3DTWA

Crystal structure of the vegfr2 kinase domain in complex with a benzisoxazole inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
311
structure length
288
Chain Sequence
ERLPYDASKWEFPRDRLKLGKPLGRGGQVIEADAFGIDKTCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of amido-benzisoxazoles as potent c-Kit inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 288
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dtwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dtwA01
2F4JA 2X39A 4B99A 2CSNA 4CMTA 4ANNA 1JLUE 3R63A 5AP0A 4USFA 3Q52A 4M84A 2IN6A 3FMDA 4ZXTA 2O0UA 2BRNA 3OS3A 2ITVA 4CFNA 2O63A 4EORA 2VTQA 3GCVA 4ZSEA 4DEHA 3V3VA 1GIJA 4IIRA 4J98A 4DAWA 4E3CA 3EQBA 4YO6A 3O51A 3W10A 5C1QB 4CT1A 4TW9A 3BI6A 4MNEA 4DF3A 3CTJA 3RPVA 4YNOA 5E8ZA 3RMFA 1OUKA 4DC2A 4C33A 2YDKA 4MHAA 5GINE 2YIYA 4RQKA 2QO2A 4F63A 2GHGA 3ZFXA 1ZLTA 5HNGA 2W9FB 1CM8A 4I4FA 4GH2A 4NFMA 2VX3A 4UB7A 4IZYA 4ZEGA 1FBNA 2WMAA 4YZBA 3W32A 4FEUA 4O7SA 3QQKA 2JAVA 3LMGA 3ZBXA 5CXZA 4QMXA 2PY3A 4FF8A 1PXKA 2XK7A 4F1TA 2HY0A 4NKSA 3RAWA 3QTIA 2FGIA 4RIYA 3HV6A 4QMNA 4IX5A 3NNUA 5AV1A 3AC4A 4FTNA 5HGIA 5HVJA 2PE1A 3I7BA 3NR9A 3RCDA 3GCQA 4BF2A 1OUYA 2VX1A 2ZMDA 2W99B 3TUBA 4ZP5A 3F3VA 4CKRA 2WXVA 3PVGA 1SM2A 3QRUA 4QMYA 3ZMMA 1XWSA 4IAZA 1Y6AA 2WTKC 4J71A 4P2KA 3UIUA 4XX9A 5IH6A 5KMKA 3KVWA 2FSLX 3FDNA 3E63A 2FYSA 3ZONA 4BIBA 1R0PA 4BR3A 2ERKA 2X2KA 3ZU7A 2EB2A 3MV5A 5GHVA 2CNUA 1OPKA 4QYYA 5CSVA 3FLNC 5C4KA 5HHWA 4PTGA 4PTEA 4MYGA 2VWYA 3K2LA 1NVRA 3FLSA 4DG3E 4NYEA 4IAKA 4L7SA 1PW2A 3KA0A 4WRSA 3SKCA 4UYNA 4XP0A 5JQ5A 3IO7A 3VIDA 2BHEA 4JDHA 4OTDA 3ZUVA 4YTFA 3CY3A 5HG8A 4FTAA 4QTDA 4XG7A 4O7WA 3FLZA 2O64A 3EN7A 4G16A 3NMUF 3U6IA 1OPLA 4IC7A 4S32A 2UW6A 2YACA 3AMAA 4IX6A 4P5QA 4Z9LA 3PJ2A 3GNIB 3FI4A 4YJPA 4FE2A 4F0IA 1FVRA 2J5FA 4ZS0A 1BYGA 3Q32A 4WSQA 5D1JA 3O50A 5I4NA 4LOPA 2I40A 5HLWA 4QYEA 3UG2A 2J0JA 4X2NA 1ZMWA 3LFEA 2PUNA 3KXHA 2Q0BA 1W0XC 5DOSA 4XYFA 2CKOA 2W1CA 5CVHA 2ETMA 2BUJA 5C4LA 5AR2A 1OBDA 3OT8A 5E8WA 2YJSA 2FUMA 4CMOA 3QAME 4DE4A 3HUCA 3VO3A 2XCHA 5KNJA 4M0YA 3FL4A 3BELA 2CDZA 3FQHA 3NNVA 1NW1A 2QR7A 4PDYA 3VBWA 2Z2WA 3NYXA 4Z16A 4D2WA 3TNQB 2B9HA 4W4YA 4XRLA 2XIYA 3RNIA 4X3FC 3OCGA 4G2FA 3T8OA 4ENXA 4EH6A 4EOJA 5L3AA 3OTUA 4FV6A 4RWLA 5FP6A 2IW9A 2C0OA 5AUWA 3FZPA 3BLHA 5BVWA 4I6HA 3QQHA 3SRVA 4LMUA 1OIQA 3VHKA 4C4HA 4YLKA 4YLLA 3T9TA 3P79A 4PL4A 5D10A 1SVGA 2IW8A 5KMOA 5I3OA 3FI8A 1M2QA 5DA3A 5CS6A 3O2MA 2GNHA 4DG0E 2G15A 5F9EA 3UZPA 4O84A 4NCTA 4RJ6A 3JS2A 1PYXA 2WQMA 3PSDA 3KXXA 5DT4A 3RBWA 3NVKI 4GKHA 2QOQA 3R21A 4IXPA 1YOJA 5L2IA 3IW8A 5CQWA 5LOHA 5AP6A 4AOTA 3D5VA 4QMMA 4TTHB 2PU8A 1KV2A 3LJ2A 3NZ0A 5J7BA 4MXZA 4M13A 4JXFA 2JKQA 3GQIA 1GZNA 4L45A 3V5TA 2NRYA 4IAAA 1RJBA 4IZAA 2XIKA 4UXQA 3QXPA 3WF8A 3G15A 2XNGA 3VWAA 2VTNA 4JBOA 4ACDA 5ANJA 1WAKA 4D28A 5A46A 3COMA 3TG1A 1RE8A 2J6MA 2GDOA 4KNBA 3UIMA 4E7WA 1YRPA 2G1TA 4BIDA 2E9VA 3EFLA 3JY0A 3O0GA 3RAHA 2YERA 1W84A 2KTYA 4DT8A 1Y8YA 5CF8A 3R8PA 3VNTA 4YURA 5EQPA 1YI6A 5LXMA 4QMLA 4EJNA 4KBAA 5C03A 2I1MA 2A27A 2GNGA 2IZTA 3VUIA 4FV8A 4U80A 3EN4A 2VWZA 3ALOA 4DA5A 2FB8A 3TIYA 5IDPA 5FEDA 2BZJA 2Y0AA 4L7FA 3MESA 2XA4A 4QYGA 3HV5A 3VUKA 4GVJA 2BTSA 3FMNA 3S00A 4FTCA 3ZSIA 4UWYA 3NIEA 3Q4TA 3MJ1A 5KMIA 3R1QA 5GZ9A 3FMLA 2UUEA 4I21A 4O0TA 5HX6A 5DT0A 1K2PA 2O65A 3VS0A 2EXCX 4RJ4A 3UNZA 2X6EA 4K77A 1Q97A 3WE8A 4NUSA 3L9NA 4AFJA 4IB3A 2P4IA 3R8MA 3KF7A 4O2PA 3CE3A 3GP0A 4NJDA 4CQGA 4FGRA 3TV4A 4U0IA 1PMNA 4N4SA 5LARA 4ANLA 4FKTA 1JBPE 4EOOA 2JBPA 3THBA 2NNWB 3RP9A 4GCJA 2XRWA 1O9UA 1IEPA 2BCJA 2RFNA 5HD4A 1OZ1A 4BC6A 1CMKE 4F0GA 2XK4A 3CS9A 4EONA 5HIEA 3EQRA 3QD4A 4ZZOA 3Q5ZA 2XK6A 3QZIA 1UA2A 4FICA 3ZRKA 4AN9A 4EYJA 2UZDA 4IX4A 1Q8ZA 4QT1A 3JR1A 2V62A 3VW6A 3O8TA 3OCBA 4FG9A 2WEIA 4GFOA 3GC9A 5AAFA 4AACA 3KC3A 4DGMA 3I79A 2Q83A 4OTIA 5LCKA 1LEWA 3I6WA 3QUEA 3DLZA 5IEXA 2GMXA 3NW6A 3CQUA 4QMTA 1M2PA 3FBVA 3VHEA 3UOKA 2JAMA 3F82A 3WF5A 2Z7SA 4DLIA 3TNHA 1URWA 2JGZA 2VTJA 4JBPA 1O6YA 4U43A 5DNRA 3MVHA 4YZ9A 4OLIA 4ITHA 3P1AA 4UBAA 4BICA 3DNEA 4LUEA 4F9CA 3HMOA 4IAYA 3NRMA 4HVHA 5KKRB 1E1VA 1YOMA 5EW3A 4AZVA 5CASA 3ZRLA 2C6IA 2XYUA 3RJCA 4N6YA 3KRRA 1NY3A 5FWKK 3QA0A 2IO6A 3EMGA 4J8MA 2PVJA 3PRFA 4WNPA 4D2RA 2JIUA 1XQZA 5EM6A 5ANGA 2W1HA 4PTCA 4HZRA 2X7FA 3EFWA 3GI3A 2UW0A 4AA0A 3DZOA 4FIHA 4FIIA 3ACJA 4C4IA 1JOWB 1KE6A 1H25A 3U87A 4CCBA 5IG1A 4IVAA 2PMIA 5IPJA 3PZHA 1YHVA 4HGTA 3R73A 4H39A 5IQHA 1JKSA 4FV5A 4F7NA 3QUDA 2GCDA 4FEVA 3FKLA 4RWIA 2VN9A 4FIEA 2R2PA 1OL2A 5FP5A 4G9CA 5C9CA 1ND4A 2QKRA 4NM0A 2FH9A 1H07A 3ZRMA 5TKDA 3HRBA 2R3IA 3KN6A 4O0SA 1G3NA 2UZLA 2VV9A 2W1ZA 4QPMA 4E6DA 5BMSA 2PVHA 2QOFA 1H28A 3TJCA 1YVJA 4OBPA 3GQLA 5C01A 2R0UA 3A4PA 3PVBA 4L46A 4EK3A 2XF0A 4O21A 3MVJA 2WELA 3D2IA 2B9IA 2OK1A 1U4DA 4EOKA 2XP2A 1U5QA 5J8IA 5IH4A 4RX9A 2OICA 1U59A 3MFRA 3LHJA 2WKMA 3B2WA 5F94A 4NL0A 1YHWA 4FT9A 5H2UA 4QQTA 4DFUA 3F69A 1LR4A 1WCCA 1ZYDA 5ETAA 5FBNC 4AOIA 2YN8A 3OXTA 2XMYA 4ALVA 2OJJA 4MD8E 2Z60A 2QOBA 1H1QA 4O1OA 3TJDA 4BCKA 3H10A 3TUDA 3C9WA 1ZAOA 4O0VA 4JAJA 5H8GA 2I0HA 