIA 5BVKA 3BYVA 3JY0A 4KKEA 4ZSGA 3ZS5A 1JNKA 3GOKA 3W2PA 3AKLA 3VS5A 3PJ1A 2GNGA 4KBCA 1URWA 3BYUA 4F78A 3TZ9A 4RIWB 4C36A 4ZY6A 4DEBA 5DR9A 2B9HA 4YNEA 2QODA 3LFQA 4UWCA 1IAHA 4O7YA 2W5HA 4E6DA 4BCFA 1XQZA 4W8DA 4G3CA 4EEVA 3NFGB 4DEEA 1VZOA 5CVGA 2KTYA 4O96A 1OL5A 3P86A 5DOSA 1KE5A 4XP3A 5D9HA 3FYJX 4I5PA 4C4JA 1YWNA 3K5UA 5IQAA 3CCNA 3SC1A 4FIFA 2CKEA 3A4OX 4P5QA 4DN5A 2I0HA 2VRXA 3ZO3A 4ZZOA 4KWPA 3TCPA 2JIIA 4YMJA 3BQRA 5I3OA 5HU3A 1ZWSA 2P2HA 5E8UA 4QTBA 5HX8A 4YGAA 2BRBA 2QOIA 2Z7LA 4J96A 3P1AA 4OTDA 5CQUA 2J0MB 5E1SA 3W0PA 4AQKA 2W9ZB 2OJGA 3PY3A 4O4BB 3KC3A 1JKSA 3UOLA 4BICA 1ST4A 3RINA 2QURA 2O63A 3PWDA 4FE2A 1SVEA 5F1ZA 5M4FA 2AUHA 1YDRE 2E9OA 2ZV7A 4Y8DA 3TUBA 4QYHA 3AQVA 2YJSA 1E9HA 4L7FA 3D2KA 4Q9SA 4U41A 3P78A 4F0GA 3OMVA 3KXXA 3PJ3A 4HYIA 4B0GA 3TDWA 3ANQA 2QLUA 3ORZA 2HK5A 4XV1A 5IQEA 1NW1A 4A7CA 3BQCA 3G0FA 5CT7A 4BBFA 3FMKA 5HCZA 4BDBA 3HVCA 5L6OA 3Q32A 1Z9XA 3WBLA 4MD9E 2Z2WA 4I1ZA 4V04A 2PZYA 5LVMA 4M14A 2Y6MA 5AM6A 4LGDA 3PSBA 4RA5A 4XEYA 1YI3A 2HZNA 3VUTA 5M06A 4BN1A 4HVIA 4M68A 2R3FA 2C6DA 4I5MA 5CU2A 3TNQB 4ASEA 2OXDA 3DDQA 3E7VA 4HVGA 3KK9A 5IQBA 2GQSA 3SLSA 4GG7A 4D5HA 4X6RA 4UMUA 3GCPA 4XP2A 5AUWA 5BVFA 2ITVA 3ATTA 3R83A 3BYSA 3QALE 4I24A 4OBQA 4PP9A 1LUFA 5AA9A 4UXLA 2XKEA 3PPKA 4NW6A 1WBOA 2J51A 2YIQA 1ZLTA 3NZ0A 3VBWA 5BVDA 4WO5A 4YC3A 5JQ5A 2NYAA 4ZEGA 2BKKA 2HZ4A 4DT9A 2BTSA 2HW7A 3RHXA 3FEGA 3EFJA 3H10A 3O17A 1BMKA 1XBCA 4FZDB 4IWOA 1R0PA 3BLQA 5DGZA 4WG4A 4FIJA 3P7CA 3VRYA 3R1QA 2XJ2A 3W2CA 2FUMA 3DY7A 3KXMA 5EM8A 5FWKK 4PRJA 3CXWA 3FKLA 2WB8A 5F20A 1E1VA 2IPXA 2WEVA 4FGRA 5AR2A 4FEVA 3R7OA 3WF7A 4JX3A 2QOKA 3BE2A 4FV0A 3KVWA 1PYEA 4FYOA 2ITYA 5LCJA 3I0QA 5AAEA 3GXLA 3DPKA 4EOMA 1B39A 4D2TA 1CSNA 3W16A 2J0JA 4Y46A 5F4NA 2GNHA 3FAAA 5KBQA 3GU4A 4JQEA 3LXNA 5KE0A 