3DVNB

Crystal structure of k63-specific fab apu2.16 bound to k63-linked di-ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
217
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVKTGLIHWVRQAPGKGLEWVAYISPYYGSTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREYYRWYTAIDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin chain editing revealed by polyubiquitin linkage-specific antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Human IgG1 fab fragment light chain
total genus 35
structure length 217
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dvnB01
4K71C 3S3PA 5JHDB 4U1JA 1NBVL 4PRAA 5LAXB 5B3NA 4XNYH 1CGSH 4K3JL 3VFTB 5DD0L 4KPHH 4OQTH 5JOFB 4DW2L 4LSVL 1IAOA 1QRKA 1T2JA 4XP9L 4JO2L 5E2TH 4YWGL 4AIOA 5FM8A 4Y5YA 1WIOA 3QIUC 4ZUVA 3GMMA 1B0GB 1RJLB 5ICYB 3E6HA 4YZFE 1A7PH 5DJ0B 5HGBB 2X7LB 1FAIL 5CBEA 1CXFA 2J8UF 5MENA 1FHGA 2ZWLT 4NBYB 5EA0H 2OSLB 3HC4L 2Z9TA 2CLVB 5HYSB 4M02A 1YJDH 1VFOA 5BV7B 4FZ8H 3QWRA 5JW3H 3MGOA 3SY0A 3QXDB 1SJEA 4LEOB 1OSZA 1XR8A 2VDRL 8CGTA 4U7KA 5C0JB 3GMOA 2F53B 5JZ7D 3VA6A 3ARGD 3EW3B 4KK8D 5E1AB 1C16B 4PJBA 1Q0XH 4QHKI 3VH8G 4WFED 1KCSH 5C0BA 5EOCH 1SBBA 4LDOB 2C3WA 4R2GD 1MJJB 4DKAA 4QRRE 5C9JB 5CLWA 5ID0B 3O0RL 3OKNA 1J11A 1MI5B 3I6KB 4PRHD 5DF0A 1T4KB 4FQ2H 4OIIH 4PJHF 5KSVA 1IARB 2I60L 4JY5H 5DD0H 5CEZD 3I02A 4UNTA 3O3AB 2MQ3A 1DEEA 1N5YH 1EFXD 2V2WA 2KQNA 3RWHB 3HI6L 1DVFA 5FKAA 1DQJB 4P2QA 3U36A 2Y5EA 5EU5A 1NGWA 1IEAA 3BDYL 4YPGA 4K7FB 4H0IA 4EN3C 3BZ4B 2ZUSA 4WIQA 1GYAA 1AC0A 3KJ4C 4OF7A 1XFPA 5FDWA 2G5RA 3DUUA 1CE1L 3UTOA 4CKVX 2WBJA 2XXCB 3QUXD 4FQJH 5FYJL 1OT2A 2YUWA 3EUUA 5T3XL 3TNNB 2VDLH 1KLFA 3HAEB 3ZTJG 4EBQH 2XKNA 2EIBA 3ZDYE 4PP2A 3GSVA 4RMTA 2PW2A 4F7PA 3EO9L 3QZWA 