3DVAB

Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
324
structure length
324
Chain Sequence
AQMTMVQAITDALRIELKNDPNVLIFGEDVGVNGGVFRATEGLQAEFGEDRVFDTPLAESGIGGLAIGLALQGFRPVPEIQFFGFVYEVMDSICGQMARIRYRTGGRYHMPITIRSPFGGGVHTPELHSDSLEGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEHLKLYRSFRQEVPEGEYTIPIGKADIKREGKDITIIAYGAMVHESLKAAAELEKEGISAEVVDLRTVQPLDIETIIGSVEKTGRAIVVQEAQRQAGIAANVVAEINERAILSLEAPVLRVAAPDTVYPFAQAESVWLPNFKDVIETAKKVMNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Oxidoreductase/transferase
molecule keywords Pyruvate dehydrogenase E1 component subunit alpha
total genus 108
structure length 324
sequence length 324
chains with identical sequence D, F, H
ec nomenclature ec 1.2.4.1: Pyruvate dehydrogenase (acetyl-transferring).
pdb deposition date 2008-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dvaB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dvaB01
1V1MB 1OLXA 1UMBA 1POXA 2EZTA 2R5NA 1N0HA 2BEUB 2E6KA 2IHUA 2JGDA 1DTWB 2Q28A 2OZLB 1NGSA 4RJKA 5ERYA 2Q29A 1X80A 4JU8A 2UZ1A 3EY9A 5ESDA 2BFFA 5I4IA 3JU3A 3LQ4A 3DUFB 3ZHQA 1UMCA 3F6BX 5EXDA 4KGDA 2Q5OA 1T9BA 1X7WA 2C3PA 1T9DA 1X7YB 2J9FA 4KXYA 2VBGA 3EXFA 4MPRA 2QTCA 1QGDA 3M34A 1V1RB 3DVAB 5I5GA 1PYDA 1X7XA 3IAFA 4RJIA 5EJAA 2VK4A 3EXG2 2WVHA 3AI7A 4KXVA 1OZHA 1PVDA 1V16A 4ZP1A 2NXWA 2BFEB 3AHEA 5I51A 2G67A 3AHIA 1OLSA 4JUAA 4MZXA 2PGOA 4QELA 3AHDA 1L8AA 1PO7A 2BFDB 1YBHA 5K3SA 1W88A 1WCIB 1Z8NA 1W85A 4GM1A 2UZ1B 1V5FA 1X80B 2PDAA 5EJ9A 3OOYA 3MOSA 2PGNA 1UPCA 1YHZA 2JI8A 1OZGA 3HYLA 2BP7B 4GG1A 2EZ8A 3DUFA 1BFDA 2VBIA 2BEUA 1T9AA 1UMDA 1WCIA 3FLMA 2AG0A 2OZLA 4JD5A 4K9MA 2JIBA 2C42A 3OE1A 1KEKA 2R8PA 1OZFA 1X7ZB 4K9OA 3LQ1A 2C3MA 2PANA 5DEIA 2JLCA 2O1XA 5C4IA 3EYAA 3ZHRA 1TKCA 1PI3A 2Q5QA 5DGDA 3ZHUA 3AHCA 2G28A 1U5BA 1V11A 1V5EA 1OLSB 2BFEA 2IHTA 2WVAA 3M49A 2XT9A 2VK8A 2V3WA 1UMCB 1X7WB 2J9FB 3EXFB 5EJ4A 1X7YA 1X7ZA 1X7XB 1V1RA 3DVAA 3IAEA 2R8OA 1YI0A 3EXHA 5EJ8A 1UPAA 2EZUA 2BP7A 4QQ8A 1TKAA 1Q6ZA 2BFFB 2UZAA 2X7JA 1OLUB 3UPTA 1JSCA 1UMDB 2JI6A 3DV0B 2IHVA 2FN3A 2WVGA 3ZHSA 1W88B 2BEWB 3EXIB 4KXXA 1RP7A 4KXWA 1W85B 3RIMA 3ZHTA 4K9KA 1ZPDA 2C3OA 1NI4A 3EXG1 2BEVB 3LQ2A 1YNOA 3E9YA 1QS0A 4C7XA 2JLAA 1U5BB 1YD7A 1UM9B 2QTAA 2YIDA 2DJIA 2BFBB 3UK1A 2W93A 3EXEA 2C3YA 2EZ9A 3HWWA 5EJMA 5EJ7A 5AHKA 2IEAA 4JUDX 2AG1A 3EXHB 2Q27A 3AHGA 1YI1A 3LPLA 4FEGA 4GP9A 4JUFA 2BFCB 2JI7A 3FZNA 2Q5LA 5EXEA 2VK1A 3HWX1 2C31A 3DV0A 4K9PA 1V11B 2YICA 4FEEA 4K9NA 1TRKA 2BEVA 4JUBA 5EJ5A 1QS0B 5HGXA 3D7KA 1UM9A 5FEMA 4GPEA 4QPZA 1OVMA 2XT6A 1R9JA 5HHTA 5EJ6A 2G25A 1OLXB 1UMBB 4XEUA 1V1MA 2O1SA 5HJEA 5HYVA 1OLUA 2JGDB 1Y9DA 4GM4A 1GPUA 2VBFA 3F6EX 3AHFA 2BEWA 3EXIA 4MPJA 3AHJA 3EA4A 5DGTA 2XTAA 5K2OA 1V16B 4GM0A 1B0PA 1UPBA 4COKA 5ERXA 2BFCA 4K9LA 3M6LA 2JI9A 1IK6A 5K6TA 4MPPA 2C3UA 1T9CA 2BFDA 4RJJA 5IMSA 4MQ5A 2Y0PA 4C7VA 1AY0A 1V5GA 4JUCA 4K9QA 4WBXC 1TKBA 4KXUA 2Q5JA 3L84A 1QPBA 3EXEB 1YHYA 2BFBA 2EZ4A 2VJYA 1ITZA 1DTWA 1POWA 2FWNA 5I5EA 5K6RA 3KOMA 3ZHVA 4JU9A 1NI4B 3M7IA 1MCZA 3FSJX 4Q9DA 4D5EA 4D5GA 3EXHC 3AHHA
chains in the Genus database with same CATH superfamily
1H2YA 3UK6A 3RIYA 4AKHA 4YO8A 4UNRA 2OHHA 4JIGA 2IS1A 1WUIS 5A7GA 5BWBA 3H0KA 4XOIA 1ZQ9A 2PR7A 1LV7A 1SBZA 4V0SA 4FDLA 2UVDA 3SKVA 1DL5A 2R6FA 3PUZA 2AX4A 4KN6A 3VU0A 4ZAWA 4LOLA 1OWMA 2ZWIA 1PJLA 3ZU4A 3QBEA 1BZYA 2CVFA 2VT3A 4FSDA 1G60A 1RAHA 3FRIA 4F2HA 1Y3AA 3HADA 4BNVA 5AKGA 1DMRA 4CT0A 3AVUA 5FFFA 4PC3A 3C8UA 1MC1A 4Z1MA 4MQEA 4ZP1A 3JWIA 5TV2A 3TI9A 1M6EX 1Z5NA 2OLKA 2QB5A 3G2QA 2B2XA 4HWPA 5J3JA 1HQYE 4AUNA 5SYAA 2QD5A 3TXYA 4EFDA 4KREA 2R6R1 2XF2A 3UOAB 1FTNA 5GINE 1KDRA 2VSXA 1J0AA 4GKKB 2C2KA 1G66A 5SYMA 1XZAA 1ISMA 3T1OA 3CCCA 1IATA 3C3JA 5JG7A 1E99A 3D3EA 2DSTA 1LQ2A 2VSYA 5BSMA 1FMJA 4KLZA 4DIOA 5LFAA 5H68A 4B45A 7REQB 1T9HA 3C74A 4AQ7A 1SXJA 3R5TA 4WBNF 1P1IA 4ND2A 4BGDA 4L9SA 3THYB 1L7OA 1ZW6A 3BAFA 1Y6FA 1A27A 2Y71A 2YJGA 1LX7A 1VIMA 4XD2A 1YDHA 1N33B 3FI9A 3UMSA 1V1RA 3VMMA 2R97A 2A67A 1Z28A 4JGGA 3V8RA 2H52A 2O8VA 5JYBA 2X7JA 3CF4A 2YS7A 4OHPA 3GRZA 1EVJA 4G1UC 2N47A 2PZKA 4ZYVA 1DRJA 3R8CA 1KGSA 4D3YA 3NTXA 1NUPA 4FNOA 3P9SA 4WK2B 5E2BA 2G1KA 2Y99A 1SU8A 1Y8CA 2OECA 3TRHA 1E0AA 1Q2UA 4PQEA 4GEGA 4Z86A 5CJ2A 4BGEA 4EARA 2KS6A 5DNDA 2PXAA 1KP3A 3DVLA 3O75A 1JHVA 4HLNA 2AXEA 4BX3A 1UXOA 2IH4A 3VNVA 3T9EA 5TJ9A 1IPEA 3NRCA 1KK0A 3FDJA 4L5CA 4BDTA 1NWHA 3WHIA 4BV3A 1O6GA 2HK6A 4ARZB 3O8NA 5A3QA 2E4VA 1BHSA 5LU9A 1X1RA 2HWUA 5AHWA 4NFLA 4IYRA 1II8B 1OAOA 5LA6B 3MEQA 4JR0A 4JODA 4B73A 1FK8A 3OZAA 4G0UA 1P1RA 4M76B 3KPVA 1I01A 1RYEA 2WWWA 3MQ4A 5K0NA 1ZWLA 5IN4A 5KYXB 2I1LA 1HOXA 2DBRA 1I2ZA 4IS3A 1XEWX 1PUIA 1E1CB 2NU7A 2GPNA 4M89A 2B4AA 3I0ZA 3HCDA 2N46A 4NX2A 4RK7A 4TRMA 3IT3A 2WIJA 3A70A 4EK9A 4MPPA 4QLBA 2QN2A 4AP9A 1Q1BA 4AK9A 2BKEA 4MVJG 1B0UA 1ZQ1A 2EZ4A 4X64B 1EVKA 2PSDA 3PDCA 3L49A 4TKLA 4KV7A 4P93A 5IVPA 4E11A 5LQAA 1NVUQ 1RHJA 2CHVA 1Y1KE 4PW0A 4QXAA 1V9LA 2WU0A 4XB6B 3PUXA 1LNSA 2YXBA 5G2OA 4EUHA 2I1QA 1TOAA 3WB2A 4BUZA 5CDUA 3CR7A 1SAYA 1F9AA 1KETA 3I09A 4IMIB 4LJ6A 4YMIA 5HPYB 2QUZA 2YMQA 5CM8B 1B23P 2YWXA 