3BLAA 4E4XA 5KCVA 5AFVA 3CY3A 4NT4A 2WGJA 3RPYA 1WAKA 3O0GA 4IVBA 4MKCA 4P5ZA 2OIQA 3E3PA 3IS5A 5JQ8A 4YZ9A 1L3RE 2WTWA 2E9UA 3GC0A 3SX9A 1UU3A 3DK3A 4JBVA 4AFEA 3GU7A 2J9MA 3EN6A 2C6TA 3L9PA 5JFSA 1BX6A 2CCHA 3FLWA 4FTAA 3L9LA 3AC4A 1H1RA 4JG7A 5TF9A 2W1EA 4F63A 4ZJVA 2PULA 4AXFA 3TN8A 1OZ1A 2R5TA 3TIZA 3UYSA 4KA3A 2X0OA 5FXSA 1OKZA 3OCBA 2CGUA 3II5A 5A6OA 3R1SA 4IAFA 4QPSA 3BIZA 2VO7A 1PKGA 4B9DA 3N4VA 3FLYA 4DFUA 4LI5A 2ERZE 3QTXA 3R7IA 4DF3A 3NYNA 1BLXA 3FXXA 3PFYA 4TWOA 4FICA 1SM2A 4CYJA 2CNUA 1ZMVA 2Z8CA 2IF8A 5AAGA 5AM7A 3R21A 3ZC5A 4AGDA 4DH5A 2BFYA 3DJ6A 3EKKA 3OTVA 1Y6AA 4IM2A 5HGIA 4IMYA 3UDZA 1J91A 3WIKA 4A9RA 4NYEA 3DAKA 4ZSEA 4O0VA 4G6NA 1YKRA 4DCEA 4H05A 3IW8A 1JPAA 4BGHA 4O86A 3DKOA 3TUDA 3GU6A 4FYNA 3TV6A 3IDCA 4M8TA 3UNKA 5HVKA 2QR7A 2C69A 2X2MA 4WRSA 4FKJA 5DWRA 5AA8A 4Y73A 3UDBA 3H0ZA 3K3JA 4FG9A 3TNHA 2CKQA 1ATPE 1W0XC 2G2IA 3E8DA 2BRNA 1ZZLA 3PUPA 2X9EA 4O1PA 1OKYA 2AC3A 3F5GA 4U43A 3ORXA 5C27A 1JKLA 3QGYA 4ZSJA 5ANDA 4JBPA 5LVOA 4D1ZA 4JQ7A 1BL6A 2UZEA 3GQLA 5E90A 3VJOA 4FZFB 4ERKA 3QRKA 4IM3A 3UOJA 3NGAA 4UWYA 4ONAA 4HVSA 3FZRA 3GCSA 2VTPA 5C1QB 3PXKA 2CLXA 1ZARA 3C4XA 3KXHA 4OT6A 3NEWA 2RFDA 2RL5A 2F9GA 5E8VA 2UUEA 3NSZA 4YSMA 3FZTA 5I9WA 4TY1A 3FI4A 3MVLA 2NPQA 1A48A 4GK2A 2PSQA 4CQGA 3O8TA 3QU0A 2JKOA 2VTMA 5AP2A 4ANNA 5ANOA 4ALVA 3HP5A 2UZLA 4PL4A 2W1CA 4IFGA 3R7UA 5LXMA 5ACKA 4FKWA 4O7TA 2PUNA 2OGVA 2Z7QA 4EQUA 2XMYA 4FF8A 3IOPA 4XG2A 4QDEA 5AV2A 3SXSA 3CGOA 3ZUTA 3R8VA 4TYGA 4C58A 2GNIA 2JIVA 4YJQA 3KIOC 3EQHA 3R7EA 5EFQA 2VGOA 3R04A 2IW6A 3UO6A 4AOIA 4DGNA 3TUCA 3PPZA 1LR4A 2V5QA 3OXTA 1XBAA 2XNNA 4IB5A 4KIOA 2OO8X 5AP3A 3RVGA 2PPQA 5CZHA 2VNYA 1HCLA 3GVUA 2BPMA 2PZIA 3VRZA 2X7OA 3PJ2A 4MBLA 3NCGA 2CN8A 3BRBA 4DGLC 4I0RA 3EN4A 2GNJA 5FQDC 3LCOA 2R3LA 4YJUA 4BF2A 4C7TA 