4NM8H 5FAAA 3SKMB 3CD4A 4GUPB 2FR4A 2N4IA 1RVFH 4M43H 4R3SA 2SEBB 1NEZA 5J89A 2PYED 2HMIC 3BEWA 4DOHB 2W9DH 3IVKB 2AK1L 5HHQB 3MRKA 4L29A 3MRJB 2EYTA 3DMMA 2NZ9C 4PBXA 4PJ8C 5T3ZL 5FKAB 4IRSB 43CAA 2F19H 1JZ2A 1FRGH 5DQ9B 1J1OL 4QRRB 3ZTNH 2FL5A 4IRSC 4D9LH 3RBGA 1SEQL 4I0PC 1EO5A 4F7EA 2Y5TB 5EU5B 4K9EH 1MH5A 3Q1SL 1VSCA 4TTGA 3SKJL 4DGIL 5KVEH 4UU9B 2ZSWA 3RPIB 4M7JH 1NBYB 4UB0L 1IGML 1DDHA 2Y06L 3H0TA 1JUFB 3HPLA 5KW9H 6FABH 1CL7L 4XP6H 1IKNC 2W65B 5DD1L 3SGDI 4NYLA 2FR4B 4NDMA 1AY1L 4AMKH 2AV7B 3HNTH 3EDKA 3IDYB 3AY4C 3QZWB 3VFSB 1S3KL 3MUHL 3QIWD 2J6EA 4YHPA 4GG6E 4UV7H 2VLKD 3TLRA 4PYHA 1KTKE 3U30C 4JRYA 5BZWB 5HYEA 5GRXG 1LVEA 2VDNL 3ZHKA 3UJIL 3ZMRA 1S8DA 2H1PL 4JFZH 4M5ZH 5GXBB 1N7ML 5KJRL 1TJIH 1IKFH 5HGHB 1UEMA 1Q1JL 3D3VB 4I13B 4JPKL 3W5NA 3T4YA 4WV1A 4N8VG 2HLFC 3BVNA 4M03A 1KTDB 4NZRL 2JE8A 2J88L 4HUVA 5HHMD 4M4RA 1KFAL 2AKRB 2CJUH 2VAJA 1OAKH 1QVOA 2BHZA 1P1ZA 5C0IB 2DQUL 4L4VA 4NOBA 3VMNA 3C60D 1INQA 1K5NA 4ODVL 5EORL 2FX9L 5IB5B 5FUCE 3BRDA 3BW9A 3BMVA 2ZUXA 4U6TA 1BWWA 3BP4A 4W4OC 1T80A 1ACZA 2WIMA 1TITA 1YPZE 3QUKA 2IMNA 4JRYB 3MV7B 4WDIB 1BQHG 3AAZA 3RTQA 1U8PB 4CVZA 1GOGA 1B88A 1WZ1H 1RFDL 1U8LB 1NGYB 2DI8A 3DV4A 3PWPD 4JM4H 3G5ZA 4ZUTB 4S1DD 3TYFA 3O6KL 1RK1A 4P2CG 4Y2OA 2L4OA 1CFTA 2YRZA 3O3EB 2Y9RT 5GGSA 1T1ZB 4NQCD 3H42L 5FYLE 3HZMA 2P43B 3GMPA 1NMCC 4P5TA 1GRWA 3JZ7A 1QBMH 3O3UN 4UQ3A 4WCYL 3W0WE 4ZD3H 1FH5H 3HFML 5IB5A 3UTQB 4I4WA 3D85D 4LVOC 4Z5RB 1YC7A 2QSCL 3D87B 4OCWH 5CLTA 3P2TA 5GSVA 4NZDA 4WO4C 4NCDA 2EDYA 3GHBH 1Y6MR 1J9CT 1Q9OA 5F7FA 3TT1L 3GSXA 2ADGB 1PKQB 1NGQL 4FG6D 1FSKC 1IAIL 1ZVSB 1UWEH 3AAZB 3HMWL 3V5DB 4HC1A 5HSFA 4FQ1H 2HKFL 3I9GH 3A6BL 5EZOL 4GQPH 4EI5D 4RISL 4V1DE 4E41E 4OZGF 3QDJD 5C6PB 5KVGH 3AY4A 