5LWNA 2O8YA 4NKAA 1GY3A 1PXLA 2OXYA 5HBJA 2C0IA 4MVFA 5E91A 4B8LA 2QHNA 4AW1A 2VNYA 3A7HA 4B8MA 2VGPA 1QCFA 1GZOA 3NDMA 3CQWA 5M56A 4TYHB 4XNEA 4PP7A 3ZFMA 4PDPA 4QMUA 1Q99A 3OWKA 3QCSA 4UV0A 3ZDUA 2R3NA 3TCPA 3U54A 5J79A 4QTBA 1GZ8A 5EOBA 3BYVA 4L68A 5EYKA 3P78A 5H3QA 3LJ1A 4CFXA 5K5NA 2JDRA 3G33A 3SXSA 2PVYA 5HG9A 5GZ8A 4BZOA 3JUHA 1MQBA 1MQ4A 2BFXA 5CT7A 3HVCA 4CFVA 3NVMB 2QD9A 3C5UA 3CC6A 3V6SA 4EZ5A 4JT3A 2VNWA 3VUTA 2RG5A 3OXZA 4YTIA 3GVUA 4OT6A 3RVGA 4X6QC 2HCKA 2CGUA 2X9EA 4TYHA 4YC6A 4EL9A 2PZIA 2EUFB 4FTOA 4QP2A 3EN5A 2C47A 4NIFA 5EH0A 4DH3A 3BCEA 2GNFA 3KXZA 1MRVA 3FAAA 3HDMA 4NW5A 1JNKA 4X0MA 2VU3A 1H27A 2WTWA 3FE3A 1Q8TA 3VUHA 3LVPA 4YJRA 2UVZA 2X4FA 3MY1A 4S2ZA 2PMNX 4F64A 3W1FA 4QYFA 1CTPE 4DGOA 4ANSA 2G2IA 4RJ5A 2JIVA 3FXXA 4FYNA 2C6OA 1ZY5A 3KXMA 4TL0A 2GFCA 4FT3A 4UY9A 5KE0A 4YSJA 4PMPA 3PLAE 2YISA 1SNUA 3C4ZA 3RAIA 4FUXA 3EHAA 3DKOA 5DRDA 4R78A 1QMZA 2JDOA 5GIOE 1YXTA 2ONLC 3P08A 3FXZA 3GOPA 4MD9E 4U3ZA 1RW8A 3BHHA 2R3QA 4DN5A 3SX9A 1P2AA 4AN3A 3PJ8A 4RIWB 3PJ3A 5DWRA 1QPCA 3BU3A 5JEBA 4UMPA 4FKPA 1PKGA 5L4QA 4BYJA 4J95A 5I9ZA 3ENMA 5HX8A 3ZZWA 3RPRA 3G2FA 2NRUA 2YAKA 4CT2A 3FMKA 3BEGA 4U8ZA 3GOKA 4AN2A 3AT3A 3H9OA 4RIXB 4RMZA 3CD3A 4RFZA 3UJGA 4C8BA 4L6QA 3A99A 5DIAA 1BX6A 4AU8A 3EQIA 3F5UA 3UP2A 4D1XA 3EQPA 3W2RA 4MQ1A 5IQBA 2BILB 1Q8UA 1UU9A 3VQUA 3E3PA 3FMMA 3UO5A 3O96A 3F2RA 5CX9A 4QQCA 4RVKA 1Y8GA 1H24A 3Q2MA 3QD3A 1ZMUA 3FPMA 4QO9A 5H9BA 3VW8A 2PVKA 2ZVAA 4R3PA 4M97A 4YJTA 2VO0A 2ITNA 2VO6A 4FV3A 3C51A 3HV3A 4AE9A 3I0OA 4BCJA 5K0XA 4BWPA 2QVSE 2W1FA 5AR8A 3E8EA 4YC8A 3WZEA 3U6HA 1MP8A 3P7AA 2OIBA 3P86A 4RJ3A 1VYWA 4MBJA 3M42A 4IJ9A 4P5ZA 3DK6A 4ONAA 4AT3A 1ZMVA 1BI8A 4EK8A 3LCOA 4AT4A 2XNPA 5HTBA 3Q3BA 3VBYA 5KMNA 2PWLA 3F3UA 4GSBA 2YDJA 4IH8A 3O17A 4JDKA 4IEBA 4UWBA 5FDPA 3QX4A 3PA4A 5T6KA 1M14A 4WO5A 4DGGA 3SDJA 4USEA 5DT3A 2C1BA 2BAJA 4JIAA 3LJ0A 3HP2A 3PRIA 4MWIA 4O7VA 1HCKA 1ZOEA 1LUFA 3ODZX 2GFSA 3R04A 4UZDA 4XEYA 5E8YA 5JQ8A 3F3ZA 3ORZA 4BDCA 3FYKX 4JG6A 3BWJA 3TKIA 3V51A 3AQVA 2O2UA 3IKAA 4OTPA 5FBOA 5KCVA 4MK0A 2BR1A 3TKHA 4WNMA 4FUYA 5CZIA 4QP7A 5IA0A 4GFMA 3DBQA 2F57A 4AFEA 4ANMA 2VTLA 5FM3A 2ITZA 4ALWA 3TDWA 2W9ZB 3UZRA 4Q9ZA 4HCVA 4DTAA 4TYEA 4D1SA 5L6OA 2JC6A 2GS6A 4MNFA 3HP5A 3CTQA 3KMMA 2R3MA 3QRJA 4RRVA 3C4EA 5AP1A 5F1ZA 5KX8A 2JEDA 4U79A 5EI8A 4EUUA 4KBKA 1ZYLA 3L9MA 4CYIA 4LRKA 2GQRA 2YLEA 3VJOA 2RIOA 2B9FA 4I0RA 3MY5A 4U7ZA 4EHVA 3DGKA 4L9IA 2OG8A 2YDIA 1WBWA 1W8CA 3Q60A 4LFIA 1QPEA 1BL7A 5FQDC 1S9IA 5IA1A 3R22A 2OZAB 3KREA 3IW7A 1SNXA 2PVMA 3UE4A 4APCA 4EH3A 2Q0NA 4EK5A 2WZJA 3DK7A 2V0DA 3F2NA 4BWXA 4Y8DA 2VTHA 3ACKA 4MF0A 5LCJA 2J51A 4CTCA 2IZUA 4RGJA 1Q8YA 5JMSA 5CALA 3HA8A 4WOVA 4M67A 5I9YA 3AOXA 4FI1A 3T9IA 4D4YA 2WMTA 3IOKA 4O86A 3MGYA 3KMUA 2J0LA 4YZMA 3SG9A 4CEGA 5BMMA 4R1VA 3G9NA 3R9HA 3UTOA 4F65A 5BNJA 3RI1A 5HI2A 4H3QA 4TYIA 2WTVA 5BPYA 3FC2A 4WG5A 3MW1A 3NEWA 4FV7A 4RFYA 3PXZA 2OF2A 5A4QA 3VN9A 4ACMA 5AAEA 2C5VA 1WVYA 3GU7A 2W5HA 4UMQA 3D15A 4GIIA 3O7LD 4A06A 5L2WA 4LOOA 2PE0A 2XB7A 4TWPA 3GFEA 4YTCA 5I5ZA 1OECA 4APPA 1OMWA 3OC1A 4FOBA 4RT7A 4Y46A 4BDGA 5JFVA 3DKFA 3F5PA 3QWJA 4FG8A 4UXLA 4C36A 4PPBA 3EWHA 3IGOA 2YFXA 5EHYA 2BVAA 5CEQA 1XH6A 3E64A 3BQRA 5DH3A 3TACA 4PMMA 4PDSA 4C02A 1JSUA 2OBJA 3QKKA 3NSZA 3IS5A 4E93A 4KIKB 3UOLA 2A4LA 3PZEA 1NA7A 1P5EA 4FTRA 4O27B 5EKOA 3V5LA 3A7JA 4GT4A 3ZM9A 4IX3A 4X6RA 1V1KA 5G1XA 2WU7A 4FSZA 4OTGA 3TZ7A 5EQEA 2YZAA 4FNYA 3AMBA 4WRGA 4Y5HA 3KB7A 5HE3A 5LMAA 4C61A 4WUAA 2QOHA 1DAYA 1XH9A 2PE2A 5DN3A 4YBJA 5ANOA 4JDIA 3UVPA 1FVTA 3HMMA 4XG6A 4EBWA 4RC3A 3ZCLA 4F6WA 5CU2A 2B4SB 5JH6A 2FO0A 2IPXA 3NAYA 4Y83A 4XUFA 4BTMA 4AAAA 1OIYA 3OUKA 3QTUA 1ZZLA 3QTXA 5AV0A 4PF4A 4J1RA 3TV6A 5DRBA 2JLDA 3BYOA 4JBQA 2BTRA 4O7LA 1UVRA 4KIKA 4QP4A 4AZSA 4QRCA 4QMWA 3CR0A 4HGLA 3NW5A 2ZM1A 3GENA 4FTUA 3QX2A 2HXLA 1GIHA 3CGOA 1ZXEA 4U6RA 4X21A 4E4XA 4XG4A 3GB2A 3R6XA 4O22A 2GS2A 2ZB1A 3DNDA 4MNEB 4CCUA 4YU2A 2BKKA 1J1CA 2VTTA 4BTKA 4CFUA 1BKXA 4XCUA 4NU1A 3V8WA 4QYHA 4GG5A 4KA3A 5A54A 3D7ZA 2GNLA 2ITYA 4QMSA 4YSMA 4HVGA 3BV2A 4GUEA 4CKIA 2GTNA 4S30A 3ALNA 2QCSA 2BDJA 3P0MA 3QTQA 3FMHA 4FKQA 2C69A 4C3FA 5CU6A 3SXFA 2REIA 4W4XA 3LCSA 1JWHA 2VZ6A 4ARKA 3QQUA 5AP2A 3S2PA 3SOAA 4A9RA 4B9DA 4D2TA 4D55A 5EKNA 3I5ZA 3R9NA 3DT1A 1XO2B 4MBLA 5C27A 4F4PA 4RIYB 3R28A 4D2VA 3HA6A 4MBIA 2J2IB 2BAKA 5ANEA 4QNAA 2XNEA 3BHVA 4DINA 2WB8A 3G51A 4EZ7A 1U46A 3SG8A 5HTIA 4FV2A 2HW7A 5M4CA 3QXOA 5ICPA 1PMEA 4FOCA 3QZFA 3R8ZA 3HRFA 4HVIA 5IUIA 4RG0A 1UWJA 2ETKA 5EDPA 3DQWA 2WIHA 3SGCA 1OKZA 2WMRA 3DKGA 4BTFA 2ZV8A 1H1WA 3PY0A 1IAJA 2QU5A 2E9NA 3LAUA 2X8EA 4PUZA 4ALUA 4GT3A 4PRJA 4AZEA 3QRKA 2WNTA 4GV1A 5LMBA 4XG3A 3P23A 3BHTA 4E4LA 3DJ7A 3OROA 4F7LA 4BY9E 4HYUA 1OI9A 3DQXA 2CCIA 3I6UA 5KKRC 3ZXZA 2BZIB 4Y72A 3PUPA 4F7SA 5G6VA 5J5SA 5JFXA 3IONA 4BHNA 5HIDA 4BGGA 4L8MA 5J87A 3HL7A 4ZTHA 3BU5A 3SLSA 1R0EA 4GFGA 4YGAA 3ULIA 4ACCA 3I60A 5CZHA 3CXWA 3DY7A 1LEZA 5BUIA 3U55A 3OW3A 3RCJA 2OH4A 4AWIA 5GJFA 5JGAA 4IW0A 4MX9A 3EL8A 4PPAA 3DAJA 3TZ8A 4JLCA 4O7YA 4ZLZA 3QRIA 3TDVA 1P4FA 2PVNA 