4EQ6A 1ADCA 1FX0A 1H8ED 4RPIA 5GOTA 4S2EA 3QE0A 1MO5A 2WQ7A 2CSUA 2ZSEA 1MOSA 5CAEB 1IWPB 1IZ7A 1ST2A 1BHJA 3OO1A 3QKIA 5JJBA 2JBAB 3GLFA 1ZM3A 3R0VA 1KC1A 4YXWD 1BFKA 1L5SA 3ITKA 2D1YA 1II9A 3ND7A 4EPRA 1TTQB 1XFDA 3E9RA 3WR5A 3HJRA 1K88A 5EJ9A 1O2DA 2ZI6A 5JSZA 4JYZA 2H2GA 2EBFX 3BXFA 1G5FA 3HI6A 5IANA 3GDHA 4GKJB 3IS3A 3HCCA 4IINA 3CC8A 5DVZA 3STXA 2VDMB 1R2QA 2DKNA 4A4DA 1LW6E 3FTCA 1BRMA 5FA6A 1LTHR 2OFPA 2E87A 2WTAA 5A9SB 1ISJA 1GY8A 1OGJA 4INZA 1GGEA 3ZY5A 5CVCA 3GJSA 3GLHB 1J0CA 1ZJ6A 4I19A 4BV8A 2GCOA 1GKUB 3CCBA 4CKBB 1F38A 4HAOA 3RVOA 4CLRB 4KQXA 1NJ8A 3T0FA 3W05A 2HRZA 1N7HA 3PD0A 3T0GA 4JXZA 3PA8A 3R3JA 4M0PA 3RBAA 2I6FA 1MQSA 1NSFA 2KBFA 1VPEA 1VHQA 1TM2A 3G7NA 1OWNA 2G70A 4GRIA 3W7VA 1VSVA 4ZYXA 2H65A 3VTKA 1R8YA 3RR2A 1G9TA 2WVGA 4DUGD 3KXDA 4C0KA 3EZ2A 3HABA 4IJ6A 4B87A 7ADHA 2I62A 3GHYA 3GF4A 3HJGA 2ECKA 4MVJI 4NV0A 4OJNA 9LDBA 2DLCX 1VJDA 4MRNA 4U2KA 2GFIA 3OT4A 5EHNA 4BC0A 1HMPA 4L50A 5REQA 1T2VA 1AUPA 4QGFA 3ANYB 2PZLA 2CNWD 2VTKA 5BSHA 2PA0A 4DOMA 5K20A 4Y7DA 1IB6A 2GEDA 4H7IA 3S2FA 3HU2A 2I0FA 2LGJA 1A7UA 4IAOA 5ALXA 4X1KA 3VR0A 1NXVA 4NBNA 2Y1GA 1YI1A 4L8FA 4HEHA 4CQMD 2JIDA 4FT4A 1WXDA 2NTJA 4QBFA 3NT2A 2H2HA 4O3MA 4EPVA 2PVCA 4MR8B 2K2QB 5JQGB 2ARKA 1AKYA 1M66A 2AV6A 2F2TA 2GH1A 3KQYA 3DTVB 3F5SA 1P18A 3O1IC 5T6BA 4WZAE 5KNDH 1HT0A 2CLCX 2HJGA 3OE5A 1MENA 3KU4A 1CQIB 1VL8A 1UZAA 2FPIB 2ESRA 2CXUA 1ZD8A 4DLWA 4UTVA 2O59A 2QRVA 4LI3X 2JW5A 2MYUA 4PG6A 3E3MA 3L8GA 3T5TA 2VBFA 2NUPA 4C7BA 4HNUA 4C1BA 1T1SA 3HXQA 5G4KB 4JI0B 2QV7A 4QWWA 2CNOA 2FI1A 1XZ8A 3UA3A 1DX6A 1RWPA 2K4MA 1K9VF 1JYFA 5FUBA 4PSVA 3RVRA 2QAJA 2ZXEA 2VUSA 4AY2A 4RYDA 4GBGA 4GMDA 3WA6A 3ZGLA 4RDXA 1Q20A 3LS2A 3GFQA 3LKDA 5B1SA 3TWOA 2IEIA 3PUWA 1W581 3WLEA 2HCJB 4DV2B 2YZGA 1D2CA 3B2QA 1N4AA 3ZN2A 4WQMA 4OM8A 4CV0A 3CVXA 1B93A 1M5UA 2PSSA 4D4KA 2OSVA 3FUCA 4NBKA 4RQUA 4QHTA 4UOEA 4AZWA 5IDQA 1RWWA 3D4BA 1SQSA 2YVQA 4QG3A 4LHWA 4YJ2A 4M8SA 1HDGO 3H5IA 3V46A 4N1AA 3VSDA 4C7KA 2XXBA 3ESZA 4PWYA 4ESOA 1T5DX 2IE8A 2IKSA 3CJTA 2C4KA 3I1YA 2IZ6A 1C9JA 3HN6A 3NANA 5LMCA 4MQFB 1YMQA 1I8TA 4KIFA 2OHFA 4IJWA 1IEVA 5A3RA 3RROA 4P1ZA 1E2JA 1VMAA 1YSCA 1Z73A 2CB0A 2G67A 4W7IA 4DUGA 3FJ1A 4K6HA 1USGA 5FL3A 2I7XA 5GIOE 2RH8A 1UBFA 5D3KA 1JDSA 3G5LA 3OUTA 4I1VA 1LF5A 4JX8A 4L6IA 1H8EA 4FP9A 5L6MB 3OOYA 2Y9MB 3EQ7A 2AHRA 2IW3A 4HR7A 3BCRA 3RRNA 4FS8A 2KJQA 5HILA 2RAUA 5IAJA 4IIVA 3PIRA 1Z33A 1G19A 4CIVA 4NXNB 1C9MA 1MIOB 1BW9B 1TD1A 5IC5A 9MHTA 3B1YA 3K92A 2C99A 3PCXA 5JI2E 4F2WA 3ORSA 3VO2A 2A1IA 3OE1A 4HQRA 4J3NA 2FE4A 3PI6A 1HEYA 3MJFA 3R7SA 2O1XA 4UXHA 4ZREA 5DHUA 2PX2A 2ZSUA 1H2BA 4JSTA 4QUDA 3TSYA 4A5OA 2PD6A 3F5MA 2BOVA 1I5OA 3DF9A 4ZHQB 2QTNA 4DSNA 3ODPA 1Z26A 1C7JA 2LBPA 2Q6LA 3CM0A 1F2DA 4YMHA 5C4GB 1VTKA 3GRRA 1FP1D 4CL0A 1ZSVA 3AUTA 4P7JA 4KNVA 1S4MA 3RS3A 2QD1A 2ZVQX 2NZ8A 5KJ1A 4EHBA 5E6RA 2Q4DA 4ENWA 1NVGA 2RI1A 1KMHA 3LYUA 1CQIA 2HTFA 4P82A 4DLLA 2EJUA 3VXKA 1RHQA 2VCHA 5ELLA 4AECA 1YIAA 3O3CA 3TJZA 2BHTA 3ZKAA 2EZ9A 2YV5A 4YRRA 1E61A 1IEXA 3NC0C 1GRVA 3D02A 1PGPA 1GYQA 2LD4A 2D54A 4IRUB 5FULA 1A5TA 3KNZA 4HYTA 1PR6A 3MS2A 4A73A 3W5CA 1N2HA 5FTMA 4D97A 4D8YA 3E9CA 4QPCA 3INRA 4RGVA 2HW8A 2EW1A 3MB5A 2ZUTA 3UT0A 2A6PA 1A9PA 3NWJA 5FTKA 1YQ9A 4IIFA 1UBGA 1F8FA 2PBZA 3GLRA 4I55F 4YJHA 2ZJBA 2DQ4A 2O20A 3AY0A 4F93B 1E2EA 1X39A 3KWLA 1DIHA 4X6XA 5ENZA 4WW0A 2ZEJA 4E08A 3BGVA 3SSOA 1U0GA 2WZBA 1NFRA 1JFVA 4LV5B 3V4OA 2PXXA 1GKIA 3DKKA 4PHTA 1OXTA 4AJ4A 5GJBA 2M1XA 4N0MA 3BF8A 4HQKA 4ID9A 4EG6A 4YGXB 4CQMB 2FFRA 3K0AB 3FCUB 1M34E 3K6JA 1MZVA 2BFDA 4PSAA 4JLSA 4O33A 5FUXA 3T7CA 4AJIA 4GOKA 2RH5A 2ZIVB 3S8YA 4JC5A 2G04A 1KJJA 3FVTA 2AOWA 2XCOA 2SICE 3A11A 1TTTA 3IAHA 4YDQA 2CDNA 3KLMX 3L07A 1XDWA 3K70C 1JILA 1M7HA 3O91A 3HKEA 1L5FA 1KOLA 2I3GA 3TR6A 3GPLA 2D2EA 3GLGE 1XL0A 3D0QA 4BO8A 5JQGF 3Q3VA 1Z0UA 5F5LA 1G3RA 2C5BA 3RVLA 4AJOA 1ADYA 1GZ7A 5G02A 1K8YB 2YFKA 1U3WA 4X84A 3ZG6A 2NNWB 1VLHA 5GQSA 3ZKWA 2ZPTX 4ZU1X 1W96A 4BQOA 3GRPA 5JZVA 1FYEA 1I14A 2DFLA 3IT2A 3OY7A 3A4TA 3PFHA 2OE2A 3N7AA 5DO9A 2R3SA 4B4UA 5B7NA 5K01A 1MKYA 1K6JA 1JHYA 2I6TA 2Z2ZA 2FFJA 3GJ0A 3OEHA 4W5TA 2IU4A 3I62A 4YT2A 1ZG3A 3PHBE 4R8RA 1XCLA 2WJVA 4DE5A 2PGLA 5EZYF 2FOLA 2WA2A 4TOIA 3KT3A 1UDBA 1TM4E 5FI5A 1DAEA 1JHXA 4EY8A 1SM4A 3FX2A 2I4LA 1E1LA 5ECWA 2PDAA 3S4YA 4BJ1A 5ITWA 1E6UA 1PDOA 1AZWA 2WTEA 2BTEA 3P9CA 4D7AA 1FSPA 4KSYA 5LYJA 2JG3A 4G67A 4NENB 2BIFA 3E5HA 1XB2A 2VP2A 3F9RA 3GNLA 3LWZA 4ZRNA 4ZVUA 4BB6A 1G18A 1WW3A 2R44A 2O1EA 1PZGA 4DIBA 3U1BA 1A4IA 1KKLA 3PUVA 3AKDA 3IMCA 4OP2A 4RH1A 5AW5A 1K6XA 1QK4A 3L46A 1L8LA 1N5OX 1RHMA 2P3QA 4HDNA 2L18A 3EXFB 4XSGA 5L7WA 3AUFA 1L4GA 2EF1A 2BMAA 3DONA 4RF4A 3JVIA 1MIOA 3BORA 3Q6IA 3UFBA 2VH1A 3LOQA 1L7NA 4P6VF 5F1PA 1HDOA 4NFYA 1Z6GA 3IIKA 1I4DD 3HDQA 4LSZA 4JZKA 5I7RA 4BO5A 2ZE5A 1IOZA 1LPPA 2YV1A 1PF7E 1RWOA 3FZQA 3N28A 1K75A 1RI4A 4NDAA 3U3DA 2Q1XA 3RS2A 1ZOLA 2V0NA 1VPWA 3ILHA 1R4MA 4NP6A 3ZXUB 2IQ5A 5LU8A 3N58A 3C3WA 10MHA 1Z88A 2VWPA 1JMKC 1RNLA 3N6RA 1E2LA 4LDQA 1W2HA 3O95A 5HZGA 3HJUA 1O9GA 3BRWA 4D56A 3PHLA 1BKDR 1G55A 1V5WA 4KTTE 4HBZA 5D7NA 5KJ6A 2PT7A 