4Y1AA 4X6DE 3RWDA 5BXFA 5D5MF 3L7EB 1INEL 2XY1A 5FF6A 3BAEH 5DZLA 2XA3A 5HHOB 1UVQB 5F88B 5MI0B 1U8NA 3GBMH 1WC7B 3EFDH 3OJVC 2D7QA 2WLZA 3VD9A 4UBDC 3WFCH 3X13A 4P23B 5EZJB 3QSKB 4YXHH 5A16B 4Z9KB 2VLRE 1JPFB 4OB5L 1IFHH 4JFDA 1GSMA 4QGYA 4KWUA 2VE6A 1A1NA 1EPFA 3LS5H 5DVOA 2V2TB 3NZ8B 4IRJB 1MWAL 4NQDB 5IVXF 3U9PH 1QLRA 3EOBA 3MRCB 2BVQA 3V6ZA 5HD8C 2R2BB 4Q9RH 4PRNB 1T89C 2R23A 3B9VA 4GT7A 2DIJA 4XCNA 5B39G 4X6CA 5H35B 1CFNA 3UYRL 1MJ8H 5D5ME 5I1DA 5BV7C 4R96A 4F58L 3L7EA 3MLUH 1DQDL 4YBQD 4OFVA 1D5IL 2WUBH 3CXDH 1MQ8A 5TFSH 3BXNA 3FT4B 2AXJA 2YR3A 5DA0B 3B2VH 5EIIB 2I9TA 4PLNC 1N8ZA 1MWAA 4NP4L 3RL1A 1Z3GL 5DC9B 3BMWA 1CGUA 5BJTA 5EZJA 1P2CA 3TH4T 3U0WH 3ZDYF 1FPTH 4JB9L 1PKQA 1CLCA 2FWOB 4G6JL 2AXFB 3ARTA 4IRJD 4UDTA 2VE6B 1O5DT 5GGVY 1N6VA 5E2VL 1KTRL 5C07A 3SKNA 5I6XC 3UPRA 1BM3L 1BFOA 2KL6A 5I1AB 4GXUN 1HOCA 3O41A 4Y7MA 4OZIA 3MYZA 2VITB 4JN2B 4KKLD 3UYOD 4L8CB 4ZO9A 1J0JA 3NN8A 1AR1D 1SQ2N 1VPOL 3UC0H 4TSAH 3VXPB 2CK0L 3GIVA 4LHUD 4N1HB 4OF3A 3IETB 2RCSH 4NN6C 1S9YA 4OZHE 3CSGA 4OCSH 3GKZA 2CRZA 1TZHB 5ADPL 4LLYA 3NA9L 4YX2L 3UBXG 1JNNL 5D7IB 5K9OA 4K94H 2AJXL 2AXHA 4MA1B 5CZXD 3LKPA 1KXVC 3DX8A 2IAMC 3O45A 3ARGA 4BQ6A 3MJ8A 4NO0B 5EH1A 4NJAL 3U0PA 1KCUH 1ZTXH 1XF4A 1YN7A 2F58L 1KN4L 5ETUA 3T2OA 1UWEL 4X7TA 1BQSA 5D7JA 2GCYA 4R4BA 4I9WE 1HOCB 1YMMA 1JNJA 5ACZB 5JHDE 1A1MA 1C5DB 3UPRB 5MERB 2VDKH 2V7NB 4O51A 5DK2A 3TBWA 3C09C 3JWDH 5DJ2B 3GEWB 1OB1A 3FQRA 4RAVB 3PIQB 2AV1A 3L3OB 1MCHA 2VOTA 5JORA 4OFYD 3L9RA 4F3FB 2D9QB 2Y4SA 3JWDC 4OFKA 2BNQD 3VXPA 1MAML 5FGSA 1IGTB 4NM8L 3RWFB 5KS9F 4GRMB 1CLOH 3B5HA 2H41A 4DKDC 3THMH 4PS4L 4LLDB 4YK4C 1ZHBB 3VXUD 1XEDA 5I9QB 3STZA 1EJOH 2DKSA 1NC2B 1EEZB 2NNAA 3DYMA 3SGKA 4L4TD 1QRNA 4IDJH 2DYPD 