3DVNB

Crystal structure of k63-specific fab apu2.16 bound to k63-linked di-ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
217
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEWVAYISPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human IgG1 fab fragment light chain
publication title Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB01
4WWKA 1RJZA 2BSTA 1S7XA 5LWYH 1ZGLA 4XI5C 3H7BA 4MS8C 5IHZA 2AQ3A 3HC4H 1C12B 4JQXC 4J3SA 2Y25A 2GITA 3ZT7A 2VL4A 5CJ8A 5GHWH 4PRDA 4TN9A 1LE5B 2X10A 1QVOB 4QEGA 1SYSB 3WYRA 3GMRA 4F7PB 1A1OB 4HIEB 2NCMA 3JXAA 4I5BB 3BDBA 4JY4A 4FQLH 4YXHH 1K8DB 1MCOH 2BSRA 3V6FB 5TQ0L 1MEXH 2V2WB 5L7XL 5ESQA 1AO7B 1NBQA 3F6IA 1WAAF 1CLYL 4X6BB 4PRPD 4H5SB 3IJYA 2D7PA 5D7IE 1U91A 4FP8H 1YEHH 4RMUA 1T04B 5B21A 5TE4L 1I4FB 5F3BB 2FGWH 1K2DA 5C09E 4N5UA 2P5EE 3AMKA 4XGZB 1FO0A 2PO6C 4YR6B 4ODTH 5HPOA 4Y5YA 1RJLA 3BEWB 3P0YL 1DUYB 1TJIH 1XR9A 3TO4D 1J0ZA 3SDCA 3QHFH 3VFUB 4HJGB 1WBYA 4KMTH 1UWEL 1OD7A 4YAQA 4M7KH 3CSYB 3HE7B 3B5GA 4D3CH 5MENE 4JGUA 4GJTB 4P2RE 5KSBA 4MNGE 5KSAD 4S2SA 4YUEL 3V6OA 1EO7A 5EO0A 5FYLL 1BBDL 4X6CF 2AXFA 1OP3K 5CBAB 4OUUA 1T1YA 3L3HA 4M93B 4P3WA 5E8EA 1RZFH 1Q72L 3FN0H 1JGEA 2CR6A 3CLEH 4HH9A 3PXHA 3VA2C 3MACL 4WTXA 3RX7A 4HBQA 2ICES 4DCQA 4NC0B 3WS3B 1ZVHA 2A6KB 3KR3L 1X7QA 4U1NB 3D48R 4IRZH 5T1LD 3EJZD 4TULH 1HDMA 1NMCB 4U6VL 3RWHB 4JO4H 2DKMA 1DFBL 4KVCL 4P4RA 3I6KB 5GZOD 4M7LT 3QO0A 3LKQB 5CLWA 2RR3A 2FH6A 2O5ZL 3ZE0F 4S1QH 1MCNA 4NQUA 1MFCH 3DTXB 4JHZA 5DMGC 3ES6B 1GC1C 4HIXH 1YEKH 1MCFA 2QSTA 5HHMB 4DAGL 2WBJA 4B7LA 2GJZA 2GQHA 5CP7A 4JPVH 1U8KA 3HHRB 1YEJL 2MKLC 4NBZB 1CU4H 2NW2A 3L6FA 3S98A 3VFWA 5JO5A 3LAFA 4LVOB 2P44B 2ZSWB 3QXVA 5I8CA 2HRPH 4YBLC 1CFQA 5F21B 4BFIB 4NHCH 1HK6A 2VISA 4OZ4A 3AY4A 5CKGA 2NX5A 3MLPA 1Q9KA 3RVXC 3OAYK 4ODHL 5CJ5A 1IM9D 5E6IC 3LRSB 4LNRA 4ENEC 3DROB 1TIUA 4LL9A 5MEQB 2GT9A 5KG9B 4PJ5A 3O4LA 3B2UC 4CNIB 4KUZH 4FQ2L 4HEME 4E42A 3TCLA 5SX4H 3QH3A 5FV1L 1KPVB 1L0YA 2VZUA 5C92A 3W0WB 1YEDB 1MFDH 1WFUA 1INDH 2ZUYA 3REWB 1MPAL 2IEPA 4JN2B 1V7ML 1ZSDA 1AR1D 1GZQB 3SCMA 2VTFA 1LEGA 2ADJA 2AJXH 5FB8B 4ZMAT 3H9SD 4EN3A 1EAPA 3MUY1 3WNLA 1IAKB 3ROOA 1AQKL 4FZEH 5E2TL 1DN2A 1F4HA 3QB7C 4PRAB 3VFNB 1KCUL 4KKCD 1CBVL 3MLTA 1L7TH 4NC1E 3EHBC 2AJZB 2P5WD 3EIFA 1QFHA 4N1CA 4NZUH 1PSKH 1SMAA 1RZKH 3RAJL 2BVUA 4NFCA 3FT4B 5CBEA 2G2RA 3DETD 5DSCA 1IC5H 4LLMA 2AEQH 8CGTA 5JHDD 1EHXA 5ALBL 3QJFB 5KS9A 2VLRD 2VDNL 3PIQA 3NA9L 1BAFH 5IROA 1K3IA 4U1HA 1SEQH 4F3FB 1CTNA 5HI5D 1JZ4A 3JTTB 2NY1D 2Q3ZA 2IH3A 4NQVB 4CVZB 1A9BB 2LAAA 4QHLB 5DMIH 2V2XB 3LKNB 3TVMC 1Q0XL 4YK4C 2EECA 5FECB 1U8PA 2BNQB 4J12A 4LLWB 5EBLA 4NO3B 3VE0B 1EGJL 4WJ5B 4FFZL 1GPOH 2VIRA 1DN0A 5C6PB 3IU4H 3GMOA 4X4MA 1JMZA 5I66B 3KLAA 3QO1A 3BX7C 3WD5L 3GMMA 2AK4E 5AG8A 4X7CC 5T3ZD 3C6SB 1LEKB 3SOBH 4IS6B 1WK0A 5KSBE 2VDMH 2D31B 1H15A 4OM1L 4GRWB 3S96A 5E6ZA 1YUHB 1K4DA 3IYLW 3S6CA 3GDBA 1U6AL 4RMTA 4PG9A 1J05B 1QBBA 2MKWA 1FGNL 4MAYD 3SO5A 5T3XL 5GGSA 4HS6B 15C8H 4P46B 4HWBH 5IEHB 1FH5H 3SE8H 3NVQA 1CXEA 2F53D 2VITB 5DMJB 1SQ2N 5F1NA 5BS0A 5FGRA 3P73A 1KFAL 1PAMA 3FO1B 1ZHNB 5FIEA 3T2PA 2R0LH 5IB1B 1YY9C 2JIXA 4NPYB 4XP6H 4DVBA 4KTDH 3ZKMD 4IHOB 3O45A 5E6YA 5HD8C 5F7EH 2YEZA 4L8SC 2O5XH 32C2A 4UNUA 4XP4H 2ENYA 4WWKC 5C0AD 1MCWW 1S7VB 3EJYD 4NQDA 5DJ2A 3GI8H 2OZ4A 2C7UB 3QWOB 1EZVX 4JAMA 4MD4A 3BKJH 4AEHH 3G5VB 2IALB 4PJDF 5DFTA 2CUIA 2OI9B 1C5CH 1WQVT 3GMPB 2ZWLT 1EBAA 4OAWB 2D03L 3MROA 5JW4Q 4BFGA 3GI9H 1K6QL 5EC2B 4H0IA 4WU7A 2IQ9H 4XVTH 1FAKT 4WO4B 5BJTA 3EYQD 2VR5A 1M1SA 5C0BB 1JRHH 2OR9L 4P3DA 2ADGA 1DQDL 1IKFH 4U1SB 1EK3A 2BC4B 2A83A 1CF8H 1AHWA 3UYOD 2BRRH 4BSVA 5HGDA 1MRCL 1TETL 3W81A 2UYLA 4Y5YC 5IW1A 4QRSA 2E27L 2DLTA 5JA8B 3QEQB 3FQWA 3TA3B 2CUHA 1IGJA 4YHZH 3SDCC 2VQTA 2X4RB 1AGBA 2D7OA 2MJWA 2Y07H 5A43C 3FCTB 1UA6L 5TDOB 5C9KA 3KPLB 1Z5LA 1I9JH 1JHKL 4M1GL 4OCWH 3QUZA 5CD5C 4BQ9A 3BZEB 3KPMA 3N06B 5H35A 3KJ4C 2Q3AA 4X7EC 3V6OC 5JXED 4LHUD 3LV3A 4RISL 1BX2B 4IRSD 2BCKA 1I9IH 3MJ8A 4NRZB 2JB5L 1IL1B 4UAOC 4B41A 4M6MH 2P4AB 4OCMC 2NY7H 2FJGB 1BZ7A 3DVGA 4Z7NE 1JHLL 3DBXA 2A6DA 5MENB 1Y6MR 4UIMA 1GRWA 3V5KA 2O61A 2XACC 5DYOB 1KV3A 3OKOB 4KDTC 4P2RB 4XC1H 5EZJA 5JUEL 3GBML 4IOIA 2Y4SA 1X4XA 4OCLC 3DGGA 4X4ME 4XZUA 1MCKA 1UXWA 3MRQA 1X5JA 3FONA 4FTVD 3U0TB 3WDIA 5DJZB 3S36X 5TGBB 2A9NL 2QADD 4Y1AA 5GRUL 5JPMB 2ESVA 4IRJD 5FM8A 1FVDA 2VYRE 4FG6C 1CFSA 3N9GH 2P42B 2WBJC 1JVKA 4PY8J 3AGVA 3MBEC 3QUXB 4XNYL 4XAKD 1RIUH 3LKRB 3NPSC 4QY8B 1AY1L 3L5WA 5I8EA 1IC1A 3B3IA 5CINL 2HKHL 1W72A 1EMTH 3H3PH 2FO4B 2IBBA 4R7NA 3QIWA 2DQIH 5BRZE 1VFUA 5FV2A 1SJEB 5L88H 4PBVC 2WUBH 4EJ1C 5C7XH 3GSOA 1QSEA 3AY4C 4EQ2A 2DOCA 3C60A 1GGBL 4LPTA 5TE6H 3SGJA 1O7VA 4NUJB 4JQIH 3ARTA 5DJAA 4QKXB 2DN7A 3SE4A 4LEOB 2F5AL 3WFCH 5FA3B 5D7SL 3IF1B 5BXFB 5JOPE 3BDYL 3CCHA 4MQTB 3MNWA 2VN4A 4RNRB 5TQ2H 4J2XA 2WIIA 1FYTA 3P4NB 2F5BL 3SCMC 4HXBL 4WV1B 4MX7A 3JWDC 5DEFB 4WFFD 3C8DA 1WEJL 4EN3C 1XEDA 4NT6A 4EIZC 2IH1A 4GOSA 4LCIH 2FJHB 4P9MH 1FL5B 3QJHA 3PWUA 2GJ6E 2ATPA 1YMHB 3MUJA 4WNQB 5ID1A 3IGAA 