1Y8GA 1Q62A 3ML1A 4D2RA 4UYAA 3MFRA 5I9VA 4O0TA 3R9RA 2XCKA 3W8LA 4WD5A 4EWHA 3EOCA 1OMWA 4L44A 2V0DA 3QTQA 3RAHA 4EOKA 2Y8OA 3C7QA 4C61A 4FTKA 2VWZA 4J52A 4IZYA 5A54A 2GNLA 4BGGA 4F9AA 1VLRA 1CDKA 1R1WA 3UG1A 3ZLSA 3DT1A 3ORNA 5CNNA 3R73A 4MK0A 4BKZA 3T9TA 4BY9E 3BU5A 3OCSA 3ZM4A 1Q8YA 2JGZA 5B2MA 2X0QA 2JDVA 3Q4CA 3ZO1A 4L7SA 4O2PA 3RPOA 2EXMA 4RVLA 2R3QA 5HO6A 4DFBA 5DLSA 2F2CB 3LM0A 1U4DA 3LAUA 4E93A 4E6AA 1KV1A 3HMMA 3SG8A 4G16A 2C3KA 1SVGA 4OLIA 4ZK5A 4FVQA 4LMNA 5AAFA 4FSWA 4V05A 3M11A 5F9EA 4BHZA 3FLNC 2JBOA 3QHRA 2XK9A 3BGZA 4G34A 2X6DA 3FI2A 4YO4A 4ZLYA 3U6JA 1B6CB 4WNMA 3KL8A 5LVPA 3B8QA 4MNEA 5A9UA 4GJ3A 3ULZA 4PQNA 4HPTE 3U55A 2B55A 5L8JA 3OXIA 4BCJA 4MBIA 5JN2A 3FSFA 1ZYLA 5TR6A 4GRBA 3U9CA 1Q3DA 2OF2A 4PPCA 3R8LA 4N6ZA 2GCDA 4YPDA 2QU5A 4FTLA 4ANLA 4EUTA 4RZWA 3ZCLA 5KMNA 4O82A 2WU7A 2YZLA 2PE0A 3NCZA 2PZPA 5J9YA 4MWIA 5C4LA 3I4BA 2GQGA 3ETAA 5BUJA 1J7IA 4FSUA 4RLKA 3VS3A 3MB6A 1Y91A 2DQ7X 4IACA 1XR1A 3VUGA 5IMEA 3BX5A 3TM0A 3AC3A 2WQBA 5DHJA 4HVDA 4FT0A 4ANQA 4BJJB 1UWHA 5AV3A 3PG3A 2J0IA 2UW8A 4U7ZA 1IAJA 3PP0A 4MAOA 3UIBA 4QYYA 4DDIA 1BYGA 3IDPA 2JLDA 3LFDA 4UMPA 2JC6A 3PVBA 4ACDA 5FEEA 2VTSA 4H3QA 5GZAA 3DB6A 3PJCA 3O51A 2QO2A 4AUAA 3R1YA 4CZTA 2YDIA 3DOGA 4FT5A 3SOCA 3F9NA 4EBWA 3N4UA 2CPKE 3DK6A 4IXPA 3RMFA 2Z7SA 3SW4A 4GUBA 1NVQA 4XLVA 3V01A 4BIBA 3NUSA 3EN7A 4I21A 4E73A 3KRJA 4UYNA 3KF4A 4BDHA 3W18A 5AP7A 3P7AA 4L8MA 4WNPA 3HA6A 2HENA 3FQEA 4AA5A 1BUHA 2R3MA 4G17A 3BI6A 1YHSA 3PXYA 3R8MA 4PL5A 4TN6A 4YURA 3ERKA 4M7IA 3Q9ZA 5CSVA 4EOPA 1IR3A 3KB7A 2Y9QA 4EYMA 1QCFA 3NIZA 5HVYA 4CFUA 3OP5A 5JMSA 4U44A 3O2MA 4DGMA 4V01A 3FC2A 4QP1A 4BDIA 3MDYA 5JH6A 2O65A 3P23A 2RG6A 2WMUA 4FSQA 2PUUA 4CEGA 3OROA 1OB3A 2WPAA 4JXFA 4CKJA 3LFFA 1PXPA 4FK6A 2W1ZA 5GJGA 4DFZE 5GZ8A 5GZ9A 3A8WA 3D2IA 