2VLKA 3IXAA 4DGYH 3UTPE 1H15B 2A77H 3FQUB 3MUY1 5GRVL 1DQLH 1G9MH 1P69B 5HGDB 1Q9WA 3C60B 4J8RB 1T20B 3D0VA 5E8OB 4HQQL 2XIDA 1KENH 1RUKH 1NPUA 4H25B 2LVCA 3Q48A 3OB0K 1EHLL 4AEHL 1JN6A 3UMTA 1NL0L 3NFNA 3RIAK 2CLRA 4ENED 4BH8A 1AKJA 3E0GA 3RKDD 3LRSA 3EO0A 4PRIA 3K4DA 2ESVB 4BELD 4GBXB 1NAMA 4OZ4A 3DYPA 4BZYA 5FDYA 1GAFL 2AQ3A 2IC2A 3I6KA 2ERJB 1PYWB 2CIIB 3HC4H 2DM3A 3CFKA 1TZIA 1P7QD 4J23A 1WFNA 1MFAH 1DLHB 5SWSE 1FVDB 2ORBL 3V6OE 1HE7A 3MOQA 5TQ2L 1H15A 4D9QD 4X5XB 4H8WL 4LHQB 3CFCH 2X4UB 3QXWA 1R24A 3KAAA 4DVRL 5BVPH 3VXRA 4P57B 2XXMB 4KZEH 1LK3L 4L8BA 1D3CA 3EGSB 4X6DB 3ULVL 1AGEB 3GGWB 1JGLH 4BFEA 3T1FA 3ZDXE 2IFGA 2Z93A 3IVKA 1AQKL 4P23D 2Y06H 3VFPA 2B4CL 4XP4L 1JHTA 4NN5B 3C60C 5F89A 3AXLB 2X4TA 2A77L 3OKDB 2M8XA 2VWEE 4YHIB 3REWB 4AEEA 1BZ9A 3TBSA 2J8OA 2DBJA 1SJHA 5F7YC 2X1QA 3RGVD 2HVJB 5FYLD 1VB9A 1D6EB 4ZFZA 1OP5K 1FYTB 2RBLA 4JCMA 1AP2B 3BH9B 3WS3B 2AJSL 5E8OA 4BZ1H 4J4PC 2X09A 1ZHKA 2EKJA 1IVLA 3NAAH 2OMNA 2YD4A 1ZLVH 3S6CA 3CFDA 5HJ3B 2JJTA 3OSKA 1BQHB 1OT1A 1FO0B 4QGTA 4PJ9C 5DJDA 5IFAH 4M7LH 3OV6A 4PTTA 1S7UB 3T2NH 1XGUB 4HWEL 4U1KB 1UA6H 3DO7A 3LEXA 3VXQA 3JVGC 4L3EE 4LBEB 2CO7B 4WTWA 3F7VB 2E7HA 4J6RL 3GI9L 4PGCA 3WHXB 2XICA 3MLSL 5EIVA 4YHIA 4P46A 3BHBB 2APBA 5EBLA 1YNLH 1KULA 2KUTA 4V1DD 4XGZA 4E41D 3T0EB 5AYUH 5HDOA 2P5EB 3ZE2E 4LPWA 5EC2A 2Z31A 3BVNB 4ZAKC 4G6ML 1WFUA 1BEYH 2C1OB 3IJHA 3O4OB 1A2YA 4HS6A 1YZZA 4MHHG 4QTIH 4XWOC 5DUPL 1R24B 2VZ3A 3HE7B 1HYRC 1SY6L 2PXYD 1OCWL 4YDJB 2YXFA 4RGOL 4R97C 4P4RA 2LQRA 1ORQB 1AXSA 1IQWL 2YZ1A 4JFQB 1YDPA 4JKPH 3DECA 3S98A 3CX5J 5IHUL 2RCSL 4NC1C 2O5XH 4L8DA 2LFGA 5ANME 2R56H 4ODTH 1AKJD 2BHUA 4H8WH 1OWWA 1VPOH 1CR9H 2ITCB 3GK8L 5D1QD 3U82B 2EDQA 1M71B 4DZBB 3F7VA 1UGNA 5CINH 