3DVNB

Crystal structure of k63-specific fab apu2.16 bound to k63-linked di-ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
217
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEWVAYISPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human IgG1 fab fragment light chain
publication title Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB01
1XIWD 4NZUL 4EDXB 2Y1VA 4F58H 4XP9L 3NABH 2F54B 4OT1H 4YEFA 4P2CG 3UYRH 3C5SA 1C5DA 4PJIE 4QHLA 4FQPA 5C0BE 5IW1A 3PWPB 3D5OF 5FCUH 3P4OA 3T77B 4DTGL 2QSTA 4Q74A 1EGJA 3IU3B 3WFDH 2XPGB 4NO2A 4Y4FC 3VRLE 3A67H 5FK9A 3O6FA 4PG9A 2ESVE 2ZUTA 3G5ZA 1DZBA 5HI5C 3ECBB 4H0IA 1EX0A 3EJJX 3BZEA 3EJYC 5JW4Q 5KSUA 1ZLUH 2V2TA 5JUEH 5EPMB 3V6BR 3NMEA 1T1YB 4TVPE 3FFCE 4MJ4A 5TGBB 1CR9L 1CE1L 1E28A 4ONHA 4QCIB 3UEZA 1EEQA 4XH2A 2I5YH 1X6NA 2W65A 1RAMA 1T20A 5GZND 1UXSA 4K94L 2AXFB 5IFAH 4NC2B 1IBGL 1UXWB 3D85B 5DGRA 5ESVA 3UDWA 1UH3A 5DR5L 3SDAA 3EFFA 4ZQKB 4YBLB 4LEOB 1N64L 4GQ9L 2OR9L 5DO2C 2XICA 1FLRL 4AH2B 1MAML 4HXAH 4R7NB 5GS2D 3HMXH 4MJID 1KIRB 1S9XB 1G6RL 2NZ9C 4CN4A 2CIKB 2YMXH 2ZJSL 3W9DA 1NCTA 1CF8H 2FLBT 4I0CC 3P4MA 4PJ7B 4JRYE 2H9GA 4HXBL 2C3GA 1Q0XH 2GK2A 2YA0A 1RUKH 1T22B 1NLBH 4HFWB 4HLZG 3O4LB 5I1KL 2A6DA 2F15A 3QNXA 2JF1A 1MRDL 3ARDB 4QGTA 1ZSDA 4HGMA 1IEBA 1EFXA 4PRID 2BXZA 3OG6B 2DIAA 5HJ3A 3MRKA 4NQEA 4TNVK 1QA9A 3IAPA 5CSZA 5B38A 1N6UA 2J1KA 5J9PB 2XWJB 5CD5C 2W0KA 4F7EA 5LQBH 1WBYB 2A2QT 3B8SA 3OKEA 1OSPL 1AXSB 4ONGL 3MRQB 5DQ9A 1FV1A 1WWBX 4ORZC 5IROC 1OP3H 5K33A 3W39A 1P6FA 4OLVL 2GUOA 5A16A 3ARYA 4KRPC 1ZEAL 4DCQA 4QOKA 4X7SH 3D2UD 5DJ6B 4ZMAT 1RHHA 4HWBH 4MD4B 3VI3F 1BHGA 5D1QC 1MWAA 3I75B 3N50A 5SWSB 3D0LA 5A43C 3SDYL 3MACL 2FD6H 3C60A 2P47B 4HUMB 4K94C 3FMGL 3GM8A 4KK6D 4PREA 3ZTJG 3TM6A 1DLFH 4ZUSB 1OW0A 5KVEL 5H8DA 4MQXC 1R3LB 4ELKB 4LLQB 5IG7A 3IJYA 1KIQB 3ULUL 3TBWA 2L4OA 1ZT1A 2VXUL 1X44A 2XTJD 4PY8I 1FQ9C 3LKQB 1J9CT 4JFHD 1BZQK 4Y4HC 1YN6B 2VLME 3BVNB 1XT5A 2BVQA 1DN0A 1QQDA 1FBIL 1SMOA 3PIQB 1EMTH 2C7UB 3TT1L 2Z91A 4OIIL 3FN0L 3IXTB 4WHTB 5I66A 5AUMB 1BAFL 2AEQH 3O2WL 2VDLH 4XNMA 5FUZL 5MEPA 2PTTB 3IDGB 3MLUL 3TNMA 3I50H 3U30B 3MBEA 3S35X 4MA7L 1FIGL 4JFEE 5DD5L 4L8BB 2I9LB 2NTFB 3R4DA 4KKNA 5DD1L 3QUZB 3RA7H 3ZT5A 5HGGS 2GW5A 1EXUB 5D7IF 4ZUUB 2YD4A 1FFPB 4AMKL 1FGVL 3CFJB 5F3HA 4NKDB 4PJAE 2MKWA 5GIRA 4IIQC 5JDSB 1JE6A 4PJ5B 1AGEA 3BQUC 2ADIB 5HDOA 2NXYC 2OYPA 3P4NA 3BKML 5EDXA 1AQKH 2X05A 2NY6C 3MROA 4J7RA 4EUPB 1P4IL 1LDSA 3Q6GH 4JRXB 4MX7A 1B88A 1I1AA 5T3XE 1OB1B 2EDYA 4L8SB 1W0VB 4JZJC 4XC3L 4DFHA 5IR1A 4KMQA 1RK0B 5DZNA 1AH1A 1T0PB 1IGJB 3OJ2C 4NPYB 2I07A 3PGFH 1A6VH 2HJLB 3QUKB 3MUJA 2EE2A 4NWTH 1MJUL 5KS9A 1JHKH 1RZGA 4CKVX 3MNVA 2A77H 1IILE 3ZDZF 1RUML 2J5LC 3KJ6H 4Q9RH 3ULUC 3RY6C 5JNYA 3PV6B 3PWUB 5CUSL 3V5KB 1HIML 5FA4A 4HFUL 3MA9H 1FFQA 1X5ZA 2CIIB 2VN7A 5T1DL 2HT4C 2YOCA 2AV1B 1CBVL 4K55A 3ZTNH 1S7TB 3SE4C 3OB0K 1XGRB 5I15H 4EBQL 3DMMA 1AIFA 1RULL 2FGWH 3IDXL 5FO9A 4JFDB 4Z7NF 1M71B 1DQML 1PEWA 1JK8A 2FLRT 5INCB 4IRZL 4WJ5A 1TMCB 5CFHA 1CICA 5GS3A 1A7QL 3HAEA 1SQ2N 3QXDB 3BKJL 3RWFB 4F7TA 4OCRL 5IJVB 2RIKA 2EZ0D 1EAPB 1TNMA 4L8CB 5JTWA 4MJ5A 3B2VL 2QSQA 3C6SA 4UU9B 3QDMA 3O41A 2HFEA 2EXYD 2FWOA 5HHOA 2VE6A 2PCPB 1JRHI 5IVXB 3OHXB 3P9LA 4RA0C 2AJZA 2N56A 1X5IA 3AB0C 3VJ6A 4L4VA 4N9OB 4AM0B 3SDXE 2NY0D 4GOSA 5F3BB 3Q5YA 4X4ME 4Z8FH 3WS6A 5IJKC 5CBEA 1QBLL 5HDQL 3C09C 1BEYH 3KWWB 4WTZG 5CP7B 4M5ZL 2IALA 3BDYH 5TE6L 4DVRH 2GSIA 3EOYG 1BF8A 1Q0YL 3QRFM 1NDGB 4LPWA 3ARBC 1J0JA 1HWHB 1XGPA 3AS1A 3KPRA 4NZJA 2XACC 3EDDA 4WV1C 3QQ4A 1U3HD 3KR3L 3NFPB 3QWRA 3QQNA 4PD4K 5I30H 1QEWB 2JB6B 2X9WA 3SO5A 2CLZB 1LK2B 3TZVB 3GB7A 5CP3A 5EORL 4K9EH 3IFPB 3PL6B 4DKAA 5EN2B 4KUCF 5T3ZD 2EECA 1LEIA 3WYRA 1KTKE 1NCCH 2AJVL 3FB6B 4CMHC 2AXGA 1MFDL 2P5EA 2PR4H 2PTUA 3CC5B 4L3CB 3ES6A 4LBEA 1LE5A 3HKFA 3B9KD 4CW1A 4U6HB 3EYUH 1LNUB 4ZUWA 3IVKB 5HGAB 3DVFA 1OTSC 1ORQB 3OR7B 3BX7C 3L5IA 4EQ3A 1J8HA 1HH9A 1G0XA 1IGCL 3IF1B 5IB4B 1H3GA 2R8SH 3VRLF 4JPKH 4FQ1H 1MCFA 2BMKA 2NY5H 2W9EH 3WLBB 4U6YB 5A1AA 3I6LD 2VSCA 4WI9A 5HGDA 2ZKHH 1DQDL 4YFLF 1AR2A 2AXJA 5HVHC 4ZD3H 1NDMB 4WCYL 4AT6A 2I9TB 3LMJH 4WTXA 1FZOA 4O02L 3NZHL 4JHWH 4XNXH 4IDJH 1NAML 4NNYA 4QRRD 2ITDA 3SDDA 4P0DA 4YNYB 3FONA 4KQ3L 2H6PA 5C2BL 4TPRH 1BJ8A 4BJLA 1VACA 1ZK9A 3HNTL 2V5RA 5DRXA 3DNKA 1RZ8B 3RVVC 2R2EB 2P44B 3CPLB 3EHBD 3ZKXC 1IM9B 1X5LA 1X5HA 2YK1H 4HUWA 4RFNB 4V2BA 3GUTB 5CJXA 3ZKSD 4XGZB 3BN9C 2EH8H 3GSNH 1GC1L 2HTKD 3SKOA 1FPTL 4EI6A 1U58B 4XHQA 2GFBB 1DN2A 4BQ6A 5A40E 2FX8H 5JW4N 3RVXD 4XX1E 3IKKA 1I75A 2AJYH 5C0AE 4KDWA 5HHNB 4N0UB 3DX9B 4LVNB 1F4HA 2I25N 2A9MH 3VXQB 3ARFD 1KGCD 3EYVB 3KVQA 2VNCA 2VDNL 4GRWF 1H15A 3LAFA 2B2XL 4OFPA 1AY1H 1P5UA 4OGXH 5I18H 2DTML 5FV2A 1ZHNB 2BRRL 1KC5L 1A0QL 1J1PH 5IT2L 4HAFA 2FHFA 3TO4A 1V7NH 1P7HL 4HKXA 4P48A 3LRSB 2F74B 3MJ8A 4TVPL 4JZOA 4OD1H 4XNUL 1W72L 3WE6A 4HQQH 5J1AB 2ARJA 1N6QH 1S7VA 5INDA 2A38A 4CNIA 5DJYB 1QHPA 4Z7VE 2LAAA 1K2DB 5CEYA 3HI1B 4FFZL 4UT7L 3OPZL 3WIFA 3H9SE 2DBJA 5IF0A 2FR4B 1KNOA 1KPRB 4HK3N 5CIPB 1RJLA 3NTCH 