3U0WH 5HI3D 4ZXBA 3GSRB 4G8EB 1BFOA 4L1HA 5FOBA 3WXWH 2H32A 2VXTH 3MRPA 4M7ZC 5I1LB 3S36H 1U8QB 2E6QA 4LKCA 3ULVD 5IIEB 4KROB 4QCIB 5TF0A 4JM2B 5EU6B 1QSFD 4U1LB 4N0YH 1T6WA 2PYFA 1PEZA 3KWWB 4HC1H 5DLMH 3OX8B 4I1NB 4P3CL 4RFNC 1QACA 3W9EA 3Q6GH 3NH7L 5E8PA 4GAYA 5IROC 4Y19A 5D1XD 1TMCB 2IAMA 4DJMA 1DQMH 5I1AB 2QL1A 2OXGA 4XWOD 2K7PA 5LXGH 3VXUB 2Z91A 3D39B 5DJ6A 4MDIB 4S10A 5F7DB 2VOTA 2DBLH 1C08A 5DURB 2O26U 4H0GA 3UZEA 3U7YL 2A74B 3SKNB 3DI2B 4C57C 4WVRA 5F7KC 5INCA 4N8CH 1FVEB 4HCRA 4EBQH 1BVLB 5FUCE 4U6YA 1KXQE 5DJXA 3CVIH 4O51B 1JYXA 5J11B 5D93B 1PZ5B 4HGWA 1PBYA 3QWRD 5EDXA 1G9MH 1OTUC 4DW2H 4LQFH 5E8NA 1F13A 1E4XH 1U8MB 5JPNB 4N9GA 1TTUA 1X5IA 2OP4L 4ZUVB 3RDTD 3L3IA 3MCKA 1PKOA 2ZG2A 1LO0H 2H41A 4XP5H 5AAMA 4RDQG 4PLKD 3T0ED 2AK4B 5GZND 1YMMD 4UBDC 3ULUE 4JFFD 1RULH 3GSQB 2J6EL 3C6LD 2DJ4A 4LSSH 3X12A 4NNXA 3DYMA 3LEVL 1YYML 3UJJH 1OAZH 3W11C 1VEOA 1I1RA 3BD3A 4EUPA 4Y4KB 4G43B 3NGBB 4JREC 4LCUB 4WIQA 3CH1A 1MI5A 5DQJA 3P0VH 2D0HA 4M5YL 1UZ6E 1A4KB 4U1IA 2VWEE 4FQJL 4KJQC 5E9DA 5JOFA 1G1YA 3RKDD 4G8GD 3QNYA 3TT3L 3S35L 1I9EA 2XKNA 3LEYH 3LKPB 2UZIH 1NDMB 3QI9B 3KPPA 5E03A 5L2KB 4R7DA 5A16A 1H8SA 4O9HL 1MLCB 1OPGL 4OGXH 3PDGA 2BP3A 4BZ1H 4X7TB 1QHPA 2R29H 1NCTA 5KTEH 3BP4B 4OD1L 1ED3A 1RZ8A 2ATKB 3IJSA 4U6TA 1ZS8A 4GKNA 5IFJA 1IBGH 1EEYB 4N0FA 4L3AA 3IXAB 2N7BA 3GSWB 4X6DA 1N6QH 5CSBA 3SDDC 2BNUA 2ADFL 1WTLA 1QSEE 3PV6A 3V6ZB 2AJVH 1OL0A 4B7IA 4LLYB 1KLUB 3RNKA 4K94C 1HSAB 2GSGB 4URTB 1WBXA 4W81A 4PRNB 5HTSA 1JUFA 2QHRH 4HK3N 1X44A 1A6UH 2RGSA 4Q58C 4U1MA 1BLNA 1QYGH 2R56L 4HW6A 2WV3A 1T2QH 1OTSC 1MJJB 5C0EB 1KPUB 1ZLWK 1XGRA 1G6RL 3VJ6A 3D3VA 2GHWB 3I02A 5KSUB 1SHMA 1BQLL 2PW1A 1F02I 1AHWC 1FYTE 4G7VL 3WFBH 4HJ0C 4A6YL 3HI5L 1J1XH 1GIGL 1WVZA 3EYFA 1LDPH 5JDSB 3FOMB 3HE6D 1N26A 1HE7A 4F2MB 1DEDA 1P4LA 3MNZA 4LPWA 1XCTB 5H8DA 5J1AB 4Z7UA 2PXYD 4MAUH 1LQSR 3FHQA 5FUCC 1JWUB 4JPKH 4JLRA 5TH2B 1R5VB 4PJAA 1NC4D 5DJYB 5E2VH 4R8WL 3QUZC 1D9KB 4NKOA 1MY7A 3PDOA 3WUWB 3RIFF 1A1NA 3DHMA 1F00I 3X14B 3D0VB 2J5LB 4XHQA 3U7WL 3NFPA 2WWMD 4OFPA 1SVZA 2BVQB 4U31A 2V2TB 1JGUH 4L5FH 5D1ZD 3OKEB 1MAKA 3KPNA 4H88L 3MREB 4PJCB 2DYPB 1H3PH 1NLDH 4LARL 1KTDB 1OLLA 3C5JA 1QBML 4EUPG 4FZ8H 3MLXH 1H8NA 3K1DA 1MQKH 3OWEA 1DJSA 4K3DH 2QQQA 2XXMB 1GVIA 3RPKA 4X8XA 2A6JA 2ZCLH 2X7LA 5HVHB 1UH4A 3O4OB 2H1PL 1CG9B 1HNGA 4G6AD 5F7YC 1HSBB 3NZHH 1T2JA 3I6GA 1WZ1L 4D9RE 1GGTA 1CDGA 4BUGA 2JJVA 2X4QB 4P48A 2R0ZL 1N5AA 1CE1H 1JWSB 3MO1B 4ODWA 4JHAL 4WHTA 1DBJH 5C07A 5HGHB 2X2YA 1LEIB 4ZO8A 4CL7A 4FMFA 4NKMB 2OBGA 4L9LC 3MJ9L 2R2EB 4P49A 2YMXH 5D7IF 3IXTA 4E41B 2GAZA 3RZCA 3WIHL 5LCVL 3EOBA 6FABH 2VE6B 4OCRL 1FG2B 1KPRA 1QSZA 3V5HB 4EZMA 4HV8A 2BVYA 1VENA 4F7EA 4ODVL 12E8H 5ESAA 2VLKB 3IU3A 1A3QA 2WW8A 2R23A 3G08A 1QFWM 3PHSA 4M62L 3MLUL 2JJUA 2HFFA 2Z8SA 1T89C 4G80B 3QIWC 4QHNB 2NY0B 1FPTH 2HG5A 4FS0A 2DQEH 4AIOA 4XCNB 1P7QB 3ARDD 2XV6B 2VSCA 3LQAC 4ODXA 1PYWB 2EDEA 1MFEL 4WFHD 4JANB 3C60C 3OGOE 4OLXL 3KYMA 2EXWC 3SGJC 3T1FB 3U9UB 3VG9C 4HUVA 4WW2B 1BHGA 1BQHA 4WDIA 3LHPH 1LK3L 4N0UA 5DT1L 5BRZB 1FAIH 1J1OL 3K81A 5ENWB 3FQXA 1WZKA 5DDHA 4XT1C 1AP2B 4NQCB 4DKEL 5MEPA 1D6VL 2CLRA 5IMMA 1FE8H 1WTGT 1CR9H 2GTWB 5F1OB 1LO3H 2HKFL 2IPTL 5KBNC 3HB3C 4GBXB 4K2UL 4ZFGH 1YEEL 5A2IH 2EC8A 4P5TC 3NIDE 1E28A 3Q3GB 3UJTL 4LLDB 2YKLH 4Z7QE 4ZXBC 1CWVA 2XWBA 3KAAA 3P9MB 2AJYL 4TYUA 2P8MA 1MRFH 1YPZE 4Q74A 3WJJA 1ZHBA 3IDGB 5I18H 1FZOB 4HWUA 2DKUA 4LCWD 2ITDA 2DLFL 3B43A 4XMLH 3BWAA 1H0DA 1YEFH 4I48B 1FRGH 5GS2H 3O9WD 3BPOB 1A7RL 1OAKH 3PQYB 2YPLA 1A0QL 2IAMC 2GJ6B 4ZO7A 5GRJL 1P4BL 2I9TA 4LRNH 5F9JB 1BOGA 4Y4FD 3ZE1E 3KHQA 1FNSL 3GJFA 1UH2A 5AD0A 5EU7E 1S7RB 4X8JB 1RUQL 5ADOH 5C0DA 1QRND 3DV4A 5IBLC 1QFUL 4U1KB 1CCZA 4X4YB 2EE3A 1NUFA 1Z9LA 1HINH 1P53A 4XTRD 4DN3L 1MVUB 2Z31B 3QPQC 1NBVL 1G9NC 1KB5L 2NTFA 1G9EA 1QBLL 3CFDB 4FQHB 5FA4B 1HEZB 1J5OH 4MJIB 3BZ4B 3D69A 5C0ND 1VDGA 3T0AA 4NQSA 2EC9U 3V5DB 3RWCB 3P11L 5E2WL 3TT1L 4NN5C 1KIRA 4XCYA 2JCCE 5HHVL 3ARBD 5DFWH 4UQ3A 4M00A 3AREA 1S8DB 4FQQA 3LVEA 1E4JA 4DN4H 4OCNC 1S9VA 4JM2F 5DD0L 3NABL 4MCYA 5ALCL 3MV7A 4LU5L 1S7WB 4TOYL 1UB5A 1I7ZB 1A6VH 4V1DD 2VZSA 1X5LA 3VRJA 4KY1H 1XH3B 1R5IB 5DJ8B 5TFSH 1NGXB 1TPXC 5AWNH 4TNWK 5DD1L 3SDYH 5JW3H 2CJUH 1MCLA 1BQHG 5D1QA 2C4FT 1C5BL 1A2YA 4ZFOL 5A2KH 3E8UH 5DD6B 1J0JA 3GSUA 4C83A 1B6UA 3WIIH 1U8IB 2NXYC 4TUJB 5IP4A 4DFIA 5BV7C 5J3HD 2CLZB 5LKNA 5HHQA 3HNVH 1NEZA 3BH8B 5IUSA 2DTSA 2IAND 1A7OL 1C5DA 1U3ZA 1MQ8A 2J4WL 2V7NB 3FFCD 1S78D 4W68A 3T2OA 3MOAH 4P59L 3S4SB 4FQLL 1I7RB 4WU5A 3WNPA 1T0MB 4PJFE 4UOW1 3DGCR 3FO2A 5CD3B 1FN4B 5D5ME 5J6GA 2I24N 5E1HB 4QHKJ 2EIZA 1CD9B 3ET9F 1A1MA 5CEZL 2IPKB 3VWKD 1HZHH 5DJ0A 4KKLD 4MA7L 3QXDA 2DWDA 2JJWA 4GAJH 4PRPA 3TH3T 4APQD 5J0BA 2X6MA 3KXFE 4I4WA 5J4MA 4JFHD 1DQLH 1KIPB 4N0UE 2B5IB 43CAB 4X5XA 1JI1A 4DZBB 5IMLA 1BEYH 1H3UA 1RVFL 1FZKA 4I0PB 4U1JA 1TVBB 5F9AC 5GRVK 4DKFH 2HLFD 3TO4A 4WHYG 4XX1G 1VFBA 3UTPE 4OTXL 4QRQA 2NZ9D 2NY4D 2Q7NA 3HLAA 2BOBA 1SJHA 4X80H 4LF3A 3UYPA 2EH7H 3RWDB 2MCG1 1H5BA 4QRRE 1OF2A 3VXRE 