2VTIA 3QFVA 4AA4A 3NCGA 3NUUA 2QLQA 4IVCA 4KWPA 4N0SA 4O96A 2FSTX 3AC2A 4CV9A 4TPTA 3H4JA 1RDQE 3I5NA 3IK3A 3FPQA 5CLPA 5C8MA 4M68A 3SW7A 1E1XA 4QMPA 1S9JA 3C50A 4G3DA 5JN2A 1KOBA 4BCPA 3SRVB 3EN9A 3TM0A 3PFQA 3RZFA 3VQHA 4ID7A 2VO7A 3ZFYA 2JFLA 3DJ5A 3IG7A 5JFWA 3MFTA 4GU9A 3MPAA 4WKQA 3UOJA 2H6DA 3KFAA 2R3PA 4FTKA 3PPKA 4AP7A 4HVSA 3I1AA 5CSPA 5E4HA 1ZYSA 3I0QA 1LPUA 4DCEA 4RQVA 3UNJA 4A9SA 2GNJA 4CG9A 3BYMA 5TF9A 2P2IA 4FTQA 5KO1A 3GC0A 2F2CB 3MPTA 2A0CX 3FZ1A 5LMKA 3UC4A 4X2GA 1W98A 4D58A 4BL1A 4O6EA 1B6CB 2VTRA 1XJDA 5E90A 3IGGA 1R78A 2C6EA 1GNGA 1VR2A 5CAOA 3VS5A 2A2AA 4L52A 2JBOA 4MAOA 3MTFA 3UC3A 3JPVA 4YNEA 1ZYCA 2VWUA 3QALE 3KL8A 5AR4A 3MBLA 4ERWA 3BRBA 3NIZA 5TO8A 5A9UA 3PG3A 4BTJA 3MS9A 4KIQA 4PMTA 4C35A 3DTWA 2R3OA 5FEQA 5EQYA 4D0WA 3MH0A 3OZ6A 3VJNA 1ZZ2A 4AW5A 4JS8A 4DEBA 3U9CA 1XHAA 2UVYA 1U5RA 3FKOA 5CY3A 3DAEA 3NWWA 3MTLA 3OG7A 2RSVA 4ZSJA 3VF8A 3Q2JA 5HE1A 4PQNA 4ZY5A 1R3CA 3CJFA 2R3LA 5DR2A 4D4RA 2QOLA 1KV1A 4FZ7A 3OF0A 5A6NA 4CVAA 4EQUA 5B2MA 2NP8A 4FC0A 4FVRA 4LMNA 4ANQA 1Q3DA 4RWJA 3AD6A 4I0TA 2WMWA 3A4OX 3I7CA 5AUUA 4PP9A 4FL2A 5HQ0A 4B0GA 4G5JA 4JJRA 3FWQA 3MI9A 3ZSGA 5BQ0A 2OFVA 5FUTA 3R1NA 1JKTA 2EXEA 3PSBA 4GK3A 4RZVA 5DFPA 3VUGA 3ZTXA 5CF6A 2XJ1A 4Y5QA 5AUZA 4EBVA 2OI4X 2GU8A 3D83A 3QCQA 4HZSA 4IJPA 5AR5A 3EH9A 3QD0A 3LQ3A 3ELJA 4IZ5A 4GVAA 2J7TA 4DITA 1BUHA 3FLQA 4J7BA 2PZ5A 1Z57A 3PP1A 3COKA 1CKPA 1M52A 3FZTA 5F20A 4I23A 3TKUA 5I3RA 3QRTA 4ZAUA 4BBFA 1V0PA 3AD4A 3HEGA 3NYNA 4I1ZA 2C5NA 2ZV9A 2F7XE 4XBRA 4DTBA 4H3PA 2BALA 3E92A 3W2PA 5KHWA 2Z7QA 4BDBA 4D2PA 2PUIA 3A8XA 4FV0A 4NM5A 2OJIA 4KKGA 1ZYJA 4UZHA 4A9UA 4JQEA 3H30A 1JAMA 2E9PA 4FKJA 2Y4IB 4AW2A 4V0GA 1J7IA 2BDWA 2BMCA 2DUVA 2WTDA 4G3GA 4U97A 5IQCA 4YC3A 5J9YA 3A61A 2PL0A 3OOMA 2VO3A 2XKEA 4N6ZA 4U5JA 1Q5KA 4G6LA 4XLVA 2XKCA 3GCPA 3R7UA 4AG8A 5IZFA 3LLAA 4ORKA 3DLSA 5IA5A 3CKXA 1SVHA 3LMIA 2CCHA 2J0MB 2VRXA 4I4EA 4OBQA 4JIKA 2QG7A 4R8QA 2YZLA 2QQ7A 4KSQA 2HWPA 4TXCA 2CLXA 3FC1X 4WG4A 3SV0A 5L2QA 4XP2A 5LWMA 5ETIA 2PVLA 5M51A 3S4QA 5CU0A 3Q9XA 2XK3A 5AUYA 5CSXA 3VRYA 4Z3VA 1P14A 4S34A 3MA3A 1TKIA 1NVQA 3AC3A 2X2LA 2YITA 4XJ0A 3TEIA 1YW2A 4NZWB 3EYGA 2W96B 4L3PA 3KN5A 5KBRA 4YHJA 3EN6A 3EQCA 4DCAA 3ZLSA 4E20A 5IKWA 1XR1A 3PXRA 4I92A 3KVXA 4XBUA 2QO9A 5HNBA 3MIYA 4ENYA 1ATPE 4GRBA 3R1SA 1VZOA 2OKRA 3PDTA 5D7VA 3M11A 5JSMA 4II5A 3DBDA 1UU7A 2PUUA 4TWCA 4RJ8A 3E7VA 3ZUTA 1SVEA 3ZO3A 5C8NA 2ITWA 2F9GA 4XRJA 3W8QA 2GPHA 2PVFA 4YMJA 3R01A 4EC9A 3WF9A 3EZRA 3BIZA 3KRJA 3W8LA 4MXYA 2C6MA 2PTKA 3PXKA 3BYSA 3MY0A 3R8UA 3ZZEA 1OKYA 4JQ7A 3LM5A 5D12A 3BU6A 3OCTA 3QYWA 4KSPA 5A4EA 4BCNA 5KMMA 4RBLA 1WVWA 2BHHA 1PYEA 4C58A 2JDSA 5FXQA 4CZUA 4JRNA 3IW4A 2OW3A 3KULA 3ERKA 2IWIA 5EFQA 4BKJA 4FEXA 5J5TA 3ROYA 2YM5A 4HYHA 4H05A 1TQMA 4O38A 2IZSA 5L2TA 2ZOQA 4OT5A 5E1EA 2R3RA 4R77A 3GU4A 3SC1A 4OUCA 4K9YA 1H00A 1XH5A 2J90A 3BWFA 4DTKA 5EOLA 3TZMA 2QONA 3VUDA 2UZVA 2RG6A 4I41A 2CLQA 1VYZA 2NO3A 4IB1A 4FVQA 4FVPA 1NT2A 4UALA 2Y9QA 5HORA 3N9XA 3WYYA 5KHXA 2Z8CA 4K1BA 4KRDA 1DI8A 3PY1A 3NW7A 3R9DA 4JNWA 3QGYA 1YDTE 3C4CA 4AZFA 4EI4A 4XOYA 3AC5A 4E4NA 4Z7HA 3RAKA 4AS0A 5IA2A 3QWKA 2B0QA 5CAVA 4MF1A 2YJRA 4G5PA 3ZM4A 4IAFA 3D14A 2OSCA 4IAIA 4C4EA 4EZ3A 1WBOA 2EB3A 4FSUA 5FEEA 4EQMA 4X3JA 2UZEA 3GU6A 3CQEA 5AV3A 5DMZA 3LLTA 3W18A 1JQHA 2OJ9A 1L3RE 2YCRA 4KS7A 2X2MA 2IVTA 3S95A 4E6CA 3R7EA 5HCZA 5ITAA 1WVXA 5DLSA 4FZFB 5BVKA 3QC4A 4QMZA 4X3FB 5A3XA 4C4GA 3HDNA 1GJOA 5CSHA 1K9AA 2QOOA 4DFBA 4NIFB 3NNXA 2QHMA 1U54A 3ZH8A 4CLIA 3OVVA 4HGSA 2J0KA 4C59A 4CXAA 3PP0A 4D5KA 2WTJA 1FOTA 5DEWA 2QOCA 4LL0A 4BZNA 1PJKA 3OT3A 3TL8A 4QNYA 4RC4A 3HGKA 3QQGA 5IF1A 3PIYA 3QCYA 4Y85A 4A07A 2AC3A 2GQSA 4IM0A 1Z5MA 3EQHA 2W5AA 1J7UA 4O7ZA 4O83A 2O3PA 5LVLA 3D94A 2XK9A 4BDFA 3BLQA 3H9FA 4MCVA 2R0IA 5HCYA 3FV8A 4PY1A 5HG5A 4KKEA 3R83A 5CEOA 2FSMX 2OO8X 2XM9A 5C8KA 5J1WA 3GUBA 4X3FA 5CF4A 3RM7A 2PYWA 2HW6A 4FMQA 4DEGA 4DH7A 2C4GA 2HZ4A 2UZUE 4IWOA 4ANBA 4BYIA 5IA3A 4FTJA 5FXSA 4K6ZA 1IRKA 2YM6A 4G34A 2UW7A 1F5QA 1Q24A 3R1YA 5I9UA 2XNOA 5A14A 4LL5A 3F7WA 3O23A 2ZM4A 1FMKA 5D9HA 4IC8A 2QODA 3MVLA 4YJVA 5AWMA 4HW7A 4OGRA 4OTRA 2RFSA 2XCKA 4PNKA 1WBNA 3WZUA 3R71A 3N51A 3L8VA 4IDTA 3OEZA 4GK2A 3QA8A 3VS4A 3W16A 4ZJVA 1H0VA 3AT4A 4FA2A 4CMUA 1AQ1A 5J1VA 3Q6WA 3UO4A 3NLBA 4C4JA 2X8DA 3C7QA 3LFAA 3V5PA 5M57A 2HYYA 1OIRA 3GC8A 3LCDA 2C0TA 2Z7RA 5M09A 3UZTA 1XH7A 5DVRA 5DR9A 2UW8A 1YXUA 5A4LA 4IADA 5IH5A 4JX7A 4PPCA 3GEQA 4QQJA 4EH8A 5AAGA 3TZ9A 3QU0A 2DYLA 3EKNA 3DCVA 4LGHA 3KY2A 3NUPA 4FL3A 4O0XA 4FKRA 2C6LA 1FINA 3OWLA 4WD5A 5LVPA 1EH4A 4DHFA 2CNQA 4JR3A 1MRYA 2F49A 4FEQA 1OVEA 5D7AA 2ZYBA 1B39A 3DTCA 3HYHA 4FGBA 4BCIA 5ANKA 2ETRA 3NS9A 4O7TA 3BGPA 5KUPA 1WBSA 3RWPA 4MWHA 3C13A 3DK3A 4BBEA 5AA8A 3LFCA 1STCE 1KE5A 2BDFA 2R3HA 1GOLA 2R5TA 3DBFA 3MWUA 2DQ7X 4Y73A 3UG1A 2CN8A 3UO6A 4F6UA 2F7EE 2KULA 1TQPA 1TQIA 2W1GA 4XP3A 4CLJA 2UZTA 5LQFA 2WMSA 3PVUA 4LV8A 4MXOA 3QQJA 2BZHB 3D5WA 4D1ZA 2YA9A 3OY1A 4GJ3A 2QG5A 3LFNA 3R7IA 2DWBA 3F3WA 3V01A 3HNGA 1VEBA 4ITIA 4J53A 3OFMA 3P7BA 5IA4A 4HYSA 3OMVA 1R39A 