5JHDB 3OAZK 5FA3B 1ETZA 1JNNH 3MLPA 3T4YA 3VWKC 3BHBB 1GGCL 5B4MC 5I74C 2OSLB 3QDHA 4M93B 4RNRA 1FVEA 4NCC2 4GLRI 1A4KB 5EULV 4NQCE 4QNPF 2WSKA 2APTA 2ICEA 5EU5B 3CXHK 2FEDD 2VITB 1GC1C 4OTXH 5D7IB 5HHXH 2E7LC 3P0YH 2AEWA 3V0WH 1NCDH 4QO1A 3HS0B 3MJ9L 4P5MB 1K5NA 5ALCL 3IGAA 2E5EA 1CE6B 5BS0A 5CZVH 5DURB 1WGOA 2ZPKH 2HYMA 4M00A 4OLWH 1IAKB 1KV3A 2P43B 3OKOB 3T09A 3IJHA 5DUML 4P99A 2VRAA 1XEDA 2X4OA 4R0LC 2DLHA 1GIGH 3O11A 4Z7WA 3G04A 1KTRL 4A6YH 3TYGH 1F8TH 5C09D 4PJAF 1L7IL 1I8LA 4ZDHB 3MJ6A 1WBXB 2IPTL 35C8L 2Y6SC 4XI5D 1F4YH 4MDJA 3MRIA 4JHZA 3RVTD 3TEUA 1AQDA 2ED8A 5D71L 3GMQB 4RA3A 4DZBB 1HHGA 4U49A 1UG9A 4D9RD 4YIQB 5IFHH 1V5JA 3CFEB 1VFUA 1JGLH 5EUKA 4NSKB 2Z9TA 3FN3A 4QYOA 1A3QA 1XCTB 1OSZA 2VDRH 2WBJD 5KSAD 3U0TB 5GGTL 1PZ5A 1BX2A 4JGUA 4XZUB 4E0RA 4RMQA 4G42A 5HVGB 2FJFA 4JO2H 1VEPA 4C56B 3HE7A 3MA7A 4ZS7H 4FTVA 2MWCA 4WY7L 4U3XA 4PJFA 1X4ZA 4S1RL 2VXVL 3KYKH 3GBLA 1MIEL 4NJ9L 1FDLL 3E6FA 2IG2L 5JORA 3KPOA 2W0PA 4NGHH 3NCJH 3V5HB 4NN5C 3PQYB 3HMWL 3TJEL 4FQ2H 3DX6A 4MAUH 1BFVL 2Y4SA 3DLQR 1J5OH 2KZWA 1EIBA 5J12C 5GJSH 2PYFA 3L3DA 5IMMA 4KQ4H 4UIMA 2ZCLH 4HG4J 3MTRA 1YPZF 2P7TB 1YQ2A 2VZ3A 1SVCP 1JVKA 1OAUL 1BVLA 1QSZA 4HJ0D 1FFOB 4M3JA 1H5BB 5B8CB 3O2DL 1BM3H 4O2FA 1A3LL 4MAYD 4ZOAA 2VN4A 1MCQA 1DL7L 2F53B 1HZHH 4M62L 5BRZE 4J8RA 1N26A 1BGXH 2VXQH 1ZHKB 3VA6A 2FJGA 1MFAH 4X6EA 3OX8A 2F5AL 5HY9B 1OM3L 5GSRA 5D7LE 1AP2B 3JVGA 4JM2D 1GRWA 1S7QB 3SDXF 4XWOD 2VWEE 1ADQA 1GJIA 3TESA 3QUMH 2UZXB 4KKBD 5B39G 1WT5C 1FSKB 3NCCB 1P4LB 2C9AA 4KWUA 4E41A 3MV9D 5ENWB 2AKRA 1CDHA 4Y5VA 5EUOA 2CR6A 3QEGL 1YEEL 4K7PH 5L2KD 3KGRA 1UYWH 3ILPB 4OCNC 1NH6A 1VGKB 1QLFA 3NZ8A 3OL2A 3L3HA 3JTSA 4XAWH 5J11C 1T89A 2M26A 5L6YH 3W9EA 1LDPL 5C0BB 1QLRA 1KJ2L 4XPGH 4ONFH 3DX8A 1XGQA 3PUCA 3U82B 2XWTA 5ANMA 3RWDB 1KB9K 4LCUA 4CUCA 3OGCB 3S4SG 1O5DT 3DGGB 5AEAA 1YEKL 3CMOL 3RL2A 1SYVA 5DWUH 3TVMB 1U8PB 2WWMC 3QDJE 3HE6B 1TQBB 3PHOA 4I0PD 3RU8L 4H5SA 3WKML 4XCNB 3P0VL 4U33A 4YGAB 5DD3L 1H3PH 1YY8A 4KK5D 1KCKA 3BD4A 1VFOA 3HZMB 2HH0H 4QRPD 4HS6A 2YPVL 4RGND 4UQ2A 5AWNH 4U6XB 2AERT 4L3EE 3FFCB 5MERA 3SKJL 1VHPA 4JCMA 4G8EB 4JVUA 5DRNB 4LGRB 1UKTA 2ZOKB 1CDJA 5E1AA 2QV2A 1QVOA 4NKQB 4ZS6D 1MH5A 5DJXA 5EA0H 3LN5B 3KPNB 4WO4C 4Y2DB 4H1LB 3V6FA 4HKBA 3S96A 3MUGB 3H7BA 1FO0B 2ZUUA 5GRVK 1MCNA 4NFBA 3O2VL 1FFRA 1QFHA 1JP5A 3HG1B 4X9GA 4AG4H 3CVIL 1QKZH 1U8HB 5E8NB 3UTZA 2E9JA 3MJGX 2X4NA 1HYSD 1L0YA 4GBXC 4S1SL 4QHMA 4OF5A 5JXED 1FYTA 1DSFH 2GJ6B 1D9KA 1NC4A 2VSDA 4LKCA 1KCVH 5SX5K 3WNLA 1E27A 4WIQA 3HI5H 1WV7T 3BWAB 1L6XA 3X3FH 1GYAA 1QBAA 3V8OA 4EIZC 4GRWB 2IAMA 4XXCA 2WUCH 4MWFB 1EHNA 7FABL 2LAGB 3LB6D 4UV4L 1D5BB 3C6LA 5D2NA 1WWCA 2E6JA 4ZFOL 1VFAB 1YNTA 4KK8D 1U42A 3U9PL 3OAUH 4CDGC 2WLYA 4G9DB 5FHBL 4D8PA 2FECL 1UVQB 2CXKA 3ROLA 3WD5L 1YYLH 4RWYH 2E7MA 5JOPE 3MRMA 3Q1SH 3BJ91 4QXGL 4R3SA 4NRXB 3BEWB 4ZPTB 1LEGB 5AZ2L 1DBBL 1IAIH 4J6RL 4ZAKA 2PW2B 1U91A 2OTWA 4P46A 3D69A 4HKJB 1FL6A 5D7JB 3F7VA 4TQEH 4ETQB 1DQJB 3MOQA 3BUYA 1ACYL 3RDTD 2BERA 3DHMA 2N4IA 3SQOL 1TZHA 4R4FL 4CGTA 4G7VL 4JPIB 4LFHG 1HQ4B 4JKPH 2AV7B 5SWZE 1AD9A 5F21B 4BELD 4EN3B 4Z7VF 4LSQL 4FFWC 3BD5A 2Z93B 4P59L 1F90L 1EVUA 4P2RE 5DHVA 4R8WH 2B5IB 4YAQA 1CDGA 2X89A 1A2YB 4L4TA 1R5VB 4YHML 1AR1C 5K9JH 2ZOLB 3S36L 1R3JA 2X7LA 1BIIB 1JGUH 3GSUA 4NQTA 5CEXB 3DV6A 3IFNH 3MNWB 3JV0A 2BNQD 4NM4L 1NGZA 4OFDA 3OG4B 2NY2D 1BQUA 2Y7QA 3T0EC 4EVNB 3NH7L 3UJJL 2C3HA 3NGBC 3U1SH 4ZFFA 1ZA3B 2IFFL 4LCIH 5E2VH 3VG0L 2BSSA 5GRJH 3WLWC 1S3KH 1HNFA 4LQFH 3QUXC 2CKNA 1HHIB 5EU7E 3VCLB 4U6VL 4PJAB 1JZ4A 2JJSA 4R2GD 4F57L 4PRHB 4PRNB 4QRQA 4O9HL 5C9JB 1GOGA 4OB5H 4Y19B 5HYJD 1HDMB 1D5XA 4NKMB 1MREH 4Z95H 3ARUA 3MLSH 3FT4B 4XHJD 3W5NA 5EBLA 4RGOL 5KVGH 4QY8B 4F8TA 1WWAX 1MI5E 3SDCB 2XZAH 4EDWH 4ISVA 4FABH 1HHHA 4NO0B 1CGYA 4NNXA 2VISB 4X6FB 3KS0J 1DFBL 5IBLC 2YRZA 4JM4H 1WLHA 2PYEE 3F58H 4JQXA 5GRYA 5J3HD 1G9MH 5EBMA 1BVZA 5C7XH 2OTPA 1WJ3A 5BV7L 1DEEA 2EYTB 3FB5A 4KJPD 1A1MA 5C0IA 3L3JA 1E0OB 5HVWA 3HFMH 3RGVA 2XXCB 4AL8H 4HZLB 1MWAH 1NMBL 1D7FA 5D1ZD 1J18A 1G7HA 3WUZA 2ENSA 2IH3B 4D0BB 3MLZL 2JIXB 4MDIB 2EC8A 3UC0L 4JPWL 3UYOD 2AJXH 2W07A 4HDIB 2HKHL 1AHWC 3STBA 1ZE3C 4GAFB 1MPAH 4M6NH 3MXWH 5I1LB 2WQRA 4L9DA 4PRDA 5C0DB 3UTSB 1YEHL 4YHIA 2HFGL 1S7XA 3MCKA 3OKLA 1NANH 1YPZB 5D8JH 5I1EL 1N8ZA 1R24B 2X4PA 4YXHH 2GK0B 3W0WB 4YDKH 1CFVH 2W91A 1JTPA 2FX7H 2DN7A 4OGYL 1Q9LA 4KVCL 4NO3A 3WNKA 1IEAA 3FZUC 1I3RA 4KKLC 1KB5A 4OCWL 4YHPA 2D03L 5FGCB 4LEXH 1MCOH 2Z31B 3VFNB 4MD5A 3SDXB 1WZ1H 2GJZB 43CAA 5L8JB 4WNQA 1TJHH 4ZFZA 3VDAA 1J1OL 4P5TB 2AEPL 3B2UC 3DSFH 4OGAD 4PY8J 5IEKB 1FNSH 4QTIL 2D31A 3GJFB 1A4JA 1I7RA 1IC7H 3X12B 4Q2ZB 4FQXA 2ZUYA 4MD0B 3U9UA 2DQEH 3ARGC 4PRAB 2BNUA 2NYYD 3FRUA 5BV7C 5L8LB 4YO0A 2YPLA 1EHXA 4LLYA 3GRWA 2GT9A 4KGLA 5AZEH 1I7TA 2G60L 4O51B 4ZXBD 5KVFH 1U8QA 5ID0A 3QUYB 4BKLB 5DQDH 2R1YB 3QT2A 3DXAD 5GGUB 1A7RH 2L7UA 4MJIE 1MIMH 3WNMA 4J3XA 4LOUD 5BO1L 5C07D 2MFNA 4HIHB 1RK1B 5DMKA 1G7PB 1QRKA 1I3GH 1JWUB 1PW3A 3GI9H 3MRHB 5FDYA 3IFLH 4WWKC 4LRNL 2HFTA 2H3NB 1AXTL 