5K0SA 1QB8A 1G64A 3KD2A 4K9PA 3A6FA 4LHEA 3ZHOA 3NLLA 5E2IA 1CJVC 1QHXA 5EJ5A 3TO5A 2F1IA 4B5LA 2PL3A 2RI0A 1ZK0A 1MT0A 2Z57A 3B6ZA 4JELA 4QPZA 3IP9A 3WJAA 4AKIA 1VG8A 5ED4A 4H1HA 1KYTA 1LGYA 2GYUA 2O2DA 3DBRB 1V37A 4Z7OB 3L7AA 5FI0B 2AFHE 1IIBA 5ALFA 1RRCA 1IHYA 3DYIA 1Z2PX 2WWFA 3WK4A 5BNTA 4FFBA 3ONDA 2NTEA 4QDZA 3ESAA 3VKUA 3VU8A 1E7RA 1TF7A 2XMSA 1AV7A 1EPUA 1NX9A 2XIJA 3D1JA 5F12A 3RASA 4A6DA 4ZI7F 1BH2A 5AESA 4L57A 1P4HA 1JQJC 4UBIA 5CFRA 4RGQA 4I4TA 1NURA 1N0VC 4YRMA 3CPEA 1GDDA 1KMMA 3RNOA 1XTRA 4ND3A 1R10A 3GFOA 2P5YA 3CKLA 3AZPA 3P4XA 4CQJA 1UBEA 1LBIA 1B74A 3DLIA 2ZXUA 1MV5A 3TRIA 5FPQA 2QM7A 2Y77A 2YFHA 1X80A 3HU5A 2MJLA 5ALHA 1TUGA 5FAXA 1CJSA 2QIPA 2QVLA 2IELA 3O8BA 4RPKA 4R0MA 5EXDA 5LJLA 1Q92A 4FYIA 4TRRA 1X7WA 3A26A 3SEQA 1T13A 5CVEA 5K4HA 1ORVA 4MQ4A 3QVOA 4INPA 4KI0A 3V7NA 2P4HX 2BZGA 3B82A 3DLPX 1QHIA 3EXG2 4L22A 4Q3OA 3RUHA 4HJXA 4AG5A 3IILA 2Q5IA 2GJSA 3MJHA 5KOHA 2IBTA 5KAMA 5KQSA 2BFDB 4E2FA 4P32A 2XY4A 3HN2A 3DPSA 3SX0A 4HAUA 2C4NA 3R5SA 2HLDA 1C50A 1FTWA 2J5QA 2F90A 2PH3A 4G65A 3SC6A 4BQFA 5KIAA 4GVPA 2KLBA 3AUXA 2GZMA 4ZYWA 4ZZ1A 1GTG1 1N0UA 1UPFA 4EHNA 4YYZA 5B6PA 5K8VA 2JFYA 1Z07A 1DIGA 4K0RA 1IM2A 1KEPA 5J5VA 3SX2A 5ICMA 1W76A 5IT4A 1Q1GA 3A6DA 2PVSA 2HD4A 4EFLA 2XOEA 1SKMA 1HE4A 1T2DA 2YJTD 3B1XA 3EFBA 3G23A 2HU7A 4O4JF 2YHUA 4M1SA 1TD9A 1PRYA 1ZA2A 3HN7A 3CXUA 1Z62A 2J9FB 2XBLA 3KT8A 1J9EA 3DEAA 4QJ5A 1E0JA 5BSUA 3ZE7A 1DAPA 2VF8A 3JYQA 4FCWA 4EB6A 1DC7A 4ZYTA 1RRMA 2C7BA 2QUIA 3UPTA 2AE1A 3UMBA 4DVGA 3R8FA 5CYPA 3AV0B 1XTUA 2WDPA 1MAVA 1GNVA 5EUMA 3WYAA 4E46A 1RP7A 4NOKA 1FA9A 3WLIA 2RHDA 1UXGA 4DLVA 1SR8A 3JQ8A 3CIFA 4LXXA 2Y1DA 4OVKA 1XNQB 3LK6A 4Z4IA 2P9BA 2XMGA 3H11B 3DM5A 2GO7A 3K94A 4XWKA 2CYAA 1ZVQA 4MR9A 2KSQA 3E35A 3TSCA 5C7OO 5A4DA 1IVSA 5AHKA 5DWVA 5JS7A 4GNKA 2YZKA 1J1ZA 3IDAA 3LHKA 1GNRA 2IYLD 3LPLA 2AR9A 1IN7A 3GCDA 2BKUA 4C3VA 4CIYA 3CRQA 2ZFUA 1ODKA 4M8NE 1Q50A 5KTSA 1I1HA 1XIVA 3LXMA 3O4FA 4JR1A 3W5IA 4L75A 4V0QA 4BFXA 3RAFC 2ZJZA 4HDSA 4GPD1 2C77A 3H1FA 3NOQA 2F59A 4NS4A 1F2UA 1IN5A 3HZZA 1P5FA 1U9ZA 3JAKA 2IYTA 2VUUA 5HWSA 1THGA 4XUEA 4FWIB 3QUBA 4AP5A 3RVKA 1A7KA 3A4NA 5HIAA 1E3SA 1BXKA 4TLEA 1Z6TA 4UDYX 4E51A 1E4EA 5KYWA 1YR2A 1C7FA 3EA5A 2QYOA 1FP7A 3AW9A 3LA6A 3LMKA 4I3GA 3ERCA 3PR2B 2DHDA 1DIRA 2FDXA 1OT5A 3ZZTA 4FVTA 2BEKA 2Z8YA 4WE3A 4RF2A 2H9AA 2YIJA 1R0ZA 3V4LA 4HDKB 2JKYA 4AO7A 1BSVA 3B6JA 3OQIA 2WWRA 1NI4B 2ZI5A 5DI3B 6LDHA 3QQPA 2OOSA 3EXHC 5ECGC 4DIMA 5BWCA 2H16A 2HPAA 4FCCA 3AERB 2WY2D 2ZRLA 3UXMA 4ZN6A 2X2PA 2XCUA 2X0KA 4PYQA 3IQHX 5BQXA 4P83A 1NQXA 3TW8A 2IK8A 3OM9A 3EEFA 1OFUX 4FKZA 2VPZA 4G09A 5T3UA 4DLAA 3STHA 4IS2A 2FEWB 5HQ3A 4FFRA 1GQYA 4IUCS 4RIFA 3HCOA 5CX1B 2C9OA 2IUFA 5CT4A 2P0YA 3JZAA 1KQPA 5G1PA 4WAUA 1NXQA 2G36A 4OQDA 2H57A 2IXTA 1EP2B 1JWBB 3RDPA 2Q2VA 4OI4A 4TYQA 4EB8A 5A9SA 4YB8A 3JWGA 4HUTA 1O54A 2PFKA 1UC9A 1PT7A 2I54A 3F7TA 3FFAA 4ZVNA 4B2YA 1W87A 4JOSA 4KPEC 4B09A 3DMPA 2HNAA 4NYIQ 1V8FA 1H5NA 2WU4A 4P53A 1HDEA 2IDJA 3U7JA 4LC9A 3QENA 5JQGA 2RG7A 1Y63A 2IP4A 1C7IA 2NM0A 1KPHA 3IRVA 2GHIA 2WSSA 4XM0A 3UYLA 3A9VA 1XRQA 2GTHA 3ORFA 3H4VA 4KIJA 3KJNA 1SVOA 3HY6A 4G24A 3RS8A 1GL7A 3NG1A 2P91A 3X1MA 5A2QA 1X8XA 3EN0A 4H7DA 2EG5A 2VHQA 3NYIA 3M49A 4PLVA 3N2EA 3PA6A 4CIDA 4AJKA 2D1TA 1NM5C 1ZJJA 2ZJ0A 2AOUA 4OGGA 5B5SA 4JBYA 1FE8A 3EZNA 2P3SA 1A4UA 5BRAA 1JJAA 2X9NA 3ZNQA 5KX5F 4IHJA 2E3JA 1GUDA 2IY8A 2B82A 5LP6A 3F6RA 3EAGA 1JLHA 4KQFA 2BUAA 4F4IA 2JD0A 1CX9B 1YDWA 2O14A 2QUJA 2R25B 2V97A 3G2OA 4R8KA 2HFKA 1EDDA 1PHRA 3BEDA 4X41A 3T5AA 1PU2A 4BN4A 1WPGA 2JLAA 4KSCA 1V43A 3F9CA 3BA1A 2DRIA 5DLEA 1Z75A 2FZEA 2HSZA 2XUOA 3KOXA 3QE4A 2JIMA 4DLYA 3ZWAA 5F1YA 1K4YA 1B8NA 1KIFA 5K6AC 4IFTA 5K8LA 3CMCO 1ONPA 3GEIA 4B35A 2ZUVA 3LGSA 4L85A 5JYCA 4EUFA 5HSGA 1NF9A 4EKEA 3N59A 4ZICA 2QRGA 3T9CA 3GD7A 5HR5A 5KKNB 4CEHB 5EHGA 4B7ZA 1OU0A 3NCHA 2VYVA 1NF8A 3OJEA 4NJMA 3HBNA 2QTVA 3QEJA 2ZSIA 1K5GA 4OLJA 1AQIA 5DXAA 1TU4A 4Y2PA 3PQ2A 1JG1A 4BLQA 4DCPA 3EPJA 2X1HA 1WCXA 1XRNA 4HGRA 4M46A 3G2IA 4O4IA 3GLFB 3GT3A 1PZEA 3AFGA 3OEHD 3QU4A 5EJGA 5DTEA 1ODSA 3SJZA 1P0QA 5HNKA 4G81A 3ROXA 1NVVQ 4MUBA 2OFXA 4MR8A 4RMGA 4H15A 5C5EA 4CU5A 1Q7BA 1UXIA 1ZK4A 3TDMA 3ZWXA 4Q16A 4A0FA 2H1RA 1UT8A 4JLBA 3AMVA 4GYWA 4Q12A 4JI5B 3FYCA 5I5EA 2W8BB 1RWMA 2HI0A 3AESA 3W1VA 2J9ZB 3KEGA 4J0CA 4MQMA 4RK6A 1M33A 3KLOA 3MWEA 3S44A 2GBLA 3SSMA 2ZM6B 1X9HA 2HZBA 3L6UA 3WHLA 4N5LA 2XZDA 3KJQA 3ETLA 4W5QA 4U7JA 1AXGA 2R60A 5ALVA 4CTKA 4FILA 4EZBA 5HTOA 4HDSB 5HIJA 1D2AA 3FCAA 5BR8B 3QEKA 4HTFA 4FN4A 3CKKA 3Q5EA 4L0DA 4RVNA 2EJVA 3EG9A 3H83A 1G3MA 1OXSC 3CINA 4X95A 5CHEA 4ARZA 4DRZA 2BMWA 1W49A 2GDZA 3F6YA 1XVLA 3ASZA 1FFHA 1T4GA 2V1XA 3AH8A 1ORTA 3HCNA 3FROA 1GL3A 4YP6A 3AJ9A 3NUZA 4MPDA 3AVQA 2JGFA 2WWHA 1FU7A 5F3RA 3W7AA 4Z6KA 3T3NA 3ADPA 5D2CA 1M3SA 2AI3A 5ERGB 4D9EA 1HDRA 3CEAA 2O8FA 3SE7A 2B5OA 3JQ8B 1G5QA 3KZMA 4JC4A 2ZIGA 1UFQA 2W42A 5C8DA 4CLHA 3GRVA 1CS4C 7MDHA 1GZHB 1FTQA 2C00A 5EEHA 2I8LA 4OQLA 1EFAA 4IHJB 2ZLBA 5AI8A 2P11A 3H9CA 5TMBA 4A2WA 4XSVA 3OWXA 5KOJA 2SKCA 3FHTA 5BVHA 2AG0A 1WP4A 1BGWA 4JENA 3U3XA 2BHSA 2E49A 