3BKBA 3KRLA 5EHYA 3QLFA 2HAKA 5FBOA 3TWJA 2XJ0A 3F3TA 5BMMA 5AV4A 3ZFXA 3P5JC 1YXVA 4D2WA 2A27A 2YM7A 4QP2A 4C4EA 2YERA 4YUQA 3C50A 3H0YA 2WKMA 3H9RA 3W55A 4FOBA 5EI8A 2VAGA 2X4FA 5IUIA 3FHRA 2J4ZA 4GUEA 3ZTXA 1G8SA 2ETKA 2XZSA 3MPAA 4ZOGA 1OVEA 5ETFA 1W2FA 4L9IA 1PXNA 5B2KA 2AEGA 5KMOA 4GK4A 4U79A 5FG8A 4CVAA 4FVPA 1W84A 2EWAA 2JDOA 2YDKA 1CKIA 3D7ZA 3FC1X 3ZZWA 3U51A 4K33A 4I6LA 5KMKA 3BPRA 2I7QA 3VBTA 3HAVA 2YWVA 1WBVA 2UVZA 4ASDA 1B38A 5FLFA 4BWKA 3MFSA 4DEAA 1SZMA 4BI0A 3K5VA 2ETMA 3KA0A 4FV2A 2J0KA 3LMGA 3Q6WA 4XRLA 1WBWA 2ZDTA 2BDWA 3I1AA 3FJQE 3OS3A 5EHOA 3VN9A 3VF9A 2SRCA 4TWCA 1GZOA 5BYYA 3C4WA 3IW7A 5CEMA 4IHPA 2RGPA 5E8ZA 3QD3A 1XMLA 3FZSA 5KMLA 3EYHA 1E1XA 5M07A 3G33A 3MIAA 4DG3E 3C9WA 1TFFA 5C4KA 1FMKA 4AXCA 3GCVA 4M3QA 4BWXA 4ALUA 3C5UA 1FGKA 3KK8A 4IVDA 4D2VA 4HGSA 5BMSA 4WT6A 5CVFA 1ZMUA 4R7HA 4EC9A 1Q5KA 1WMKA 4TKSA 3HRFA 5JFXA 5HCYA 4FT7A 1GIJA 5AUZA 4TPTA 3JR1A 3WZUA 1ZY4A 2YAKA 4D58A 3GOPA 2DS1A 4FKQA 4E3CA 5FM2A 2B7AA 3F3WA 5CF4A 3A4PA 4D4VA 4YTFA 4BDCA 5L2SA 4W9WA 2O8YA 4IQ6A 2JDRA 2XF0A 2B53A 4ITHA 2BR1A 3RAWA 3WF6A 1ND4A 1F3MC 3ENMA 3QX4A 5JRQA 3A8XA 3CS9A 3ZXTA 2NRUA 4EK6A 4ZZNA 3ZM9A 3IPHA 2ONLC 2IVVA 5J5SA 3EQBA 4DEIA 3NRMA 3LXPA 4PNIA 4Y5HA 2BFXA 4JIAA 3PXZA 2XK7A 5CT0A 3UP2A 4PNKA 4FV9A 4NW5A 5HLWA 3AOXA 3E93A 2HWOA 4EK8A 4AW1A 2VNWA 1JLUE 4U0IA 1KE7A 2XRWA 4CV9A 2R0IA 2QNJA 3M1SA 4O27B 4TYEA 4O7ZA 2XIKA 4BZNA 2BRGA 2QO7A 1CKPA 5FGKA 3T9IA 3D5XA 3NAXA 4BTJA 4EJ7A 1PMVA 2OXXA 5CXHA 4FNWA 2OFVA 2R7BA 2JKQA 3BCEA 4KKHA 4M97A 4L3JA 3DLZA 4H3PA 4EK4A 3PLAE 4RT7A 4O4DA 4L3LA 4U3ZA 4EH8A 5IQCA 3M2WA 1PYXA 1WVXA 4FKGA 3R22A 3VNTA 5M56A 2PMLX 1PW2A 3KRXA 2LAVA 3HMIA 3QRJA 3P4KA 3IW5A 1U5QA 4OBPA 2VTQA 3W33A 4FKUA 4UMQA 3PSCA 5HQ0A 5J7BA 3DS6A 3E3BX 4JBQA 3UOHA 2RFEA 3MH2A 