2Y36H 1RMFH 3RGHA 1RZFH 1JI1A 3LN9A 4NT6A 5GS1A 5DXWA 5EO9B 3BEVB 3GO1L 3TN0D 1RZJL 4NN6C 4EZMA 1QSFD 3VXME 1B0GA 4PRIE 1LO2L 2PKDA 4YUEL 2CDEA 1XMWA 5DMIL 1U2HA 4Z7QE 4R90H 5ITBH 1X5XA 2HVJA 1JF6A 1F45A 4P3CH 1GZPA 3P9MB 1K6QL 1CFTB 4U6TA 4X5XA 3FB8A 2NY4D 4MSWB 3HAEH 5C9KA 3CSYA 3VWJC 1M4KA 5T1MA 3NIGF 3ME0A 3SCMA 2J8HA 5J57B 2F8OA 2X1QA 4PJ8D 3ZL4H 4OCYL 1I8KB 4PJ9C 5DUBB 4GAJL 5DJZB 3X14B 4Y16C 1CDYA 3V4VL 4P4KB 2VLLB 3WBDA 2EIZA 5DJDB 5ISZE 4QKXB 3FAXA 5EPMA 3EYFB 5E9DB 4G80A 1NKRA 2CKBB 3JWOH 3B6SB 5TGBA 2X4TB 5GHWH 3SGKC 3F12A 1JHLH 4CADA 4HLJA 1E4WL 3IDIB 4PRPE 4RRPA 3V0VA 4QF1A 2O5YH 3GSWA 1YYML 1UXWA 3JWNC 3QDGB 3RKDD 5LGJA 3GHEH 2BVUA 3HZVA 1P2CA 2XTJE 1BBJA 4ZQKA 4UT6H 5C0AB 2AJUH 4JFHE 4PIRF 3VFPA 1KELL 2FH8A 4NM8L 4ODSL 1MCLA 4U1JB 4YQXL 5SX4H 1QRND 2J6EA 4HPYL 1WQVT 4R7NA 1XH3B 4P23C 4POZD 4AQOA 2VLJD 1C12B 2CIKA 3KYMB 2VLKA 4OM1L 5CP3H 2GCYA 4S11A 3QCVH 4KHXH 1A6AB 5BXFB 3VDBA 1MUJB 5IP4A 3ROOA 2F54D 5I71B 1RZJC 5L9DH 3O4LA 1I9JL 4OCXH 1TDQA 4K8RD 4Z9KB 4OFIA 3PWPD 5E08H 5KN5B 2EC9U 3GMRB 3O9WA 1E6OH 3AU1B 1KJMA 5DMYA 3DO7B 4Z7VB 1KCLA 5FYJD 1NKOA 3Q5OA 2VDKL 3QIWB 5FHAH 5KVMC 1FNGB 5DFWH 2ADFL 3MUY1 3H9SB 4XBPB 1F4AA 5MP6H 5IHUL 2DLGA 3KPSA 3NA9H 4XMKL 5LCVL 4HIIB 3MFFB 4HAGA 4QXWA 2K3TA 4YDJB 1J05A 2VWEC 4P2OC 2W59A 4JY4A 1H3TA 2BNRE 4H25A 4U1GC 2VZOA 3IKCA 1S9VB 2CK0H 3VRJA 1WTLA 3I75A 4OLEA 5JW5A 3QIUA 1T5WA 3D85D 1NGYA 4NWUL 4HCRA 3EO1B 3O6FD 2AI0L 4C58B 2P8MB 3WJLA 3U7YL 1M1SA 4KROC 4Z77B 3RUGE 1NUDA 3PP4L 1RUPH 4OLYL 3D3VE 1KBGL 1HHJB 4LVHB 2DQJH 4I48A 4WFGD 3MV01 2ID5A 5DTFB 1RURH 4PLJC 3S37L 1O7SA 4XCFL 3AY4A 1EV2E 1Y0LA 2BDNH 3Q6FB 5KVDH 3FQRB 3BUTA 4TSCL 4NYLB 1BZ9B 3HHRB 3ARDD 1FGNH 3R06B 4G6JH 3TA3B 1YC8A 3K8MA 5F72S 2NX5A 1FCCA 4UB0L 4XP5H 5I6XC 3STLB 4H26B 3MRDB 3WL9A 3SQBA 3RL1A 3DURB 2IADB 3O3BA 1AJ7H 3F7YA 2GTWA 2IH1B 2OJEB 5KG9A 4Z78B 1I3VA 1JTOA 2Q8AH 1CYGA 2IQ9H 3L3GA 3HI6L 1JZ7A 1EXUA 2DQCH 3QFJA 4QRTB 5TQ2H 3CFJA 4WU7B 2D0GA 5ILTL 4XPFL 4LASH 4PJ5A 5K59E 1P7KB 3RBSA 4DKDC 5ITFA 1FFNB 1T2QH 4DOHB 3HRZB 1ZT7A 2YUVA 3EOAA 3L3KB 2ADGB 4PLOB 1I4FB 1KCUH 2ZUVA 5SWSD 1K4DB 3ARQA 2PNDA 4E42B 3QHFL 4N8CH 4Y4FB 4O2EB 4I2XE 4JRXA 2FL5B 2WUBL 4AIZB 1J87A 5BVPL 3BKYH 3MLXH 3MSPA 1V7ML 4M9OA 5A2IH 1JYNA 3QXAB 2Q1EA 1MQKL 1L9MA 5JDJA 1P6AB 1JWSB 4UNVA 3VDCA 5LXGL 1Z5LA 3L3OB 5I1CH 5H37G 4L1HA 5B39B 2EDXA 1C1EL 3KPTA 1CD1B 5HYFA 2CGRL 4OZFG 5E7BA 4CVXB 5J56B 3JV6A 3FAWA 2VKXA 2XZQL 5MEQA 2OM5A 1OAYH 2FECI 3D25B 4ORGB 4J12A 5FO8B 4ODUA 4Y4KC 4WFHD 5CD3B 4P5KA 4G9FB 2A6JB 1A22B 2UYLA 3PDOB 2ICWI 5LKNA 1TJIL 1NGWB 3BPNC 4CJ1A 5FYKL 4UIKL 4U4BA 1DEDA 3BP4B 1PLGH 1BOGA 1ORSA 3LVEA 5F89B 1JPGA 1FZMA 4F15B 2G75A 4GG8B 3BSZH 3L5WA 1G7QB 4O58H 3RWFA 3TT3H 4Q9QL 4UZGA 1KLUA 1EAPA 1VERA 2IJ0C 3EUUA 3I6LE 4L8CA 1PDKA 4WFFD 4JO1L 4UU9A 3WKNA 3KYOA 4YXLL 4HUVA 3PGDB 2AJ3A 2JCCA 4OQ1A 1ITBB 1WFUA 1PX3A 4LIQH 1UZ6E 3OHXA 1EDQA 1BJ1H 3QHZH 1FZKA 3MBED 4BSWA 1ZVSB 3SN6N 1S7SA 1YECL 2JKXA 4D9LL 3U0WH 4HSQA 4HUUB 4QRRE 2H8PB 1IQWL 1OARL 5HYSB 1U2CA 4FZ8L 3MUZ1 5CP7A 5AAMA 4CN6A 1D5MA 1INEH 1FVCB 1ZS8A 32C2B 3RZCB 3X11B 1TVDA 4IS6B 3V6OA 3KG5A 2CK2A 3GMNA 1XGTB 4PP1C 5MENA 2H41A 5JHLL 3TPKA 4H8WL 4LARL 3ULSB 4HUXA 3B9AA 2ZG1A 3BGMA 4RMWA 3VGBA 2J8OA 4L3EB 3GNMH 4PB9H 2ERJB 1N5YH 1JNLL 1N2RA 4OBSA 4N1HB 2ZCHL 3T3PE 4DGIH 1DQLL 3PL6A 4U1MB 4JFDD 4XP4L 4F9PC 5DVKA 1HXMB 5E4EC 2P49B 5ELIA 4RMSA 1A6UL 4FMKA 2Z35B 1GHFL 1N59B 1GCFA 4ZSOE 5KSBF 3ESVF 3FB6A 3QCTL 3MRBB 5E5MB 4Y4HB 1G6RB 1MRFL 3IDNB 4HMCA 4L3CA 4WW1B 4Z7QF 4TSAL 4PJDE 1O7VA 4IIQA 1HOCA 4M7KH 5GGQH 3IVKA 1NL0H 1FAKT 2DMCA 3RWEB 2EE3A 1JF1B 1RUAH 5IB4A 3IF1A 1WZMA 4TUOA 1NLDL 5DT1L 1YN7A 4LLDB 1SBSL 2EH7H 2Z8WC 1BECA 5K9OA 3E8UL 4JZJA 1I7UB 4UT9L 4KDTC 5BZDB 2IPKB 1RZKH 3V6ZB 4JFPA 1NDMA 1AO7A 1MY7A 2Y72A 5EOQH 3MLRH 3ZT7A 1ADQH 1HKLH 5DMGC 5HBBA 4LU5H 4CVZB 5I1AB 4MNHB 3BQUB 3RY6A 3MRLB 1ZLWH 3HUJA 3LSOA 3MRPA 4JKKA 2X4SB 1JHTA 2BRQA 4JR9L 4LRIC 1Q9WB 2NY6B 4J3SA 5ADOH 4H8WC 1JFQH 3TZVD 4FQLL 1IM9A 4PTUA 2PO6C 4G6AD 1XIWC 1X9QA 3GSOA 3O81A 2X1WL 3GIVA 2WLZA 2YD9A 4HLZH 3GUTA 3MGAA 1K8DB 3QAZC 1EGJL 5E8PB 3RI5K 3KXFB 2O5XL 3QNZB 3H42L 4WHDA 4Z7UE 4KJYB 2JELL 3FQNB 4LSRL 2HLFC 3MJ7B 2RAMA 1CZ8L 5BMFH 2HVKA 3VFGL 4X4XB 3WFEH 5EOTA 3U7AA 4DZ8B 1V3KA 5CJQL 4AEFA 5HHNA 1CFNA 2DQTL 2CJUL 3T1FA 1U3JA 4RGMB 2GITA 3BIKA 5IWLA 2YD3A 3EYVA 2ADJB 3CX5K 2MNUA 4J4PC 3AFLA 1AKJA 2VDOL 4MA8L 1BQLL 2F9BT 3SY0B 4AEIH 2DQDH 3UTTA 4LPYA 5C09E 3CLEL 4JFZL 4P2RB 1SEBB 1H9VA 1YMMA 4H0GA 1T1ZB 3LRSA 5EC1B 3NFNA 4P2QB 3TIEB 5GZNC 2DQIH 3MLYH 4RAVA 4OJFL 2EYSA 4G7YH 4I0KA 1ED3B 4GRWH 4OZ4A 3ZE2F 3VXSA 3ZTJH 4JG0H 1GGYA 2VZSA 4LSVL 4D9RE 4X99B 3JUZA 4XCEB 3ARBA 5EIVA 2HG5B 4BH7B 4KHTL 4RX4D 2VZ1A 3ARPA 5JPMA 4WV1A 1A02N 2R56L 4GMSL 5CIPA 1BFOA 3AREA 4OCSL 1R5IA 1QFWL 1YEJH 3MPCA 3U2SA 4LCWB 4ZYKB 1HEZB 4G43A 4NHUB 1MFNA 3RUGF 4KJQD 3VXTB 2C26A 5DI8B 5K9KB 1A7BA 2ZCKL 5GSVA 3N9GL 3QEHB 4NZTH 1X3DA 2E27H 2NCMA 1LO5B 4HK3J 4M7ZB 4PJHA 1JNJA 4LSTH 2P48B 2EDKA 4LDEB 3MGTB 