3PXYA 3QL8A 2QKWB 3ZO2A 3PG1A 3C0HA 5HO7A 3QYZA 4FZAB 4EH9A 1XBAA 3H3CA 4XS2A 3MVMA 3OBGA 4BIEA 3GCSA 3F9NA 5BVOA 3WIKA 5IMXA 2YLFA 2WOUA 3ORLA 1PXOA 4O1PA 3G0FA 3LPBA 4U45A 4EH5A 3ZC6A 5M4IA 3CPBA 3EL7A 4RJ7A 2VWBA 4FIFA 2J4ZA 4QPAA 3RK9A 1M17A 1H01A 3MJ2A 4MKCA 5M53A 2JIIA 2UW3A 2ZV7A 2P3GX 5AA9A 4GYIA 4FT0A 2VTSA 2XJ0A 4EHZA 3T3UA 2GNIA 2PVRA 4G17A 3BGZA 4XV3A 2I0EA 4DBNA 2F7ZE 4J97A 2HIWA 5IMEA 4YJSA 4TYJA 4BCHA 3Q9ZA 5CAUA 4ZOGA 3IECA 4I3ZA 4BDIA 5TR6A 4J96A 2E9UA 2P2HA 1VJYA 3ORTA 3AC8A 1L8TA 4IWPA 3RPSA 3QTWA 3OW4A 4FZDB 4E8AA 1YXVA 3A62A 5HIBA 2SRCA 3D9VA 3E3BX 1A06A 5EK7A 5AV2A 4IANA 4CYJA 5DPVA 4KINA 1J3HA 3ORKA 4GG7A 2V5QA 2WU6A 2AUHA 4UYAA 4D5HA 3FQSA 2BKZA 3SA0A 5ANIA 3GU5A 3AD5A 4KD1A 3VS3A 4EH7A 4KIPA 4QMOA 2ESMA 1PHKA 2IW6A 4MEDA 4MXAA 4ZJJA 4F1OA 5EDRA 2C5OA 1YQJA 3DB6A 3E62A 4I5CA 2OGVA 5KZ0A 1WFCA 4FK6A 5DE2A 4MXCA 4QP6A 4L3LA 3HLLA 1IASA 5CAPA 3FQEA 1NXKA 5M07A 5IUHA 1IA8A 3JVSA 3KK8A 4MD7E 2WQBA 3VRZA 4Q5EA 4I94A 4GU6A 4IWDA 3BEAA 2BIKB 3FI3A 2W5BA 2V7OA 3LFSA 2WIPA 5DI1A 5CENA 4ASEA 4PL3A 3UNKA 2OIQA 3GGFA 4J8NA 4U9AA 1JSVA 3V8SA 3UBDA 2OXXA 3GXLA 3OWJA 4NCTC 5AMNA 4BKZA 4GT5A 3DDQA 4K18A 1URCA 4DEIA 3HMIA 3AMYA 2AYPA 1Y6BA 5HBHA 3WF7A 4WA9A 5CSWA 5AEPA 2OF4A 2VAGA 4A4OA 3GT8A 4FV1A 4NK9A 3F66A 4CTBA 3EQFA 3IW5A 1BI7A 1Z9XA 5EDQA 1H4LA 3CGFA 2C6KA 2CGWA 2RKUA 4EK6A 1V0BA 3Q9WA 3Q4CA 2BZKB 3U4WA 4A4LA 4CZTA 4EH4A 2WQNA 3M2WA 2W1DA 3DAKA 4G6OA 3DDPA 5DG5A 3VC4A 4ZTNA 4FIGA 3GCUA 4M12A 2ACXA 3ZEPA 4BHZA 3IDBA 5EW9A 3IDCA 3ID6C 2R3JA 2WMBA 4F7JA 3K5UA 2B7AA 4DFZE 5FD2A 4R7HA 1B38A 3ET7A 5HCXA 1DI9A 3VAPA 5E92A 2CKPA 4JQ8A 3KCKA 3LW0A 4UN0C 1IA9A 4BDHA 1QL6A 4CFWA 3E7OA 5K0KA 2QI8A 3CEKA 2I6LA 2WD1A 2XZSA 4I0SA 4ZTQA 4DG2E 2XKDA 5BVFA 3NX8A 4YJNA 3KK9A 4ZTSA 2CNVA 3U4UA 1Q62A 2IZRA 3UVQA 2X9FA 5KZIA 3A8WA 3TXOA 4F70A 5A6OA 4M69A 3BZ3A 3PA3A 4JL9A 3BGQA 4CQEA 5CEMA 3MDYA 2C30A 3DOGA 2Z7LA 3II5A 3VVHA 4LGGA 1FMOE 2VWVA 2JKKA 3LXKA 2ZB0A 3UODA 3RK5A 4G6NA 3DBEA 4HNIA 2WPAA 4LRJA 5LVNA 4FBXA 3N4TA 3EFJA 2CHLA 3CBLA 2X7GA 4FKUA 4D9UA 2WMXA 2G01A 4H1MA 4K11A 4KAOA 3RM6A 5IDNA 4FG7A 5AJQA 3DBCA 4AXAA 3L1SA 3Q5IA 2BFYA 3CTHA 2C3JA 3E5AA 3LE6A 2IJMA 3BE2A 3E87A 5AP4A 1Y91A 4UMRA 4YPDA 2VWWA 4EWQA 3R8LA 4WBBB 3PXFA 4RIOA 3C1XA 5AM6A 2PUPA 2XUUA 3UQFA 1QPDA 2XYNA 5DBXA 3DA6A 4K33A 5L8KA 5JKGA 2Y4IC 3LFBA 2XM8A 4V05A 5CI6A 4EOLA 1OIUA 3JVRA 4NTTA 3C0GA 4R1YA 4TNDA 3S1HA 4ZMFA 3R2BA 4ITJA 1Q8WA 3GU8A 1JSTA 1SMHA 1UU3A 3HMNA 5M06A 2GS7A 4EOSA 5E8TA 2W4KA 2X4ZA 2B9JA 2PSQA 4M66A 3DXQA 4H58A 3Q04A 4S33A 5HLPA 4C4FA 1XH4A 2J5EA 3FL5A 4FNXA 2YCFA 3SXRA 3C4WA 4IVBA 3ORXA 1SYKA 4PNIA 4D2SA 2QR8A 3HRCA 3ITZA 2EVAA 2OU7A 3DV3A 3MPMA 1Q4LA 2VTOA 1T45A 2XIZA 2XS0A 3E8NA 3LXLA 4JG8A 5IQEA 4M0ZA 5FDXA 1MUOA 4M14A 1BLXA 5J7HA 5HESA 3ORPA 3PY3A 2ONLA 4IBMA 4ZK5A 2ZV2A 2JITA 2V22A 4E5BA 4IM3A 5BVEA 3Q6UA 5IUGA 2WGJA 3O8PA 4G3FA 2BRGA 4L3JA 3ZLWA 4HGEA 3BQCA 3AT2A 2QNJA 3D7TA 2QOIA 4AGCA 4NM7A 1YDRE 3Q4ZA 2X8IA 1IR3A 1ZWSA 3BYUA 3EYHA 3O71A 1WBTA 4K8AA 4TY1A 3U9NA 3WZKA 5LVOA 1ERKA 3WI6A 2UZOA 4KBCA 3TTJA 4A9TA 5AADA 4ZTRA 2H34A 1H8FA 4IE9A 4KRCA 3OWPA 2IVSA 4ZY6A 1KWPA 3NUXA 4DH8A 2YIRA 1CDKA 4ZSLA 1PRYA 5HTCA 4H36A 1ZOGA 4U41A 5BUJA 2CPKE 3QTSA 1FVVA 2ITTA 4RZWA 3LMHA 4F6SA 5HE0A 5HZNA 4JG7A 4K0YA 3Q9YA 2YABA 4IQ6A 1REJA 4JDJA 4C3RA 1ZRZA 3UMXA 4TWOA 3BBTB 4IHPA 3LXPA 4PWNA 2ZDUA 2XH5A 3U8WA 4RPVA 1HCLA 4Z55A 5A4TA 2PULA 4O81A 3QUPA 3EQDA 3PVWA 3MFSA 1X8BA 4Q9SA 4HPUE 3BBWA 4BCFA 4GUBA 4AX8A 4C3PA 5M08A 1OKWA 5CVFA 4D0XA 2OWBA 3QGWA 1UKIA 3DZQA 4FKSA 3QKLA 1PY5A 4L44A 3OD6X 3PIXA 2C5XA 4EHEA 5HU3A 3MN3A 4CRSA 1OM1A 3W2OA 4ASZA 2XJ2A 4IZ7A 5CEPA 1Y57A 4YJUA 4MQ2A 5GNKA 2IG7A 4EEVA 2VGOA 2YAAA 3DFCB 3K54A 5E8XA 3DFAA 3PIZA 4WBOA 2UW5A 3V5JA 5IISA 2CJMA 3VS1A 2GHLA 3QTRA 2O5KA 3F6XA 2XNBA 3WARA 2QC6A 3VS7A 3LFFA 3FY0A 2OFUA 2OIDA 3CD8A 4AQCA 3KEXA 1WBPA 3UMWA 1G8SA 3DXPA 3TT0A 4UWCA 3NAXA 4W4WA 1MRUA 3WE4A 3BE9A 5F95A 3F61A 4O7NA 4XLIA 4L53A 2W7XA 2GTMA 2IVVA 4L00A 4CG8A 1XBBA 2J0IA 4LRMA 4KS8A 4MH7A 3UDBA 4DEDA 2B55A 4JOAA 4BN1A 3CSVA 4AGWA 4DLJA 5L8JA 5AUTA 3UVRA 2I7QA 4X2JA 4ZTLA 1W83A 3ZUUA 4ZLYA 4QMVA 4OAVB 3UOHA 2PZRA 4R7IA 3A7IA 2LGCA 2UVXA 4W9WA 2XEZA 4RLKA 1PMUA 5T68A 2PHKA 4V04A 2XRUA 2C68A 3IPHA 4O0YA 3ZXTA 4KUJA 5HG7A 3G0EA 2G9XA 4BZDA 1J1BA 3SQQA 3QHWA 4OR5A 3B8QA 4KB8A 3CPCA 1ZOHA 4DYMA 4IDVA 3UP7A 2WTIA 4QMQA 5B7VA 4PV0A 4L01A 5AM7A 2ZDTA 1XH8A 2RGPA 5DHJA 2X0GA 2XKFA 2X6DA 4C2WA 4NEUA 3I4BA 1REKA 3KU2A 4G9RA 3BKBA 2YIXA 5ACKA 4H1JA 4YZCA 1J91A 2RFDA 3VBQA 3EZVA 4A4XA 4FKVA 4H3BA 5J95A 1FQ1B 4CRLA 2VTAA 3QQLA 3RGFA 3T3VA 4QP3A 3EFKA 3GBZA 4UMTA 3R2YA 4DH5A 4FV9A 3JYAA 3AC1A 3N4VA 4M8TA 2IVUA 3PYYA 4I24A 3E88A 4AGDA 4CFMA 1R1WA 2ITUA 5EM5A 4O0UA 4AZWA 3OCSA 4E73A 4AF3A 3TUCA 4E26A 3FY2A 3AGMA 4GYGA 3TN8A 2HK5A 2Y8OA 2J50A 3M1SA 4FNZA 4V0GB 3QTZA 3FZOA 4G3CA 4QPSA 5CTPA 3FZSA 4DFLA 4OTQA 3TTIA 1Q41A 4IB5A 2CKEA 4AE6A 5GJGA 2YM7A 3D0EA 3OXIA 2W06A 4WIHA 5L6PA 3KRLA 5ACBC 3G6HA 3LCKA 4ASXA 4QTAA 4B7TA 3CIKA 2P33A 1YWRA 5HLNA 3A60A 