1KJ3H 1JV5B 5KSAA 2ZUTA 2FECL 3PJSB 1N3NA 4WENB 3ULUH 2R2CA 5FEBA 3FN0L 1CIUA 1ZEAH 1DQJB 3GKZA 3PG2A 4J6RL 5EN2A 4HWNA 1A3LH 2WINB 5DQ9B 1KCRL 4GW4A 5JXAH 1MWAA 1OVZA 4P57A 3CFEB 4ZNCD 3RUGA 5F7HA 4TULL 1MUJB 4JO4L 1X4ZA 4L8DA 4S0SD 4NWUH 2ARJA 4LQ1A 1OGAD 3GSVB 3LS5L 3SDAC 5I1EL 3FRUB 2MQ0A 3JV6A 5T1LA 4U3XA 5TF1H 1J0HA 3ARQA 5B8CA 1HOCB 5HPMA 1FNFA 1I1FB 4XNZC 4RGNE 5DZOA 3EO9L 4OI9A 1W72H 1NEZG 4P9HH 1P84K 4UU9A 1NL0H 3OGCA 1JPSL 1XT5A 4Y8AA 1VGKA 1Z0NA 4JFDD 1YJDH 3RZCC 1KJVA 3OZ9H 1GGUA 2R2HA 4WWID 2DD8L 2LTQC 1CD8A 3QBTB 1C1EL 2FLBT 3T65B 1G7HA 5CILL 3AC0A 1PG7X 1QR1B 1ZT1A 2OJEA 5IB4A 1Q38A 3G9AB 1UQSB 1JNHA 2UY6A 5AYUH 4U6HA 3MRFB 1IGTA 4GG8B 2HH0L 3NACH 1CXKA 1MVFA 1CGSL 4K07A 4MD0B 3TJEH 5IQ9B 4RZCA 1IM9A 3IVKB 2DDQL 3I75A 2EDXA 1QLFA 2JJSC 3IB4A 4OB5H 2FX9H 3D0LA 3NAAL 3VRLE 1NCDL 3HUJA 1TZHB 2VL5B 3MGOB 4PY8I 3BGFC 3CFCL 4XMPL 5KZCB 3BYYA 1CFNB 1FFPA 1JGVL 2RIKA 4HG4K 3GSNB 4PJ9D 3L3GB 4GS7C 4FZEL 3IDMA 4XPTH 1A5FH 4OZHA 2HLAB 4Q2ZB 2UVEA 4Z7NF 3GIZL 4GMSL 4D0DB 1B88A 1RZKL 3PP3K 5EPMB 3ARXA 5DFVC 4DQOH 5CJOL 1W2KT 3EYVA 3L9RA 3PWPD 3O3UN 3VCLA 4RFEB 3DSNA 2P5WA 2P24A 2HTKD 3WKNA 3OR7A 1N5YL 3U0PB 5D8JH 2G75B 5F3HA 5T1DH 1NH6A 3VGFA 4LVEA 4TRPL 3DARA 5DXWA 4DEPC 1SEQL 4KPHL 5JHDA 4XXDA 1EJOL 4XBPA 4UINH 2VDKH 5DMIL 5FHAH 4IBLT 5EOTA 2YD7A 1UACH 1X6NA 3B2VL 2V5MA 4PJGA 2YWYA 3R8BB 3QISA 4LVNB 3L3JB 2BX5A 1S7TA 4OLZH 3RWIA 1CXIA 2Z8WC 2CRIA 3IU4L 4H20L 3M45A 3WNNA 2FJFB 3KPRB 4NO5B 3D6GA 5CMAB 1BJMA 1FFNA 5KN5A 4WW2F 3B9EA 2BY3A 2ZZUT 3UO1L 3QT2A 1KEML 4NJ9H 5GQBA 1YPZB 1SMOA 4GO6B 4LKXA 2W65B 4XCCL 1C16A 2VXQH 5E99L 5FCSH 4U2ZA 5CCKL 3DURA 3W9DB 3CVHA 4UNTA 1IAOB 2UY7A 4CVXA 4L4TB 1FL6A 4ALAL 5GS1B 4R4FH 2X09A 1R24B 2VXVL 2JLLA 4J3XA 4MAYA 5A2FA 5MI0C 5J6HB 1G7JB 1N59B 1KIQB 3AREC 3PGDA 3QUKB 1DDHA 3O8XD 4XNXH 3VFGL 4CJ0A 1UM6L 4OF3A 2VN7A 3JWOC 4X98A 3I85A 4R26L 4BQ8A 5L6YH 1P7KB 4ZTOL 2QBWA 2YBRA 1MF2L 4K7PY 4QNPE 3LSOB 5IVZB 4GW5A 3MYJB 1ETZB 2EEAA 2JCCB 1JPTH 2QQLL 3CXHJ 4GW1B 2W60B 4GSDL 1I8KA 1UM5H 4ESKA 1WWWX 5ITBH 4NKQB 4OLVH 2VDQL 4FQXB 4CAGA 5T5FH 4P4KB 3VFRB 2YD1A 3STLA 5IMOA 2WBWB 5C0CE 1DBML 2AI0H 1UH3A 3O6FD 1C5CL 2ZJSL 4WI2A 3MR9A 5F1IB 5DWUL 1N7ML 1KJ2B 1KCVL 3TO2A 5KVGL 4Q6IB 3B5TA 5BMFH 3QA3A 1R3LA 1PLGH 4PR5B 3VMNA 3BAEH 3FQNA 2CKBB 5GGVL 3UEZA 5IGXH 3N1MC 3GIVA 3A6CL 2YRLA 4TNVK 2D7QA 1IKFL 2Y23A 4Z76B 4TVPH 3TF7C 4X9GA 3GMLB 1F5WA 4AM0B 3IDNB 3QZWG 3WHXB 1OLZA 2XQBH 5DR5L 1AIFB 5IW6B 5BVJA 1CD0A 5D5MB 4XVUD 5HYIA 2MQ3A 2Z0BA 3WHE1 1U8JB 1AO7D 1V3MA 3DMMB 4LSTL 4Q9RL 4OZHE 3W39A 1ZA6B 1X5XA 2EYRB 2YPVL 4M6OH 3TN0B 3VFPB 5K9JL 3FO0L 3MJ7A 4GKOA 4QF1A 3OG4B 3O81A 3SQBA 3TO4C 3ULUF 1BWWA 2KQMA 3EYUH 1M71B 2YD9A 4HJJH 4C56E 2W0FA 2OJZH 3KXFB 1QSVA 3VU2A 2GK2A 4ZD3H 4WEBL 5EA0L 1UZ6F 1H5BC 4PFEA 3BZFB 1OWRM 5KSAC 4FRWA 4LLUA 4RAUB 4LHUA 5JXEA 1KT2A 5C8JA 2YSSB 5FO7A 5F72S 1VPOL 1CYGA 3O2VH 1A7QL 5EZIH 3O3AB 5IVXA 4XP1H 1GC1L 1AQDB 4ETQA 1KJ2H 1WLHA 1XCQB 3CUPA 3V4UL 4KV5E 5DHYB 5IB2A 4O00A 1A6ZA 5TDNB 4XBEL 2ICEB 4QRRB 3VXRB 1DBKL 2E7CA 2CKBH 4YDLC 3GMNA 3MRBB 3HI1B 4K23H 4PGDB 3EJZC 43C9B 3DX9B 3Q48A 4IMLB 4FTVA 3HZYB 2D4FA 5B8CC 1MHEA 2J88H 1CZ8H 5GZOC 1PY4A 2Q86A 4PP1C 1HIML 1TNNA 2P8LA 4IRJA 4H25A 1LO4L 5T33L 4LIQL 3QUMA 3SKOB 4XPBL 4F58L 3DRTB 2WK2A 3CMOH 3ZDXE 1DLFL 2DQIL 3OMZA 3QDMD 4K3GA 3CZFA 1MCDA 3H9YA 4QXUL 4N90E 2EO1A 4CMMB 2YZ1A 4RGNB 1JGDB 1NDGA 5LGJB 2BOCA 1R3JA 3F5WB 2EIEA 3VGBA 2I07B 1NGWB 2C4FU 5I1CL 4HBCH 1C7SA 4JHWH 3S9DB 1RK1B 1JNNH 1G7IA 5CJQH 1KSRA 4PJEA 3PHQB 1DQQB 4HLZG 1TZIA 4UT9H 2SEBA 5D2NA 3DIFB 1YZZA 5D7KE 2H3NA 4G7YH 4PLNC 5DZLA 5TQ2L 2Z92B 4H8WH 3FB8B 3IKKA 4C54A 2OTWB 3B9AA 4UDTA 2HAZA 5DF0A 5F9WC 1YNKH 1ADQA 4GLRH 3TIDA 4U6XA 1DUZB 2R69H 4YBLB 3ZKND 5H2BB 1CGXA 4IIQB 3DV6B 1AR1C 4Y16B 1M7IB 2C3VB 4HPOH 2H9GB 4A2LA 1IEBB 5DUPH 2Y5TA 1HQRB 5C0GB 1W0WB 1S9YB 2VDOH 4QOKE 1NBZA 3EYSL 2EYSB 2Q8BL 3GMQA 4XAWH 2OLDA 1AGDA 1IZJA 4MSWB 3OXRA 1YECH 3W0WD 4LHUG 4KKCC 5C2BL 3BXNB 2OXHA 2UUDH 2CDFB 2Q8AH 5GSRA 1B90A 3Q6GL 3D18B 3BIAX 5DK0A 4AEIH 4ISVA 3DETC 1QSFA 1DQML 1O5DT 1NAMH 3QFJE 1FZMB 1OHQA 5IB3B 4FNLL 4ZPVB 2YR3A 5C0JA 2NY3B 2W0PA 2XZAL 1A4JB 1S7UA 4W70A 5SX5K 5I1IL 1NFIB 5D1XA 5HI5C 2NY1C 3GJEA 3MXVH 3BIKA 3EDJA 4I13B 3U1SL 4N8CL 5D6DA 5AZEH 5JQ6L 1KEGL 4ZO6A 4HMCA 1T2XA 3G6JE 4S1SL 4FA8A 1BD2D 4XPHL 4X7DC 2P47B 3UPRA 2EDNA 4DW2L 3UTTD 1IAIM 3VGAB 1TXKA 1TITA 3OB0K 1NCUA 3AFLA 3PUCA 3QWRA 5GGUB 2YUVA 1AH1A 2OL3B 1RU9L 3DVNB 3FQUB 5INDB 4BFEA 4JRXD 4JDZB 3CZJA 2AV7B 5C0FB 4YK4B 1IT9H 5IVXE 1K8IA 3RVWD 4ZUUA 3TV3L 1OCWH 4MAYC 4NN6C 3MRMB 1EIBA 4R2GB 3T0EA 4LLVB 1YMMA 4OZIB 3NFNA 4JFFA 4NRXA 2RJMA 1AC6A 4MYWB 4LK4A 5DVKA 2BVOB 3D9AL 4PGJA 3ECBA 2HVKB 3CGTA 4WUUB 5CAYB 1FL3B 1UVQB 1R3IH 4IM8A 2UZIL 3GBLA 4N1HB 3DX7B 3NIDF 4LGRB 2FBJL 5I73C 2NYYD 3T4YB 2OQJA 4Z7QF 5EWIH 4PJXA 5E24E 3SGKA 1S3KL 2JB6A 3LDBC 2X4TB 4G8GA 3F7YB 1XF1A 1UWXH 4TQEH 3KNBB 5D71H 4P46D 1IEAB 1YPZF 2G9HB 3ZKMC 4UT6H 4PRID 3DUUA 5MP6L 1A3RH 4KVNL 3EJYC 4Z0XA 1TCRB 1EO8H 4N68A 