3QRGL 3RTQB 4U1KA 2OYPA 2DTML 1S7TA 3D48R 2R1YA 2Y07H 5AG8A 2P1YA 1KYOJ 4G3YH 3K8KA 3TCLA 1UH3A 3CSPA 4QY8B 3RAJH 1VEPA 3RAJL 3KYAA 2OQJA 1LMKA 3BP4B 4JREC 4NUGH 3KS0H 5EUOE 3KPPA 4G8IA 4JQVC 5EUKA 1WEJH 4MSWB 1CTOA 4Y5VA 1T66C 4R7DB 2CO6B 3QG6A 1U8QA 1KJMA 5BW7C 1AGBB 3O2WL 5H37H 3QUZC 1WITA 3GHEH 4M62L 1TETH 2FX7H 3LS4H 4ZO8A 3N1MC 2Z8VC 1CZ8H 2VDMH 4I3GA 3QUMB 2VDOH 3KDMB 4C83B 4XRCA 3BPOB 4NKOB 1N26A 4EDWL 1MRFL 5KVFL 5FYKE 4N0UE 1U36A 1NEUA 3FONB 4ONHA 4QTIL 3P0YL 5CGYC 3V0AC 1A64A 4IDJL 2XG5A 1U92B 5SWQB 2EYRA 3FOLB 2DQFB 2C3VA 1OAUH 3FO1A 4PGBB 4Q74A 4H26A 2OCFD 4YHOH 3RL2A 4RGMC 5EBMB 4X7SL 5DXWA 5F7LB 2NY2B 2Z4QA 4TULH 1E4KC 2ZCHH 4QO1A 1JUFA 4NQDD 4HUVB 2MJWA 3HI5H 4HC1H 1OLLA 1KB5H 1TVHA 5F1SA 1WBYB 3IJSA 3FOMB 4M7LT 3V79C 3M8OH 1LQSR 4X5WB 3OR7A 2DICA 3MRNB 5FV2A 3RY5A 1DJSA 2FBOJ 5FEBA 1CI5A 1GZPA 4BSJA 1NH6A 4ISVB 2OXHA 1FVCB 4P46D 1WJ3A 3A6BH 3EYUH 2AABL 4KROC 5D7KD 2AGJL 1ZGLB 1QEWB 1KEGH 4WGWB 4P5MA 2H8PA 1QQDB 3U4AA 5I8OL 3P9MB 3PWUB 4U2ZA 1NGQH 1YMME 1KJ2H 2R23B 1ZOXA 3W11D 1QBAA 4GKNB 2EDKA 5A2LH 5ALBH 3DIFB 1PLGL 3VD3A 3QUMA 3RL2B 4M6ML 3ZSSA 1QRND 1I4FB 2P5WE 3VXSB 3BXNB 2AXGA 4OZHB 4DVRH 2IAMD 5BVPL 1AGDA 4KKLC 3SDXF 3NIGF 2OZ4H 5DQDH 1P9MA 1IC7H 4OCRL 1KGCE 1CDGA 4PG9A 4Y2DB 4ONFL 3C8KA 3STLB 5LGHL 3GJFA 3QDGA 5IFJB 4Y5VC 4WUUE 5T1MB 3DRTB 4P2YA 1OM3H 3VW3H 5IMMB 5KAQG 4KTDH 2NY2D 3SE4C 3L3JB 3WLWD 4AT6B 1HKLH 4U6VL 5IK3A 3UAJD 4HZLB 5CZKA 5IG7A 1N0LA 4NNPH 2UZIH 1S5HB 3C9NA 4OLYL 2B5IC 3BWAA 3SGEH 1ZLWK 2WBKA 5GS1B 3NZHL 4QRPA 3ZSTA 3DIFA 2WK2A 5JHLH 2OP4H 4Y1AB 2DD8H 2Z35A 1IC4L 3CU7A 3MRRB 2BSED 1WCBA 4JZJC 1D9KB 1U8NB 3NH7L 5E6ID 5JHLL 3ARBD 4F37F 3AREB 1I1CA 2MKLC 1AGDB 3RY6A 4LOUD 4B0MM 1F45A 4ELMA 5J9PB 3BGMA 