3F6LA 4OD2B 1E6JL 5CEZD 5DEGB 3QO1A 5JIPA 2Y07H 5EZIL 3TBSA 12E8H 4Z76A 4X7FC 5HHVH 3MFGB 2I26N 3L95A 1EZVY 4QHNA 3BRGC 1G7JA 1PG7L 1YC7A 1LILA 4PV8B 1CLZL 2CRZA 4FQQB 3I85A 2LTQC 5I8EB 3KPQB 3TYFB 1JPFB 5I0ZA 5J0BA 4QXTB 3REVA 5SWQA 3QIBB 4K3GA 3SDAC 1T1WA 1KN2H 3CVHB 5IEHB 1QSEA 2ATKA 4HWUA 3MV8A 3WHE0 5K59F 2YRLA 1R3KA 3FOMA 4J23A 1RIUH 2DLFL 2FATL 1KTDA 4UAOC 4X98B 4F7PB 2WIMA 1YNLH 3G6AB 2VLRE 3FHAA 3MV9E 1P7QB 2DWDB 4XPTH 1F2QA 2HKFL 4XCCH 3UBXI 4S2SB 1F11A 5E99H 5L7XL 5JHDD 3L5XH 1P4BL 1VADA 2P42B 2VDQL 2XN9A 1S7RB 5L2KE 2P45B 2BFVH 2DYPA 4YIQA 1FN4A 4K23L 3S3JA 1UA6L 1WC7A 3NFSH 4W6YB 1SMAA 1YJDH 3I6GA 1HYRC 1NCWH 3PNWB 1CDIA 4FXGA 2ZUWA 2JTDA 4IOIB 2B0SH 1S9YB 2MCPL 5DYOB 1XF4B 4W4OA 2BY0A 1GL4B 1QBML 2VYRE 1VKXB 1DDHB 3BRDA 1DLHA 3LY6A 5DK2A 4D9QE 2HT3C 3UTOA 4F8QA 3OV6A 1PYWA 3G5YB 1CL7H 3OKYA 1B6DA 1LVEA 2EDFA 3QPQC 3HNSH 3ZKXB 2KDGA 4PGZA 2DIBA 4QRPE 4N90D 4NO5B 4YPGB 2ZNXA 1YEIH 1CDUA 5F96H 3PABB 4Q97A 4GSDH 1BD2B 2D0FA 2Z4QA 2AABL 1CLYL 4R4ND 5CAYB 3OKNB 4GKZB 5I76A 4WUUB 1FNEB 3C60C 1GGBH 1OW0C 1FFOA 4IOFD 2RR3A 4LMQE 1G7MB 2AK4A 3IDMB 1G1CA 1QPPA 4P4RB 4I9WD 4KMTL 4K7FA 3JV4B 4MJIB 1NAMA 1UZ6F 5CLWA 5LWYH 3S8WA 1AP2A 4NQVB 1CU4H 2DQGL 3UJTL 4ZUVA 1LMKA 3UAJD 4MS8D 1U92B 4F7CA 1FORL 3GIZH 4RFOL 5ACZB 1X5JA 2NNAA 5EZJB 5KSBB 1VGKA 2EXWD 5T3ZL 4KPHL 3VXMB 4PRIB 4BQBA 2E9BA 2E7LA 4C56D 3GDBA 5DJ8B 3CFKB 1OCWH 3F8UB 4O4YL 4PJIA 3EO0A 3CFDB 3DTXB 2CRYA 3ZYJA 5F7WC 3BH8B 2RHEA 1BQSA 3QZWG 3RWDA 2YUXA 3VWKB 1N5AA 3DGGA 3VFWB 3T3PF 2NLJA 4OM0H 3GJFH 4HIXL 5GJTL 5DEFA 4G8IA 4Y1AA 5ALBH 3PQYD 5JQ6L 2R0KH 2ESVA 3WHXB 25C8H 5TDPA 1IM3B 1ZTXH 3G6DL 4R0LA 5GRUL 1P84K 5H2BA 5D6CB 5ISZB 3DO3A 4OT1L 1B9ZA 3B9DA 3AAZB 4EI5D 4NZDA 4PJDF 1A3RL 1I1AC 3A6CH 2WWKO 1MNUL 4O5LL 3U6RB 1W72A 5EU6E 4UBDC 4DGVH 2FH6A 4GXUN 1EJ6A 1MFCH 2OR7A 4PRPB 3O3AB 2F53D 4I77L 4PP2A 4LDLB 4G6MH 4M03A 1OHQA 5J13B 3MRNA 3SGDI 4NQDE 5BQ7A 1FHGA 3INUL 2XTJB 4BFIB 5AD0A 5ESQA 4NC1E 4HHAB 2ARJQ 4KY1H 2OP4H 4KUCD 3WSQH 1U8HA 2XQYG 5E8NA 1YEDB 1I8IA 5I2IB 3IETA 2VXTL 4M6OL 4JKMA 4QHKI 5FYLL 2OQJA 1ZHBA 1F02I 4JRYA 4HBCL 4XPAL 4X7EC 2BNQE 3V8CA 2GYSA 2XQBH 5C6TL 4D3CL 4PGBB 5C0BD 1F97A 3WFBH 3HB3D 3UBXG 2C4XA 1U95A 4XT1C 3HC4H 3LHPL 2HA1A 3BP7A 1DANU 2ICCA 1CICC 3WNOA 2ORBH 3GI8H 2IEPA 3TVMD 4MWFA 1VGEH 5I1IH 5KTEH 4MMXC 3HE6D 4GXVL 3AS0A 1V3LA 4DKFL 4Z7UF 5DJ2B 1MJ7H 5JMRA 1TCRB 1F3JB 2AP2A 4N9GB 5HYJE 3RIAK 3LS4H 3O8XD 1JN6B 4U3HA 1KG0B 5I1GH 1RUQH 2R39A 3LS5L 3WIHH 2H2PD 4HUNB 1CT8B 1U8LB 2CKBH 3FQXB 2BNRB 2FBJL 5CZXD 5HHME 3VXUB 2WBWB 2WP3T 3L1OH 4KUZH 4U3CA 2ZSVA 3WS6C 4FQCH 4J3WA 4R4BA 1RD6A 4PGJA 1TQCC 4Y2DD 5ICYB 4HKJA 5JW3L 5I8OL 3RWIB 3BWUC 2F5BH 2QSCL 4KTEH 3CFCL 4LSUL 3FO9A 4Y5XB 5E94B 3HG1D 5C08B 5DVMA 3D3VB 1P9MA 3UXFA 3QFDB 2AV7A 4ZPVB 1DQQA 4XCYB 1DBKL 4ODTH 1MAKA 1LO0L 4X5WB 3EHBC 3OJDB 2GJ6D 3NCBB 5FO7B 5TPWL 2Q7YB 1ZGLB 3T0BA 1MHCB 1QYGH 5FEBA 5GGTA 2A83B 2KL6A 5BVJB 4OBRA 1LE9A 2ZOLA 3R8BB 5HSFA 2H26B 1DLFL 1I9RH 2HTKC 3PGCB 3AXLB 5GGRA 5T1KB 1KENL 5CEXA 2R2HB 4LLAA 1A47A 4NKOA 2EEBA 3KYAA 4MCYB 1TVBA 4Z0BH 2LVCA 3MBXH 3TFKD 1WFOA 4RIRA 3HPJB 3EIFA 1IGYB 4MNQE 4JFEA 4UOW1 5D72H 3L7FA 2CSPA 1LO3L 4E5XB 3TIDB 1IC4H 3VFOA 4HK0B 3TV3L 1X5KA 2V2XA 2NQCA 2EDDA 3BE1H 5J11B 1YNKH 1UACH 4F2MB 3ARZA 3TCLA 4OZGE 5HGHB 4WGWB 4ODWB 3MNZA 3BP5A 1NAKH 2CLVB 3SEPA 5JA8B 3O2DA 1INQA 4I2XB 1QPXA 4K3DL 4WO4A 4LCYB 5D7JD 2BVOB 4QY8A 4GG6F 5KOMC 1WIPA 1KCSL 3CZFB 1T80A 4XVUD 2V9QA 3WEXB 1OT1A 5I1HH 4N8PA 5EIIB 2I60H 5E8EA 5E7FA 4YH6A 4JJ5B 4X6FA 5F7NC 1S78C 2APVA 3CU7A 4PJGE 1X4XA 3EYSL 4DEPB 3MODH 2V9RA 3SE8L 1U3HB 1KFAL 4HIEB 3RVUD 5FECB 4EN3D 4TUKL 4JY5H 2IANA 4GBXA 4RDQF 1KLGA 4LNRB 3LKSB 2Y06H 3Q0HA 5CJBA 1H8OA 1NC2A 2DD8H 2VLMD 4ZO9A 1A1OA 2FNBA 5IIEA 4WI2A 4YFEA 5C86A 5DK0B 4JFFE 3BPLC 5CJXC 3DVNB 1QLEL 3LV3B 5FKAA 4NJAH 5F1IA 3DXAE 4AEHL 1A6ZB 4HCRH 2WBKA 2IH3A 1IAII 5C0RL 4D0BA 4HEPG 4LLUB 3NAAH 3WDHA 4ODHH 1KJ2A 3GK8L 5C07E 4OZIE 1U8KB 1KIPA 3HN3A 3H9ZA 1SJEB 2Y5TA 3BESR 4K2UH 4YXKH 2FSEB 2GAZA 4UDTB 5DD0L 4GW4B 4PJCE 5GISH 5FF6B 2OMBA 2QBWA 2YD1A 3MREB 1BWMA 4OLUH 1UB5B 4TUJB 1HILA 3MYJB 2X89D 1TNNA 2DLEA 4BH8A 1NBZB 3QA3B 2BOBB 4LHUG 1FL5B 4PRHD 2PXYB 3HR5A 4MVBD 1ZAGA 2EDHA 3TO4C 1T6WA 2O61A 4EXPX 4KKAC 5DF0A 1WF5A 4Y19D 4ODXA 3V4UL 4U1KB 1OF2A 2J88H 3VD7A 2P5WB 5F88A 1XCQB 2J12B 5CILL 1F6LL 3PJSA 5CJOL 1J10A 4HT1L 4AENB 5IESL 4R96B 3SDCD 3W5MA 4NO0D 2HRLA 4HF5L 3FO0L 4X4MA 2VL4A 1R3HB 3NACL 5D1XA 1XGYH 4DUVA 1RFDH 2Y5EA 1JGDA 3FQWA 5F93C 5TE7H 5IEKA 2HFFA 2QQNL 1T4KA 1L0QA 3BPCB 1S9KC 3OF6D 2R9HC 3X12A 4NUJA 1CGXA 1FZJA 3ZKQD 2YBRA 1HSAB 1LO4H 3C8KB 3D39E 2QJDA 3SKMB 1YY9C 1VA9A 2DS4A 2WBJC 3B9EA 5KSAC 4PGEB 2AGJH 4ALAL 4NQXA 1JUFA 2JIXD 1N7MH 1PVHA 3HLAB 4UV7H 4JLRB 4NDMA 3T0EA 3WN5C 2YWYA 4JANB 1C5CL 3QUYA 3M07A 4YX2H 3GBMH 3VXNB 1RVFH 3ARFB 2NW3B 4FS0A 4M1GL 3BKCL 2A74A 3UTSD 3O6KL 1HXYA 4QRUB 1IQDB 5TE4H 5IB2A 1SJHA 4M9PA 3S98A 5EC2A 1BF2A 4CMMB 2R69L 2A6KA 4ZFOA 1JPSH 4PJDB 1F42A 4M7LH 5GQBA 3W0WD 3MRHA 5I30L 2F54E 1NUNB 