1R0AH 2BHYA 5D2LE 3MRGB 3GJFK 4NNYB 3VXQB 4KJPD 3ZE1F 1FO0L 1RQ5A 5KVMC 5HY9B 2LU4A 5EOQL 5FKPA 2LFGA 4KQ4L 1MRDL 4N5ED 3BYTA 4HKZA 5I17B 2W9DH 2YUXA 2QHRL 5I9QC 4F7MA 2WP3O 4GXVL 2OL3H 3K3QA 1JFQL 5JDJA 2FHCA 1INQA 3D25B 5D96B 5D2NE 5FYKE 5C0CB 4L8SB 4W6YB 3TIEA 5C0IA 5F6IC 3P30H 4PV8A 5ADPH 2NNAB 5AZ2H 3VXOA 3EYQC 4GAGL 4TSBH 3BD4A 5ELIA 2AGJL 4I3RL 3SKJL 4NGHL 5DMKB 4K71C 2JCCF 3WXVL 4DOHE 1CXFA 3WFDL 1XGYL 2ZG1A 3SJVE 1X5ZA 3QHZL 4WO4D 1ZT7B 2Y7QB 3L5JA 1BIIA 4UIKH 4OF0A 1A7NH 4JPKL 1JMXA 3T0BA 4M8QA 3HE6A 2VH5L 4OGYH 4O5LH 1LP9A 3OXSB 2QQNH 1I75A 2PXYA 2CSPA 4YC2C 4WCYL 3MYZA 2FL5B 3TNNB 1T1XA 3BW9B 1IC4L 1U91B 4L5FL 1WV7T 2MSPA 2XWTA 3QAZC 4I3SL 1Y18A 2F58L 2XXCB 5D7JB 3TA3D 1RUAH 5JXEC 1FO0B 4FZ8L 2I5YH 4YFLI 1L9NA 2X89D 5D1ZA 3B2UD 5IBUB 3SDXA 4IRSC 5EIIA 5F7LB 2PTTA 3BKYH 3KPTA 3ZTJH 3KYOB 1BFTA 3MRKA 5JORA 4NBYB 1AGEA 3LRHA 4WI7A 5C09D 3KHOA 2P5ED 2ZUWA 3K4DA 2M1KA 5FDWA 2PKDA 3K2UL 3Q5YA 4F37F 5IWLA 4PJFF 4K7FB 3QIBB 2VUYA 3CDFA 5D5MF 4B50A 1AD9A 4LCCB 1KN2L 2MFNA 3MBXL 2ADIA 5L8LB 4JRWA 1A14L 2H8PB 5DTFB 3RWFB 1HHIA 3KPQB 4QRUA 4R3SA 5E5UB 4O4YL 5MEND 2QADC 4NRYB 5C08E 2VLLB 4RWYH 1ND0A 4P2RD 4OD2B 1T0PB 4BFBD 2A1WH 2QSQA 4IRJC 3VH8A 2E9JA 1CT8B 4AL8L 1A8JH 3HMWH 3AXLA 1Q94B 3QDJE 2B20A 4JR9L 5T5NF 5JW5B 3TYFA 2Z4QB 1Q1JH 3MPCA 2BK8A 3HC0B 3CNKA 3HPLA 3O11B 4R9HA 4XRCA 1CGWA 3VWJA 1ACZA 3ZTNH 1F8TH 4R96B 1RHHA 4WY7L 5F7FA 2EXYD 3BUYA 4R4BB 4FXGA 3JWDL 1OB1A 3DI3B 1SEBA 4RGOL 3ARDA 2DQCH 1M7XA 3QUXD 4Q0XH 2EYTB 2F74A 5CP7B 5D2NC 3MBEB 1F90L 5H94B 4M43H 3TC9A 4BZ2H 3MUHL 1RI8A 3U6RA 4GUPB 3DO7B 3NCJL 3DRQB 4LGSB 1EVTC 2ICWJ 2R1WA 5GJSL 1F4AA 2GFBB 1U93B 3FL7A 3UTQA 2XFXB 2ORBH 3RI5K 4MNQE 2DM3A 4HZLA 4OI8A 4E9LA 5FUOL 25C8L 1XR8A 3C09C 4MLIA 4OD3H 4TUOB 5IR1A 4PBXA 4BSWA 4YXLH 4FXKA 4UTBH 1SBSL 4YDJA 1IKNA 4X83A 2FWOB 3UP1A 1D5XB 5HI3C 4HT1L 5I71C 3TCLB 3BT2H 3QH3B 4XMLL 3UJIH 3MMEB 5DVOA 1L7IH 3ULVC 4UUJB 1MHCA 4GKSB 5ILTL 5E70A 1OAKL 4LCWA 2DQGH 3MRJB 4JFXB 3I9GH 4LRNL 4QOKB 3TZVA 2ADJB 4LASH 3VGEA 5KSVB 3O9WA 2FIRT 5D1XC 3ROOB 5ADOL 5ICZB 2EDFA 4XWOC 1O7SA 4Y4FA 3T04D 4JM2D 3LKOB 1YN7B 4L1DA 5D6DC 3MRRB 4NM4L 3L5HA 4M7ZB 5IG7B 3PHOB 1BVZA 1QRNA 1QNZH 3BE1H 1LP9E 3QEHA 5GRVL 3VH8G 4OCSL 5E5MA 4ZDHB 1CL7H 1VACB 4JDVA 1N4XH 1P69B 1NPUA 5CGYD 4OIIL 3FB5B 4K9EC 4O02H 3L3KB 5KS9B 1OAQL 3MNVA 2IWGA 3S34L 4RMQA 5DURD 4WFEE 4U1GC 4BQBA 2AEWA 3KPSA 4JZNA 5EU3A 5JW4R 2EDWA 2GI7A 1VKXA 4NDMB 3O2DA 3SDXE 2PNDA 3G6JB 3WS6A 5I74B 1G84A 3ARBA 4YDVA 3I2CH 3RDTC 3OAUL 3CDGA 5AWNL 1YY8B 3VFOA 1E6JL 3KLAB 4PLKC 3T0EC 3T77B 5GZNC 2HN7A 4V1DA 1TZGH 1VADA 5I16B 1JN6A 1T66D 2CK0L 2OZ4L 5IW3A 3TBSA 4KU1A 3E8UL 4M1DL 5IFHL 3LY6A 4KUCF 3AS3A 4FQCH 4L9DA 2PCPB 3S96B 3DWTA 5EZLA 1A6WL 4NKDA 2AK4D 1FIGH 1QFWH 3SGKC 1WAAA 4PG9B 2A73A 3RKDC 1GZPA 3CXDH 1MJUH 4K94L 3D87B 5EULV 1U3HA 1I8LA 4KMQA 3MOAL 2BJMH 1Y0LB 1NBYB 4Y4KD 3N85H 5GGSB 3V52L 1YEGL 2IANA 2MNUA 1XZ0B 1P1ZA 2ZOLA 5D7LE 3FFCA 4S1DD 3QDGE 1CE6B 3FKUS 4ZSOE 3ZL4L 1KXTB 3QI9D 5L2KD 2D7MA 2AV1B 4JO3H 4Z7WB 3QNZA 1R3KA 3RBSA 3V8CA 3VW3H 4HKBB 1HXMA 3WV0A 5FGCE 3VWKA 2OK0L 3C8KB 4OLUL 1WZMA 4DVBB 1H3XA 4YBQD 3BPLB 3R1GH 4OZIF 4LPYA 2DMKA 1I9RH 3EOAB 4UI2A 3GKWL 5I0DA 4QTIH 1BF8A 2B1HL 2VLJA 3T8XB 4X6CA 4MCZA 4ZOBA 3PWNA 4NQDB 2R9HD 1PEWA 5E8DH 5D2LB 2BY0A 4XCFL 3C08L 1GSMA 1XF3A 5DRWB 3EGSB 2QSCL 4WEMB 4NQXB 4NJAL 3VXPA 3SDDB 1N2RB 2GKIA 3SQOH 1URLA 1UM4L 1I3VA 3UAJD 2FECI 4K3EL 4BYHA 3OKNA 4WU7B 3HE6C 3QXWA 4ZS7L 2IBGA 1NFDE 2E8YA 2PXYC 3KDMA 4QNPF 5E08L 1CK0H 5A2LH 5MHSE 1NGYA 2DI8A 2W38A 3NCFB 5BOZG 5EU4A 3NCCB 3V4VH 1BFVL 4DOHB 3RJDA 1RJYB 3S37L 1XF2B 1G0XA 3D1MC 3SJVB 4DVRL 3ELAT 2WWMC 1MH5A 1HQ4A 4KK8D 4QHUA 1J10A 4OLEA 5D1ZC 3QDAA 4HULB 2IF7A 1JGLH 5IJVA 3HMXA 4OZFA 4UV4L 1D9KD 1IGFL 1AGBB 1LMKA 5I1GH 3BRGC 1OGAA 4UV7H 1KG0B 2CXGA 3O0RL 4Z8FH 1ERNA 4GRMA 5IWLC 35C8L 4Z7OE 1W72L 4G6AC 1HHJA 5BZDB 5FDYA 4C58B 1VERA 2DYPD 1NL0L 1K4CA 4QRTA 2DQTL 2VDPH 1AI1L 3VD3A 5A3ID 3QCTH 3LV3B 1OSPH 4KK6D 4P5KA 2A0LD 3QIUB 2HFGH 2BCKB 3MJ8B 3O3EA 4UDUB 1OAXL 5FK9A 1G7QA 4P5MA 3RTQB 1EFXD 3KPSE 1NEUA 1NKRA 5ITFB 3DBXB 3MRIA 5T1MB 1A64A 1OQOA 4JKPL 2VSDA 2O61B 5I76A 3E6HB 3EO0B 5DD3L 3NZ8B 5HYJE 2CLVA 1M05A 2BVPB 4HAGA 4XWGL 4OBSA 4KHXL 5FYKH 4Z5RA 4XZUB 1G7LA 1UXWB 1MFBL 1SM3H 4BELD 5I75C 2X40A 1VFAB 4V1DE 2X05A 4YGAB 4NCC2 5E0QA 1JF1A 4GKZA 1BBJB 1EFQA 1I85A 4FFYL 5C08B 4OB5L 2XKSA 2OMBA 1NJ9B 3ARDC 4PJ8B 1VFMA 4L9LB 2EKSB 4ONFL 5K59E 4NQEE 1FVDB 2YC1A 3OKMB 3SN6N 3FMGH 3UBXI 5GS2D 4L29B 4LLQB 1U8HA 2NY0D 1P2CA 1XGTA 1P7QD 3IAGC 3LN4A 4HIHB 1LK2A 4OKVB 1PX4A 3K2MC 2MPAH 3HZVA 1D5BB 1JTOA 1S5HA 1R3HB 1M4KA 3GSXB 4RBPH 1WSST 4NKIL 2FBOJ 2IQAA 4PGZA 4KV5F 5DI8A 2ZSVA 3HPJA 4X0KA 1RUPH 1D5MA 3A67L 2CRMA 1F3DH 3K0WA 3C60B 2C4XA 1CN4A 2QKIB 3P4OB 4Z6AT 5CZVH 5BRZD 4HIIA 2DLIA 1IKNC 3QXAA 3MOQA 1AE6L 2B1AL 4I77L 3ARGB 1UJTA 2Z93A 4P2QA 3DYPA 4HCRL 1RUMH 2APXA 4HUUA 5BO1H 4KJQD 4OZFG 1GGCH 2FD6H 5D72H 5GGQH 2VLJE 1G9NL 1FVCB 3S5LA 4MNQB 4YE4H 2XRAH 3AAZA 4JB9L 3TZVC 4ZUSA 4IJ3C 4ZG1A 