3FMJA 1G8AA 4RSSA 2E2BA 4EK4A 4XMOA 2QOKA 1O6LA 4JAIA 1BMKA 1P4OA 1I09A 1YXSA 4X2FA 5FM2A 2YHVA 3VUMA 4BVUA 4DH1A 1PXNA 5FLFA 4YP8A 5I9VA 4ZZMA 3F88A 4FSYA 4QTCA 5GJDA 4FT5A 2R3KA 2H9VA 2V55A 3MA6A 2C3IB 5HNIX 3SVVA 5CEKA 5K4JA 2JFMA 2BRHA 4J52A 1JKLA 3MB7A 1UU8A 1DS5A 4B6LA 4PX6A 4AT5A 4KKHA 2HY81 4PMSA 5AFVA 5EM8A 2HAKA 4HJOA 2CGVA 2DS1A 1W7HA 4QP8A 3POZA 5IQDA 4CD0A 3RALA 4NT4A 3LXNA 3V04A 5DGZA 2HZNA 2A19B 5AP7A 4RFMA 3L9LA 4F9AA 3OTVA 4XV9A 3PSCA 5E1SA 5BYZA 5HKMA 2YM8A 4GIHA 3R00A 1HOWA 3HUBA 5B2KA 2JKOA 3G5DA 3KQ7A 3ZBFA 3RK7A 3TNWA 5FRIA 4ACHA 2PPQA 4YR8A 4HCTA 3O8UA 3C0IA 5HD7A 3H0YA 4XHKB 4N57A 2JKMA 2UV2A 3FJQE 1TVOA 1CSNA 3H9RA 5EI6A 5HICA 4BCMA 4C7TA 4J99A 3OHTA 3BHUA 2ITXA 5IQAA 4BB4A 3QLFA 4OTHA 1YWVA 1PMVA 4YUQA 3HX4A 5CI7A 3UIXA 4W8DA 4A7CA 4YHFA 4JX3A 3RHKA 3BHYA 5H8BA 1PXPA 2P55A 4KIOA 1KUTA 1H1RA 1V0OA 3FXWA 2R3FA 3CP9A 4P7EA 3PE1A 4C34A 2OLCA 3KULB 3JXWA 2WMUA 2NPQA 3POOA 4NJ3A 3ATSA 3NUNA 4FSTA 3KGAA 2Y6MA 5FGKA 4IWQA 2XBJA 4GK4A 5AP5A 3QC9A 5JZNA 4FSQA 2Z02A 2EWAA 3EIDA 2BAQA 3VF9A 3WZJA 3HKOA 1E9HA 5H8EA 4CNHA 2YEXA 2YIQA 3FUPA 4ZS4A 1OKVA 4PL5A 5JRSA 1OGUA 3IOPA 2BRBA 2ZJWA 4X2KA 4ZIMA 3OEFX 4RVLA 1UNLA 5FTOA 3ZYAA 4FSRA 4BCOA 4E6QA 4EC8A 2R9SA 2WMVA 4Q5HA 5C26A 3MH2A 4JI9A 3TNPC 2R7BA 3VULA 4O82A 2WQEA 5TT7A 4K2RA 2H96A 3HECA 3LZBA 3NNWA 4O0WA 1G5SA 3JY9A 4BI1A 3N4UA 1PF8A 3IW6A 3P9JA 3UYTA 4C62A 2XNMA 1GIIA 4QD6A 2WTKB 4BDKA 2HOGA 1ZY4A 3OP5A 1AD5A 4C38A 3P7CA 3COHA 2CN5A 3PWYA 4DFNA 1Q61A 4GS6A 2VWIA 3LFDA 1YI3A 3RWQA 3AG9A 4WSYA 2RL5A 3DS6A 3SD0A 3ZEWA 5IEYA 1UV5A 4C0TA 5BUEA 3ZLXA 2W1IA 2Y7JA 4P90A 5HU9A 4P4CA 3MIAA 1F3MC 2HELA 3HMPA 3REPA 1J7LA 3FSFA 3F5XA 5AIKA 2HZIA 3R7GA 2ZM3A 4AZTA 3DKCA 3PTGA 3R0TA 3Q53A 2OJFE 4RX8A 5CYIA 4FKGA 3KF4A 4C57A 5IEVA 4TN6A 4OAUC 3ZLYA 5JK3A 4JRVA 1AGWA 3LQ5A 4IFCA 4XG8A 1OBGA 3A7FA 3VS2A 4QTEA 4NWMA 1U54B 4TKSA 2QURA 4D4VA 3AGLA 3LCTA 1BL6A 3ZC5A 5CXHA 5EYDA 3EJ1A 3ZS5A 4FSNA 3QZGA 2JD5A 2UZNA 3C4FA 4I5HA 4L67A 5I9WA 1IAHA 4AA5A 4I93A 4W4VA 4NSTA 1KSWA 4GJ2A 4ZLOA 2PMOX 2I0YA 4CFFA 2UZWE 2PK9A 3OOGA 3EKKA 5K4IA 2VD5A 3KRXA 1JVPP 3C4XA 4LGDA 4AUAA 4YJQA 4ERKA 2F2UA 4RA5A 1K3AA 4UX9A 3FEGA 3R30A 4EWHA 2HENA 4LOQA 2C5YA 3WOWA 3RKBA 4USDA 5B0XA 4D9TA 3OUNB 3PJ1A 5FTQA 3F5GA 3ZOSA 4NTSA 3NYVA 1XBCA 4M15A 4FYOA 3MH1A 4ACGA 1KE9A 5CWZA 2LAVA 4ASDA 4HNFA 4I6BA 4EYMA 4O0RA 2R4BA 4UMUA 4F0FA 3RPYA 5ANDA 4FNWA 5M4FA 2C6TA 3PPJA 2VWXA 3G6GA 4GL9A 2QLUA 5E8SA 4FX3A 2VX0A 4BDDA 3W2CA 3KXGA 4FT7A 3PXQA 2WHBA 3R8VA 2GQGA 4DFYA 2EU9A 2OH0E 3PE2A 5BX0A 5LVMA 4DFXE 2UW4A 2V7AA 3LKMA 5DYJA 4U81A 4EUTA 2XBAA 5E8VA 3D2KA 2HZ0A 4M3QA 2B53A 2W1EA 4I20A 4IVDA 2A1AB 2CGXA 1UWHA 4R7BA 4W8EA 3LIJA 4I22A 3WF6A 2B1PA 4FODA 2R7IA 2YM3A 4BI2A 4E4MA 3FLYA 5DEYA 2QO7A 4LV5A 4RWKA 3C5IA 3UQGA 3VS6A 5AUVA 2XIRA 2XIXA 2W4OA 3D5UA 4BDJA 5L2SA 4FSMA 3FYJX 5L6WL 5JGBA 5HOAA 4R3CA 5GIPE 1KE7A 5IQGA 3COIA 4MTAA 3TWJA 3ZHPC 4E6AA 5ETCA 3TNIA 5F4NA 5K9IA 3UQCA 3EOCA 3FHIA 4FK3A 5EM7A 4CGAA 2BIYA 3KMWA 3MYGA 2YWVA 4DEEA 3QF9A 4KABA 3K5VA 5I0BA 1GAGA 3IDPA 4B4LA 3NUSA 4FV4A 4R3RA 5CNNA 2C3LA 3NPCA 4RC2A 4TWNA 5CU4A 4BDEA 4DGLC 3QQFA 4O2ZA 4EKLA 3B2TA 5CNOA 4Z7GA 3ANRA 5HEZA 4EOMA 5J9ZA 2QU6A 5HO8A 2CKQA 5JZJA 2YCSA 3NUYA 3I81A 3PPZA 1WBVA 2C3KA 1SZMA 2W17A 3MSSA 4FSWA 4NW6A 3V5QA 3NCZA 4IMYA 4E5WA 3PJCA 3ODYX 4EJ7A 3IQ7A 3E93A 2XNNA 1OB3A 4U44A 4OW8A 5AUXA 2G2FA 3O7LB 4YTHA 4ZMEA 4CV8A 5HBEA 4R5YA 3V8TA 3HAMA 4I5PA 5HVYA 3PA5A 4V01A 4W9XA 4CSVA 4EOPA 1M7NA 4F9YA 3S0OA 3MFUA 4U42A 3UYSA 5D11A 4LQMA 5T3QA 4DEAA 4LM5A 4F1MA 3P5KA 3W33A 4IACA 3GC7A 1JPAA 4QQ5A 5EYMA 3TV7A 4BGQA 5L8LA 3L8PA 2PZPA 5M4UA 4GEOA 5K5XA 3SAYA 5GZAA 4RA4A 4LI5A 2WMQA 4BWKA 4Y95A 3SW4A 2ITQA 4JBVA 4Q2AA 5EW8A 1UNHA 1FGKA 1WMKA 2ZMCA 4A9YA 1YI4A 1PKDA 3F7ZA 1H08A 5D41A 3DJ6A 3ZO1A 3S3IA 3RTPA 5JRQA 1GZKA 2J9MA 3QHRA 2I0VA 3ENHA 4RIWA 4I5MA 4QOXA 3E8CA 3L8SA 4F9BA 2UW9A 2R64A 4HVDA 3R7YA 4FTMA 4O91A 3HV4A 4FKIA 3WBLA 4C2VA 5JGDA 3Q4UA 1M2RA 2ITPA 3TI1A 3AXWA 2HXQA 2FSOX 1OL1A 3QKMA 3VBVA 2GHMA 5M55A 4XH6A 1I44A 4OBOA 1O6KA 4XOZA 4RIXA 3R7OA 4S31A 3V6RA 1WZYA 1KOAA 4TZRA 4M7IA 3CLYA 5JFSA 2ITOA 3NGAA 3ETAA 5ETFA 3BX5A 4YLJA 2YM4A 2PZYA 1UNGA 1PXIA 4RX7A 3DU8A 1DAWA 1ZARA 1QPJA 4YZNA 5DR6A 4ZY4A 2P0CA 3LOKA 2WAJA 4YBKA 3H0ZA 1YKRA 2VUWA 4HYIA 3ULZA 1OITA 3W55A 4F9WA 4YO4A 2PMLX 1H26A 1OL6A 2XK8A 3ZO4A 5E7RA 5E8UA 4TRLA 2YIWA 4DT9A 4NFNA 3RZBA 4TNBA 4EKKA 2RFEA 4BCGA 1KE8A 2C6DA 2RF9A 2XEYA 2XVDA 3KRWA 1CKIA 4FZ6A 4R6VA 5CEIA 3FLWA 5LMKC 3GFWA 5AX3A 5E9EA 3Q96A 3RNYA 3D4QA 3OY3A 4MXXA 3BLRA 4EOQA 4AGUA 2B54A 3FSKA 1PXJA 4FKLA 4NH1A 4TT7A 2Y4PA 3BV3A 4FR4A 4RVTA 3R02A 3ATTA 4GKIA 4FTTA 5AIRA 3LFQA 5HE2A 3PWDA 5LJJA 4ANOA 5BYYA 1DM2A 5CT0A 4I6FA 4U40A 4F99A 3W2QA 2G2HA 5A4CA 2WQOA 4JR7A 2W0JA 4EQCA 5AX9A 1IG1A 4D4SA 4FTLA 3L9PA 4G31A 4I6QA 2EXMA 4O6LA 5EYCA 2X1NA 4GW8A 5B2LA 3VBXA 2FVDA 5EI2A 2BROA 4GMYA 3P4KA 3RHXA 5TE0A 2B52A 3LQ8A 3HZTA 4EHGA 4ZTMA 3FI2A 4O7RA 3G9LX 3UIBA 4AOJA 4OTFA 1APME 4XV2A 4E5AX 3FKNA 3K3IA 2E9OA 5KMLA 4DBXA 4L42A 1OL7A 