2HWZH 2VZTA 3M8OL 4JB9H 4NZUH 4XP9H 2H3NA 3EYQD 5CSGA 3PWPE 2ZSWA 4XNQB 4TULL 2NTSP 2Q20A 3RNQB 2ICWA 1I8LC 2Z31D 2VABB 3REWB 4DTGH 1WEJL 5FYJE 1MLCB 4HJ0C 1NCCL 5F7YC 1L9NA 1C08B 3BPOC 3K46A 4P5TD 2EYRB 2KKQA 3P9MA 4FFVD 4WHYG 1CFTA 1MOEA 3I6KB 3QUXB 1K4CB 4HC1H 4JM2C 3LQAL 4XWOC 3KNBA 1EO5A 1U93A 4KKBC 1ES0B 3CJJA 1NBYB 4JFYA 5DRWA 1CR9H 1CE1H 4N8VB 1JV5A 4JN2B 4C4KT 1I85A 3UPCA 5JW4M 4K94H 4RBPK 1IBGH 4GT7A 2LVEA 1UCBL 3HZYA 4GAGL 5DR5H 3MLWL 1IAMA 4Z7UB 3QEUB 1N64H 2EC9T 4NRYA 1DVFC 5DJCB 1MRCL 4GQ9H 1NGXB 2OR9H 2V5TA 5MHSE 1FLRH 3BP6B 3QI9A 3VH8B 3WNPA 4M43L 1MAMH 3H9HA 5ABDE 4WFGE 4WEBL 5IMOB 1G6RH 1BIHA 2ZJSH 3KDMA 3T2NH 3UPRB 4ZO8A 3WNNA 4CAGA 1RZ7L 2R1WB 4HXBH 5JLZB 1SJVA 4KK5C 4MLIA 4S1QL 4RFEB 3SE9L 5I1KH 3D87B 2YEZA 2H1PL 4RGNC 1MRDH 1YDPB 3CFBA 5E95B 1M05B 2JJWA 5IW6B 3GFUA 2DDQL 5SX5H 1II4E 2DIJA 4Z6AT 2NW2A 2I24N 2FEEL 5A3ID 4R97B 1BOYA 4LVOC 5LAXA 4M3KB 1UCTA 1MCHA 1N4XL 2WW8A 1OSPH 4J1UA 4ONGH 1UJ3B 1FNGA 3ARGA 4OLVH 5TF0A 3LQAC 4P4KD 1J11A 5EO1B 3X13B 3DVGB 1ZEAH 3H3KA 1ZT4A 5E03A 3H9YA 3RBGA 4N1EA 1HYSC 4X6DA 4HWZA 5SWSE 5JXEC 1QHOA 5E9DD 5J6GA 3IXAB 1FE8L 2QLVB 3SDYH 3MACH 2J8UA 3RTQB 1RZIA 3N1MC 3CD4A 3FMGH 4QRSA 4NQCA 1BVKA 2RGSA 1XAUA 3GBNL 5KVEH 1QTYT 1NFIB 1DBML 3RJDA 4TTDD 5IB5B 3QDGD 2FJHB 5IK3A 1MLBB 1MY5A 2CDFB 3ULUH 5F9DC 3T08A 1FH5L 2JK5A 2VXUH 3LB6C 1X5AA 5C0AD 4QOKE 2OI9B 4JEGB 5BV7B 3TPUB 3KLAA 1K8IB 3SGEI 1AGBB 5TQ0L 4WDIB 2OL3L 2XIDA 3QWOB 4WI3A 4WWKA 5HYIA 4MA3A 5F1NA 2DRUA 3FRPG 4WFHE 3TT1H 2B4CL 4OIIH 3FN0H 5CINL 5GPRA 4GG6B 2X40A 5B38G 2DL2A 3C5JB 5EU3B 1BAFH 3O2WH 5FUZH 2CRMA 2AS5M 1CGSL 4MAYB 2IF7A 3LDBC 3DUSB 1U8MA 1NCDL 1OGAA 3MLUH 5M95B 3GEWB 1FJ1A 1T5XB 4MA7H 1FIGH 5DD5H 4L9LA 1LK3L 5DD1H 3DETD 4JDTL 5DUPL 4R26L 4BFGA 3QCUL 3WXVL 2X1OA 1TVHB 2Q8BL 2IADA 4X8JB 4PJ9A 1JGEB 1DP0A 1OAKL 3QIWD 2O26U 1CGWA 3MV7B 2IPUG 4AMKH 5I9QC 1FGVH 3CSBA 4Y16A 3H9SD 2VLRB 2YC1B 4UQ3A 3Q3GB 1AC6A 4WFFE 3ELAT 4AEEA 4OV5A 1OVZA 3BKMH 5JIIA 3VE0B 3FQUB 4YFDB 1P4IH 4D94A 1Q9OB 2P4AB 4APQD 4KI5E 4XNZB 4CU7A 5FOBB 2W38A 3MR9A 3B83A 4XC3H 3VWJB 1JWMA 3MV11 2IAMC 4QWWD 1NMAL 1MJUH 5HI3C 1A9EB 2ZUQC 4C54A 4GRMB 4JDZB 4I0PB 2UY6A 3C6LC 1RUMH 4DK3A 5IFHL 1DUZA 4LNVA 2R2BA 4DKEL 5CUSH 2FYYA 1HIMH 4LPCA 2ZG3A 4P23A 4HFUH 1Z9OA 4OZIF 3RQ3A 1NGQL 5T1DH 1QBBA 4R2GC 1CBVH 3O4OC 1EEZA 4JFXA 4PJCF 4CVXA 5E2TL 4JFDE 5D2LA 2B4CC 1RULH 3IDXH 2B39A 3D25A 4ZAKC 4ORGA 1MEXL 3TA3D 3LIZL 4PV9B 4ZS7L 4TTGA 3G9VA 1DQMH 2Q3ZA 3NVQA 2A6JA 3FO2A 4IRZH 3T2QA 2VAAB 3OJMB 3IFOB 2QEJA 4JDVB 1B0RA 4XVJL 3K2UL 2BSTB 2QQLL 1A7QH 4AIXA 3BKJH 3OKMA 1A7PL 5BRZA 2GQHA 4HPOL 3QZWB 1X4YA 4OCRH 5C0JB 1B4RA 3BP4A 4OKDA 5J3HC 2V17L 1GPOH 3B2VH 5D7LA 3RJQB 4UDUB 5KAQG 2V7HB 4JAMB 4P2OA 5IVXE 2HLAB 2BC4B 4KKCD 4KQ4L 4Q58C 3AS2A 4I5BA 2CUIA 2ATPA 1I7ZB 4I18C 2GKIA 2XFXA 5K9QI 4Y4FD 1QBLH 1W8NA 2YS4A 5HDQH 4H88L 4GKOA 1J1XL 3MCLH 4M5ZH 3QRGL 4GAYB 4D0CB 4Y2OA 4X7TA 5T1LB 5TE6H 3GMOA 4HV8B 3NIDE 1Q0YH 1ND0B 2XRAL 3EJYD 3UTQB 2G2RA 2L7JA 5FFLA 2OJZL 2AJSL 3K3QA 3EGSB 1T1XB 3ALPA 32C2A 1A1NA 3RZCA 1MFEL 3KR3H 3QDJA 4L4VE 3U4EB 2R29L 2W0FA 1A6TA 3SKNB 3FL7A 2D2OA 5I75C 1KB5L 2JB5L 5EORH 4XVTL 3CSPA 2VUOA 3F65A 1T66D 1S8DB 3GSNB 3UCRA 1W0WA 2R23A 2BK8A 1RU9L 1Z3GL 4G9FD 5KJRL 4XPGL 3RHWF 1VENA 3E3QC 3KPPA 4X4ZA 2AJVH 5EU6B 4GW5A 1I1FB 3VFTA 1MFDH 3MRJA 5CZKA 2X42A 4N5EC 5DO2D 3UBXB 5LGHL 2NZ9D 3NCYP 4CU8A 3CNKA 2NXZB 4JQXC 3CLFL 4LL9A 4NQDB 4OAWA 3GGWA 1H3PL 4IRJB 1IGCH 5CGMA 3ZE1F 1FNFA 3SPVB 1KEGL 1C7TA 3V52L 3RGVC 2NYYC 3WUWG 4YDVA 3BH9A 1G7IA 4JCLA 4YGVB 1DUYA 1FG9C 1DQDH 1TZIA 4YHNA 4U1IA 4WCYH 4LCCA 2C3XA 5CD5D 4U1LA 3B3IA 4O02H 3NZHH 4MNGB 1NAMH 1J8HE 1R5WB 3DUUA 3DROA 4KQ3H 4V1DA 5EZOL 5C2BH 4U7SA 3I2CL 4XXDB 2CQVA 3FQTB 3GMLB 3HNTH 3D1MC 4G6FB 4KRPD 4WUKL 4JY6B 3MYZA 1QR1A 1HKFA 43C9B 5TDOA 4HJGA 4M7LT 1NFDA 4ETYA 2Q76B 4JZNA 4U1HA 3C08H 3HCVB 3EDEA 4YC2C 3NCFB 1R0AL 5D1QD 5HYJB 3MLTB 1ZV5A 4UUJB 1ZGLM 4Y4KA 3TN0C 1GC1H 4L3ED 3S7GA 4X4YA 3OXSB 4G6KL 5BCAA 4HS3A 4PGCA 5KSVB 4K8RL 4MQXD 1FPTH 1XR9B 5HHMB 4ENEC 3OSKA 1MVUB 2WIIA 1SYSB 4N0UE 5E8PA 4ERSL 5FYJL 2NY4C 5GGVL 1T7VA 2IQAA 5DSCB 4Y4HD 2VDNH 3FKUS 4KTDL 4Y7MA 4PJ8C 4PJXB 1NGPL 2DTMH 3D9AL 2BRRH 1A0QH 1KC5H 3VFSB 5IT2H 1QOKA 2A73B 1GH7A 2NY1C 3DRQB 2KUTA 5SWZA 3LQZA 5A2FA 3TBVB 2D7PA 4XNUH 1W72H 1S5IH 2VQ1B 2IMNA 3T8XA 1CDBA 1FL3B 5EC1A 5CBAB 5JXAL 5EFIB 4FFZH 2QSVA 3OPZH 4UT7H 3E6HB 5CS7A 1ONQA 3KPLA 4OZHB 4UMGA 3QPXL 3CH1B 2B7DT 2J6EL 3L9RA 5CHNB 2CLRB 3BQUD 3HC0B 5BJTB 3HRPA 3QG6A 4MNQB 5FDWB 5KW9L 3V0AC 1LHZA 1GGCH 2G9HB 1E4XL 4IRSA 5K9QG 2LV4A 1SEQL 3MRCA 2NY6D 5GS1C 4HJJL 3CCHA 1A7OL 3CUPB 4UTAL 2PW1A 1KACB 1L4IA 1HEZA 2X6MA 5D7IE 2SEBB 5T33L 1CCZA 3G5VB 1LEKB 5IQ9A 3QNYA 2FGZA 5HHPB 4F9PA 5K9KA 3KXFD 2BVPB 1I8MB 3MJ9H 4K8RC 2C3VB 2ITCA 5ALCH 1DJSA 4NP4L 3PWVA 4S0TD 5DZLA 3VXRB 2WNGA 3MXVL 1KLFA 4JFOB 2DQFA 2Q6WB 5IVZA 3D0VA 3ULUD 1MI5A 4G8GA 2XXMB 3A0OA 5IFJB 1CFQA 2APBA 3S35L 5FB8A 3G6JA 4X0KA 1VPOL 3BIBX 3MRGA 3C5ZB 4NZRL 4QHKJ 3L6FB 3QXVA 3BZ4A 4PB0L 1KOAA 