3F47A 3EZ7A 2GM3A 3ROFA 3SKXA 1ZJWA 1KFBB 2C4UA 2L19A 5E7JA 1YDFA 1GZ6A 3O0TA 4Y6RA 1TEZA 5CVTA 1XVAA 1ZOOA 1JXMA 3BGOS 2NYUA 3C70A 2JAOA 3VPFA 1G6KA 4G84A 4AJLA 1DJQA 3DBVO 3L8FA 4JOBA 4D3SA 5KPJA 4NCHA 4YAFA 2OBNA 4LDZA 4B82A 4B2LA 1QNLA 3OKPA 2XB8A 3RF6A 1JE1A 1CUZA 2XV1A 1XZCA 3G13A 1QIFA 3NTOA 4WZBA 5D3MA 1LJLA 4Z9BA 1ABEA 3I30X 1B4DA 2IX9A 3C3CA 3PR1A 2W6IA 2J7KA 1P73A 3BFPA 4NYMR 1U5BB 2I6QA 2O6LA 2FCAA 1KO7A 4QATA 5H81A 5GJVC 4PO9A 4GXTA 4A7PA 5K5EA 3EHDA 1YTUA 4CG0A 5H4GA 1QVZA 4FUTA 4YH1A 3D8HA 5EIFA 3UJ8A 4CPDA 7REQA 4XDHA 5K0JA 1ZC3A 3B1VA 3U4HA 4BMPB 3MZ0A 5AM0A 2GM4A 4XGKA 5B4VA 3A37A 3S7ZA 1AX9A 2C5SA 1LK7A 1ETUA 5F3WB 3L4BA 1MAHA 4UPDA 1EX9A 3DVSX 5JAOA 4HXYA 3ZNPA 1ZMXA 1DBSA 1JTEA 4ZDJA 5LNK1 4MUAA 1J8DA 5G40A 2RSLA 4E5UA 5HZHA 4RHCA 1V8DA 2DPYA 3TNYA 3MMNA 2ZW9A 3IP6A 3FDFA 1HZZC 3L7JA 2ODEA 4LHVA 5EMNA 1U8CB 4B4WA 4TVKA 5C51B 2I6UA 3CRRA 3INNA 3NVKI 4YY3B 4PLYA 2R84A 2CXOA 1PSWA 1ZVVA 2P5SA 1JKIA 1SXGA 1N0IA 3C6ZA 2XAAA 4CIXA 3DT8A 3FAKA 3T7JA 2M1ZA 1NNSA 1KAHA 1KC3A 2DT8A 1EQUA 4P54A 1Z8FA 3EIQA 1J5XA 5I7UA 1XJQA 3EPRA 4ENRA 1RQLA 3CLRD 2WLSA 2F55A 4YN3A 4CWAA 1XMIA 4WSOA 2R5NA 1YE3A 2J0QA 1BJRE 5DSTA 3KJGA 1Z34A 2XUHA 2E4WA 2ZWVA 5HG0A 1K08A 2Q6OA 1KARA 2WD7A 4DCNA 2OCBA 1XPUA 2WABA 1C1YA 2E7ZA 3QG5A 1Q1QA 4QJ4A 3VR1A 1AD2A 2ZRFA 1D4ZA 3W2IA 1Y6QA 1A8QA 1XD9A 4TS1A 1BC5A 1HDIA 3FVVA 3DZGA 3SC4A 5JMWA 3V1YA 5KQPA 4OATA 1XZPA 2WJPA 3GROA 4YECA 1QIDA 3U3MA 1CDOA 3ROMA 1PEDA 5BVGA 6YASA 1PL6A 1XPRA 4PC1A 1PNRA 1LNQA 2PGOA 2BHRA 3ETNA 3NJ8A 3T41A 2FGJA 1W85A 3MBOA 1LPOA 3K4PA 2GD2A 3O1HB 4GYKA 4UAUA 3X2EA 1U63A 4NAHA 2AWNA 5JY1A 4NYMQ 3J7AC 4IOMA 1T5TA 4ZQCB 3BSFA 4BWFB 1T9AA 4ZOLB 1IBSA 1XOIA 4HN9A 4K6FA 2QRKA 4WFKA 4BYGA 4QDOA 3DE7X 1FFXA 2BE9A 3BMXA 3OU7A 2JFPA 1DG9A 4TKVA 2EHDA 3CNNA 2JI4A 3H5OA 3TYXA 5HUQA 2FJPA 3G3EA 2C78A 1CHNA 4ACBA 1SUAA 1UKCA 4CV2A 3N6VA 5LQUA 1XQ6A 2ZRCA 4YRDA 1YRLA 3PXXA 4Z2YA 5C31A 1QU3A 1SUFA 3QY9A 1W35A 2BGRA 5D5PA 4Y2QA 4LTMA 4DMFA 3S99A 1A8IA 2W2LD 4ZOAA 3TRJA 1SCKA 3PGA1 3IKLA 3B51X 3WX0A 4DJJA 5KSYA 3Q8LA 2NV0A 4RSRA 2GK6A 5E6UB 2F8SA 3M1IA 4EHAA 5JISA 3BWEA 5EMLA 1NASA 1L7XA 3SY8A 3WRXC 5DHTA 3FTEA 4K87A 3H4MA 2ZYGA 4I50A 4YRPA 4PZPA 3RFCA 2HUNA 4OB6A 5CDTA 1LQTA 1E79D 3Q85A 4RELA 4F84A 2ZB4A 5F4BA 4KQ1A 1Z45A 2JEOA 2Y1WA 3HHEA 1VYVA 2XMZA 5EESA 3FPSA 4XFDA 1FQKA 3N2IA 3QG1A 2P77A 3M33A 2DECA 4JA0A 4OHCA 4QRDA 3TL6A 4BO6A 1F5SA 4WEOA 3B36A 3EQ2A 5KBYA 1EG2A 1TEHA 1OZAA 3WAGA 3W5AA 1YBMA 3ND6A 3UB2A 4B6FA 3IUPA 4BOYA 3ADOA 1G8HA 3JPWA 1THMA 4QDKA 3VHQA 4RVHA 5L3QB 2JK1A 4ZT7A 1KWKA 4WZ6A 5ELXA 1HE3A 3FBTA 1Y4AE 3Q87B 1N5KA 1OBCA 1GN9A 4GPEA 4HTAA 1QFZA 2JLXA 3KHTA 4R1QA 2E48A 4UQLA 2PKCA 2VDJA 4CKYA 4WXHA 1K6EA 4B7XA 5AJHA 3NMUF 1I2AA 1O95D 1ISIA 3EA4A 1NBHA 1W6UA 3IKJA 3V9PA 3M6FA 4UBLA 4X20A 3W9SA 4LE2A 2GRUA 4P33A 1IULA 2AMYA 1UAAA 2FAXA 2FX2A 1T9GR 4ND1A 2C0QA 1O89A 1KWGA 1JKMA 4B3TB 3ANMA 3QVXA 1YL7A 4GSLA 5CT8A 2FUG1 3GVHA 2QSJA 3EMVA 4C2UA 2PZFA 4UDOA 3EHEA 5TT0A 1U2PA 4HGOA 2NU9B 2C1ZA 2H29A 4YUYA 4FQ8A 3FSJX 4XOUA 4HO1X 3K8QA 1BVYF 4QGHA 2ZBFA 3RFFA 2EXXA 1TK9A 4G01B 4Q34A 3NNNA 2IC5A 1KU0A 2YMPA 3QH4A 5I9TA 1EIZA 5DYYA 2JHFA 4I1SA 1MDBA 3RHSA 5ES4B 4NV3A 4NH0A 4V1CA 3D5TA 5FPKA 1XEFA 1BN7A 4CCWA 1CUBA 1XVUA 2Y68A 4DDVA 4KITB 1YE8A 5EXPA 5FUMA 1OUMA 4TXMA 3NEJA 1WB4A 1NQUA 2JFNA 3OD1A 4LX0A 3WJ2A 3U4DA 2E4AA 3QUTA 4QREA 4UXIA 1Y5RA 3WLMA 1G63A 1DAMA 4L8LA 4NRDA 3V97A 1DKMA 4RHTA 2OUKA 5KMGA 4N40A 1LLCA 4RS4A 1XPOA 1A2KC 5J2UA 4H1WA 3TUJC 4QOEA 3VU9A 2BM0A 5BSVA 1EMDA 4CMBA 4MW6A 1HM5A 5EERA 5E6UA 2CV1A 3HRKA 1QIKA 1YQDA 2PBFA 3KYDB 3QVTA 1G6OA 2X14A 3UAVA 1L0BA 4DPKA 2ZJ7A 3B52X 3BHMA 3N7UA 4C07A 4UEWA 1TVKB 3G0HA 1VDMA 2IZZA 1NFFA 1NW3A 1RABA 2CJFA 2JLCA 1G5IA 3MQFA 3HXKA 1Y1SA 3HYCA 4OHUA 1XA4A 3NHWA 3PNQA 4XQEA 3SZOA 5TF0A 1NN0A 1ECFA 1XTJA 4F72A 5KVSA 3A14A 4XJSA 3FB4A 5WRFA 4AJ9A 5JARA 3DQQA 1CLEA 5P8WA 4EECA 1JBKA 1ZP6A 4E6PA 3IULA 3EPKA 3IURA 4FBMA 4WKOA 2AC4A 4BCCA 1TKAA 3FWKA 3AFOA 5JVDA 5B4UA 1B43A 2WG0A 3AEUA 3QWIA 1MQAA 2CGEA 3C3EA 3LDGA 1AIPA 4TM8A 1A5BB 2BEWB 3GU3A 2DJ5A 4HXGA 1XZBA 2VHVA 4UJ3A 5AVTA 4C21A 3FIUA 1WAMA 3AIMA 3KYIB 4G5SA 1QAMA 4MVJE 3W5VA 4R2XA 4W5RA 2UUOA 2VUTA 4Q93A 3DDNA 4JFAA 4MQLA 2JGKA 2IHBA 2XKBA 2JJ2A 4D6XA 3URKA 1CUFA 7ABPA 4EB6B 4HKTA 4RYLA 1AUVA 1S3FA 1YF3A 3LLUA 4L76A 2C4HA 4TKVB 1T1GA 4ID3A 2BSQA 3PJFA 1PQ4A 1HFWA 1SC9A 2CJWA 3ZU2A 3W5DA 4G4GA 1DC5A 1EI9A 2ATVA 4DCTA 3B78A 2H0RA 3L6CA 4ZV9A 2O57A 3DAYA 3OTOB 5TMPA 1FIUA 1KAEA 3NH6A 4HVLA 1MP0A 1HFEL 3AQIA 4HDRB 1CRZA 3WSTA 4P35A 5IXYA 1KTVA 1LK0A 1A8UA 1QUFA 4B85A 3WYNA 5IKPA 2GK3A 1UC8A 3KKNA 3NRBA 4PBSA 5CW2A 2FLVA 1GV1A 3HO8A 3RKRA 3IE0A 1GZ3A 3CV3A 3OJFA 5FL7A 3LGXA 5E95A 4QUJA 1EK6A 4H0CA 1BXRB 4WKGA 4X71A 3VHRA 1OTYA 4L8GA 3ANSA 1GAWA 5GZ1A 5JPDA 4ISBA 2JH9A 3PJGA 3RTGA 3HA2A 4QTXA 5FPPA 5F2NA 1EE2A 4EO4A 2ZRGA 3F90A 3TE7A 2PL5A 1SB8A 1TCAA 3FSEA 3WBKA 4AJPA 4N0EA 3ZDRA 3CH7A 3U9SA 1F51E 1FS5A 3EQ9A 4R2IA 3SC3A 5AI6A 1Q7CA 1POXA 4QOSA 4NE2A 4IG9A 2R6ZA 1P7YA 2XSZD 4Z4EA 4MKFA 1ISPA 4EEKA 1IH8A 2UZ1A 1UEJA 4XIJA 