2GY7B 2APFA 3QIUA 1HI6A 2P48B 4UMGA 4ZFFB 5JXEC 1GCFA 4X98B 3W82A 4JY6B 4XBEL 1CBVH 3DHJA 1IMHC 4G8GB 4DZ8B 5D2LE 1M7IB 2G5BB 1UYWL 2NTSP 1U2HA 1OAQL 1MPAL 3FCTA 1KJ3L 1LD9A 5ITFA 1E27B 4YFEA 2MCPL 5DGRA 4APQB 4TN9A 4Y2DC 4QRSB 1EK3A 4XXDB 2CDFA 1FFOA 3P73A 5IB3A 2W59A 5CEZE 2C9AA 1ZA3A 1IQWH 2YK1L 3DROB 3KLAB 3SEPA 3BQUA 5GGVH 4MVBC 5IQ9B 5FGBC 4M7JL 1N59A 1YQVL 2ITDB 4PR5A 4ZUUB 1WF5A 4RRPG 3V0VA 2V7HB 4IEFB 5SX4H 1VACB 5DJ8A 2CK2A 3RNKA 1ZGLM 2W9EH 3OXRB 1IGTA 4S1RH 1MCPL 1HI6B 4S1RL 1KEGL 1YEKL 3I50H 1B4JH 1KF9B 2AABH 1NAMH 1F00I 4EUPB 4MAYA 3NIDF 4JJ5B 4MGXA 2VXQL 1A02N 4LASH 3GSRB 4ZTOL 1HEZB 3T0AA 1I7RB 4OCSL 5JW5A 1ES0A 5CJXA 4XCFL 2BNQE 2QQNL 1MCWW 4FQPA 1KB9K 4KUZL 3I3DA 1YYML 1G7IA 3BJ91 2COQA 2R1WA 4EI5A 3ARRA 1OAYL 5EZIL 5FYJH 3QHFL 4KVCH 4JPWH 4HGMA 1NDMB 2A6KB 1XR9A 1C08B 1VFBB 2I07A 1N59B 5DT1L 1U95B 2M26A 4G9FE 1RHFA 4WI9A 4KJQD 4NO0A 2KQMA 2ZCKH 2L0DA 4LCIL 4PJ8A 2QSQA 2DQIL 4JRWA 5DFVD 3NTCH 4G6JH 2IBZY 3P73B 1DE4A 1U8KB 4MLSA 4S1DC 3GJEB 4UAOC 4DKEL 3CDGB 1DL7H 1HSBA 4OCNC 5MEQA 5MENB 5AWNH 4Z18A 3IF1A 4PGZA 2PYEE 3O0RH 5IJVB 3DVNB 1G9NH 5C09D 1CD1A 3QUYB 2UZXB 4HS3A 5IW3A 2BFVH 4PV8B 2I26N 1NEZG 1F90H 3PDDA 3EZJB 3OPZL 1KELH 4PRHB 3TZVA 5KS9B 4XNUL 1H3UA 3UYRH 3VG9B 3TO4D 1EMTL 5I16B 1WK0A 3IU3A 3U4BH 4OSUL 4EI5B 3MLWL 4GS7C 1WBXA 4NWTL 3WKMH 2W92A 4ZS7L 2LABA 4L3EB 5C9JA 2BNRA 5E8EA 4Q9BA 1C7TA 2CQVA 4J3VA 3RX7A 5IQ7H 4H1LG 1R3KB 1J10A 2VDNH 3BPNC 4JPWL 1KTLB 5J1TC 1HQ4B 4MNQD 5C71A 4PJ8B 2UWEA 1UH2A 3BT2H 2MPAH 4RFEB 1U8OA 3QNZB 3CSYB 4WI5A 3MV9B 4Z0BL 1CXIA 3B3IA 4RWHA 4Z7WE 1A9EA 3DXAB 4YWGH 4ZFZB 3VFOA 1T7XA 4NZTH 4Y0GA 5L8LB 2NY6B 3L3HB 4OV6F 3RKPA 1S7UA 5DQJA 2GSGB 1G7HA 5DUPH 3SJVE 1U3HD 1L7TH 3VE0B 4QHUA 5FO9A 1MCRA 