4ZOEA 2PYEA 3TBTB 3EOBA 5DUMH 5E1HB 5ADPL 3GSXA 4OI7A 3T0XA 4Z18A 4DGYL 3KPMA 4MA1B 4OUUA 4P2RD 2EE9A 2QKIA 1KXQE 3X3GL 4JFFB 5BS0E 2Z8SA 4ZXBB 5DRZA 4P2QD 3ULVL 5I8EA 2MKLC 2P24B 3DXAB 5E8OB 2IPTH 35C8H 1JMZA 4I9WE 4NIKB 3QIBA 5C07B 4OZIB 5D71H 5IEHA 3OTTA 4YBLC 3QUMB 1D5ZB 4KI5F 4PY7B 3ZKMD 4H20L 4BZYA 4Z7WE 4KZEL 4LRIA 4C59B 3U0PB 4IHOB 5KZCB 2UWEA 4LCWD 3GKWL 4LIQE 4GRLB 1XF2B 5GGTH 4U1SA 4OZFH 1XIWA 3QQ3A 2EICA 5FUOL 3N85L 3JZ7A 1X7QB 3JBG7 3ARDC 1AD0A 4G8FA 2OMNA 3K4DA 4MXWL 5GGSB 4NCC1 4WY7H 4S1RH 4W70A 1T21B 2VXVH 3QHTC 2FEEI 5D93B 1MJJB 1MIEH 4NJ9H 1FDLH 2IG2H 1JYXA 1OGTA 5H35B 2OK0L 3HMWH 3TJEH 1IL1A 1PKQA 3PWJB 1JTTA 4EJ1C 4W6XB 3BRFA 4NO5A 1ZLSL 8CGTA 5F9JB 1QFUL 4GKNA 3QAZB 5IBUB 4FQHB 3PXJA 1WIOA 2JJTC 3GJEB 1AGDB 2W9LA 3D39B 1OAUH 1KEML 2X4UB 1BLNB 3O2DH 1P69B 1WZ1L 1S5HB 3G08B 3KYNA 1A3LH 2VIRB 1JNHA 2P8LB 3QIUC 5IKCA 1DL7H 3ULVC 3EDFA 2F5AH 5FGBC 1OM3H 1UQSB 2HJKB 4BA8A 1W8OA 3MQIA 1OTSD 4K7PX 2AAVA 4GUPB 3LEVL 1P7QD 1KT2B 1WBZA 2FIKB 2X4RB 3T3ME 4OF3A 4DVBA 1PD6A 2FO4A 3QEGH 2RFXA 1YEEH 3NIDF 4HGWB 4XBGA 5E6IB 3AY4C 2EKSB 3BZFA 3RNKB 2LABA 2YKLL 4FFYL 4LLMB 2CPCA 1LDPH 5ACZA 4GS7C 3I3BA 1KJ2H 2FZ3A 4PRIA 2DI8A 4L29A 1YEKH 3LKOB 3CMOH 4B5EA 4E41E 3U30C 4XPBH 3CDGA 3UO1L 5DJAB 1IGFL 1MCIA 3QUZC 3RU8H 3WKMH 5C0FB 4I1NB 3P0VH 5BZWA 3W82A 3MZGB 4HH9A 5DD3H 4NQSB 3DBXB 3JTTA 4FNLL 5C8JA 1A14L 5DQJA 1BWWA 1LP9E 2YPVH 1C5DB 3C5SB 1BD2D 5IW1B 3BN9D 1IZJA 1CI5A 3D2UA 1IFHL 5HYQA 2VMFA 1IM3A 1KCRL 4OQTL 3P4OB 4M1DL 4WUUD 4NO2B 3MRRA 5FYKU 5IHZA 1TETL 5J89A 5CCKL 5MEOA 1CTOA 4LAQL 3GMMA 5ETUA 4L8SC 3O6FB 3LKPA 4PG9B 3G5ZB 2N7BA 3C2AL 3FFDA 2X1PA 3HG1E 5KSUB 3O2VH 3C2SA 5GRVL 1S7UA 1DANT 2HMID 1CL7I 1KXTB 1SHMA 4AJ0A 2CUMA 1E28B 4ONHB 2G5BA 2XYCA 4DN3L 4HHAA 4S1SH 2GJ6E 2Z92A 4XH2B 4PS4L 1CGUA 2X70A 1UXSB 1WUNT 3MGOA 5HDBE 5I2IA 1KJVA 5DD6A 5ESVB 4UILL 5E6YA 5GHWL 3SDAB 3EFFB 3TCXA 2NY7L 2WINA 3VXMD 3FRPA 4GRWE 5D70L 1IKFL 5CWSB 5IQ7L 1PSKL 3GHEL 2XA3A 2QADB 1MJ8L 7FABH 5AAWA 1CD8A 4UTBL 4UV4H 3BJLA 5F8RC 3VWKD 3HPLA 3P4MB 2H9GB 5B4MD 4LLVA 1FYTE 5BW7A 4WWID 4PG2C 1CGTA 5F9AC 3U9PH 1ZWIB 3QYCA 2A6DB 3QNXB 3RWCA 5DJ2A 3WJJA 5FHBH 3QCVL 4KHXL 1F3JA 3WD5H 1IEBB 4N0FA 5ISZD 3MZTA 4QXGH 5HJ3B 1KG0A 3MRKB 1M7IA 4FP8L 5AZ2H 2PETA 4J6RH 4NQEB 1EUTA 1QA9B 2BZDA 3ZMRA 3V9FA 4F37K 5B38B 1SM3L 3FQXA 2CD0A 1JGVL 3FCTA 4F7EB 5D2NE 1BZ7A 4PRPD 3VXPA 3OJVC 1ACYH 3F7QA 3SQOH 3GSVA 4I3RL 4R4FH 3W39B 4G7VH 2GUOB 4QNPE 4B53A 3V6OC 1CK0L 5HPMA 4DCQB 4QOKB 4M61A 4LSQH 2XI9A 4NQUA 1OD9A 1RHHB 4N0CD 4C83A 4P59H 4OF6A 4FQJH 3RUGA 1F90H 4JN1L 1MWAB 3D0LB 3QFDA 3C60B 3BW9B 4X5WA 3S36H 4MYWB 4PREB 1Q9KA 1IGML 3PL6C 1C16A 2Y6SD 5IG7B 3IJYB 3QWQB 4NM4H 3ZHKA 1HI6A 1TITA 1IGIH 3TBWB 1ZT1B 3NN8A 3NH7H 3UJJH 2H32A 4LPVA 5EO0A 2IFFH 4LGSB 1MF2L 1M7DA 2VOTA 5CEZL 3VG0H 2BVQB 3VG9B 1QQDB 4L4TE 3FT3B 3HPJA 4PRHE 4U6VH 4U1NA 4F57H 4Y19E 4YHZL 1RURL 4E5XA 4M8VA 3TIDA 5I66B 2BOCA 4HK0A 4XNMB 4I4WA 5GZOC 4MB5A 1SVZA 3K0WA 4L5FL 1UKSA 1ZLVH 3VGFA 2IBZY 1FNLA 3TNMB 4CDHA 3MBEB 4RISH 2BNRD 4RGOH 3VXUD 3H8NA 2UY7A 4KAQL 2HJFA 4I2XA 5F3HB 1KYOK 1DFBH 5IW3A 5DS8A 3QO0A 2YUZA 5GIRB 1SJXA 3OKKB 5JPNB 1AGEB 5F1OB 3B4NA 1UM5L 5BV7H 4M1CC 4JREB 4L3AA 4YHOL 2WM0A 5C08D 3P4NB 3D3VD 1D3CA 4HX1A 2VZVA 1EHLL 1U3HA 4HIEA 3MROB 4MX7B 1I1AB 1NMBH 4HW6A 3LKSA 3MOAH 2YXFA 2BSRA 5B22A 5IR1B 4KJQC 3ORJA 2O5ZL 3MLZH 4Z7WF 1VFMA 1KUMA 2I07B 3UC0H 4JPWH 4F3FA 2HKHH 5T1KD 1RZGB 2D7QA 3MNVB 5E56A 3UTSE 4K3JL 1TTFA 4UOW0 5JNYB 1OAQL 1YEHH 1YPZE 2HFGH 1PG7W 5FA4B 3CK0L 3B9KA 1FG2A 4LVNC 4E9LA 5I1EH 3BT2L 3W0WE 4UDTA 5IWLC 1IC5L 4OGYH 4KVCH 2QR0B 3DMMB 4RMTA 1AIFB 3MMEA 3MYJA 4MXQD 5DC0A 1KJ3L 5FGCE 1NBZA 5FO9B 4OCWH 3BISA 2D03H 3VFUB 3I3EA 4ZO7A 1JK8B 5DMJB 3WUWA 4WJ5B 4TSBL 4P57B 4RZCA 2X4QA 1V05A 1CICB 3HAEB 3FOLA 4ELMA 1J1OH 1K3IA 2WWMD 2AEPH 4MCZA 2PTVA 4F7TB 4ZTPL 4QTIH 4MJ5B 4J3UA 4PJFF 3C6SB 4QRRA 3G5XA 3O41B 2HFEB 2FWOB 4MJ6A 4WTWA 5HHOB 3VFRB 2VE6B 3DPBA 3AREC 4Q9CA 1Y6NR 3P9LB 5FUCE 5AG8A 2AJZB 5EOCL 4OSUL 3VJ6B 4ZG1A 1E4XI 4L4VB 4Z5RA 3VW3H 1TLKA 2QQKL 3DYMA 1NBVL 4X9HA 5DZOA 1GZQA 1Y18A 5CBEB 4LIQL 3T3MF 2G60H 9CGTA 3SO3B 1QO3A 5DJ0A 2EIDA 4NBZB 2IALB 2GSIB 2C1OA 4X6BA 4KXZI 3KLHC 1OP5H 3SOBL 3DYOA 4C55A 1G9NL 1XGPB 3KPRB 5BO1H 1CXFA 3ARFA 4BZ2L 4ZSOA 4IBLT 3HMXA 2VDML 3GB7B 4LRNH 4X80L 1PAMA 1AXTH 5A2JH 4PJDA 1G84A 1ZVYA 2FRGP 3GO1H 1RZJH 2PXYD 1LEIB 4X7CC 4O2CA 1T0NA 5E00B 1UFUA 4MQ7A 1PQZA 3GNML 1LO2H 4JHAL 4YUEH 5DMIH 1N5YL 3ZKNC 2J4WL 2P5WD 1RHFA 1MCBA 2AXGB 4ODVL 1JYWA 4Q6IB 1K6QH 4YR6B 3ES6B 1LP9F 1LE5B 4FG6D 4CW1B 2VABA 3REWA 3KJ4B 3O6LL 5D9SA 1MLCA 4ZUWB 5IVOA 1C08A 4RQQB 4OCYH 3VMPA 5HVFB 1J8HB 1HH9B 4UINL 3V4VH 2W9DL 5GGQL 1SY6L 1T04A 5HGDB 4LKXA 5EH1A 2QHRL 5E9DE 5T5FL 3VGEA 4MS8C 5ICXB 5DC9B 4X9BA 3VGGA 2UZIL 4HWBA 3VXOA 4AT6B 1FZOB 1E4WH 1KPVA 3C9NA 3U7WL 4W4OC 3QDGE 1N0XL 3WS3A 5F7DA 4NNYB 1YYMH 4DN4L 3T65A 2ITDB 3SDDB 1T03L 3FONB 2H6PB 1IRAY 1MCEA 5HDBF 2CDGA 1VACB 3GSRA 1XR8B 5DRXB 5GGVY 1KELH 4NM8H 1G9NC 4ZTOL 4BQ9A 4FFWD 4YQXH 1EO8L 