5C5CA 1U0SY 3FJOA 1L4KA 4OKNA 2UYGA 3K9HA 4C88A 1KOGA 5LPNA 5DNCA 4CEJA 4QVIA 3GLIE 3CBQA 1I2MA 3D2BA 4X7MA 4IDPA 4YRKA 2JLZA 3IIMA 2WYUA 1SCUB 1LD3A 1K8XB 4ECAA 1LA2A 2E4ZA 1SOAA 1ZH2A 1HT3A 3FKQA 4BFCA 3MWLA 1OB2A 4OQFA 3T6KA 3OWHA 2RONA 1RM3A 2XXJA 3CTMA 4MZXA 2DAPA 3N2ZB 4FYJA 1FCJA 1E2HA 1CVLA 4MJLA 4OX9Y 3C43A 1Q3KA 4PBRA 3RTCA 1Z2EA 2H92A 1AU9A 3I8XA 4CM1A 3TNDA 2QVGA 2JFWA 5A7HA 1CZKA 5JR3A 1YHZA 4FOSA 3O9ZA 1W0JA 4W6QA 4KR9A 3QFSA 1WHSB 2J45A 4RA6B 1XMJA 2B8TA 5E1OA 1VG1A 3CT6A 2H1LA 1QRTA 3WB1A 3RJMA 1YS9A 4IG4A 4GLBA 4HEA6 1W1WA 4E7PA 4EKGA 5BW4A 4FW8A 5FBQB 4JWTA 4IXMA 4GBED 1KI8A 4Q9AA 4Z0TA 3G6KA 3WL5A 2EFYA 2P0EA 5EWLA 1L5MA 1NW4A 2WD8A 3A05A 4OJYA 4QYMA 3ST7A 1WMAA 3LVQE 1Z4MA 3ZQ6A 3V8QA 3GJ6A 1Z16A 1VHJA 3WS7A 4MUGA 4ZO9A 1QSGA 2Q2WA 3I5XA 4M6WB 4HGZA 1T0UA 1IZZA 1RJ9A 2NO4A 4PHFA 1KYWA 2KMLA 4DRYA 1XTBA 4QXQA 3DAHA 4PPYA 3WFJA 4ESVA 5EA2A 4DNQA 3C5HA 1U98A 1GPBA 1LS1A 2XGOA 2YIMA 4CM6A 2E89A 1KDYA 1AHHA 3SR3A 1N1EA 1M1YA 4I4NA 1G5HA 1PBNA 2Q9AA 3C7AA 4MUIA 1F3OA 4OQNA 5DYIA 3D6TB 2BH9A 4IYJA 1H0RA 3EXEA 5CT5A 3ZDEA 1C0PA 4DLNA 2ZBQA 3EISA 4L8YA 4UASA 4OB8A 2EOAA 3DMNA 5IYZF 1U94A 2OPHA 4FIDA 1SXJB 2FRDA 1QYCA 2YWEA 4FD2A 4ZT2A 2IF2A 4C22A 1UC4B 1FNSA 1ZI8A 3GRFA 1SXIA 2XSZA 5CEFA 2J3IA 1W4RA 4I7EA 2AN4A 2BKLA 1LSOA 3RSGA 2E1RA 5K0FA 1DUVG 1XLWA 3W2TA 4TL7A 3EGDA 2FG6C 2GR9A 5F7XA 1D09A 4NEGA 1P19A 4XVRA 1EFDN 1N5MA 4REMA 4A6EA 5LQJA 1Y8QB 3ISJA 5HE9A 3VH4A 3ZHUA 5D3MB 1LNZA 4AF7A 1QFJA 1S2DA 3CZ9A 5I47A 5IJ9A 5IAGA 4ZI2A 1JJIA 3UMVA 1GLVA 3NTQA 3G68A 2AQIA 1N5DA 3OX1A 3UXHA 3GGSA 2XWPA 4IDOA 2AZDA 2C3UA 5DTMA 2GCGA 2P68A 4IQ8A 2J3EA 2RDMA 5DW3A 4MEBA 3KJEA 3L1VA 4B6GA 4N18A 3LIIA 1E1CA 2NU7B 4QODA 1AHNA 1EFPB 4QUBA 3DMFA 3IA2A 3WLNA 1KAQA 3CLTD 2FMHA 3OI7A 3Q3EA 4HC4A 4YROA 1RXEA 1CR6A 1KXZA 1QOZA 3HWRA 4IMJB 4JS0A 3AC0A 3JQDA 5DIZA 1V6SA 5C1PA 5KWSA 5B58T 1Z0JA 1M9NA 4EY4A 1GD1O 2ODQA 4UBOA 3VR6D 5GJWC 3V8EA 3ZZ1A 2Q49A 1ZMOA 2R8EA 4UE3S 4ZAVA 4BZPA 3EUEA 4PG5A 3TGLA 4TZ6A 1L5HB 3K53A 5CA0F 4B3HA 2G71A 4B3GA 1PGQA 2O8EB 3GJ4A 2PMEA 4CM4B 2F9MA 1PWXA 3B3FA 3TOCA 4DT1A 2BKVA 4N01A 1J33A 3OX4A 3M6AA 4BMCA 3KCNA 5I4CA 1U0HC 4N5IX 1G38A 1M1NB 2FMKA 3S70A 1NL3A 2HU5A 3DYBA 3DEFA 1U65A 2YNMC 1EX7A 3JW8A 2Y1CA 4IIJF 3MLEA 5I4BA 4RQAA 2AXNA 5D51S 1KGDA 2G0NA 1NZFA 4RY0A 3TZHA 4F7WA 1W88A 1O96B 4ZOQI 3EIFA 1LDGA 1YBVA 5F7ZA 2BFNA 1YR9A 2I67A 2JHPA 1C30B 2ODWA 4D9GA 1OIWA 1IB0A 4KLRA 2D5IA 5KKCA 3FOZA 3J81A 1EBFA 3C1TA 5EVJA 2R79A 1NV8A 1Z4LA 3KYCB 3VH2A 3GGDA 5GZ3A 1VCOA 5KTMA 3W1EA 3ADDA 1R6AA 1N6KA 3GCGA 4IEIA 3GFFA 3UBMA 1SBQA 3TQIA 5AW9A 3SKYA 5AKKA 2WG1A 5F2KA 1JWAB 2I76A 5FWYB 3TSAA 4D1YA 3TFOA 4TSKA 1AKNA 2MWMA 4RW0A 4EMSA 1B1AA 2Z9BA 4KC0A 3PRYA 2XZOA 3PCTA 1DCMA 3LD9A 1R3UA 3KUXA 5BVHB 3MWGA 4EKDA 3A1VA 3PZRA 1JNYA 3FI0A 3R9XB 3PX3A 2ACEA 2ID7A 2XD4A 2XQFA 5CG1A 2VJMA 3GLSA 3TKYA 3MM4A 5BQFA 3LQ2A 2OHJA 3BZUA 3F67A 3A1DA 1Z83A 5I9MA 2OB1A 1ENZA 5JAZA 1NVDA 1EFRA 4DKXA 5JASA 3V7YA 2EWWA 3TTSA 1P33A 4JT8A 5HZMA 3Q1KA 1IZ0A 1ZD4A 2ABWA 2JLVA 3SHQA 3BSWA 3O8DA 1JDVA 3ICVA 5AM2A 4XWYA 3P9YA 1O94A 1HYQA 5EKUA 2X8WA 4J9VA 1N9GB 1NE2A 4R3NA 2ZJ2A 2H5LA 2HIGA 2REQA 2W6OA 3KXPA 1A96A 3ESYA 4ZTBA 3EPHA 3R3YA 4CEJB 2H7VA 1G41A 2VJPA 3F6SA 5B53A 1Z5VA 2XYHA 3FSGD 3NONA 5EE0A 1L1FA 4BO1A 2XT6A 1U1FA 1U6KA 4M49A 4IDCA 4QJBA 4RK1A 1DGQA 2FWAA 2R9VA 2YXDA 2LCIA 2WUDA 3O92A 4D44A 5CA1A 1F17A 1WDTA 3JQFC 3TTYA 5KVCA 3GJZA 3DO6A 2Y67A 2D0DA 2VKTA 3M2PA 1RWNA 4HAYA 3RB8A 4H1VA 4C76A 3REQA 1EUQA 5C7YA 1G21B 4YAJA 3IOMA 4U7DA 1XLTA 3VYRB 4NBVA 4JK3A 4PGAA 1UANA 3JR7A 4EG3A 2XGSA 3RSHA 4YRGA 1R6VA 1V7CA 1W5TA 1V2HE 3NYWA 3TZBA 1MA0A 3O4GA 3ROZA 5A7FA 1JE0A 1Q0RA 2QW1A 3QVLA 2Z83A 2XCQA 2C9YA 4GVXA 4IUYA 2OAP1 1YRYE 4TV9F 3VTFA 2GJ8A 4HI0E 4RKFA 4G5GA 1PBTA 2XUPA 1E3JA 1ZITA 1ML4A 2Z1DA 3WSVA 2M6KA 5HBGA 3F78A 3LP8A 1ZR2A 4U0JA 3CG4A 3PFWO 3NXSA 4C05A 1ELOA 1ZSYA 1XF9A 6GPBA 5JBIA 1Z17A 4KQ9A 4ZDWA 4S0ZA 4PLTA 4Q7JB 3RU7A 1EIWA 1NMYA 4J9UE 3D8BA 1EHIA 4BPRA 2NSHA 4BVHA 5CX1A 3CVWA 3IJRA 1Z3CA 3PVSA 2H8GA 3R6TA 1Z8NA 1SXJD 5LQKA 2DHCA 3BH7A 2FSVA 4G0OA 2O8BA 5H8WA 3ELUA 3Q0EA 4Y1GA 1G0NA 3CZ5A 4DA4A 3GFBA 1VCHA 5CLHA 4M1EA 1L7VC 4L5BA 4OHVA 1ZAKA 4PRYA 4N3NA 5BMOA 1KJYA 1TF2A 1RWKA 2EL7A 3QF4A 3QX8A 5A4IS 2VNIA 5TJHA 3TNLA 1QOPB 4XRGA 1P2GA 3ZQJA 1WA5A 1RPNA 3SBOA 3D6VA 1O6ZA 5AXDA 2J31A 4RHFA 4LJ7A 3WGJA 3GCWA 1EK0A 3ZE1B 3HBLA 4I1IA 1AKRA 4H08A 5KCZA 2QJOA 3STWA 5JFOA 1IPFA 2CB9A 3H0CA 4GP6A 2B36A 2WIFA 3AYZB 3T1YB 2UXBB 1SCJA 3CW2A 1O96A 2WSLA 5SY9A 3I2KA 5EP2A 5KCMA 4BATA 1ENYA 3KTAA 4I8IA 2CNNA 1L5OA 2VDOB 1ZK3A 2X4IA 1Z6PA 4F11A 2QM8A 2Z08A 1T3HA 4MGEA 4LY6A 3PI7A 3V2HA 1H2ZA 4U39A 2DFNA 1JDBC 3I2FA 1WX1A 4FB5A 1M0TA 3CE6A 1CUAA 1BEUB 4OIMA 1GVHA 3WK6A 2G40A 4PQRA 3MJCA 3QEMB 3ONFA 1JLLA 3AR2A 1QQ6A 3DD1A 4XLTA 4CQLB 4YMUA 3E9MA 4TT3D 3P97A 2YYAA 3VPCA 3MJEA 3W79A 1UIRA 4F8EA 1RTKA 5KSOA 1YA4A 1KSJA 1TQ2A 2VJDA 2LUOA 1ZNQO 2JFQA 3E2PA 3GJ8A 1RQNA 3BD7A 3LUPA 1MC8A 2I6XA 3ELYA 5FEMA 3PQ7A 5UKDA 2ISSD 5M2QA 2CFCA 3PUKA 2PLRA 5FBZA 3QVGB 4TVBA 4KQHA 3HXLA 1UAGA 2QUAA 