3ZDXF 1PG7L 4OT1H 5E00A 5JOPD 4MJ2A 4ZUWB 3O9WC 2IH1B 4NJ9L 4ZTPH 3M1BA 4P5TB 5L8KB 1A6AA 4Q9QH 5CWSA 5JOEA 4Y4FC 3F58H 5F1SA 1IRAY 5KANI 4O2FA 1F45A 4YH6A 2H32B 1UXSA 5I1DB 3UXFA 1S7SA 2VXQL 3W82A 5IMKA 3PL6A 4HK0A 3S3SA 5K9OB 5BQ7B 4XTRC 3X3FH 1FORH 2GJ6D 4KJYA 1AKJD 1ES0A 2XTLA 3W9EB 1P84J 3IETA 5E94B 4X5WB 1NGZA 1AGCB 5C0NC 1T22A 4LSVH 4NZTL 1CLOL 3DSFH 3G5YB 1BGXH 2ID5A 2BXZA 3NOIA 5DRZA 2Q6WA 1M6OA 4HFUL 1CQYA 5BV7L 3ARBC 3E2HB 2Z31D 1LO2H 5GGTL 3ILPA 3VXME 3GBNL 3Q5TA 3O8XA 4CN4A 1D5ZB 4ELKA 4K8RH 2A6IB 3O6KH 4MJID 3T3PF 4TPRH 4NCDA 5DJXB 2G60H 4PJDA 2WWKT 3BVNB 3NN8A 3HS0B 2HJLA 2FYYA 2DQHH 4M7LL 5B38G 2BVTA 1Q9LB 2FB4L 1IE5A 1UM5L 3CLFL 4UILH 3HRZA 3F8UB 3BJLA 4AENA 4DGIL 3VXTA 5FF6B 5E8NB 2EDRA 2WZPD 1T03H 3BEVB 4NN5B 5JIHA 4N9GB 4Y5XA 3V0VA 4AIXA 3RY4A 1SVCP 2EE9A 3L3IB 3MCKB 2CMRL 3IDXL 3G9VA 1U3HC 2G5BA 2WQ8A 3GRWL 1EEZA 1I8LC 2HFTA 5J3HC 1AJ7H 1T5WA 3U48A 4HG4J 1XGUB 3IRZA 2MHAA 1HWHB 3O6FA 1TPXB 1PLGL 5ANME 2AABL 1WFOA 1S78C 2NXZB 2Q76A 1T1ZA 3FN9A 2AQ1A 3MCLL 2KZ1B 4OJFL 4U1IB 3HG1B 1H3TA 3G6JF 4EOWL 3ULUD 3NIGE 4AMKH 3S5LG 3VWKC 5C6TL 5IKCB 2XQYG 4KKLC 5DA4A 1FIEA 4R7DB 2ED9A 1C12A 2CIKB 4FABH 1B6DA 5D7LB 4MZ3A 1LE5A 2JELH 1QVOA 1SYSA 3QDGB 3O2WL 3O3BB 4ZSOB 3ZT6A 1U3JA 1RZ8B 4HIEA 1NGPH 4M6OL 4KRLB 3V6BR 1K8DA 2FEDD 3V6FA 4EDWL 1CFVH 5IVXF 2V2WA 1AO7A 3EFFB 3NFSH 4RX4D 3VRIB 3V7MA 4PJHE 3IFLH 5JQHC 3HAEG 5FGCB 3GK8H 4X6BA 2VXSL 2BNUB 4LP4A 3WN5B 4JN1L 2HLFC 2PW2B 3J8F7 2ITCB 4XVSL 2NZ9C 2NY4C 1N6VA 3MODL 1YQVH 1I4FA 1X4YA 5F3BA 4L3EB 1MJ8L 2FZ3B 4XGZA 1YNLH 4YR6A 4U1MB 4NUGH 3WCYA 3O2VL 5DD5H 1BLNB 4I0PD 5IQ7H 4MMZC 1QSED 4UT7L 1ZLSH 4LEXL 1NAKH 3BEWA 1QTYT 4AG4L 1DUYA 1RK0B 4P2QE 4D94A 3QRGH 3IDIB 5CUSH 4Z7WF 3VFUA 4HJGA 2YUWA 5LBSL 4PJ7E 1TFHA 5JMRA 3C5ZB 3CSYA 3HE7A 5CZXD 5L0QB 1EAJA 4R0LB 3ALXA 1ZTXH 1KUMA 1NFDB 1VGEL 1CDJA 3MNZB 3O6LL 4KZEL 3F6LA 1NCAL 2V9QA 1FYTD 4KDVA 4C59B 1XF4B 5E7FA 5CBAA 3T09A 5D2LF 2Z8VC 3ZMRA 3OQ3B 4JEGB 1RMFL 2WUCH 4DWHA 3HNTL 3OKDA 5KVDL 1IAMA 2Y36H 4YWGH 1A9EB 3WS3A 4EIGB 2A6KA 1WC7B 4U1NA 1T21A 3DPBA 3NIFE 3NTCH 2EEBA 3RWHA 5ERWA 2J2ZA 3WKMH 3SDAB 4G8FB 1EBPA 5EUOB 4JQVC 3I6KA 3UYRH 2B4CH 1BZ9A 3LKQA 3VXSB 3LQMA 3TH2T 5F8RC 3V2AR 2NTSP 2X4SB 4XB7A 2J1KA 3ES6A 1MHHB 3U2SB 1VA9A 4PJDE 2IBZY 2D7TH 4ODWB 1XF5B 2ZCKL 2VJXA 2AJUH 2RFXB 2XA3A 4F8QA 4D9RD 5LQBH 1CFBA 3TPKA 4YFEA 1NANI 5HYJB 4BFIA 3MLRH 4EXPX 1K3ZA 1N0XH 1MFAH 1UADC 1A21A 4NC2B 5F96H 1I1AB 5EUKB 3FOLB 3ZLQC 4PJ9C 3QCUH 5I30H 1BWMA 1VFOA 3LRSA 5DHVB 2V17H 3DROA 7FABH 1YECL 2HG5B 5MEQA 3ZKQD 5KG9A 1Z2KA 4NQEB 4BKLB 4OLWL 3QUYB 1T83A 1KPVA 3W0WA 1YEDA 5KZCD 3REWA 4JN2A 2D9CA 2HTKC 1KENL 4HEPG 5ESVB 1S9WA 1NCBL 3P4MB 5FB8A 5JA9A 1BMGA 1ZLUK 3U4AA 1IJ9A 4YHKH 1IAKA 1AXTH 1B2WH 1TJGH 4PRAA 3VFNA 4HQQH 3RNQB 2AJZA 2ICWI 4HWBA 4HS8H 2I60L 2BFVL 3T2QA 4XBGB 3MRHB 1I7TB 4M6NH 1FBIH 1BM3L 3FT4A 4DKAA 4OV5B 5DO2D 4PB0H 3CU1A 3SGEI 1OY3B 3V7AG 2B2XH 3QJFA 1JZ7A 1BD2A 3PP4L 4P23B 3JUZA 5E5RB 5EBMB 3JWOL 1KCSH 3GHEL 1A7BA 4F3FA 3RGVB 3RWEB 3JTTA 4NQVA 4CVZA 5CIPB 1A9BA 2EDYA 3PL6C 2DM7A 4QHLA 2FX8L 2V2XA 2QQKL 3LKNA 4YX2L 1SY6H 1U36A 2VZ3A 2VQUA 3UBXG 4WTWA 4Z0BL 1KN4L 5I8OL 2BNQA 4LLWA 4NO3A 1INEL 3VE0A 2XA8H 4JRXA 4B5EA 4WJ5A 1FLRH 2A9MH 3OJDB 1DP0A 1REIA 4UQ2B 5I66A 5DHVH 1AFVL 3QR2A 1EXUA 3IDJB 3MV9E 4LAQL 3G04B 3C6SA 2JE8A 1LEKA 1UWGH 4IS6A 4YQXH 2D31A 5ICYB 3LRGA 2N4IA 3O8XC 2DF3A 1IC7L 4HSQA 4HH8A 1YUHA 2RB8A 4G6FB 5I1HL 1G7MA 3LS4L 3O3DB 3MRDB 2IFFH 2FNBA 3V0WH 4OSUH 2CGRL 1J05A 4K7PX 3CSGA 5D71L 1FNHA 4YIQB 4HUXB 1JNLH 1GGIH 1M7DB 4HS6A 4HD9A 4OFYD 4Y5XC 2BDNL 3VXMB 1Z6JT 4P46A 3TYGL 5IEHA 1ZANL 1S9VB 2PR4H 1BOYA 4CU6A 1EVUA 3MV7B 4MA1C 4ZQKB 4NWTL 1JNJA 4S1RH 2DTML 1LE9B 3LMJL 2CDGB 3FO1A 3O6FC 1ZHNA 3BHBB 1U8OB 2IG2L 5IB1A 1IM3B 2F8OA 4NPYA 3I6LE 3BKCL 3GNML 4YNYB 5FUZH 5IVOA 5HHME 4ONGH 4P4KD 3B4NA 5KOVC 1S7VA 2X1OA 4MQ7B 2C7UA 3QWOA 5EG6C 5CFHA 3G5VA 2IALA 4OFVA 1QKZH 5FYLE 3RP1A 4K3JL 4OAWA 1FC2D 3D2UB 3CFBB 4HHAB 1BQSA 3SDXF 4XVUC 2L0DA 5EC2A 5SWSE 4D0CB 1MWAL 4MB5A 1KTKE 3SKMB 4J3OC 4WO4A 3WL9B 1A1MB 2WSKA 1I1YB 5EORH 1RY7B 1RIHH 1RIVH 1NCWL 4OQ1A 1G7PB 2BHZA 3EKCA 4U1SA 1CS6A 5F7NC 5JIKA 2BC4A 4XMKL 3MFGB 3GM0A 3CSPA 4K7PH 3HMXH 2I5YL 3DMMD 4CN6A 1BZQK 2P45B 3LZFH 1T7YA 2NY5H 2UWEB 3TN0D 4JFQB 2EDDA 1U95B 3DOSA 3TA3A 4H26B 3ULSB 4PJHB 3PV7A 4Y5VB 1NC2D 2ARWA 4LPXA 5DGQA 2X4RA 3K8MA 2X89A 1FZKB 3FCTA 4PS4H 4GRLB 2IADB 5D7IA 5TDOA 3KXFD 3HE7C 3KPLA 5FYJE 1IAIH 1UFUA 3MRLA 5C0RH 3BZEA 1F11B 3GFUA 4PB9L 3I50L 2X42A 2E6JA 2P5EA 3G5ZB 1SJHB 1RHFA 2DQUL 1FFOB 3BO8B 4JY5L 4QXGL 1ZK9A 5TE7H 3H0TB 5GXBB 1BX2A 5KSAB 3UTPD 4NRZA 4RWYL 1IL1A 4PJ7B 2V9TA 4IDJL 4CMHC 3NPZB 2FJGA 5MENA 4G8IB 1GCFA 2O5YH 4QRRD 5DYOA 3OKOA 3VXRD 4P2RA 4JFZL 2BNQE 4MNGA 3LIZH 1GHFL 4PY7B 1NMCC 1SYVB 5DA0B 2HWZL 3K4AA 1ZHLB 3U0TA 2HVJB 4LP5A 1FCGA 5DJZA 3CC5B 3H9HB 5TGBA 5E8OB 5JPMA 4JVPA 4YEFA 4GRWE 4TSAL 1II4E 2FDBP 1PDKA 1RZKC 3L5XH 5GS0H 2LU3A 4YDKH 1DBAL 4HC1A 4E5XB 1IGML 3QUXA 3WE6B 3MLZL 1NFDF 4UOJA 4BZ2L 3LKRA 4QY8A 