3WHE1 4Z77A 1HQRA 3WIFB 4I3SH 5GS0C 5EZOH 5EWIH 1RJCA 1V3JA 2NX5D 4LLWB 3MLTA 3L5WA 5A40E 4XBGB 4DCQA 1C5CH 2YOCA 3C60A 5T1KB 2R29H 1W72H 5FUZL 1NEZB 4K55A 4X4ME 5BVJB 3IJHB 4K7PH 4Q9QH 1F3JA 1YQVH 3ARFD 3BDBA 1OSPH 3VWJA 5KSAA 4IOIA 4R26L 4AQ1B 3CU1A 1MF2L 1G1CA 4Y5YB 1J8HB 1S9WB 4FHBD 1B2WL 1YJDC 2CMRH 3L3GB 1T66D 1B0GA 4TNWK 3QI9D 1CQYA 3KPMB 3SE3A 3MUJA 3F5WB 3TN0B 5F44A 1HDMA 2X2YA 3PJSB 2B0SL 1YNTA 3HKFA 3LPWA 4PV9B 3GZKA 2ICES 1OAZL 2AJ3A 5JUEL 5ESVA 3RUGA 2IEPA 4NZTL 4OV5A 1D5XB 1VADB 4XC1H 4F8QA 1KCRL 4Y19A 5ICYA 1IAII 3ARXA 1RZIB 1EGJH 1SYSB 1ZMYA 5TE7L 4OFPA 1XGRA 5A2IH 2AEQH 1LE9B 4D3CH 4JHWH 4EUPH 4K94L 3B3IB 3O6LL 3N0PB 1JGVL 4HXAH 2FX9H 2VDOL 1IJ9A 1PX4A 2RAMA 1CFVH 3WFDH 1NBQA 3RU8L 2DQUH 1TETL 3QG6B 1A7NH 3VFVB 5J6HB 3QDMA 4R0LA 5MP6H 3OAZK 4FXGA 5DRZA 1RZFL 2ENYA 3HPJB 1S7RB 3BKYL 2XPGA 4BA8A 1EO8L 3EJJX 2EKSB 2QQLH 1JRHH 3ZKSD 5JLZB 1CDHA 1U3HB 5CINL 5EBMA 5D8JH 4U49A 3T65A 1XGRB 2JELL 3NABH 5DI8A 2YHGA 1OD9A 4ONGL 3QPXH 1U8PA 3RVVD 3HNSH 3X12B 4JO3L 5D70H 4PV9A 4MB4A 4Z7UB 1FG9C 4KMQA 3VU2A 1BAFL 2P49B 3LSOA 4LRIA 4D8PA 3JTTA 4M6OH 3BW9B 2WBWB 1FVCA 4P2RD 4DKFL 5DJCB 3QIUD 4RAHA 3MRFA 1FL5A 4XCEA 2NX5A 3BWUC 2B1HL 2UY7A 3AC0A 3RWEB 4CW1B 3VI3F 4Z8FH 1DFBH 1AI1H 5CP3A 2ZKHL 5D1XD 4CVZB 4OBSA 3U2SA 4YO0B 4OGAD 4KJYA 1AO7D 2FH8A 1CK0L 2BVUA 1U8QB 3HUJE 3O9WC 5D71H 2XWBA 7FABL 2H8PB 3HA0A 1MAMH 3EFDL 3TIEB 3B83A 5HHXL 3FN3A 3TBTA 2HVKB 3JUYA 3NFPB 5E03A 3T08A 4NBXB 2IMMA 3JV0A 4KC3B 4N0YH 3KLSA 4Z7WB 2DQDL 1XGYL 2PUQT 4Z7UF 5J1AA 3KDMA 4XVTH 2ITCA 4AEIL 4FXKB 5DD6A 3WNOA 4PJHE 5F7KC 4JY4B 5FYJE 1MFCH 5DMKB 3T0VA 2JB6A 3VWKC 1A1OA 5C3TA 2UUDK 2GHWB 4W6WB 1FNGB 4WU5B 3D3VA 5CIPB 1I1YA 2B1HH 3ARGC 2ESVE 4OKVA 2DQFA 4RX4A 3IAQA 