4XVHA 4ZVTA 4KNWA 1T6NA 2CDCA 3Q8KA 5FFNA 1J49A 1I2DA 1NOJA 3SF0A 1U2GA 1P5JA 3K31A 4QUKA 4DM7A 1DXHA 1C8KA 1GZDA 5CMLA 3GVIA 5E4TA 3ZCPA 1EXVA 1R15A 4HF7A 4E14A 1GDTA 4A0SA 4N8EA 5ICEA 4EJ6A 1QIHA 2WUFA 3KOWA 4G85A 1X7GA 1OBOA 2REXB 4L4YA 5H82A 5T4EA 2HB6A 4YJ2F 2CLMB 3NAGA 3HGQA 4G0XA 1ML3A 1PCXA 3IB6A 4N49A 4P86A 4A15A 5EI5A 3NPMA 4J0JA 4FX5A 3N8GA 1IHUA 3JX9A 2BLLA 1CZNA 2ONCA 1R4NB 3OETA 3PHIA 4DADA 1BIFA 1KAGA 1A50B 3EY9A 3FHOA 2P1DA 3U1VA 4G4SP 1T6ZA 4EOGA 3U3OA 4KFCA 3QNMA 1KDTA 1Y48E 3I2YX 5KTTA 1CUYA 1IOVA 4MJ7A 2ZIXA 3S7TA 4GZ6A 1KI6B 1X0XA 4CFSA 1X1CA 1VA5A 1HSZA 5C53B 3S29A 4PNZA 1XU9A 5I48A 3KQNA 1GTVA 5DX0A 3T61A 4DNXA 3MB8A 3AI7A 2I7DA 2J3MA 4P0QB 1UWCA 2BGJA 2RK4A 2X5XA 4X5OA 2UUBB 3BCUA 4QBGB 1P7WA 3DBRA 2QRNA 3OTWA 5BV1A 4DQUA 3MWKA 2IYXA 4NICA 5ALUA 1LU9A 2DM6A 3G8CA 3PUYA 3ZDAA 4HMQA 4IDAA 4JDUA 4Q9JA 4ZO7A 1W9MA 1GZUA 6CHYA 1PSZA 3NBAA 4NZYA 2PHZA 4LF8B 1JB9A 1P0FA 3A2NA 1TA9A 3UAWA 2BN4A 4EQZA 5DTRA 5SZIA 1DV1A 3O94A 2QBYA 1DEXA 4O0MA 2R7LA 2W37A 4MR9B 2OBLA 5JCPA 3SP1A 3WB0A 2JIRA 1XJCA 1YS6A 2XNJA 4MMYB 4UTZA 2GXQA 3ITEA 3TJRA 4YPOA 4MVXA 1X1EA 2QGZA 2ZBRA 1LJ8A 5IFKA 2ORWA 1EFKA 3M6WA 2OGTA 5P21A 1BX3A 1NNLA 1JT2A 4I9NA 4HVCA 1E7SA 3A7DA 3OEED 4V0RA 1HKHA 2TMGA 3FIJA 5J9FA 3ZHTA 5IM4F 3ICWA 3KZXA 3DBLA 1TQ4A 5JAHA 1ST3A 2B94A 3MWEB 2DE0X 1A9OA 1TJ3A 2ZBPA 1N34B 4I1PA 2O8CB 2REBA 1OKKA 4XJVA 1JHZA 2NVWA 2PH7A 3NWBA 4UMFA 2MT9A 3HV2A 4I55A 4WY5A 2P69A 1CUXA 2XYRA 3B3AA 1TTHA 1X1DA 3TEFA 4EW3A 3EXHB 2X4GA 2IYEA 4GE0A 2XKJE 2VJNA 4XM2A 1EFUA 1W46A 1XJ5A 3OBIA 1R50A 4COOA 2ZM5A 3VYSB 1QLWA 3WFZA 1V4BA 2J59A 4OP1A 1P5ZB 4BX2A 2X0NA 4KMRA 3ULKA 4K9NA 2VIIA 4YJFA 1G8JA 4Q7EA 1GTMA 1CY8A 3SQWA 2EJWA 5LBTA 3ANLA 4A0RA 1E94E 3T1HB 2HA6A 2AN5A 3SC2A 3G0OA 3EGOA 1A5ZA 3UAGA 1Q21A 1TK2A 2C97A 2ENWA 2H1SA 4Q66C 5JTTA 5FBVB 4I08A 4MP3A 2VZ9A 3UJPA 4NY1A 2QMYA 2G5PA 3DO8A 3N5CA 4O2AB 4CYMA 4TGLA 3PFCA 4ZQFA 4BKQA 3REFA 2D13A 1HRKA 1F1JA 1MO2A 1NX6A 5AD1A 2YUTA 3CEJA 3IE2A 3NBKA 1HL7A 3OCVA 3FYHA 3P9NA 4RHYA 5JMPA 5BV2P 2XUDA 2WIDA 2QMUA 4DEVA 1MRZA 4NOLA 3BJMA 4AN0A 2ILVA 1HX7A 1QP7A 1DDIA 3WGHA 4ZD6A 3QVGA 1KY4A 1VGRA 2VNHA 2GTIA 2WAOA 2Z1NA 3JYNA 4EENA 3MCVA 1BFUA 1S8FA 1NUUA 3IQGX 1SD2A 3PE6A 3C5EA 3QPAA 4KWHA 4QRIA 5AM5A 3EIEA 1W44A 3SHWA 5LZ7A 4V1CI 4RZXA 4P38A 1K8RA 4EHKA 2CKMA 2PWBA 4JNCA 4PM4A 3TRDA 3U4QB 4F4UA 2W70A 5JV5A 1UKVY 3G7UA 4M22A 3HBMA 5B57C 2FV8A 3L41A 2FCRA 3ANTA 2NSLA 3M6IA 1U2TA 3Q5GA 4XGNA 4Y2TA 4BECA 4D99A 5JQWA 3D3WA 4TX1A 1LLQA 3A25A 1JJ7A 1OZHA 3OX3A 1WQ3A 5G0WA 2QN8A 4PGMA 3WWPA 2BFEB 1VI5A 3A6GA 4MYUA 5BUQA 4XIYA 3WLHA 4IO0A 3WGVA 3SBXA 4YCLA 3R3HA 4IVRA 3KT6A 1PWHA 3CB4A 2AA3A 5ALIA 2B2NA 3LVRE 3LLSA 1OFVA 3E05A 5AW7A 4YDHB 4DLPA 1WMFA 2W4IA 2G8NA 1QFYA 1PNTA 2DWPA 1K89A 3F98A 3GLIB 2NU8B 1DAGA 4K9OA 4B76A 4DN6A 5HM6A 5KWIA 2B1GA 3FGNA 1RLIA 621PA 1T0BA 5HIMA 4M9CA 2X4LA 4R2WA 5HX7A 2J0VA 2J0EA 4R41A 4BO9A 4CF5A 3PRKE 4NG5A 4L08A 1T3ZA 2UDPA 1CHDA 2Z9CA 4DDMA 3JATB 1UKEA 3AL3A 3O74A 4HY3A 1MX3A 3ZJ5A 2XZTA 5J2TB 1UBLS 2J3HA 1NPDA 2Q2OA 2CMDA 3ZZUA 5LIPA 4BGVA 3DP7A 4Z1OA 1ABBA 2IHVA 4BFTA 2PX4A 4X65B 3UB4A 3OF5A 3QOXA 1FJGB 2GF2A 1QGUA 4MYDA 2HQBA 1OV6A 4LZNA 4NZNA 5DZSA 3WNZA 2Q8PA 3MMXA 2IPAB 4X0EA 3TIXB 2BCJQ 4DCCA 1SHLA 4FKMA 2NVUA 2WILA 1R12A 4DR4B 4K3UA 4G0NA 4OHWA 5K4AA 5CEEA 5EJ7A 1GA4A 4YMSA 4M6WA 3SICE 4ZI7A 3UAYA 1RC8A 1UINA 5AVOA 4ALNA 2PL1A 1SVUA 3IJPA 1R66A 4D8WA 1Q1EA 4Q4LA 1A9YA 4UM7A 3K5PA 4LJSA 4ZEOA 2B6NA 5CH5A 2HPVA 5A4JA 3OPVA 1XCPA 4Q9IA 5IZ4A 5D1HA 2H7CA 1T4DA 3IDZA 3FCSB 4S1PA 3ZI7A 1U99A 2EQAA 3VZBA 5HHTA 1AS2A 1L4HA 4I14A 5EJ8A 3OZXA 4X1YB 4TLCA 4WADA 1Z5ZA 5TEVA 4BVLA 1RXVA 5BRNA 2RJNA 4N5DA 3IELA 5BNZA 5BURA 4HAWA 4IUDS 3VKGA 1VPDA 2DBQA 1JFFA 1C8BA 2ZSKA 1SVMA 3KFXA 4TLMB 5A9TA 1DARA 2NXJA 4UAVA 3K05A 4UEOA 1SA0B 4BU1A 4GXQA 4P5DA 2IITA 5F7OA 3UNXA 2DLNA 3U44B 3OOJA 4V2IA 3W9YA 3J81k 1EVQA 1HTTA 1W94A 1X42A 2WV7A 1VE3A 1DAKA 3PYLA 3O93A 4J16C 2HNKA 2VFAA 3BCHA 4D9HA 4K05A 1IY0A 1RYMA 3BDVA 3RK4A 1SPXA 2Q3FA 2A58A 1EFLA 3FWYA 4V0LA 1YCHA 1PLKA 3T5CA 1T2EA 3K9NA 5CPBA 2QN6A 5L3QA 4TQUS 2VDUE 3HB5X 4UHBA 3IQEA 5ALDA 1ZY2A 3W3AA 3LL4A 2FUG6 2AC2A 5GV8A 4E1AA 1SUWA 2CXXA 3FSGA 4G0MA 4L5IA 5EJFA 2ZZNA 1SBTA 5JMTA 5KJCA 3NR2A 1FFYA 1AMNA 3CYFA 3OFNA 1J22A 3NIDB 4KYVA 2P65A 1U8AA 2W48A 5EINA 3IKTA 1N77A 1PG0A 2HBZA 3H2BA 3BXHA 1JA1A 1Y82A 4EL5A 2OC4A 4FR0A 1U3CA 3HNPA 5T64A 2C2OA 2O2CA 1ZD2P 2A9QA 4IQGA 2UZIR 3EFOB 4W1SA 2RBGA 3I5YA 3KAKA 2VPWA 5D00A 2J67A 1P2BA 1XLUA 2X2OA 1P5RA 4O4JA 1PV1A 1EINA 3NHAA 3UW1A 1QDEA 2QPAA 2X5OA 4OSPA 3LY8A 2ZRIA 1C29B 2DWUA 1WU7A 2OCDA 1Z39A 5KJEA 2FZVA 1I2CA 3QBVA 3D6AA 3DZDA 4FW9A 1NW8A 3GJQA 4G86A 4IP0A 4OHFA 521PA 2XRZA 1O0CA 4B4KA 2YBEA 1FP4A 4JKYA 4Z9FA 1RJWA 3UCFA 1N1MA 1WUYA 5CA0B 1VJRA 1JHAA 2LV8A 3WL6A 1V3TA 8ABPA 1HZJA 3ADCA 1JFLA 2FZGA 4N12A 2C5AA 4B0PA 4WZBE 3WGKA 4ZALA 3WGTA 3DG9A 1YJCA 2AMFA 4OFZA 4OXYA 4C0HA 1Z4KA 3LUDA 5KVAA 2Z2JA 3RPEA 2IYUA 4FD3A 3RUPA 1BMQA 3O6VA 3H9QA 3E9YA 2F48A 1K8ZB 1NQTA 2ADOA 1G20A 1KFKB 1W0JD 1ZNXA 5JD3A 2ZTUA 1JEYA 3ROEA 3LQFA 