1FFQA 2R2BB 4LVOC 2FO4A 4RGND 5E2UH 4FMKA 1EA9C 1F6AB 5IHLB 4JZJB 4DGVL 3REVB 2R8SL 3MLSH 3H42H 4J3UA 1SJEA 4G6KH 1YYLL 1J87A 3ZKNC 4BM7A 1R5WB 1UCBL 1FNEB 1JNHB 4U6HB 4C4KT 4NUJA 3U9PL 1WT5A 3LEXB 4PV9B 4XNMB 4XCEB 4CW1B 1EUTA 2HT4D 1JZ6A 1DR9A 3M8OH 5BVPL 3IF1A 1WCBB 5BXFA 1T83C 2WLYA 5EUOF 5JR1H 2E7BA 4UTAH 2IMNA 2FATL 4M5ZL 5TPWL 3ZSSA 3P4NA 1WBZB 4Y16D 1T0NB 1I3GH 5DEFA 3LPWA 2DS4A 5J13B 3BGMB 5D1QD 5T3ZL 5I1KL 5F1KC 5IEKB 4XPFL 2FJHA 3O41B 3RPIB 1FL5A 5L2JB 3H9SB 4WNQA 5K33A 1FHGA 3ZO0A 3CVHL 1OAUH 4G8EA 4M48L 4YHIB 3GHBL 4X99B 1OP5H 3IS0X 2AAVA 1U8QA 1V7NL 4HKJB 5GISH 4ERSH 5EU5B 5IIEA 4QCIA 2E9IA 3AB0C 4JM2A 5EU6A 4U1LA 3JTSB 1P4IL 5T3XE 2P5WB 3KWWA 2P24B 3L95B 2QHLA 3OR7B 1N4XL 4Y4HB 1RV6X 5C0BE 4JFPB 1LD9A 3HC3L 4ZPTB 3NCEB 4R90L 2AXGA 4HX1B 2NY3D 4EDXB 4Y88A 3HZMB 1E0OB 3QG7H 4KUCD 4JPWH 5I1AA 2AEIT 4EI5B 3PWJB 1K5NB 2VLRB 5K59F 3D39A 2APBA 4MDIA 3QEQE 1IGCL 3MXWL 4PJGB 3BWUC 5F7DA 3CDYA 2NY1B 3OPZL 2A74A 3SKNA 3BSZL 2GTZB 5DS8B 1CICB 1S9XB 4MVBC 2Y6SD 3BGAA 1KLGB 3QZWB 3QQ3B 2J8UE 5DQDL 3RVWC 3QQ9D 3G5XB 4O51A 3B6SB 1PZ5A 3T0WA 4R97B 5EC1B 3WIFB 2BRQA 4RMSA 1ITCA 2JTDA 1N0LA 4UB0L 2DQJH 4TSCL 1O0VA 1U8MA 2MOVA 4POYA 5JPNA 4NM8H 1C16B 4X9HA 3L5IA 5DEGB 2F54E 5FKAB 1H3VA 3MLWL 4R2GD 3MV9B 2NYYC 2AK4A 1CFTA 1MNUH 4WHDA 5KVFH 5ETUB 3GSQA 1IGIH 1DBBL 4KDWA 2X4OB 3KYNB 4J3TA 4P46C 2W1NA 3EDFA 2XQYK 3ABZA 4Y4KA 4G43A 3PGDB 5HJ3B 1DDHB 2KH2B 1RZJH 4LCUA 4BH8B 2XI9A 1A4KA 4UOW0 3AMLA 3C9NB 4CADB 4JO3L 3NCYP 4YHYC 5IT2H 4G6ML 1J8KA 3MLVL 4I0KA 2V6HA 2VDLL 4UZGA 2F53B 3HCVB 3LKPA 1NDMA 3QI9A 4KJPC 5I73B 4KAQH 4Z95H 5L2KA 1MLCA 2EKJA 2Y06L 1FDLL 1AXSB 2GW5A 4N5EC 4KQ3L 5I15H 4PYGA 3QQ4B 4KKBD 5I2IB 4NOBA 2VR9A 1OARH 2X4UB 5E4EB 1FFRA 3EJJX 1EEYA 1OAYL 3B9VA 3STLB 3IXAA 2AW2A 4NZRH 5C0AB 5M94B 2YN3A 2J3SA 3GSWA 4PP1D 4WUKH 4F15C 3MR9B 2VABB 3LH2L 4KZDL 4M3JA 3BQUB 2R0WH 5SV4A 3V6ZA 2APTA 1D3CA 1HN1A 3GGWB 1F4WL 1KLUA 4LLYA 1HSAA 2GSGA 2VAAB 4G5ZH 5HYQB 2DQDH 4PRNA 5C0CD 1T6VN 1EERB 4WO4C 4G3YL 4GQ9L 1KPUA 4MQXD 3U7AA 4LSQH 3HTLX 3V4VL 3GO1L 5KSUA 4NYLB 1NCNA 4KTYA 4LSUL 4D2NA 1ZT4B 1JGLL 5SWSB 1Q9WB 4MNHB 4K71B 1RAMA 3TA3C 5JDSA 3FOMA 1KXVC 4F2MA 4ODBD 3W39B 3NCYS 1UGNA 1XCTA 4O2CB 5J1AA 1B3JA 1KNOB 3MV11 3S3JA 4Z8FL 1JWUA 4QF1B 5TH2A 3X3GL 1R5VA 5TQ0H 1F6FB 1KELL 5L7XH 5DUML 1D9KA 1JHTB 3QUML 4HKXB 1CDHA 3WUWA 4KWUA 5C70A 3U30C 2KKQA 3X14A 3D0VA 2XZQL 3KYAA 4YC2B 5D7JD 5EU6E 4J7RA 5J56B 2BVQA 3C5SA 2V2TA 1D7FA 3OKEA 3Q1SH 4JO1L 2DYPA 4LFHD 3R8QA 1KTDA 3NIGF 4NSKB 4C56D 3S7GA 3VXUE 4IRSB 3D39E 3P0YH 3DUHA 1MELA 5JNYB 1CG9A 1T20B 3RA7L 5J9PB 1EFXA 4NOFA 1HSBA 5FYKL 1UWEH 4NHUA 1BQUA 1HI6B 4WW1B 3M17B 5LAXB 1JWSA 2IGFL 2UWEF 2ZG3A 1QLRB 2ZCHL 1ADQL 3OR6B 5K9QG 3MRCB 2C1OA 1NMBL 5HGHA 1ORSB 4PJHF 1LEIA 4YUEH 1JBJA 5FYLH 4ZO9A 1BBDH 2EXYC 3WEXB 4D9LL 1LVEA 2WIMA 5MERB 4HWEL 4PD4J 3VDCA 2QADB 2AK1L 2EH8L 2VE6A 1FG2A 1Q72H 3V5HA 4FQIH 5A1AA 2BZDA 1RZGB 3RWGB 3QUXC 3KS0J 2VLKA 3MACH 1N64L 3TBYB 2YXFA 4G80A 2OSLB 4QHNA 5I8KL 4XH2B 3KYKL 4MJ5B 1DVFD 4U6VH 5F89B 4X6EB 3E3QE 4XCNA 1DANT 1P7QA 1KBGH 4PJ7F 1XGQB 1HWGB 3ZYJA 1RUPL 1PYWA 1BJ8A 1DFBH 5CJXC 2E5EA 4KVCH 1H8OA 2DWEB 1ZGLP 2O5ZH 3CMGA 3T1FA 2VXUL 1WT5C 4YHMH 4N90D 1QD0A 4PJEB 1U8LB 4WW2A 5L2KE 4GFTB 2SEBB 5GGRB 1E27B 4G9FE 4YHOL 4DAGH 1FC1A 1G9MC 3BP7B 1HHGB 4I0CC 5ENWA 5FYJH 5D72L 3B83A 1L6XA 5BRZA 3UTZA 1VSCA 1AP2A 4NQCA 4F7CB 1JF5A 2EDBA 1CXHA 1TLKA 2PF6A 5DUBB 4OT1L 3QULB 2GTWA 5IM7B 1AC0A 1T7ZA 4DGYL 4K9EL 3WUWG 4GBXA 5D7KD 3NIFF 2F15A 3AUVA 4JG0L 2Z35B 3MSPA 1NBZB 4LLDA 4ODHH 3C09B 5TDPB 3P9MA 4AEFA 3OXRB 1EX0A 5EZOH 4KROC 5H37H 4JM2C 1F58L 4KTEL 3IDGA 2P43B 1FZOA 4XPAL 4FQ2H 4AEEA 3B8YA 3BN3B 1JZ5A 4QOKD 5ACZB 1PX3A 1I8MB 3AS2A 1BFSA 3Q5OA 3SO3B 4ZAKB 1MPAH 1V7MH 3PQYA 2IMMA 1Z3GL 2GJ6A 3MOBL 1AKJA 1JYVA 4NC1C 1ZV5A 5F9JA 5CGYC 1X9QA 4W4OA 4GRWH 3PABB 4OF7A 4YZFE 5D1XB 2VO5A 4X8JA 1AQKH 5E2TH 2EE6A 4U1KA 2XTJE 1CBVH 4X4YA 1JWMB 1KCUH 3UDWA 3QFJD 4CKVX 1NUNB 2EDOA 4Q6YA 3WNKA 2Y1VA 2KL6A 1P9MA 1MVUA 2Z31A 2C5DC 3IFPA 5J11C 3RAJH 4KXZI 3Q2CA 3CFDA 4FQHA 3UPRB 5FA4A 1HEZA 4MJIA 4QTHB 5IHBA 1DSFL 2DBJA 2X1XR 4HAFA 1T66C 5ALBH 1NSNL 4I2XE 4JKMA 3HN3A 3V5DA 1DEEB 3RWCA 1T03L 1MAML 2VDNH 3NA9H 4PJCE 3I3DA 4N9OB 4NQTA 5HYSB 5HDQL 2YK1L 3BP6B 2GUOB 2J8UB 5C3LD 1S7WA 1V5JA 3MV8E 5A40E 1I7ZA 1K8IB 3RDTB 5IHUL 1R5IA 3BMVA 3C2AL 1EGJH 1NGXA 5DEZA 3P3YA 4FFZH 2IPUG 5BOPA 4Y4KC 3DNKA 3NGBC 4JFFB 1ZWIB 4NRXB 3WD5H 4KRNA 4Y8DC 5I1JL 3C6LB 3LN9A 2E3VA 5DD6A 5EIQA 3QEGH 4S1DC 2F54B 5F44A 4OM1H 4NNPL 1U8IA 4OV6F 4QWWD 4I3GA 4MD5A 4KK5D 4TUJA 4XNUH 4Y2DB 3VFMB 2AJSL 5IF0B 4OGAD 3QI9C 5K9KB 5HHOE 2OQJB 2VUOA 3T08A 2CLZA 4E41E 1U6AH 2AKRA 3X13B 3BH8A 1A6TB 2X4NB 3C8HA 1FGNH 2W59A 3CIQA 4MB4A 5I19L 2V7NA 4YBQC 3S4SA 2VLKE 1FNLA 1T0MA 5T3XH 1CFVL 5CD3A 1FN4A 4NO0B 1Q0YL 3UC0L 1LWRA 4U0QB 3DYOA 4JO2L 3WHE0 1EEUA 3GK8L 2R9HC 1U8NB 2IPKA 3FRPA 4RX4A 5FKPB 4YPGB 1KFAH 3SE9L 1CDBA 3L1OL 3UAJC 2MCPL 3QRGL 1KIPA 2C1PB 43CAA 4DZBA 2FX7L 4XC3L 3IKCB 3IDYB 4I0PA 4NQCE 3VXOB 3W5MA 