4YJRA 5DT0A 2X2LA 2X4ZA 1NVSA 2BAKA 4EZ3A 5HX6A 3LZBA 5KMIA 5FRIA 3QXOA 4ZSAA 4FV3A 2UVXA 5H9BA 3SXRA 3H3CA 3JS2A 1ZMWA 4UZHA 4HYHA 4BDAA 4U42A 3HECA 1ZZ2A 5IMXA 2WQEA 2OZOA 3VHEA 4FA2A 4PTEA 4C4FA 4ACMA 2XP2A 1WVWA 1PHKA 2I0VA 4CT1A 4HW7A 2C1AA 3VVHA 4F7SA 2QG7A 3KMWA 2NRYA 4V0GA 3VONA 3R6XA 4RQKA 2X39A 3AC5A 3LCDA 4ZXTA 3KXGA 4R77A 2XBJA 1OPLA 4XG6A 1H01A 1J1BA 2YIRA 3D14A 5HD7A 2BRHA 2GS6A 3SDJA 2XAOA 1YOMA 1G8JA 5GJFA 2B9JA 2UW0A 4AS0A 3FPMA 4C33A 1W98A 3I0OA 4F70A 2XALA 4M0YA 4GIIA 3V6RA 4ACGA 1Q3WA 1EH4A 4RFMA 4FR4A 1H1SA 5C03A 4E6QA 1XBBA 3PPJA 3QUPA 5A46A 1F0QA 4Y95A 1RQQA 3OW4A 5A6NA 3VS1A 4GFGA 3A7FA 3I79A 2RG5A 3OFMA 3I6UA 4RRVA 4X2JA 1AGWA 2B0QA 2C0OA 1JKTA 1MUOA 3FPQA 3ZONA 5IQDA 1OKWA 3I7CA 5BVNA 3CLYA 2UW4A 4CZUA 4IDTA 2C6IA 1OL6A 1I09A 1YWVA 5M08A 3W32A 1REKA 1CMKE 5KKRC 4AWIA 4DA5A 4IX5A 2XBAA 3V5PA 4FUYA 4LRKA 4P90A 4CFNA 3KULB 4FG8A 3VUHA 4CKIA 2CDZA 3EQPA 4N57A 1Z57A 3MH0A 1K2PA 4K2RA 1XH4A 2GHMA 3KY2A 2UVYA 5IQIA 4DE4A 3WE4A 3C1XA 5K5NA 1P2AA 4UEUA 4ZY5A 4DHIB 3DNDA 4JNWA 3BWFA 2XIZA 3DQXA 4LOOA 3V6SA 4BBEA 4BCHA 3OT8A 4ZJJA 5K3YA 3VHKA 5HESA 1Q24A 2PZ5A 4IAYA 4TXCA 4R7BA 2W06A 3AD4A 2R7IA 3OWKA 4FEUA 4OTWA 2FGIA 2ZB0A 4I6BA 5CI7A 2C68A 4K9YA 5KUPA 3VS7A 2B54A 4IAKA 3IKAA 1XMMA 2WAJA 4FUXA 4AZVA 2FB8A 4V0GB 3HV4A 4MXAA 3R2YA 2UW5A 4FTIA 2I0YA 3NW6A 3ZU7A 4DHZA 5LWMA 3DZQA 4AFJA 2WU6A 5EW3A 5CASA 3OD6X 3U9NA 3EN9A 4X2KA 4JAIA 4CCBA 4GT3A 3SKCA 2X8EA 4KS8A 4WSQA 2GFCA 4FEXA 3G90X 2UZNA 4U9AA 2X81A 4MTAA 3GCQA 2OU7A 3IW4A 1GIIA 3KULA 4IC7A 1A9UA 2UZBA 4FTTA 4FVRA 5HIEA 4USFA 1VYWA 4MD7E 2ZV8A 4FSZA 4IZAA 1UU9A 2EXCX 3FXWA 1P4OA 2UW6A 1MQ4A 4RWJA 3NIEA 3QQLA 3EQGA 4RFZA 5CAOA 3LJ1A 4AZTA 1NT2A 2ZMCA 3PLSA 3R28A 1WFCA 3UDTA 2X0PA 4O6EA 3VBYA 2C3JA 5ETIA 2O0UA 1NVRA 3HKOA 5T3QA 4ZIMA 