3M89A 4ZAXA 4W5HA 1EGVB 3NHSA 3NV9A 4J4TA 2R7AA 3LF2A 4NESA 3WLQA 4ZT3A 1KZ9A 3B7GA 1JFFB 3EWSA 4B31A 4IJMA 2GN1A 4DR3B 3K70B 5SV2A 1WIWA 1P9LA 4JLJA 4O2BF 1A5AB 4MQBA 1WXXA 4I2VA 3A6LA 3A3PA 3VZQA 2OO5C 2X1LA 4L2IB 5JO0A 2ACKA 1GGNA 2ZJ5A 3P2IA 2KB0A 1EJ6A 1ADBA 2IZOA 3H9GA 4YRCA 2C92A 4BKRA 5IM4A 1DT5A 4XQGA 2G25A 4CQMA 5C2JB 3F6CA 4OUDA 1KPGA 1CJBA 4A9AA 1G1AA 5DGTA 3OE7D 4KGXA 3RHZA 5DULA 2LPMA 3THWA 1PGOA 1EXWA 1ZU4A 2QWXA 3FGZA 4I99A 4JB0A 3F3KA 5GJCA 4ZXFA 4A8JB 1UKAA 3PEYA 1BWQA 3KQKA 3PGXA 3EG9B 4JLVA 4HPXB 1ZM9A 3G1TA 4GMHA 3HXOA 1CB0A 2QL7A 2HMUA 2P3OA 3O84A 4RJIA 4HGNA 2PZGA 3K1JA 3W34A 4MW9A 4B43A 4HWTA 4PLWA 4OQQA 1Z0AA 1GV0A 4KIWA 4TXHA 3TH5A 5LVAA 1UFKA 1FSGA 5BUCA 2V03A 2ISCA 3K35A 1Z4QA 3PXEA 5D8DA 5TPWA 1KJ8A 2TYSB 4GS5A 3VV2A 3WKBA 2GPYA 1IE3A 4NPAA 3VHXB 1ZK1A 3PDUA 1V8PA 2F9FA 5CB6A 1N78A 1T1JA 1IMOA 2JC3A 4OCZA 1HE8B 1O77A 4MGHA 3OE4A 4IJVA 4TT8A 3OZFA 4KK4A 5D86A 3W5UA 1HDCA 1R5NA 1KRHA 1N3BA 3EEIA 3PXUA 1DKRA 2OQIA 3GUUA 1FMFA 3H5LA 1JX6A 1ZD1A 2GNAA 4GOJA 3H3FA 5FNVF 3DMYA 3DTVD 3MTQA 2I3AA 3DDUA 4D8TA 2I2AA 4BP8A 3HVRA 4XAQA 5AVJA 4NCBA 2YYSA 3RYTC 1EDOA 4YCMA 5K3OA 3PNMA 1JR6A 4IHJF 3RG8A 2NUAB 1B8OA 4HOYA 4BEVA 4RFSA 3RK0A 2ECQA 1X80B 2HIHA 2JJQA 1UPCA 3EBPA 1M8KA 2QAIA 3EYWA 1BDJA 2DFDA 3I6IA 3NH9A 4AJHA 5BSEA 4E13A 3UJNA 3MWYW 1PWZA 1TFUA 2QY9A 3WDSA 1VZ2A 3NM4A 4QOGA 3ZI4A 5BN1A 1M2KA 4YPFA 2WJ4A 3LH5A 3RGWS 2C7VA 4QXRA 3K5IA 4BE4A 4LNUB 5J59A 4QC2A 1GLGA 1ZN2A 3ACBA 3UO8B 4RL4A 3VR4H 3UH1A 1XQ1A 2AKAB 2CD9A 1Q6YA 3FNGA 3Q8XB 4RKQA 5B55A 1L1RA 5CB8A 2OXRA 1DBQA 1IJBA 1EVIA 1IXSB 1DEKA 1QGZA 1XGKA 5JS1A 4F5EA 1CSEE 4UMDA 2FQYA 4CCYB 1JRLA 4YP0A 4IH9A 1Z4PX 1L5HA 3MD9A 5FORA 2UYYA 2AFIB 4MV6A 2FJ0A 5DYTA 3H1AA 2VF4X 5BQPA 2YASA 3AOEA 4GHWA 4HAZA 1H4TA 3LO8A 5C46F 4OKIA 3K72B 1UM9B 1T0IA 2G4CA 1TZKA 2GSDA 3EC1A 3HDGA 1D5CA 1IJFA 5A5FA 1AC5A 3DOOA 3MILA 4KR3A 3HWWA 2FQQA 1ONNA 3DZIA 3W4IA 1TU0A 3F4BA 1UT6A 1OYOA 3DPIA 2RHJA 5E4JA 4FE4A 1EWVA 3UIEA 3LBFA 4GPTA 4F2DA 2O3QA 1SCUA 4FNAA 1WG8A 1L5LA 1QQTA 2QRHA 3IAS6 4UZFA 1NN5A 1SG6A 2VDRB 4JYPA 5FBLB 3SQLA 2OO7A 1N8TA 4ZJUA 5K03A 2IUYA 1KYQA 1MH9A 2C57A 1QOQB 3BERA 2XAUA 5ECYA 2CBZA 4EY6A 3KVRA 4FS3A 3CSUA 3IP1A 4LDNA 1VOTA 5BMVB 1ZH4A 3AJRA 3ONVA 1UM8A 4EY5A 1AN9A 1E9AA 3QITA 5HMMA 1ZIYA 5K7SA 4QYWA 4X7PA 4ARIA 1YQUA 2PAAA 4HAVA 4HCJA 5AVVA 3AGPA 3GIWA 4MUFA 3LPAA 4QG7A 3N74A 4Z4FA 2ZR9A 1KI1A 3DEKA 5E9JA 2B83A 5LKAA 4F4DA 5A3SA 4EHFA 3MGKA 4HDOB 1E8DA 4O4JB 4DLTA 3C3MA 3HGMA 3HO6A 3LJKA 4ZZIA 1R6BX 4ALMA 1XSEA 1DHRA 2GHQA 2H48A 2IXDA 2JATA 1PUJA 2NTYC 3H4IA 1XEXA 4Q3EA 4A8PA 4CMEC 1JYEA 1YGYA 2D1QA 3F7OA 3Q3GE 3SLKA 3NPAA 1Y1LA 1T10A 3G0BA 3KAJA 4E3ZA 4E70A 4JLOA 1DJNA 3H5TA 1DXYA 4E5KA 1QORA 4REQB 4AWBA 3ZLUA 1O8BA 2H0AA 3I9LA 1XYGA 2YXLA 3WLRA 2RE8A 2BR4A 2H8KA 4FNGA 4OQPA 2LRHA 4UVEA 1E2GA 2I71A 4RTLA 3TI7A 3UBTA 3ABOB 1L8AA 4F9TA 4LDJA 4LBYA 4PTZA 1PW5A 1ULBA 3OU2A 4M1TA 5B3AA 3AR3A 4JBHA 4ZOLF 3DZBA 3E7PA 2FH5B 2G63A 3AXSA 2A33A 2GASA 3L0PA 1KMNA 1X0VA 1MB3A 4ILKA 3O5AA 5B1YA 4OTZA 3P9QA 3EGXA 1AKEA 1KZGB 4NBUA 1VIVA 4IWNA 4OU5A 1AS3A 9LDTA 3OSUA 4WL0A 4D25A 2Q99A 1WOYA 3B3GA 2XYGA 3G9UA 3K6KA 4DNOA 5CT9A 4X1IA 4QSHA 3U7QA 4C87A 2C7QA 3UG6A 1CEYA 3NHMA 1GTRA 1YQWA 1P6XA 4U7GA 1RKBA 2WU8A 3WGZA 3PDWA 1W4ZA 2VK8A 4XB2A 1MOZA 2C5FA 3GHHA 3KWMA 3NV7A 4AJJA 3ANXA 3CJRA 4U7FA 4D57A 5C8XA 2B2CA 2C2BA 3Q2KA 1PS9A 2P4UA 1PJRA 5DFAA 2GBLC 2Z95A 4BNZA 3UJHA 3KTFA 3FUWA 3L9WA 3SMQA 4D3ZA 5CVDA 5CU7A 2CK3D 5DYNA 1S8NA 3DEZA 4CL8A 4D81A 5B4TA 4XE5A 3S55A 4F45A 4M0DA 3PQFA 4YHHB 1KK2A 3FNQA 1R37A 4Q7QA 5KU1A 3K6SA 5K3EA 1DRKA 3GJ5A 2W0SA 1Z22A 4G23A 3EOBI 4D9NA 1DINA 2RCNA 2XCRB 3VMFA 2D2VA 3PNYA 1I0ZA 2CCGA 2R47A 4UFOA 3QX9A 4A2PA 5A6VA 5KB3A 2UUCB 2DGDA 2JVKA 1H42A 2QSYA 1JHMA 1R5OA 1BCSB 3GD5A 3PNKA 5AKXA 4AZ3A 4AROA 1QP0A 4P3YA 1SCAA 4ZXPA 3QNUA 3TW0A 5IMSA 5LP6B 2YOHA 1X8LA 3NHUA 2ZAMA 3CRW1 1FPQA 2IOFK 3CXRA 5L6LB 1KDPA 1Y1QA 1U2QA 4X61A 2ZIWB 4Y8VA 3DHVA 3TPFA 3EW7A 3O4RA 4B75A 3HA7A 4CU2A 5JSHA 5J2TA 1ONOA 1OBFO 3LC0A 5EMJA 4EUNA 5ADHA 5LBUA 5KC9A 1UXJA 2JFXA 3HUFA 4EG1A 2A1TS 4HZUB 3H16A 2CDAA 4WHMA 1W36B 1GU0A 1OWOA 4F3YA 5GVSA 1ID8A 1PNOA 4PWZA 4MJXA 2YTZA 3GCXA 3KUUA 4QKQA 1VM6A 3IQZA 4P08A 2ZYRA 4G5HA 1DC4A 2W8ZA 3AOEC 4WK4B 4BIMA 5JNSA 1LTKA 1IK6A 1WVGA 1PQUA 1QTIA 3H1BA 1ANKA 3OHPA 5E1MA 4KYUA 4UM5A 1N2CE 3T3MB 3UOWA 4JI2B 2Q3LA 2CHFA 2BFOA 3D3QA 4IWYA 1GVNB 4DTCA 5KYTA 1PJZA 2OZVA 2YN2A 3IKVA 3K2BA 3NKLA 1XZJA 5CGZA 2BKAA 1ZNWA 1J7JA 3F5FA 2FPLA 4M2LA 3G0IA 3FCOA 1WWKA 2YJZA 2FHPA 4DYVA 1OR8A 2XA9A 1E3LA 3MRVA 5ERYA 4JU8A 5D3ZA 4CMEA 1HI9A 1MVOA 4X85A 4URXR 5JHGB 1ADJA 1ZU5A 3CEPB 1FFBA 3VKVA 4WZAA 5DWDA 3EDYA 3WMRA 2E4YA 1TK3A 1ZKMA 3DBIA 4I46A 4URHA 4V02A 4ER5A 5AVUA 3GPBA 1PK9A 2VRCA 5JCOC 4NKRA 2C3PA 1IBCA 1T8WA 2IODA 2P62A 2RC6A 2YFQA 3EQZA 1WEKA 2W8BA 3AESB 3FPLA 2PEZA 5H83A 2G82A 2WRZA 3LNTA 4LFCB 5CCXA 3HFGA 1THTA 3ABIA 2IGBA 1ILEA 3JAMA 4R9SA 2NVUB 4ZTUB 1LS6A 4RWEA 3QP9A 1B3BA 5J43A 1A8HA 1KP2A 2P4SA 2TECE 4QU0A 1GZ5A 1WMBA 3C0KA 3R0JA 2WFAA 4EVIA 4G1MB 2K7FA 1IEWA 2ZVDA 3K5WA 