2R4RL 5CHNB 1ZLVH 1TVBA 1WIOA 1QOKA 5HGAA 4XVJL 5FYKD 1N8ZB 2COQA 4KK8C 4JHBA 2D03H 3HR6A 2K1MA 1CI5A 3RWDA 5DK2B 1K6QH 4QGTA 1JV5A 3PNWB 3V4PH 3PJSA 1D9KC 4XP9L 4WGVB 4G9DB 1DQJA 4NBXB 4LBEA 4PTUB 1DCLA 2KPNA 5DQ9A 2WINA 3SJVD 1NC4B 2OR9H 3RIAF 3KVQA 1OSZB 4OF6A 1OT2A 2VC2L 1EHLL 3OL2A 3CFEA 1DQDH 4PJIE 5F9OL 1MUJA 3BD5A 5A3IC 3PQYE 4KK6C 1MRCH 1TETH 3F65A 2A0LC 4YFDB 4N8VA 3RIFK 5J06A 3FRUA 2BSED 5HVHC 2D9QB 3O4OC 4CDGC 3QSKB 4ZOAA 4F57L 1HOCA 1VHPA 1I1FA 1UA6H 2FHBA 3RL2B 5IBTL 1T5XB 1JHKH 4M1GH 3QIUD 4NN7B 4L8BB 1AD9B 3FAXA 5KAQF 4J8RA 1B4RA 1MCPL 3A6BL 1UG9A 4MJIE 4GLRI 2E7LA 3RTQD 3S4SG 2H6PA 4MXWH 2FIKB 1KTLA 4RISH 4U0RB 4LSPL 4NP4L 4NFBA 3X11B 2JB5H 4E0RB 1JHLH 1NGQL 3FRPG 3T65A 3AXLB 5HGBB 3FO9B 4DK3A 3T2NL 2YD8A 1QR1A 1PD6A 1UQSA 5JUEH 2NY0C 3MRFA 4PRBB 3GBMH 2QTEA 5C08D 4GG8A 3L3OB 4JFEE 4FOMA 5I75B 1RHHB 4MD0A 1H3WM 5IQ9A 4L8CB 3IVKA 3ETBF 1CGTA 3QDJD 3IFNH 4LSRL 1RFDL 1OB1B 2A9NH 4KC3B 4DK6A 5GRUH 5GJTL 2H26B 4RIRB 4XXCA 1JIBA 1TZHA 2VL5A 3MGOA 5LGHL 3FT3B 1ZGLM 2AERT 3ARFB 4WW2C 5E95B 2Q1EA 2F74B 4PGCB 1CFNA 3GSNA 4Z7VE 3L3GA 1ORQB 1JP5A 3ZDYE 1B2WL 2HLAA 4XNYH 4Q2ZA 1OQXA 4F7TB 4OLYL 1AY1H 5CINH 2HKHH 5CZKA 2W9LA 4D0DA 5EPMA 1PKQE 5GGSY 5EOCL 2VDRL 1EH9A 4K8RD 4OF8A 1V3LA 3H3BC 4RFEA 1YEIH 1HXYB 2OYPA 4X7SL 3ZKXC 4ELME 4HF5L 1F4XL 1YC8A 4QHMB 3U0PA 5D6CB 4G9FB 2G75A 1GGBH 1ZVYA 2P7TB 3S88L 1XR8B 3O2DL 1KCSL 2BSSB 4FXKB 4YDJB 5FCUL 1NKOA 3WO4C 2F5AH 4GRWF 4N8VG 1OOAA 4MNQD 3MA9L 1I1CA 2R0KH 4GMTH 3BDYH 1MY5A 3NA4A 1MFNA 1H9VA 2E8ZA 3L3JA 2HJKB 1U92B 3BPOC 3TCXA 1S7QA 1XFPA 4FXLA 2FJFA 5GIRB 3FAWA 4NO5A 2F5BH 1UYWL 5CMAA 5FHBL 4N0CD 4HXBH 3P9LA 2FGZA 1WEJH 4GH7B 1PW3A 4KRPB 1YPZA 4AIZA 2ZPKL 5KW9L 3UDWC 5DRNB 3RU8H 4YHNB 3PGCA 1MHPL 4DKDC 4QYOB 2Z31C 2W65A 1Y6NR 4ORGB 3V0WL 1S5IL 4OSUL 1MCQA 3P0GB 4HUNB 2UV3A 4RQQB 2GYSA 4JRYB 2GJJA 3MTRA 1E4WL 1IAOA 4O58L 4L4TA 4P3CH 5GS1A 4MWFB 3NH7H 1R24A 3MNVB 2NY6B 4KGJA 5CEZE 1G7JA 1N59A 2XTJB 2HFEB 1KIQA 1A7PL 5IK3B 1PZUB 3QUKA 1DLHB 3HI6L 3K7UA 5GSVB 3LKSB 4OCYL 4OFYA 3L7EB 1HKLL 4HK3J 1HCVA 2P1YA 2KBGA 3OB8A 5IFAL 1P7KA 2R1XB 3U7YH 3LPFA 3F12B 4WFED 4I2XB 2HN7B 3LSOA 5IVZA 5JZ7D 1JK8B 3MYJA 4JY6B 4KI5E 3TBSB 2JCCA 4GW1A 5HHXH 2W60A 1JPFB 1FJ1A 2HT2D 4AJ0A 5E1AB 3TWCL 3H9ZA 3V8OA 5L8JB 5EZLB 2ZKHH 3MV8B 3WLWD 1TJHH 1IQDB 3ULUC 4P4KA 3VFRA 1EHNA 2NR6D 5HDLA 4QXTB 2OP4H 3BZDA 2NY2B 4HLJA 3BMWA 5F1IA 1CGYA 1W0VB 1G6RB 2NXZD 4XHJD 1KJ2A 3E1F1 2VWEC 4Q6IA 4M7JL 5CEXB 2J6EH 4KJWD 3WSQH 1D6EB 3LEVH 1WZLA 1YYMH 2PETA 3AROA 4PR5A 1J0YA 3THML 3OSKA 4A6YB 3OJMB 2B0SL 2CKBA 2FEDC 4RA0C 2D0GA 5DJCA 2J8UF 5HHOB 4M5YH 3FZUD 3W2DL 4FQJH 1JL8A 4Z76A 3GMLA 5D7LD 4L3CB 3TT3H 3S35H 4AM0A 3O6ML 3QDGD 4JG1L 3IDNA 1ZAGA 3VWJD 3WHXA 4PJFA 4P9HC 4O9HH 1AIFA 5IW6A 3STZB 1OPGH 2MTPA 5D5MA 2RCSL 2ZUQB 2B5IC 4APQB 1HH9A 4OFDA 1U8JA 3EFDL 4PGEB 3DMMA 3MQIA 4MJ6B 3EYOB 4X6CB 4OD1H 3LN5B 1ZA6A 3TEUA 4I0PC 3WO3B 1YJDC 3TN0A 3VFPA 2JK5B 4ONHB 1IAIL 4GXUM 2EDHA 1NC2A 3B9KB 4AT6A 2AEPL 1M71A 2ADFH 3KXFA 3SE4C 1CLZL 5CZXC 1TDQA 4QRPE 1B0WA 2NY4B 3BZFA 1CGUA 3V9FA 4EXKA 1XIWB 2YSSA 3S97C 2X4PB 3CAFA 3CPLB 5EO1B 3C5ZD 1G6RH 1AQDA 1RJCA 3QPXL 1KC5L 1XCQA 1BQLH 5JHLL 1MIEL 3GZKA 4G7VH 5DHYA 3A6OA 3KPRE 5TDNA 1T1WA 4QRRA 1MREL 3VXRA 4A6YH 5MHSD 3HI5H 1NMAL 1GIGH 1T7WA 3HI1A 2EZ0D 3MRBA 4PGDA 5FM5O 1MIML 2Q7YB 4OUOA 5C9JB 43C9A 3DX9A 4IMLA 4KMLB 1NFKA 3HZYA 3JV5A 3PGFL 5L9DL 5HDBE 1QLEL 4PRHE 3MFFB 1HKFA 2K3TA 3GB7A 4FQ1L 4MA8L 3TZVD 4R8WH 3QP3A 1TTFA 2WMPA 4PJIB 4ZYKB 3BI9X 4QRTB 3U36B 3U7WH 3T0DA 2E7LC 4TVPE 4L4TE 2IBZX 3DRTA 2W0KA 4H88H 1NAMA 2XPGB 3BKML 4JJ5B 1RURL 3G6DL 1AD0B 4LARH 4YHLL 5EOCJ 3QEUB 1QBMH 3VXSD 4G6KL 4JFDB 3ZZ1A 4CMMA 1JGDA 1J0IA 3OHXB 1D5IL 4A2MA 3F5WA 1KTRL 2I07A 1NGWA 2H1PH 4PJBB 1WZ1H 3QXTA 4J1UA 3PF2A 1UZ8B 3KPSD 3OAZH 4PTTB 3PHQA 1DQQA 2ED7A 2R0ZH 1ACYL 1JF1B 5JR1L 4JHAH 3DIFA 2CXKA 5HYJD 2Z92A 4JCMA 3WFEL 2IC2A 2OTWA 2XIDA 4OIBA 4XXCC 5JIPA 1JTTA 3JBG7 1EEQA 3MJ9H 3CX2A 4CDHA 4Z78B 4X4ZA 1JZ3A 1I1AD 3WIHH 5LCVH 4JGMA 5H2BA 3KPOB 5B38B 5E7BA 3MJ6A 2PTVA 3DV6A 3HZKB 4IIQA 1PJ9A 4LHJB 4JFEB 1M7IA 2C3VA 4Y16A 2H9GA 4ODVH 1IEBA 4PGBB 4X4XB 1WJ3A 2XZZA 5T5NG 3LN4B 1HQRA 1W0WA 1S9YA 4M62H 3RVUD 3MLUH 1ZHKB 4XPGL 2EYSA 1ONQB 2YXMA 4NQED 4PJ9B 3QUYD 4KHTL 4MSWA 3VFVB 2XWJA 5CSZB 1MLBA 3BXNA 5LWYL 4X0KB 1U3HD 4EVNB 2CDFA 1MFEH 3HC4L 5EBWA 2YD2A 4JDTH 2AP2A 3PWPB 5GHWL 4Z7VB 4DZ8B 5DO2C 4RAVB 2WLZA 2DJSA 1FZMA 2R4SH 4YXHL 2RBLA 5IB5B 5IB3A 1KB5B 1MCOL 1MEXL 4NZDA 1LK3H 1PKQB 1A4JA 2YZ8A 1J8HE 1NFIA 1UJ3B 5JW4M 2DAVA 4LVNC 2V7HB 2XN9E 3FQRA 3UTSE 4DKEH 4HWZA 4ELMB 1D6VH 3TBTA 3D85B 4NFDA 4FP8L 1YEHL 3K46A 1CDYA 2HKFH 2IPTH 2FGWL 3TNMB 4F33B 1QP1A 4K2UH 1YEEH 5B22A 2VLJD 4ODTL 4G6JH 1OTTD 5FM5M 3UJTH 1LNUA 1TJIL 5CP3A 2IPUK 3ZYOA 5ISZB 2AJYH 3QHFL 5F7UA 2OL3A 3HAEB 3DVNA 1U42A 4KMTL 3FQUA 3DXAE 5DRXB 4HMDA 2HJFB 4JDZA 4M7KL 4ZFOB 2AV7A 5C0FA 4D3CL 2DLFH 5GS1C 4U3CA 1IGIL 5EU7C 2ARJQ 2AJ3B 3SGDH 3MRMA 3RY5A 4LLVA 5GRJH 1P4BH 4OZIA 1IQWH 3LD8C 5LVEA 4P99A 4G6FD 5J12B 1FNSH 1RZFL 