1RQQA 1A48A 3SHEA 5I9XA 5BVNA 5IQFA 3ORNA 3RPOA 1A9UA 4LYNA 4M69B 3QD2B 3G90X 3A2CA 3UPZA 1YHSA 5CAQA 4FKOA 3RINA 1W82A 4X7QA 4F08A 3UGCA 5FXRA 2ZAZA 4JVGA 3A7GA 4BDAA 4WNKA 4FKWA 2YWPA 2ERZE 3EB0A 3PLSA 1F0QA 4IB0A 4WUNA 2BPMA 3L8XA 5AR7A 3CKWA 3CJGA 5EG3A 4FEWA 1FPUA 4PDOA 2C1AA 2UZBA 3KXNA 4ZSAA 5M44A 2OZAA 4HPTE 2JDTA 4BFMA 2VTPA 5AR3A 3BPRA 4YJOA 3K3JA 2WTCA 2CMWA 2YCQA 3FMEA 5KBQA 4BGHA 3CCNA 2VTMA 3HAVA 1YDSE 3CY2A 3F2AA 4IM2A 2H8HA 4XG9A 4RX5A 4YPSA 2X7OA 4G3EA 4C37A 5FG8A 1JKKA 4QP1A 4NM3A 4DGNA 5EHLA 5CANA 4EH2A 4BBMA 3ANQA 3TIZA 3E8DA 1YXXA 2HWOA 4YZDA 1CKJA 1OPJA 3SOCA 3MH3A 5CU3A 4RLLA 4LUDA 5HO6A 3R9OA 3OBJA 4BI0A 4E1ZA 2OZOA 4R5SA 3KCFA 2W4JA 2OXDA 3DPKA 4OTWA 4ZJIA 2AC5A 2WOTA 4WT6A 4BCQA 4LG4A 4TYGA 4XG2A 4ZSGA 5EHOA 4CKJA 3LM0A 5JT2A 5IQIA 5CF5A 4WNOA 1LP4A 4F09A 5CVGA 1H1PA 2GSFA 4EOIA 3R9RA 2W05A 4L43A 1FGIA 4BKYA 4IFGA 4FL1A 5K3YA 2BRMA 2X81A 4BRXA 5KMJA 1Q3WA 1YWNA 5BVDA 4QP9A 2Y6OA 3DB8A 4RVMA 3NUAA 2R3GA 4HCUA 3ROCA 5IU2A 1M7QA 1NVSA 3U51A 3DXNA 3HV7A 3UPXA 3V5WA 3NYOA 4AW0A 3QBNA 3W2SA 4WHZA 3MB6A 3WYXA 2WEVA 1H0WA 5BYLA 1PXMA 3B8RA 3FZRA 3R7VA 3ZSHA 1T46A 2WFYA 4FTIA 4FIJA 5AV4A 4YHTA 3VBTA 3QCXA 5CQUA 3U6JA 4ZZNA 3QZHA 4N70A 4XV1A 3QLGA 4HOKA 5TOZA 2WO6A 3D7TB 4G1WA 5HVKA 1YOLA 1OL5A 3ORIA 2FA2A 4WG3A 3FHRA 2OJGA 1XKKA 5AP3A 5FTGA 3ORMA 3ZDIA 1UKHA 3EQGA 4CZYB 3WILA 3WZDA 5J9LA 3D5XA 3KKVA 2JDVA 3F3TA 4UEUA 3WIGA 1H1SA 4U3YA
chains in the Genus database with same CATH superfamily
2F4JA 2X39A 4B99A 2CSNA 4CMTA 4ANNA 1JLUE 3R63A 5AP0A 4USFA 3Q52A 4M84A 2IN6A 3FMDA 4ZXTA 2O0UA 2BRNA 3OS3A 2ITVA 4CFNA 2O63A 4EORA 2VTQA 3GCVA 4ZSEA 4DEHA 3V3VA 1GIJA 4IIRA 4J98A 4DAWA 4E3CA 3EQBA 4YO6A 3O51A 3W10A 5C1QB 4CT1A 4TW9A 3BI6A 4MNEA 4DF3A 3CTJA 3RPVA 4YNOA 5E8ZA 3RMFA 1OUKA 4DC2A 4C33A 2YDKA 4MHAA 5GINE 2YIYA 4RQKA 2QO2A 4F63A 2GHGA 3NFFB 3ZFXA 1ZLTA 5HNGA 2W9FB 1CM8A 4I4FA 4GH2A 4NFMA 2VX3A 4UB7A 4IZYA 4ZEGA 1FBNA 2WMAA 4YZBA 4LV7A 3W32A 4FEUA 4O7SA 3QQKA 2JAVA 3LMGA 3ZBXA 5CXZA 4QMXA 2PY3A 4FF8A 1PXKA 4O4BB 2XK7A 4F1TA 2HY0A 4NKSA 3RAWA 3QTIA 2FGIA 4RIYA 3HV6A 4QMNA 4IX5A 3NNUA 5AV1A 3AC4A 4FTNA 5HGIA 5HVJA 2PE1A 3I7BA 3NR9A 3RCDA 3GCQA 4BF2A 1OUYA 2VX1A 2ZMDA 2W99B 3TUBA 4ZP5A 3F3VA 4CKRA 2WXVA 3PVGA 1SM2A 3QRUA 4QMYA 3ZMMA 1XWSA 4IAZA 1Y6AA 2WTKC 4J71A 4P2KA 3UIUA 4XX9A 5IH6A 5KMKA 3KVWA 4FJVA 2FSLX 3FDNA 3E63A 2FYSA 3ZONA 4BIBA 1R0PA 4BR3A 2ERKA 2X2KA 3ZU7A 2EB2A 3MV5A 5GHVA 2CNUA 1OPKA 4QYYA 5CSVA 3FLNC 5C4KA 5HHWA 4PTGA 4PTEA 4MYGA 2VWYA 3K2LA 1NVRA 3FLSA 4DG3E 4NYEA 4IAKA 4L7SA 1PW2A 3KA0A 4WRSA 3SKCA 4UYNA 4XP0A 5JQ5A 3IO7A 3VIDA 2BHEA 4JDHA 4OTDA 3ZUVA 4YTFA 3CY3A 5HG8A 4FTAA 4QTDA 4XG7A 4O7WA 3FLZA 2O64A 3EN7A 4G16A 3NMUF 3U6IA 1OPLA 4IC7A 4S32A 2UW6A 2YACA 3AMAA 4IX6A 4P5QA 4Z9LA 3PJ2A 3GNIB 3FI4A 4YJPA 4FE2A 4F0IA 1FVRA 2J5FA 4ZS0A 1BYGA 3Q32A 4WSQA 5D1JA 3O50A 5I4NA 4LOPA 2I40A 5HLWA 4QYEA 3UG2A 2J0JA 4X2NA 1ZMWA 3LFEA 2PUNA 3KXHA 2Q0BA 1W0XC 5DOSA 4XYFA 2CKOA 2W1CA 5CVHA 2ETMA 1XMLA 2BUJA 5C4LA 5AR2A 1OBDA 3OT8A 5E8WA 2YJSA 2FUMA 4CMOA 3QAME 4DE4A 3HUCA 3VO3A 2XCHA 5KNJA 4M0YA 3FL4A 3BELA 2CDZA 3FQHA 3NNVA 1NW1A 2QR7A 4PDYA 3VBWA 2Z2WA 3NYXA 4Z16A 4D2WA 3TNQB 2B9HA 4W4YA 4XRLA 2XIYA 3RNIA 4X3FC 3OCGA 4G2FA 3T8OA 4ENXA 4EH6A 4EOJA 5L3AA 3OTUA 4FV6A 4RWLA 5FP6A 2IW9A 2C0OA 5AUWA 3FZPA 3BLHA 5BVWA 4I6HA 3QQHA 3SRVA 4LMUA 1OIQA 3VHKA 4C4HA 4YLKA 4YLLA 3T9TA 3P79A 4PL4A 5D10A 1SVGA 2IW8A 5KMOA 5I3OA 3FI8A 1M2QA 5DA3A 5CS6A 3O2MA 2GNHA 4DG0E 2G15A 5F9EA 3UZPA 4O84A 4NCTA 4RJ6A 3JS2A 1PYXA 2WQMA 3PSDA 3KXXA 5DT4A 3RBWA 3NVKI 4GKHA 2QOQA 3R21A 4IXPA 1YOJA 5L2IA 3IW8A 5CQWA 5LOHA 5AP6A 4AOTA 3D5VA 4QMMA 4TTHB 2PU8A 1KV2A 3LJ2A 3NZ0A 5J7BA 4MXZA 4M13A 4JXFA 2JKQA 3GQIA 1GZNA 4L45A 3V5TA 2NRYA 4IAAA 1RJBA 4IZAA 2XIKA 4UXQA 3QXPA 3WF8A 3G15A 2XNGA 3VWAA 2VTNA 4JBOA 4ACDA 5ANJA 1WAKA 4D28A 5A46A 3COMA 3TG1A 1RE8A 2J6MA 2GDOA 4KNBA 3UIMA 4E7WA 1YRPA 2G1TA 4BIDA 2E9VA 3EFLA 3JY0A 3O0GA 3RAHA 2YERA 1W84A 2KTYA 4DT8A 1Y8YA 5CF8A 3R8PA 3VNTA 4YURA 5EQPA 1YI6A 5LXMA 4QMLA 4EJNA 4KBAA 5C03A 2I1MA 2A27A 2GNGA 2IZTA 3VUIA 4FV8A 4U80A 3EN4A 2VWZA 3ALOA 4DA5A 2FB8A 3TIYA 5IDPA 5FEDA 2BZJA 2Y0AA 4L7FA 3MESA 2XA4A 4QYGA 3HV5A 3VUKA 4GVJA 2BTSA 3FMNA 3S00A 4FTCA 3ZSIA 4UWYA 3NIEA 3Q4TA 3MJ1A 5KMIA 3R1QA 5GZ9A 3FMLA 2UUEA 4I21A 4O0TA 5HX6A 5DT0A 1G8KA 1K2PA 2O65A 3VS0A 2EXCX 4RJ4A 3UNZA 2X6EA 4K77A 1Q97A 3WE8A 4NUSA 3L9NA 4AFJA 4IB3A 2P4IA 3R8MA 3P5JC 3KF7A 4O2PA 3CE3A 3GP0A 4NJDA 4CQGA 4FGRA 3TV4A 4U0IA 1PMNA 4N4SA 5LARA 4ANLA 4FKTA 1JBPE 4EOOA 2JBPA 3THBA 2NNWB 3RP9A 4GCJA 3AKJA 2XRWA 1O9UA 1IEPA 2BCJA 2RFNA 5HD4A 1OZ1A 4BC6A 1CMKE 4F0GA 2XK4A 3CS9A 4EONA 5HIEA 3EQRA 3QD4A 4ZZOA 3Q5ZA 2XK6A 3QZIA 1UA2A 4FICA 3ZRKA 4AN9A 4EYJA 2UZDA 4IX4A 2XALA 1Q8ZA 4QT1A 3JR1A 2V62A 3VW6A 3O8TA 3OCBA 4FG9A 2WEIA 4GFOA 3GC9A 5AAFA 4AACA 3KC3A 4DGMA 3I79A 2Q83A 4OTIA 5LCKA 1LEWA 3I6WA 3QUEA 3DLZA 5IEXA 2GMXA 3NW6A 3CQUA 4QMTA 1M2PA 2AEGA 3FBVA 3VHEA 3UOKA 2JAMA 3F82A 3WF5A 2Z7SA 4DLIA 3TNHA 1URWA 2JGZA 2VTJA 4JBPA 1O6YA 4U43A 5DNRA 3MVHA 