4TNVF 3P4LA 3VH8A 4HPYH 4HUWB 5JOFA 5LVEA 3WO4B 4OM1H 3QSKB 1AR1D 4XRCA 1S9WA 3SKOB 4WW2A 2RBLA 1LD9A 3O45A 1WSST 4EI6B 5HYEA 3WFCL 4TOYL 3JWDL 2EDLA 1I9JH 4MGXA 5CGYC 5C09A 5IW6A 3SJVD 3UMTA 5B8CC 1WISA 4BK4A 4FZEL 1BBDL 1CXEA 4PJBA 1H15B 3WHE1 2VDKH 1FO0L 1J0HA 1T3FB 1YEFL 2ADFH 3QUXD 5IHUH 4RMUA 4XMKH 5LCVH 5HXMA 2BVYA 4KU1A 1GAFL 3MJ8B 4JZOB 1FSKC 3NCEB 3TO2A 3QJFA 3WE6B 4RRPG 3M1BB 3THML 1S7VB 2WBJA 5KSAA 4CNIB 4P9HL 1BMGA 5CEYB 1NCAL 1XZ0A 3WIFB 4NWUH 4F7MA 4G3YL 5IF0B 3WN5A 4Q0XL 1KNOB 4Z0XA 4YDLB 1U8OA 5IBLD 3KPSE 2AI0H 2QQQA 1RJLB 1ETZB 3U7YH 1QACA 3IJSA 3T4YB 1H8SA 1NEZB 3PP4H 3AM8A 1IGTA 5AYQA 4OLYH 3TVMC 1KBGH 2OTUA 1XF3A 2HT2D 4RNRB 4CL7A 1FVEB 3CU1A 2W1NA 4GH7B 5JOEA 3K7UA 3QWOA 2ICEB 3S37H 1G9EA 2DI7A 4XCFH 5BOZG 5D5ME 3A6BL 5FXCH 4TSCH 4Y0GA 4XPHL 1K5NB 5C0CA 2VR4A 8FABA 2D3VA 3JWDC 3IGAB 2WMPA 4UB0H 2EDRA 5BS0B 3P11L 4MAYA 4HIJA 2R0LL 4Y2DC 3UJIL 5ESAA 5EG6C 1KIUA 1ULVA 4JM2A 3HI6H 3IJHB 3K74B 2X4OB 1HSBB 2GEEA 2UVEA 5ILTH 3O11B 3MV9A 4XPFH 3Q3GA 4Z7WB 3G04B 1QNZL 4DOHE 1AE6H 1N3NA 1WCBA 2V7NA 4KTYA 2NX5E 1YMHA 4KDVA 5L2KA 3BGFB 3FT2A 1TJGL 5DDHA 1HCFX 1BJ1J 3R0MA 3WFHA 3QHFH 3RTQD 2VH5L 4P9HC 5ERWB 4MDJB 3MRIB 3V79C 1Q9OA 1AQDB 2CMRL 2RCSL 4QHUA 1I1YA 2WUBH 3SGDH 5BVPH 5IM7A 3H0TB 1V7MH 2DL9A 2RQ8A 1DVFA 1MQKH 4YLQT 3QEQA 1DBJL 2B1HL 3DI3B 3IYLW 4QYOB 4N0YH 5LXGH 3K1KC 4JDZA 4I0PA 1OSZB 2R4RL 3LEXA 1K85A 5C6WH 1C1EH 2CGRH 2ZP0T 3TWCL 3RAJL 1JZ6A 1PZ5B 1BX2B 4ZO6A 4E0RB 2XZQH 4QRPA 4G42B 1WWWX 2FJFB 4BSJA 4M6ML 4EI5B 3HE7B 4G9FE 3S6CA 3SKUD 3MA7B 5L88L 2B0SL 4KMLB 4FTVB 4P3DA 4LGPB 4PJFB 1TJIH 5T3XL 5FKPA 3BGAA 2XNAA 1ITCA 5FYKH 3E6FB 3NA4A 4CU6A 3EDKA 3KPOB 3O3EA 5JORB 1T0MB 4W68A 3DX6B 1T2XA 3AROA 3MV7D 4XAKD 3SHSA 2DKSA 4XMPL 1F5WA 2PYFB 2VLRD 4XP1L 5IMMB 1LWRA 4UIMB 4Q9QH 3TLRA 1RQ5A 1P9MC 1UEYA 4GSDL 3MRFA 2VXSL 3WXWL 1HHKA 1ZHLA 4JO1H 4YXLH 1BVLB 2GSGB 4EUPG 5EU4A 1CLCA 3P30L 2HLAA 4OLXL 5JXEA 1ZANL 3K2MC 1CG9A 1EUUA 2B5IC 1IAIM 3E2HB 2YHGA 3IU4L 3GMPA 3H3BC 3VFMA 3K4AA 1JJUA 4NRZA 2FJGB 4X6EB 3OX8B 1YECH 3VWJD 4D9LH 5GSRB 4NUGL 5HI4D 1IQWH 1OARH 1E4JA 1TXKA 3K1DA 3PWLB 4FZ8H 1WTGT 4D9QD 2KBGA 1FNHA 4E41B 1ND0A 4Y5VB 5EUOB 3VD5A 5L0QB 1FYHB 5JHLH 2JCCE 1LGVA 4LF3A 1AGFA 4H8WH 4LARH 3O8XB 3NZ8B 3L3HB 3JTSB 4I13B 2UUDH 1LP9B 1UKQA 1T6VN 3NIGE 3BYTA 3WDJA 3W9EB 4GXUM 4MVBC 1QLRB 5TH2A 3T0AA 1Z6JT 3DX8B 3L7EA 1XGQB 2ZCHH 2A9NL 3RPIA 2XWTB 1DQLH 1S8DA 4LCUB 2JE8A 4K71C 4XP4H 1RJZA 1SYVB 5DVNA 2MHAA 1A6UH 1GHFH 3RWHA 3PHOB 3SDCC 3V7MA 4H5SB 3WMSA 1UT9A 2A1WL 3QCTH 2OX5A 2Q86A 3RDTA 2IBBA 1MRFH 1YY8B 1JI2A 4WHYH 5I73B 4TSAH 5E8DL 5C0EA 1WZLA 3ZSSA 4HS6B 2W60A 4UQ2B 4LHJB 2IGFL 5JA9A 3FTGA 1H3XA 1PJ9A 5CSBA 2DJSA 1ODAA 4B50A 2DJUA 2C1PB 4YHYB 1KSRA 4TN9A 3HZKA 5E1AB 1SBSH 1QVOB 4YGVA 1MH5B 5DJXB 3T4AB 3CZJA 3E8UH 3V6FB 4HKBB 3S96B 4UT9H 2APFA 3H7BB 2BNQA 1UWXH 3PWNA 1BJMA 5I9QB 1MCDA 4NBXB 5T1LD 1KPUA 3F5WA 3UTZB 5FM5M 3T2PA 2X4NB 3Q48A 4WGVB 5D7KE 4GQPH 2DQHL 5JO5B 4JR9H 1D6VL 1FYTB 3S5LA 2OL3A 1D9KB 1NC4B 5IB1A 2B1AL 4LKCB 1OTUD 1E27B 4FQLH 3STZA 4DQOL 3CXDL 3VGDA 3KXFE 5HYJA 3MLTA 1VSCA 1EGJH 3QISA 2YRPA 2IAMB 3NIFE 2O5XH 4UUJA 3DIFA 4RBPH 3H42H 2NZIA 3VI4E 2JELH 4LSRH 2LU4A 1Q94B 4NN7B 3Q2CA 4M8QA 2XWBA 4RAUA 5KSVA 3ULUE 4HS8L 1CZ8H 5EU6D 3VFVA 3C6LB 1A21A 2VDPL 3HUJE 4OLZL 1UB6A 3VFGH 1MFBL 1MVUA 5D2NB 4OFKA 1B2WL 5CMAA 5F7LB 5D1XC 5CJQH 1KULA 4P9ML 2DQTH 2CJUH 2NXZD 1XGUB 4NQDD 4I8DA 4D8PB 2BCKA 4AK1A 4XVSL 3ROLB 3O4OB 2VDOH 1RJYA 4MA8H 1BQLH 3MRMB 4C57C 4JG1L 3RY5A 4IRJD 1U3ZA 5HHQB 4R3SB 1EEYA 5I1GL 2B20A 3CLEH 4JFZH 4ZUTA 4ZAKB 3VRIA 4P46B 2OTWB 4I18A 4P2QE 1IAOA 2CKBL 3D69B 5IV2A 1G1YA 1YUHA 1FL6B 5D1ZA 4A6YA 2UVFA 3F7VB 3L1OL 3LZFL 4ESKA 4OJFH 3BUYB 1XF5A 2VC2L 2A6IB 1GGUA 1NSNL 1TZHB 5L2JA 1FL3A 1WFNA 4HGKC 4LLWA 5CBAA 3QUYC 4LSVH 1FVDB 5I1DA 1AD9B 3ABZA 4KHTH 3IDYB 5DHVB 1MHEA 2R56H 4GMSH 4G6FD 4YAQB 4OCSH 4LCWE 4L4TB 1JRHL 4UNUA 4NHCL 1R3JB 2X7LB 4YHKL 5TDNA 3GSUB 4AIOA 3DV6B 1OTTD 2DWEA 3IDJA 1NGZB 3M17A 2ZCKH 3LN4B 3N9GH 2Y7QB 1DE4A 5I19L 4OZGA 1FAIH 5HHMD 4ZFFB 5HHPA 5D5MF 1S7WA 1ZXQA 5IOPA 1ZA6A 3MO1A 3SE3A 2C3VA 3ULVF 2BSSB 4PTTA 1TTUA 1F6AA 5A3IC 5IB3A 2IMMA 5MI0B 4NFDA 1E6JH 4JFOA 1BFTA 1CDCA 3QH3A 3I02A 3NPSB 3I9GL 2F19L 2Q87A 2D7TL 4QRQB 5EZIH 1G7LA 5I75B 3EFDH 5F6IB 1YZZA 2HN7A 1D5XB 4P4KC 1UACL 4PJGA 1Y6KR 3TBTA 1PG7H 1T2JA 5EBLB 4AQ1B 3TH4T 1CLZH 4PR5A 4Y5YB 1I85C 1CFSA 2YD6A 1TZGL 2YZ8A 4PJHE 4ISVB 4S10A 1HHHB 1MSPA 2FIRT 4YE4H 3DV4A 4NNXB 3OXRA 1KN4L 3O0RH 3R1GL 3DXAA 2DLFH 1YQVL 2FATH 2H2SC 5EBMB 2NR6D 1NFKA 3RVWC 1HH6A 3QI9C 3FB5B 5C07A 1A1MB 5C0IB 2HKFH 3TGXA 4X6CE 5L7XH 3L3JB 2R1XA 1P4BH 2VDQH 4JKWA 4QXUL 3RGVB 4MNQD 4PJCA 3KHOA 4D0DB 5I1JL 4KZDL 1G7HB 4YFLI 5FAAA 4XB8A 1IT9L 3IB4A 2APXA 2X10A 3TN0A 1F58L 1J86A 4U0RB 1QSFA 2MCPH 1UC6A 3MV8E 5I16A 1T7YA 1A7NL 1CLOL 2EKJA 3DX7A 5A2LH 2HP4A 1QBMH 2M1KA 5I71C 15C8L 1GGIH 5EZLA 4PRDB 3V5DA 2H32H 4YHIB 4JO4L 3MOBL 3VXRD 1S7XB 3MCKB 1BQHA 2XN9E 3OKLB 1C7SA 4NKIL 4PP1D 1N8ZB 2MPAL 2X4PB 3DETC 3L3IA 1J88A 5GISL 1U6AL 