2BVOA 1RUQH 2HVKA 5I6XB 4XNQB 3CLEL 1FL3A 1QFUH 2BHUA 4J4PD 2CDEB 4PBWD 3DX7A 4S0TD 1RZIA 4DN3H 1NBVH 2X4TA 1KB5H 3ORJA 3F7YA 2H2PD 4IRZL 2BNRE 1FGVH 4RCAA 4MDJB 3VXMD 2DICA 1TVDA 2G9HA 4Q97A 3J7HA 4G42B 3DUSB 3HNSH 3P11H 2YPKB 5E2WH 3TT1H 4P4KC 1T3FB 2J12B 3L7FA 3F7QA 3V0VB 5HHVH 1OP3H 2R1YB 3OKKA 4S1QL 3TBVB 1TCRA 1MFCL 4AH2B 5DD0H 3NABH 4MA1B 5ALCH 4LU5H 2GK0B 4HIXL 1YEKL 4NNYA 4TOYH 3VXQA 3RHWF 2MHAB 2FLRT 4Q6IC 3O6FB 4JPVL 3FB7B 4YZFF 5I17A 5J57B 1CU4L 3MGAA 5CGMA 5DD1H 3OKLB 4X9IA 2HRPL 3F7VA 4ZUTB 2Y72A 5DJDB 1C5BH 3D25A 3S3PA 3CFJB 5C0CA 4NHCL 1ZE3C 3JV4B 5BCAA 2NNAA 3WLBB 1WWBX 4B53A 2CRZA 4LPCA 3P4LA 3FFDB 3D2UD 1ZA3B 2LVCA 4D0BB 2DQFB 2CO6B 5DMKA 4PJCF 1A7OH 3DMMC 2J4WH 4KUZL 4P59H 1ZT7A 2Y7QA 8FABB 3TN0C 5ICXB 5D9SB 1BPVA 1MFDL 3V95A 1INDL 3K8LA 3EO1B 3OXSA 1QFPA 4LIQE 5CEZH 1YNTB 5GS0D 2FL5A 3TNNA 2AJXL 3BW9A 2RQ8A 4LVHB 3Q1SL 4MA7H 3Q6FB 4LPVA 2Q20A 4M9OA 3BH9B 3P77A 5D7JA 9CGTA 2E9BA 2GCYB 3OAYH 4L4VE 1L7TL 3FN3A 4NZUL 1PSKL 4GRLD 1KYOK 2CD0A 4H8WC 3KYOA 1VEMA 4C56A 4PUBH 1YA5A 1IC5L 2X1QA 4OZGB 2AEQL 4JPIA 1RVFH 2LQRA 4QT5A 5FGBA 3U4BH 5EFIB 4QRPB 4K7FA 4J23A 3QIBA 1BAFL 4OTXH 4P2QD 5FXCH 4EI6B 1XMWA 3BISA 5CSGA 4LCCA 2EDQA 4NZJA 5HHPB 3CSBA 3WJJC 2H8PA 5DTFA 3RWFA 3HR5B 3KPQA 3MCG1 2P8PB 5SWQB 4NRYA 2VLLA 4FQIL 1UCTA 1GPOL 4OD2A 4CMHB 3AS1A 5JLZB 4J6RH 3CD4A 4YFLF 3SPVB 3OKDB 1T7XA 1CT8A 1KCRH 1MCRA 3ZTJG 1Q94A 4GG6E 5JW5A 2ZOKB 4KDTA 4KKNA 3SOBL 2Z4QA 2VDML 1T21B 1S9KC 3HC0A 5ERWB 3O11A 1KBGL 5D70H 4RFOH 4PRHB 3PL6D 4R96A 4OZIE 5HDOA 4RGNC 1OW0A 1BIHA 3LS5H 5I1EH 4R4BA 1QA9B 3UBXB 3QDMB 5M7QA 4ZFFA 1L9MA 1BZ9B 5F6HJ 1DVFA 4WUUE 1YDPB 2BMKB 2FSEA 4W6WB 3TP4A 3GSNH 4YHML 2EYTA 2KUTA 4X9BA 4Q7DA 15C8L 3EO9H 4LHQB 5EO9B 5FYJL 4P2OB 1SJXA 3MBEA 4HWBL 3RVVD 1FH5L 5H94A 3SE8L 1JPSH 1OD9A 2HT4C 3ARWA 1QHOA 4GUPA 4YO0B 3VI3E 3R06B 1LHZA 3DO7A 4CU8A 3JUYA 3DRQA 1ZOXA 2DD8H 2R0LL 2VRAA 4IIQC 3RWJB 2ERJB 4PJIF 4Y16C 1C1EH 4XP6L 2GFBA 1TVHB 1U93A 1WWCA 4KTDL 2XFXA 5T1KB 3T4AB 5SWZE 3ZKSD 5CILH 2R15A 5D1QC 5BZWB 2YRPA 1MCHA 5F7EL 4TUOA 2O5XL 2PYEE 4NO2B 4XP4L 4LDOB 3CXHK 5EZOL 1B0GB 2HH0H 2FO1A 3GI8L 3MRNA 2FWOA 1HHHB 1D5XA 3BKJL 1CGSH 3OJ2C 5IBUG 2XNAB 2DDQH 4AEHL 2VLME 3U79A 3U46B 4BK4A 4LFHG 3MMEA 2OCFD 3QHTC 3TESA 1B0RB 4UUJA 4GKSA 4WI5A 1IARB 3MLYH 1AXIB 1X5KA 3NAAH 4PJBF 2VAJA 1NCDH 4U49A 2X70B 3MRJA 2X1WL 4JFXA 4PP2B 5CS7A 5HVWA 1S9WB 4QOKA 3GI9L 3CFCH 4XMPH 1GOGA 5HYFA 2NY3C 3RL1B 5KSVA 5B39B 2IQ9L 1JGVH 5DHXB 5ICZA 1J88A 4XVTL 2ILLA 4MA3B 4MLSA 3LKOA 1YN7A 1JRHL 3MRRA 1VESA 3GIZH 4GMSH 5IG7A 3PHOA 3AS0A 4HIJB 4Y4HD 2XG4A 3IAQA 3K74B 3DECA 5CJOH 1CF8L 2C9AA 4WFGE 3AB0B 2BRRL 4HDIA 2Y6SC 5HHNB 3QFJA 1UB6A 5HXMA 5CJBA 4ZDHA 1VACA 3QQ9C 4EI5D 3EOYG 1N5YH 3VGAC 1BD2B 3FB5A 1J8HB 3L3KA 3DX6B 3VDAA 4TRPH 4YHZL 2XN9B 3FB6B 4KPHH 3TFKD 3UTSB 2GEEA 3MUZ1 1EJOH 1FCCA 2Y07L 3LB6D 4OFIA 3UTTB 3ZDZE 1CICD 4NDMA 1I9JL 3G6JA 4H1LB 1WWAX 4OCWL 3B2VH 3BDXA 2XZCH 4Z7VF 4JRXB 3WNOA 4H20H 3ZDYF 1YY8A 4R2GC 5FOJA 3T77A 1EXUB 1I7UB 5I16A 1I9IL 2FR4B 3UO1H 1KEMH 3CX5K 3QEGL 1KGCE 2MQCA 4M6ML 3DXAB 2PO6B 4OI7A 3V6OE 2NY7L 4YDIH 4IOFD 3QFDA 2PCPA 4XNUL 2VMFA 1G7MB 4ELMF 1SBBA 3MV9D 3HE7D 4HGMA 3WFZA 2NQCA 4XCCH 4M03A 4MHHI 4XC1L 5E99H 1CGVA 5CCKH 1Y0LA 1NBYA 4DUXA 4ALAH 4TUKH 2VXVH 4KKBC 4D8PA 4OGZA 4HXAH 4MGXA 1XZ0A 4CVUA 2CH8A 2V5RA 4PRIB 1CE6A 4FFVC 3VFGH 1FSKC 1UM6H 1Z9OA 3OKYA 5F93C 5F88B 3GUTB 4LMQE 4ZFZB 4YHYB 4R26H 2AV1A 4Z7WA 3N9GL 3GEWB 2GSIB 4JFOB 4ZTOH 2BNRB 1MF2H 4FN0A 1ROWA 4YGVA 4HKBA 4MJ4A 1RIUL 1NUGA 5FYKU 3C8KA 1EMTL 3H3PL 2XKUA 5MEOB 3EOAA 2QQLH 1ZKAA 2V5SA 5D96C 4H1LH 4GSDH 3T8XA 3FT2A 5L88L 3T3MF 2WUBL 1CVSC 5C7XL 3RRQA 1FV1B 5D2LA 4KH2A 2VDQH 3I6LD 3VDBA 4PG2A 5DC0A 4MQXC 5DRWA 3BQUD 3EGSA 3U83A 1ZVSB 3QG6A 5IOPB 4HFWA 5TE6L 3QYCA 4F15B 5HHMD 1DBMH 4JQIL 4NQXA 1L4IA 2ZJSH 1VEPA 3SDDA 1N2RA 5BW7A 5DWUH 3WFCL 2K7QA 2NX5E 1N7MH 3ROLB 1KCVH 5KVGH 1MCCA 1J12A 4HUMB 3MZGB 1IGYB 2EDTA 3V4PL 4Y0GA 3JWNC 2OS7A 1YN6B 1P5UA 3L3DB 2P46B 5FYLD 4YHPB 4PJ5E 3O4LE 4GQPH 5GGVH 3PWVB 4DTGH 3A6CH 2I9LB 4KI5F 5LG1A 3TPUB 1QEWB 3VFTB 3JSSA 5SWSD 1X3DA 1RJYA 1KB9K 4LCIL 1C8PA 1XF2A 5D7JC 1C7TA 4P9ML 3SJVA 3T3PE 4M3KB 5HSFA 5JTWA 3U0WL 5DR5H 3HA0A 2XYCA 3WXWL 2VXTL 5E6IB 1PVHA 3ARSA 3S36L 5F8QC 5GPRA 3QQNA 4LSTH 2JJTA 3PE9A 4Q9RH 4N0YL 4HC1L 2YPVH 5DLML 5FGBC 1KG0A 5D7IB 3PWLB 3TH4T 5K9JH 3FO0H 1HHKA 2QEJA 2DIAA 3MRLB 1I3RA 1F3JB 3QIBC 4ORZC 5BZDA 2F8VA 5C09B 3U30B 4PREA 4L4VB 4LCCC 2P5EB 1QUNA 1FZJB 5LXGL 2C26A 4MXWL 4WEBH 2VZOA 3QIUA 4OBRA 5EA0H 3WBDA 5FYJD 5KS9E 3BPNC 2DBLL 5HI4D 2BVEA 4UDUA 1F97A 3RTQA 4F37K 2EC9T 4JFYB 4EBQL 5ITFA 1VPOH 5T1MA 1I8IB 1A7QH 1J11A 3CVIL 2J8OA 3MA7B 3E6HA 3EO0A 1GC1H 3NZ8A 4MNGB 3MGTB 3VFSB 5GRWA 3BPCB 2BVPA 5FO8A 1G9ML 3V4UH 3CFKA 3QNXB 4P0DA 4LQFL 2F19H 4XBEH 1VFAA 4HS3B 5CEYB 3MUGB 1E4XL 1OW0C 1DBKH 3IFNL 1BBJA 5C08A 3QDHA 1DVFC 2BNQD 2FEEI 4WGWB 1NJ9A 1LO0L 4O2EB 2DL2A 4XP5L 4PJ8A 2OTUB 4M61B 4MVBD 4L9LA 2EKSA 4OZGF 1Q9OB 3TVMB 4M4RA 3QDJA 4GG6B 3FTGB 3OKMA 1RULL 4LSSL 3TBWB