4YZ9A 4OLIA 4ITHA 3P1AA 4UBAA 4BICA 3DNEA 4LUEA 4F9CA 3HMOA 4IAYA 3NRMA 4HVHA 5KKRB 1E1VA 1YOMA 5EW3A 4AZVA 5CASA 3ZRLA 2C6IA 2XYUA 3RJCA 4N6YA 3KRRA 1NY3A 5FWKK 3QA0A 2IO6A 3EMGA 4J8MA 2PVJA 3PRFA 4WNPA 4D2RA 3W0QA 2JIUA 1XQZA 5EM6A 5ANGA 1G8JA 2W1HA 4PTCA 4HZRA 2X7FA 3EFWA 3GI3A 2UW0A 4AA0A 3DZOA 4FIHA 4FIIA 3ACJA 4C4IA 1JOWB 1KE6A 1H25A 3U87A 4CCBA 5IG1A 4IVAA 2PMIA 5IPJA 3PZHA 1YHVA 4HGTA 3R73A 4H39A 5IQHA 1JKSA 4FV5A 4F7NA 3QUDA 2GCDA 4FEVA 3FKLA 4RWIA 2VN9A 4FIEA 2R2PA 1OL2A 5FP5A 4G9CA 5C9CA 1ND4A 2QKRA 4NM0A 2FH9A 1H07A 3BL7A 3ZRMA 5TKDA 3HRBA 2R3IA 3TYKA 3KN6A 4O0SA 1G3NA 2UZLA 2VV9A 2W1ZA 4QPMA 4E6DA 5BMSA 2PVHA 2QOFA 1H28A 3TJCA 1YVJA 4OBPA 3GQLA 3VONA 5C01A 2R0UA 3A4PA 3PVBA 4L46A 4EK3A 2XF0A 4O21A 3MVJA 2WELA 3D2IA 2B9IA 2OK1A 1U4DA 4EOKA 2XP2A 1U5QA 5J8IA 5IH4A 4RX9A 2OICA 1U59A 3MFRA 3LHJA 2WKMA 3B2WA 5F94A 4NL0A 1YHWA 4FT9A 5H2UA 4QQTA 4DFUA 3F69A 1LR4A 1WCCA 1ZYDA 5ETAA 5FBNC 4AOIA 2YN8A 3OXTA 2XMYA 4ALVA 2OJJA 4MD8E 2Z60A 2QOBA 1H1QA 4O1OA 3TJDA 4BCKA 3H10A 3TUDA 3C9WA 1ZAOA 4O0VA 4JAJA 5H8GA 2I0HA 5LWNA 2O8YA 4NKAA 1GY3A 1PXLA 2OXYA 5HBJA 2C0IA 4MVFA 5E91A 4B8LA 2QHNA 4AW1A 2VNYA 3A7HA 4B8MA 2VGPA 1QCFA 1GZOA 3NDMA 3CQWA 5M56A 3ML1A 4TYHB 4XNEA 4PP7A 3ZFMA 4PDPA 4QMUA 2X0QA 1Q99A 3OWKA 3QCSA 4UV0A 3ZDUA 2R3NA 3TCPA 3U54A 5J79A 4QTBA 1GZ8A 5EOBA 3BYVA 4L68A 5EYKA 3P78A 5H3QA 3LJ1A 4CFXA 5K5NA 2JDRA 3G33A 3SXSA 2PVYA 5HG9A 5GZ8A 4BZOA 3JUHA 1MQBA 1MQ4A 2BFXA 5CT7A 3HVCA 4CFVA 3NVMB 2QD9A 3C5UA 3CC6A 3V6SA 4EZ5A 4JT3A 2VNWA 3VUTA 2RG5A 3OXZA 4YTIA 3GVUA 4OT6A 3RVGA 4X6QC 2HCKA 2CGUA 2X9EA 4TYHA 4YC6A 4EL9A 2PZIA 2EUFB 4FTOA 4QP2A 3EN5A 2C47A 4NIFA 5EH0A 4DH3A 3BCEA 2GNFA 3KXZA 1MRVA 3FAAA 3HDMA 4NW5A 1JNKA 4X0MA 2VU3A 1H27A 2WTWA 3FE3A 1Q8TA 3VUHA 3LVPA 4YJRA 2UVZA 2X4FA 3MY1A 4S2ZA 2PMNX 4F64A 3W1FA 4QYFA 1CTPE 4DGOA 4ANSA 2G2IA 4RJ5A 2JIVA 3FXXA 4FYNA 1XMMA 2C6OA 1ZY5A 3KXMA 4TL0A 2GFCA 3KIOC 4FT3A 4UY9A 5KE0A 4YSJA 4PMPA 3PLAE 2YISA 1SNUA 3C4ZA 3RAIA 4FUXA 3EHAA 3DKOA 5DRDA 4R78A 1QMZA 2JDOA 5GIOE 1YXTA 2ONLC 3P08A 3FXZA 3GOPA 4MD9E 4U3ZA 1RW8A 3BHHA 2R3QA 4DN5A 3SX9A 1P2AA 4AN3A 3PJ8A 4RIWB 3PJ3A 5DWRA 1QPCA 3BU3A 5JEBA 4UMPA 4FKPA 1PKGA 5L4QA 4BYJA 4J95A 5I9ZA 3ENMA 5HX8A 3UDZA 3ZZWA 3RPRA 3G2FA 2NRUA 2YAKA 4CT2A 3FMKA 3BEGA 4U8ZA 3GOKA 4AN2A 3AT3A 3H9OA 4RIXB 4RMZA 3CD3A 4RFZA 3UJGA 4C8BA 4L6QA 3A99A 5DIAA 1BX6A 4AU8A 3EQIA 3F5UA 3UP2A 4D1XA 3EQPA 3W2RA 4MQ1A 5IQBA 2BILB 1Q8UA 1UU9A 3VQUA 3E3PA 3FMMA 3UO5A 3O96A 3F2RA 5CX9A 4QQCA 4RVKA 1Y8GA 1H24A 3Q2MA 3QD3A 1ZMUA 3FPMA 4QO9A 5H9BA 3VW8A 2PVKA 2ZVAA 4R3PA 4M97A 4YJTA 2VO0A 2ITNA 2VO6A 4FV3A 3C51A 3HV3A 4O4FA 3I0OA 4AE9A 4BCJA 5K0XA 4BWPA 2QVSE 2W1FA 5AR8A 3E8EA 4YC8A 3WZEA 3U6HA 1MP8A 3P7AA 2OIBA 3P86A 4RJ3A 1VYWA 4MBJA 3M42A 4IJ9A 4P5ZA 3DK6A 4ONAA 4AT3A 1ZMVA 1BI8A 4EK8A 3LCOA 4AT4A 2XNPA 5HTBA 3Q3BA 3VBYA 5KMNA 2PWLA 3F3UA 4GSBA 2YDJA 4IH8A 3O17A 4JDKA 4IEBA 4UWBA 5FDPA 3QX4A 3PA4A 5T6KA 1M14A 4WO5A 4DGGA 3SDJA 4USEA 5DT3A 2C1BA 2BAJA 4JIAA 3LJ0A 3HP2A 3PRIA 4MWIA 4O7VA 1HCKA 1ZOEA 1LUFA 3ODZX 2GFSA 3R04A 4UZDA 4XEYA 5E8YA 5JQ8A 3F3ZA 3ORZA 4BDCA 3FYKX 4JG6A 3BWJA 3TKIA 3V51A 3AQVA 2O2UA 3IKAA 4OTPA 5FBOA 5KCVA 4MK0A 2BR1A 3TKHA 4WNMA 4FUYA 5CZIA 4QP7A 5IA0A 4GFMA 3DBQA 2F57A 4AFEA 4ANMA 2VTLA 5FM3A 2ITZA 4ALWA 3TDWA 2W9ZB 3UZRA 4Q9ZA 4HCVA 4DTAA 4TYEA 4D1SA 5L6OA 2JC6A 2GS6A 4MNFA 3HP5A 3CTQA 3KMMA 2R3MA 3QRJA 4RRVA 3C4EA 5AP1A 5F1ZA 5KX8A 2JEDA 4U79A 5EI8A 4EUUA 4KBKA 1ZYLA 3L9MA 4CYIA 4LRKA 2GQRA 2YLEA 3VJOA 4AAYA 2RIOA 3NFGB 2B9FA 4I0RA 3MY5A 4U7ZA 4EHVA 3DGKA 4L9IA 2OG8A 2YDIA 1WBWA 1W8CA 3Q60A 4LFIA 1QPEA 1BL7A 5FQDC 1S9IA 5IA1A 3R22A 2OZAB 3KREA 3IW7A 1SNXA 2PVMA 3UE4A 4APCA 4EH3A 2Q0NA 4EK5A 2WZJA 3DK7A 2V0DA 3F2NA 4BWXA 4Y8DA 2VTHA 3ACKA 4MF0A 5LCJA 2J51A 4CTCA 2IZUA 4RGJA 1Q8YA 5JMSA 5CALA 3HA8A 4WOVA 4M67A 5I9YA 3AOXA 4FI1A 3T9IA 4D4YA 2WMTA 3IOKA 4O86A 3MGYA 3KMUA 2J0LA 4YZMA 3SG9A 4CEGA 5BMMA 4R1VA 3G9NA 3R9HA 3UTOA 4F65A 5BNJA 3RI1A 5HI2A 4H3QA 4TYIA 2WTVA 5BPYA 3FC2A 4WG5A 3MW1A 3NEWA 4FV7A 4RFYA 3PXZA 2OF2A 5A4QA 3VN9A 4ACMA 5AAEA 2C5VA 1WVYA 3GU7A 2W5HA 4UMQA 3D15A 4GIIA 3O7LD 4A06A 5L2WA 4LOOA 2PE0A 2XB7A 4TWPA 3GFEA 4YTCA 5I5ZA 1OECA 4APPA 1OMWA 3OC1A 4FOBA 4RT7A 4Y46A 4BDGA 5JFVA 3DKFA 3F5PA 3QWJA 4FG8A 4UXLA 4C36A 4PPBA 3EWHA 3IGOA 2YFXA 5EHYA 2BVAA 5CEQA 1XH6A 3E64A 3BQRA 5DH3A 3TACA 4PMMA 4PDSA 3W0MA 4C02A 1JSUA 2OBJA 3QKKA 3NSZA 3IS5A 4E93A 4KIKB 3UOLA 2A4LA 3PZEA 1NA7A 1P5EA 4FTRA 4O27B 5EKOA 3V5LA 3A7JA 4GT4A 3ZM9A 4IX3A 4X6RA 1V1KA 5G1XA 2WU7A 4FSZA 4OTGA 3TZ7A 5EQEA 2YZAA 4FNYA 3AMBA 4WRGA 4Y5HA 3KB7A 5HE3A 5LMAA 4C61A 4WUAA 2QOHA 1DAYA 1XH9A 2PE2A 5DN3A 4YBJA 5ANOA 4JDIA 3UVPA 1FVTA 3HMMA 4XG6A 4EBWA 4RC3A 3ZCLA 4F6WA 5CU2A 2B4SB 5JH6A 2FO0A 2IPXA 3NAYA 4Y83A 4XUFA 4BTMA 4AAAA 1OIYA 3OUKA 3QTUA 1ZZLA 3QTXA 5AV0A 4PF4A 4J1RA 3TV6A 5DRBA 2JLDA 3BYOA 4DDIA 4JBQA 2BTRA 4O7LA 1UVRA 4KIKA 4QP4A 4AZSA 2IEWA 4QRCA 4QMWA 3CR0A 4HGLA 3NW5A 2ZM1A 3GENA 4FTUA 3QX2A 2HXLA 1GIHA 3CGOA 1ZXEA 4U6RA 4X21A 4E4XA 4XG4A 3GB2A 3R6XA 4O22A 2GS2A 