1T5LA 2AUTA 4C5AA 4WGFA 4IIXA 2GXAA 3QXXA 3CT4A 4PYOA 4YP9A 3A1SA 3FTNA 3K1ZA 2ICAA 1JHUA 3CX7A 4HX5A 5CXSA 5L7YA 4C06A 2LDBA 4WZZA 4ANFA 4F7DA 4GPBA 4DLBA 4YCSA 2C3MA 2WYWA 5D1NA 5LDDC 1H4VB 1BN6A 1SJ9A 3I64A 3EGVA 1MUUA 5HIKA 5IJ0B 5KOHB 4RPGA 5DBEX 2IQIA 5IM5A 1BE0A 1C7QA 1DFIA 1W4BA 3BRCA 2QRPA 1X1SA 2G08A 5FNVA 2R86A 5DNVA 4KCGA 4PFQA 5T67A 3UMRA 3OTHA 5JIBA 1CWUA 4GQAA 3HM2A 3A36A 4IJQA 4M0EA 1RI5A 3PEVA 1W4CA 2VHYA 3D0OA 3S2IA 2PUAA 1NOIA 3WRWA 5BMVA 2RGUA 3VQTA 2Q3CA 2MR6A 5K8UA 3EXIB 3PHCA 1AJEA 1ZN7A 4V03A 3HR7A 2M32A 4G8CA 3HJFA 4PAOA 2ECOA 1KMCA 2Q6TA 2X41A 4WN9A 3TMAA 3K9BA 4U7WA 5CDSA 5KWEA 2HIAA 5JAPA 3N76A 2SECE 4DAOA 4UULA 1T8UA 5JJKA 1QJCA 1PR1A 1NBWB 5EC8A 1V4NA 3P32A 5EKXA 3KUKA 4PVCA 2VDKB 3DWGA 5JH7B 2WVJA 2F1JA 2J87A 2PS9A 1YS7A 2OV8A 2WWTA 3T1VA 4YLYA 5AOVA 3FPFA 4BZQA 2PJRA 5ANRB 2GILA 4Z4GA 2II6A 1ZRNA 4DNPA 2AUNA 2V6BA 3I32A 2CCKA 4XZ3A 4G1EB 3LY9A 3QKRB 1KDVA 1MVLA 3ICEA 3FETA 1A72A 3FPGA 3NORA 3EOZA 3O4VA 4H0FA 1R9JA 1YDEA 2YINC 4Q9KA 3RJZA 4FT2A 1PEAA 4H4EA 3ETDA 1Z4OA 5ECDA 1OXBB 4RGYA 1UOQA 3H18A 3BE8A 3PT9A 4F5ZA 1IQPA 1LY1A 5CW1A 4RKYA 1CS0B 2PZ8A 3R1IA 1DKNA 3DM9B 2Q1WA 3GARA 3DWFA 2VK2A 4YUVA 3RBXA 3V8BA 3OP4A 1N32B 2VS1A 2FFBA 2ZE8A 1V4VA 2QMHA 3W8EA 4H7KA 1JV2B 5EIXA 3AFHA 4V3CA 3R7BA 3IQWA 5CCEA 4LJRA 3TQSA 4IFIA 4FC7A 4HZUA 3F8TA 2IZ7A 1E6MA 1A2BA 4YUWA 1AZLA 4EG0A 5JPIA 4ADSG 3MELA 3IUMA 3CONA 3LA8A 4Q3LA 2J1LA 3LHSA 1HWYA 1TAGA 1H6BA 2JRLA 4O1IA 4YRSA 5ESDA 2WHEA 4K5QA 5BSTA 3DKRA 1YUMA 2G4LA 2Z6AA 1G8AA 1VL5A 4IL5A 3TAXA 3L7CA 2A9JA 1QP4A 2AKYA 3A6EA 3FNBA 1ZHOA 2W83A 5BYJA 3PUJA 5IS2A 5IAKA 2VHUA 1S2OA 1OIVA 1Y7HA 3KT0A 5J63A 2NO9A 3VH1A 3JQBA 2VHZA 4K2AA 3ET4A 1UOEA 2PUEA 1Q14A 4RSMA 1YRHA 4W6ZA 1YBHA 4GBJA 3CZ4A 4BLRA 2A84A 3NEAA 1RZVA 2BKXA 2QZSA 3R9KA 1J2TA 4ZHQF 3RVQA 3DBLB 2O4UX 1X70A 3R9WA 1GQQA 2PJUA 3ZWBA 1GXSB 4MYHA 4KFSA 3S28A 2BGKA 1NAHA 2BGLA 2RAFA 4QYSA 3GA7A 3FOWA 2WTNA 3BGIA 3D2CA 5C9ZA 2AFHB 3KQTA 1Q2XA 3PQDA 1JYSA 2WFLA 4HEJA 1XLVA 4IGAA 4TL9A 1ULUA 2DPMA 5IC6A 2G28A 4M9UA 1I1OA 3UY4A 2HSGA 2DUUA 2GTPA 4HWKA 4WWHA 4LF5B 2MMGA 2ZRJA 2V3VA 3EOAI 2EDCA 1IXZA 2WUGA 3C8HA 3EPPA 3EXHA 4K8OA 4PAWA 1RAFA 3RAGA 3IALA 4G97A 1L5QA 4UUMA 2O5VA 1K8QA 2ZIAA 2P8SA 3C1OA 1JPJA 3FCYA 3WBJA 4BZWA 3OTQA 1PJAA 4PPGA 3FMPB 1MB0A 2IP1A 3N8HA 3UAZA 3SXJA 2R6JA 2R7KA 1NU8A 4P22A 4BLVA 1PTKA 5BV7A 4QPJC 4KE9A 3W5SA 3TXAA 2VJLA 3MF4A 3WK9A 1A9XA 3DFKA 1HRDA 3EDCA 2CF6A 2DJIA 3KBBA 4YVFA 3VPSA 4HRAA 4N8DA 1SQ0A 3QVVA 5CJPA 5ALTA 4D9CA 2QBYB 4MWCA 4Q1AA 1KE1A 3GT0A 1XDGA 3LXRA 3QPVA 3VAZA 4B3DA 5BY2A 1OIXA 5CXXA 4OHYA 2WJJA 3BRQA 1MT3A 3MT0A 4ZDKA 1M6YA 4UHJA 5C37A 2B7BA 2A59A 2EQBA 2C29D 1DSSG 2ZVPX 3WBBA 4F92B 5HGXA 4UUNA 5FV4A 2AJBA 1AQYA 1YB4A 5BPFA 4LOJA 4IKOA 3O2QB 2FW8A 4BAZA 2AEFA 3VH3A 5ESWA 2BBWA 1PEYA 2JAQA 4JVOA 1GT6A 4YJFB 2F3TA 3FHJA 4MKGA 4YS6A 4PANA 4F4CA 2JIZA 2QRMA 3R6LA 2Q21A 5G1NA 3KYBA 4L3WA 1UPBA 4ZQIA 3UXYA 1E6WA 3L82B 1WO8A 3INGA 2GEFA 2EJCA 4IR7A 1JR2A 4MUHA 3ZE6A 5A5VA 1P9NA 2QE7D 5B6IA 2OV2A 2RARA 3GNSA 3GP3A 3K73O 4NAUA 1E9DA 4XLZA 1ITZA 4PAGA 3W0LB 1ND6A 2PM8A 1DEAA 4BQNA 1UBNA 5IT9A 2VBCA 3UK0A 3KYDA 1IUNA 4AS3A 1YKGA 3H6HA 2YV2A 2FGKA 3PYMA 4WOPA 3QSYA 2Y3IA 1MC4A 1V7QA 3GEGA 1Q1NA 1WCYA 2Q29A 5EPOA 1ZMBA 5FUVA 1HFKA 1XFAA 4I0WB 4HVTA 1EFVA 1Q11A 2FEMA 4R2LA 3R74A 5KNDA 3ZHYA 1WABA 3IIEA 5ENVA 3NDBB 3F74A 4J03A 5CLGA 1DELA 1R5JA 1BDMA 3L6BA 4KXYA 2WSMA 1QGDA 3L1JA 4O4IB 5FOSA 5BR1A 4ZYZA 5JJLA 1JNXX 1IQ0A 4O2AA 5HFJA 3D0KA 3S40A 3TD2A 1FPMA 1H1DA 4Y3UA 5KTYA 4NBSA 1OD6A 1UP6A 3STVA 4CGZA 5IAOA 4L5YA 1EM6A 1TX4B 2Q5CA 2WTMA 4BNUA 4KWEA 4LFBB 5AHRA 1V5FA 3HV0A 3R9IA 3H3JA 3EFEA 3EVGA 3TLCA 1XF1A 4FYHA 1AQLA 2BF4A 5AK6A 3UN1A 1LPNA 4N41A 1HYHA 1SUCA 1LXCA 2JASA 2JIOA 3L1KA 1EK2A 3L7LA 3ZWKA 2P9CA 2ZI9A 1RZRA 2W2OA 2PSEA 2CZCA 4KKXB 2EQ5A 3OIDA 2UVPB 4XLLA 3GMTA 3F46A 5IUKC 1NG9A 2BF7A 2DBZA 1X7ZB 4K2HA 5JFTA 4HPJB 4YYEA 1YJQA 3IP5A 3V2UA 4EHJA 5EPEA 1G4HA 2WHQA 1KQFA 1M67A 3E0QA 3IXQA 1F6BA 1S2GA 4NCJA 1CQWA 3MTEA 4PZLA 4F5YA 1TU3A 2N75A 16PKA 1DRVA 1IUKA 1XP5A 2GPJA 3LUJA 3PIIA 4LV8B 4TXLA 1YI0A 3RVPA 1MO6A 2BDEA 4RV5A 3P45A 2W9XA 4ACAA 3Q7SA 2X7XA 4P4TA 1RKVA 4LBZA 1OYWA 4I36A 1RKXA 4XEHA 3A4LA 3F4KA 5EMKA 2CJXA 1YZHA 4KRYA 4OPMA 4NZPA 3KJHA 1T0PA 3PF9A 1KR5A 5IYZA 3LYHA 4A0GA 5A6SA 5LA6F 2HREA 5LXTF 2ETVA 5EP3A 4KN5A 2WMYA 3SEFA 3ZH9B 4CW7A 1CZRA 3V1UA 1EP3B 5E9AA 5FH9A 3COWA 4LW8A 4ZT5A 4WFJA 5AOBA 2XDYA 3HEBA 3HA5A 4PU0A 5AP9A 1U6JA 1BYUA 1E2FA 3ZY4A 4V39A 3CRVA 2WYOA 4IPTA 5H70A 1MO3A 1RC1A 3H6GA 4MO9A 3CUTA 4PXYA 1KAOA 4R84A 3U7RA 3EIOA 1BG6A 1QIJA 1ULTA 2C5EA 3NT5A 2B6HA 3T7DA 3U2QA 4QGBA 1M5RA 2GBFA 1ZAYA 2LNDA 5H9VA 2JLYA 2FLKA 2WF9A 4BQRA 1TYEB 4G2NA 3QVJA 2WF6A 1ISRA 2REQB 1OLUA 2O1SA 1TO2E 1PR4A 1YVDA 2J3KA 1SELA 3GNQA 1L3BA 3OZIA 5AKEA 2CE7A 1UDRA 2FX3A 4MW0A 4F8JA 2CHEA 1J9ZA 1L7AA 2CVQA 3OIFA 3TSWA 5K6TA 1BHO1 2SBTA 1YU9A 1O7JA 1XNHA 1P7VA 4BBPA 5J23A 5G4KA 5BR7A 2XOKA 4MYSA 4J6FA 1Q74A 6NULA 1MAUA 4Q4JA 2Z4RA 4MEAA 1MCZA 2CZQA 3NBQA 1XAIA 1TO6A 4Y9RA 2KW5A 2E4XA 3MNFA 4GPZA 2HDOA 4O2LA