3UOKA 5JSMA 2J90A 4LMUA 3I60A 3ULIA 4BWPA 3Q4ZA 2VX0A 4LL5A 5HTCA 5TO8A 3E62A 4K8AA 4XP0A 4Z55A 3GC9A 3DLSA 3IW6A 4HZRA 2QOLA 3NNVA 1H4LA 4AW5A 4X3JA 2ZV2A 1YVJA 3OWJA 3R7GA 2WMWA 4DEDA 5FTQA 2OWBA 2WHBA 4A4LA 3GENA 3ZFYA 4EHGA 2Q0NA 4I6QA 3U4UA 4MWHA 3MH1A 4A9YA 1JSVA 4RZVA 4BDFA 3R9HA 2A2AA 2VX3A 4HYUA 4QP4A 3TIYA 3A60A 5HIDA 1KUTA 2PU8A 4JDKA 3A2CA 2EXEA 3GGFA 3E87A 2YEXA 5HKMA 4TYJA 3QC9A 5LQFA 4QP8A 2HY81 1Q99A 3NMUF 2FSOX 4IEBA 2XIYA 5A3XA 3VQHA 4BRXA 4Z16A 4X2FA 3OG7A 4C38A 5CENA 3F2RA 4K77A 3W2QA 2ERKA 4D2SA 2C6EA 5IDPA 5KZIA 3FE3A 4KABA 3VW8A 1K9AA 4C34A 3WIGA 5AADA 4NL0A 2GMXA 3SRVB 1ZRZA 3CQWA 1PXJA 4GK3A 4OW8A 4UN0C 2PZRA 5FXRA 4L46A 1PXKA 4LUDA 4OBOA 2JDTA 2IG7A 3ZBXA 3OHTA 2BHEA 2PE1A 1YHVA 2ZVAA 4F0IA 3QQHA 4JMQA 2HZIA 5E9EA 3HLLA 1P14A 4G9RA 3OT3A 4UBAA 3RWQA 5CI6A 3UNJA 2J5EA 3OF0A 3LFEA 4FSRA 4LL0A 4O7RA 4RGJA 3VBVA 3ZRLA 5HG7A 3FDNA 4QQ5A 3ZO4A 4I94A 4EKKA 3HP2A 2R0UA 5I5ZA 4BC6A 3FWQA 3BE9A 4ACHA 4Y83A 3QQGA 5T6KA 3DA6A 4NWMA 1R3CA 3I81A 4QQJA 4CRLA 3OOGA 4AG8A 4BKYA 2UZDA 3FUPA 3CPCA 2R64A 2PVKA 2R4BA 4NFMA 4ZJIA 4CQEA 4A07A 3V5LA 4G5JA 3RGFA 3Q5ZA 4DFXE 4DHFA 3CC6A 1H08A 3GU5A 4N0SA 1H8FA 4QPAA 4X21A 4AGWA 4HVHA 3FZPA 4NTSA 3ZUUA 3F61A 3ZOSA 2WD1A 2XM9A 4AT4A 5J79A 3V5WA 2HOGA 4H3BA 1R0EA 3EKNA 4KNBA 1XO2B 1CM8A 3LXKA 4QMQA 5DFPA 4R7IA 2ZM1A 4YZNA 5AP6A 1YW2A 5AJQA 2XYNA 5CAPA 1JSUA 4GW8A 4QP6A 2LGCA 4U97A 4D4SA 5HD4A 3R9OA 5IF1A 2C5XA 5ANJA 3W0OA 3NUUA 1R78A 4J98A 4RVTA 4O7WA 4QNAA 4FSMA 4O0YA 3ZC6A 4YSJA 4KIKB 4D1SA 4BCQA 3LOKA 5C8KA 1T46A 5AP1A 2BDJA 3RBWA 4EK5A 2Z7RA 4FKPA 4BKJA 3D5WA 1H07A 4R1YA 4DEGA 3P08A 2HY0A 3CQEA 4UY9A 1O9UA 3EFLA 3S95A 1OL1A 3RP9A 3F5UA 3PVGA 2QU6A 2WMXA 1HCKA 2J6MA 2XS0A 2Z02A 2AC5A 4QOXA 5AWMA 2RFNA 3D94A 4CFWA 5L8LA 4ZMEA 3P5KA 3CTQA 4B6LA 2EUFB