2ZB1A 3DNDA 4MNEB 4CCUA 4YU2A 2BKKA 1J1CA 2VTTA 4O4DA 4BTKA 1BKXA 4CFUA 4XCUA 4NU1A 3V8WA 4QYHA 4GG5A 4KA3A 5A54A 3D7ZA 2GNLA 2ITYA 4QMSA 4YSMA 4HVGA 3BV2A 4GUEA 4CKIA 2GTNA 4S30A 3ALNA 2QCSA 2BDJA 3P0MA 3QTQA 3FMHA 4FKQA 2C69A 4C3FA 5CU6A 3SXFA 2REIA 4W4XA 3LCSA 1JWHA 2VZ6A 4ARKA 3QQUA 5AP2A 3S2PA 3SOAA 4A9RA 4B9DA 4D2TA 4D55A 5EKNA 3I5ZA 3R9NA 3DT1A 1XO2B 4MBLA 5C27A 4F4PA 4RIYB 3R28A 4D2VA 3HA6A 4MBIA 2J2IB 4O4EA 2BAKA 5ANEA 4QNAA 2XNEA 3BHVA 4DINA 2WB8A 3G51A 4EZ7A 1U46A 3SG8A 5HTIA 4FV2A 2HW7A 5M4CA 3QXOA 5ICPA 1PMEA 4FOCA 3QZFA 3R8ZA 3HRFA 4HVIA 5IUIA 4RG0A 1UWJA 2ETKA 5EDPA 3DQWA 2WIHA 3SGCA 1OKZA 2WMRA 3DKGA 4BTFA 2ZV8A 1H1WA 3PY0A 1IAJA 2QU5A 2E9NA 3LAUA 2X8EA 4PUZA 4ALUA 4GT3A 4PRJA 4AZEA 3QRKA 2WNTA 4GV1A 5LMBA 4XG3A 3P23A 3BHTA 4E4LA 3DJ7A 3OROA 4F7LA 4DDGA 4BY9E 4HYUA 1OI9A 3DQXA 2CCIA 3I6UA 5KKRC 3ZXZA 2BZIB 4Y72A 3PUPA 4F7SA 5G6VA 5J5SA 5JFXA 3IONA 4BHNA 4MUQA 5HIDA 4BGGA 4L8MA 5J87A 3HL7A 4ZTHA 3BU5A 3SLSA 1R0EA 4GFGA 4YGAA 3ULIA 4ACCA 3I60A 5CZHA 3CXWA 3DY7A 1LEZA 5BUIA 3U55A 3OW3A 3RCJA 2OH4A 4BJJA 4AWIA 5GJFA 5JGAA 4IW0A 4MX9A 3EL8A 4PPAA 3DAJA 3TZ8A 4JLCA 4O7YA 4ZLZA 3QRIA 3TDVA 1P4FA 2PVNA 2VTIA 3QFVA 4AA4A 3NCGA 3NUUA 2QLQA 4IVCA 4KWPA 4N0SA 4O96A 2FSTX 3AC2A 4CV9A 4TPTA 3H4JA 1RDQE 3I5NA 3IK3A 3FPQA 5CLPA 5C8MA 4M68A 3SW7A 1E1XA 1TFFA 4QMPA 1S9JA 3C50A 4G3DA 5JN2A 1KOBA 4BCPA 3SRVB 3EN9A 3TM0A 3PFQA 3RZFA 3VQHA 4ID7A 2VO7A 3ZFYA 2JFLA 2X0PA 3DJ5A 3IG7A 5JFWA 3MFTA 4GU9A 3MPAA 4WKQA 3UOJA 2H6DA 3KFAA 2R3PA 4FTKA 3O5AA 3PPKA 4AP7A 4HVSA 3I1AA 5CSPA 5E4HA 1ZYSA 3I0QA 1LPUA 4DCEA 4RQVA 3UNJA 4A9SA 2GNJA 2XANA 3BYMA 5TF9A 2P2IA 4FTQA 5KO1A 4CG9A 3GC0A 2AQXA 2F2CB 2A0CX 3FZ1A 3MPTA 5LMKA 3UC4A 4X2GA 1W98A 4D58A 4BL1A 4O6EA 1B6CB 2VTRA 1XJDA 5E90A 3IGGA 1R78A 2C6EA 1GNGA 1VR2A 5CAOA 3VS5A 2A2AA 4L52A 2JBOA 4MAOA 3MTFA 3UC3A 3JPVA 4YNEA 1ZYCA 2VWUA 3QALE 3KL8A 5AR4A 3MBLA 4ERWA 3BRBA 3NIZA 5TO8A 5A9UA 3PG3A 4BTJA 3MS9A 4KIQA 4PMTA 4C35A 3DTWA 2R3OA 5FEQA 5EQYA 4D0WA 3MH0A 3OZ6A 3VJNA 1ZZ2A 4AW5A 4JS8A 4DEBA 4DHZA 3U9CA 1XHAA 2UVYA 1U5RA 3FKOA 5CY3A 3DAEA 3NWWA 3MTLA 3OG7A 2RSVA 4ZSJA 3VF8A 3Q2JA 5HE1A 4PQNA 4ZY5A 1R3CA 3CJFA 2R3LA 5DR2A 4D4RA 2QOLA 1KV1A 4FZ7A 3OF0A 5A6NA 4CVAA 4EQUA 5B2MA 2NP8A 4FC0A 4FVRA 4LMNA 4ANQA 1Q3DA 4RWJA 3AD6A 4I0TA 2WMWA 3A4OX 3I7CA 5AUUA 4PP9A 3W0NA 4FL2A 5HQ0A 4B0GA 4G5JA 4JJRA 3FWQA 3MI9A 3ZSGA 5BQ0A 2OFVA 5FUTA 3R1NA 1JKTA 2EXEA 3PSBA 4GK3A 4RZVA 5DFPA 3VUGA 3ZTXA 5CF6A 2XJ1A 4Y5QA 5AUZA 4EBVA 2OI4X 2GU8A 3D83A 3QCQA 4HZSA 4IJPA 5AR5A 3EH9A 1W2CA 3QD0A 3ELJA 3LQ3A 4IZ5A 4GVAA 2J7TA 4DITA 1BUHA 3FLQA 4J7BA 2PZ5A 1Z57A 3PP1A 3COKA 1CKPA 1M52A 3FZTA 5F20A 4I23A 3TKUA 5I3RA 3QRTA 4ZAUA 4BBFA 1V0PA 3AD4A 3HEGA 3NYNA 4I1ZA 2C5NA 2ZV9A 2F7XE 4XBRA 4DTBA 4H3PA 2BALA 3E92A 3W2PA 5KHWA 2Z7QA 4BDBA 4D2PA 2PUIA 3A8XA 4FV0A 4NM5A 2OJIA 4KKGA 1ZYJA 4UZHA 4A9UA 4JQEA 3H30A 1JAMA 2E9PA 4FKJA 2Y4IB 4AW2A 4V0GA 1J7IA 2BDWA 2BMCA 2DUVA 2WTDA 4G3GA 4U97A 5IQCA 4YC3A 5J9YA 3A61A 2PL0A 3OOMA 2VO3A 2XKEA 4N6ZA 4U5JA 1Q5KA 4G6LA 4XLVA 2XKCA 3GCPA 3R7UA 4AG8A 5IZFA 3LLAA 4ORKA 3DLSA 5IA5A 3CKXA 1SVHA 3LMIA 2CCHA 2J0MB 2VRXA 4I4EA 4OBQA 4JIKA 2QG7A 4R8QA 2YZLA 2QQ7A 4KSQA 2HWPA 4TXCA 2CLXA 3FC1X 4WG4A 3SV0A 5L2QA 4XP2A 5LWMA 5ETIA 2PVLA 5M51A 3S4QA 5CU0A 3Q9XA 2XK3A 5AUYA 5CSXA 3VRYA 4Z3VA 1P14A 4S34A 3MA3A 1TKIA 1NVQA 3AC3A 2X2LA 2YITA 4XJ0A 3TEIA 1YW2A 4NZWB 3EYGA 2W96B 4L3PA 3KN5A 5KBRA 4YHJA 3EN6A 3EQCA 4DCAA 3ZLSA 4E20A 5IKWA 1XR1A 3PXRA 4I92A 3KVXA 4XBUA 2QO9A 5HNBA 3MIYA 4ENYA 1ATPE 4GRBA 3R1SA 1VZOA 2OKRA 3PDTA 5D7VA 3M11A 5JSMA 4II5A 3DBDA 1UU7A 2PUUA 4TWCA 4RJ8A 3E7VA 3ZUTA 1SVEA 3ZO3A 5C8NA 2ITWA 2F9GA 4XRJA 3W8QA 2GPHA 2PVFA 4YMJA 3R01A 4EC9A 3WF9A 3EZRA 3BIZA 3KRJA 3W8LA 4MXYA 2C6MA 2PTKA 3PXKA 3BYSA 3MY0A 3R8UA 3ZZEA 1OKYA 4JQ7A 3LM5A 5D12A 3BU6A 3OCTA 3QYWA 4KSPA 5A4EA 4BCNA 3TMOA 5KMMA 4RBLA 1WVWA 2BHHA 1PYEA 4C58A 2JDSA 5FXQA 4CZUA 4JRNA 3IW4A 4QDEA 2OW3A 3KULA 1ST4A 3ERKA 2IWIA 5EFQA 4BKJA 4FEXA 5J5TA 3ROYA 2YM5A 4HYHA 4H05A 1TQMA 4O38A 2IZSA 5L2TA 2ZOQA 4OT5A 5E1EA 2R3RA 4R77A 3GU4A 3SC1A 4OUCA 4K9YA 1H00A 1XH5A 2J90A 3BWFA 4DTKA 5EOLA 3TZMA 2XAMA 2QONA 3VUDA 2UZVA 2RG6A 4I41A 2CLQA 1VYZA 2NO3A 4IB1A 4FVQA 4FVPA 1NT2A 4UALA 2Y9QA 5HORA 3N9XA 3WYYA 5KHXA 2Z8CA 4K1BA 4KRDA 1DI8A 3PY1A 3NW7A 3R9DA 4JNWA 3QGYA 1YDTE 3C4CA 4AZFA 4EI4A 4XOYA 3AC5A 4E4NA 4Z7HA 3RAKA 4AS0A 5IA2A 3QWKA 2B0QA 5CAVA 4MF1A 2YJRA 4G5PA 3ZM4A 4IAFA 3D14A 2OSCA 4IAIA 4C4EA 4EZ3A 1WBOA 2EB3A 4FSUA 5FEEA 4EQMA 4X3JA 2UZEA 3GU6A 3CQEA 5AV3A 5DMZA 3LLTA 3W18A 1JQHA 2OJ9A 1L3RE 2YCRA 4KS7A 2X2MA 2IVTA 3S95A 4E6CA 3R7EA 5HCZA 5ITAA 1WVXA 5DLSA 4FZFB 5BVKA 3QC4A 4QMZA 4X3FB 5A3XA 4C4GA 3HDNA 1GJOA 5CSHA 1K9AA 2QOOA 4DFBA 4NIFB 3NNXA 2QHMA 1U54A 3ZH8A 4CLIA 3OVVA 4HGSA 2J0KA 4C59A 4CXAA 3PP0A 4D5KA 2WTJA 1FOTA 5DEWA 2QOCA 4LL0A 4BZNA 1PJKA 3OT3A 3TL8A 4QNYA 4RC4A 3HGKA 3QQGA 5IF1A 3PIYA 3QCYA 4Y85A 4A07A 2AC3A 2GQSA 4IM0A 1Z5MA 3EQHA 2W5AA 1J7UA 4O7ZA 4O83A 2O3PA 5LVLA 3D94A 2XK9A 4BDFA 3BLQA 3H9FA 4MCVA 2R0IA 5HCYA 3FV8A 4PY1A