1RV6X 1X5FA 3C8HA 1OAXL 4PJ8A 4B41A 4YBQC 3LKNB 4GKSA 1Q9LB 3QIWC 4PGDA 1BD2E 3D18A 4NO3B 3C5ZD 1IEAB 5I8KL 1I3RB 2JJUA 4PD4J 2GY7B 3RWGB 3WFZA 2AABH 1CLYH 4YHPB 1WZKA 4MQTB 1HK6A 1I9EA 3PWJA 4L8DA 4WUUE 1DTUA 1L6ZA 4LSSL 4MD5B 4LHUD 2J88L 43CAB 4POYA 4ZFZB 1U8NA 4JFFD 3AS3A 4HEME 2HTLD 3EO9L 5IBTL 2D31B 1A4JB 3LEYL 4KJWC 1UADC 4X8XA 4R7DA 1I7RB 4HKZA 1UZ8A 2OLDA 4FQXB 4KMTH 3U9UB 4BSVA 3A6OA 4IMLB 4Q7DA 2BNUB 1INDL 3OR6A 2F8VA 4HWEL 4YO0B 5F9OL 5C0GA 2YPLB 3QULA 2YSSA 2NY1B 2DQGH 3UJTH 1QRNA 2GT9B 4LVHC 3BO8A 2VLJA 4HG4K 1I7TB 1M6OA 2D0HA 5KZCD 5F7FA 4F33B 5KSBE 3JUYA 6FABL 4GRLD 4RFOH 3QR2A 1U8QB 4EDXA 5ID0B 5EBWB 5T3ZH 5C3LD 2F54A 4KPHH 2JCCF 5EB9A 4O4YH 3PWPA 2RB8A 2DMKA 3TA3C 3T77A 4EOWL 4FXLA 4L9LC 1Q8MA 3IU3A 5FM8A 5DMKB 2XPGA 5ID1B 3SGEH 3GHBH 3LKOA 4HIXH 5GJTH 1H3VA 3V7AG 2R0WL 4NOBA 5GS1B 3ECBA 4NT6B 1JPSL 4XMLL 5JQ6H 2PO6D 1B0GB 3G6DH 4NQSA 4LK4A 4B7LA 1PZUB 2CDEB 5GRUH 3S34L 2ZWLT 1T1YA 4KKCC 4BUHA 2HVJB 3LH2L 1GZPB 4QCIA 1A3RH 4X5XB 4DAGL 3D39D 4ONOA 2HLFD 3FB8B 1MNUH 4O5LH 3CSYB 2AXFA 5T1MB 3SCMB 2NMSA 1V3MA 4I77H 3D85A 4Y1AE 4F9LC 1UJTA 2P8PB 1UWEL 4LEOA 4XNYL 3INUH 1ZLWK 5KANI 4HC1L 3K8LA 4J4PD 2EIZB 4GJTB 1D6EB 5CJ8A 4AH2A 1KIRA 4OUOA 1AFVL 1S9XA 4G80B 3EZ8A 4M6OH 2VXTH 4LP5A 4PJ7A 5E6ID 5FYLH 2VB5A 3F12B 3S88L 4CADB 3OQ3B 3ZE0E 4HBCH 2V5SA 4XPAH 4HFWA 1T22A 3V0VB 4QF1B 3GSWB 1T66C 5TFSL 1MELA 2C4FU 3ARDA 5C6TH 5LGJB 3EZJB 4D3CH 5F1SA 3EBAA 3HZVB 1P2CB 1BBJB 4WI7A 3VFPB 3LHPH 5CWSA 5J9PA 2AK1L 2XWJA 4GXVH 3NIFF 4DKFH 5DLML 2E6QA 3T2NL 2VLKB 1NCUA 1WBYA 3VI4F 2GCYB 2BX5A 2KQNA 2GHWB 4EKXA 3ULUF 1JPTL 1AXSA 3MRQA 3HUJF 4F15C 3ROOB 5I0DA 4HD9A 3NBNA 3ZE2E 1ZWIA 1A5FL 3LS5H 4I3SL 2JJTA 3VXUE 5DJ6A 2XY2A 3O9WB 4APQB 2WV3A 2FBJH 4MD4A 3CXHJ 1KJMB 3W2DL 4GO6B 4Q6YA 4QEGA 1J0ZA 1QFPA 5SWSA 4H1LG 3AMKA 1VCAA 1B4JL 2EDQA 4ZUSA 5FGBA 5JW3H 5I8OH 4POUB 1R3LA 4ELKA 4LLQA 3KPSB 3QB7C 5F71A 1F4XL 2QSCH 3CFCH 4LSUH 5C08E 4JHBA 1KIQA 1H3UA 1J05B 5MHSD 3PXHA 5HTSA 3RZCC 3EOTL 4JY4B 1JMXA 5EBGA 2E9IA 3LKQA 1DBKH 1CVSC 4H25B 1LO0H 1YN6A 1T7WA 7CGTA 3BVNA 3IT8D 3IKCB 3O6ML 2AW2A 5TPWH 4IEFB 3VRJB 3PIQA 5JR1L 5JW5B 5D5MB 1J0KA 1T5WB 2C7UA 1NGYB 3QIUB 3I3DA 4FQIH 3IXTA 3SDAD 3BW9A 4OFYA 1WK0A 2K1MA 4WHTA 2ERJC 1L7TL 5AUMA 1KENH 2PTTA 3IDGA 2DJ4A 4M02A 2QADD 1IE5A 4L8BA 2I9LA 2FHBA 2NTFA 4I48B 2OCFD 3QUZA 4BFBD 4ZUUA 1FFPA 1LO3H 1N0LA 1Y0LB 3VA2C 3TV3H 4NKDA 5A2KH 1JZ2A 3FT3A 3OAYH 5JDSA 2ADIA 4GS7B 2HRPL 2NX5B 1EFXD 5DHYB 3P73B 3P2TA 5GGRY 3WL9B 3VD4A 2BY1A 3RL1B 4NQED 3RIFF 3O3BB 4EUPA 3HNVL 5FYJU 2HT3D 4FHBD 3F7YB 1OB1A 4LCCC 2D7NA 2GTWB 4K3DH 2XY1A 4L8SA 4ZNEA 3VD9A 1W0VA 2DBLL 1ZKAA 5KG9B 4RAHA 1KCSH 1RK0A 3L3GB 1FCGA 3QPQD 1YA5A 1UM6L 4NPYA 1IGJA 4TVSa 1TPXC 2HJLA 3QUKA 3QFJB 2OS7A 4PJHF 3ILQC 1XF1A 2X09A 5AG9A 3EJZD 3QG7L 3EYSH 5JPNA 3OKKA 3SE8H 2CRIA 1KFAH 1DBAL 3DHJA 4QOKD 1ACZA 4TUKH 4YHLL 5ITFB 3PV6A 3PWUA 3V5KA 1ZT7B 3O3DB 4YK4C 4WU5B 3EOAB 2DM4A 2AQ2A 3C60D 1QLEH 2CIIA 3BZDA 5GS0L 2AV1A 4X6CF 2FBOJ 1S7TA 1XGRA 4AEHH 5DVLA 4K3HA 4S1DC 4YDIL 1A6WL 5C0RH 5KANG 3PP3K 4WI5A 3ZLQC 4A2MA 3WIIL 3GK8H 1GSMA 4JFDA 1M71A 3ISWA 5INCA 3S4SB 1Z5LB 2IANE 5DD0H 1VFBB 2Z0BA 4PG2A 3QXDA 1FRGL 4OCLC 5IJVA 1JZ3A 3JV6B 4RGMC 5MEQB 3LPGA 4U7KA 4ODUB 3R0NA 4P5KB 2P5WE 2UYLB 3V4UH 2QR0A 2W0LA 2PCPA 1R3IL 3HTLX 4OQTA 2WP3O 5IVXA 4X7DC 5LBSL 5CILH 5CJOH 4OD3L 4HT1H 3VFUA 4AM0A 5KBNC 5IESH 5F3BA 4KI5D 1VESA 4P57A 3CVHL 1BOGB 1ORSB 1KB9J 4HF5H 3FO0H 3KWWA 1JPGB 3NACH 1FZMB 2G75B 3L5WB 3BAEL 1KLUB 2QQNH 4KRPB 4XC1L 3IDUA 1NDGA 1GPOL 4N1CA 1QFOA 3ZKMC 2B8OT 1ZMYA 3KYOB 4HUVB 2AJ3B 5FIEA 2JCCB 4IRSC 5D1QB 4X9IA 3VFRA 3BMWA 3NFPA 1H3WM 1GGTA 1FZKB 1QEWA 1I1AD 2JB6A 4PLKC 2CLZA 1LK2A 5EU7C 3TZVA 4BSWB 3RPKA 1S7SB 2EDBA 4UBDD 1HINL 4N0RA 1ERNA 4ALAH 3IFPA 5GS0C 5EN2A 1HQRB 2XKNB 4KRNA 3MCLL 2R15A 3EW3B 4JQIL 1D5MB 1ZS8B 1C5CH 3GMNB 2R4SL 4M1GH 5MENB 3GJFK 1IARB 3BKCH 1Q1JL 4M7ZC 3TBYB 3O6KH 3CC5A 4M7JL 3LKRB 4U6HA 3I84A 4HUXB 2R69H 5DFVC 1LNUA 5HGAA 3BGMB 2APWA 3V4PL 4GMTL 1ORQA 3OR7A 3M8OH 1D5IL 1N2RB 3ARVA 3DMMD 3TNNB 4TULH 3WLBA 2DMBA 3T0EE 4U6YA 3SJVE 5E00A 3L5HA 5CJ5A 1WEJH 4U05A 1CICD 2XZCL 2BJML 2EO9A 4Q6IA 4ZFGL 3TH2T 4YR6A 2V5YA 3MLVL 3QIBC 2I9TA 4PJIF 4IIQB 1HOCB 2NY3C 3G9AB 2R0ZL 3LQAH 3QDMD 4RQQA 1DQTA 4YNYA 3UYPA 2NXYB 3BN3B 3OWEA 5IMKB 4RX4A 5HHOD 5J4MA 4TUOB 1NCNA 1YN7B 3GSQB 1RZ8A 4IJ3C 2R2EA 4PYGA 4M6AA 3CPLA 4L4VD 5K9OB 1EJOL 4JZJB 3U46B 5F7EL 5ICXA 2WZPD 4AY0A 4JFPB 4XGZA 1AO7B 1UCBH 2BHUA 3K80A 4GAGH 3MLWH 1U58A 2GFBA 2J5LB 1RSFA 2V2WB 3ZE0F 1MRCH 4KVNL 1QR4A 3HUJB 3LSOB 4FMFA 4JKLA 3KPRD 3MRPB 4M43H 5IGXL 1JHTB 4N0UA 3DX9A 1Q72L 4WEBH 3T0VA 4L1DA 1XR8A 3VXQA 3QWRD 1RZ7H 4PTUB 3C08L 1UH2A 3UZVB 3GSOB 4S1QH 5F7KC 5FYLD 3GIVB 3SE9H 1NJ9B 1ZHNA 2H1PH 4JO3L 2A0LD 1MCPL 3ET9F 2F74A 2MJWA 2DDQH 1EAJA 2HVKB 3P3YA 5C6PB 4JPVL 5EOTB 5J1AA 2P5ED 4BFEA 4Y8AA 3HC3L 5DJYA 1CFNB 1CN4A 1QSVA 3RZWA 3T1FB 1K2DA 2DKMA 2GITB 3BIKB 1OAZL 3HI1A 2DM7A 1N4XH 1AKJB 1J8HD 2FR4A 2DI9A 1T3FA 1KPRA 3UTTB 1NCBL 5C2UB 3VD3A 1RIVL 2HMIC