3ULVC 2FO1A 4MA1C 4QWWC 3RIFF 5GGVL 1BAFH 3RIAF 4H26B 4C58B 5HGAB 5IW1B 2HJLA 1NGPL 2CR6A 3LD8C 3RHWK 4ZD3L 1CZ8L 4N1EA 4XHQA 3WSQL 2X4NA 2HKHH 1DBML 1U3YA 3NABL 3BT2L 1NUFA 5DJCA 5ILTL 5D7JD 3IDJB 5GS1A 4JZOB 1N64L 4Q9CA 2XYCA 2VKWA 4QRUB 4YFLF 5EOTB 1NKOA 2PETA 4Z78B 4WHYH 5E08H 4LEXL 1P9MC 4JVPA 4NQEA 4QOKA 3FFCB 5IBLC 2ZSVA 1R3JB 4S0SD 5IBUG 5D72L 2DTSA 1BF2A 2OTUA 3MRPB 3MREA 1RJZA 3HZMB 3VRLF 3SGKC 3VGAC 1CR9L 3T0EC 2FZ3B 3LN5B 2Q76A 3VXUA 1FYTD 4XH2B 4GLRI 4APQC 2BNQB 3NPSC 4PJCB 4I77H 4MNGA 4YDKL 1MAJA 1GGBL 2IANB 4K3EL 3CDYA 1RU9L 2FJHB 3ROOA 4AENB 5LBSH 5DHVH 3QULB 4OM0H 2AVGA 4G7YL 2XWJA 2RQ8A 4WEUD 1H3TA 3T0BA 4AIZA 1AJ7L 1NUNB 3ARSA 4U6VH 4XNMB 5CSBA 1O0VA 3LKRA 3HAEG 4Z5RA 4WFGE 1I8MA 4EDXA 1IAKA 4KXZH 1OGTA 3OB0H 5D6CA 4P3DB 4ORGB 3K4AA 1U91A 5EC1B 1FG2B 3BPOC 2BDNH 4F8TA 3TPUA 5C0RH 4BQCA 3WFCL 1YYLL 3EO1B 3S97C 2Q76B 1A22B 4KRPC 4UT6H 3HRZB 3OXSA 1YEDA 3HC0B 4BKLB 4QHLA 4ZTOH 2NYYC 1G7IB 5IBUB 4Y2DA 2ICWB 3FJTA 4G9DB 4HKZB 1MCQA 4NO5B 3SE9L 1PJ9A 2DL2A 1UEYA 3GRWL 4ODXA 2IH1A 5LKNA 2ZSVB 3F8UB 2IBBA 5FHBL 3U30B 4FQLL 3ZHLA 4J3OC 1QO3B 4P5KB 3BQUC 3MV7E 4AIZB 2Y7QA 5C07D 4HXBH 3W39A 1KUMA 3MJ7A 3O45B 1TJGL 2XRAH 1VGKA 1S7SB 4LCUB 4RX4D 5BS0E 5GHWL 1BMGA 3EYVA 4JPVH 3FCTB 4LVNC 3R06A 2XN9D 3VFWB 4YHMH 5IMKB 1ZV5A 1B90A 3QPQC 4Z8FL 4NRZB 4WCYH 4WO4B 5IVZA 4TOYH 2FIKB 3KYKH 2IAND 2HRPL 25C8L 4Y4HC 3TJEL 5I1KL 4EVNA 3BGMB 1AJ7H 3HMXA 3CFJB 3WD5H 5SX4I 3OXSB 4X7SH 3IDMA 4RAUB 1G6RH 3BQUB 2YA2A 4HDIA 4P2RB 1TDQA 3PF2A 3CVHL 2C1PA 3VXNB 3JV6B 4KJPC 1J0ZA 5MENE 1AHWC 1M7IA 3HNSL 1IE5A 3RL1B 5ITFB 4EI5C 3LCYA 2PN5A 4P3DA 4PGDA 5E2VH 1RD6A 4BZ2H 3T3PF 1T6VN 3CPLB 3HR6A 4FFWC 4APQA 4KKBC 2GJ6B 1I8LC 2BNRE 5GIRB 2YPLE 4WUUB 3TBVA 3G6DL 4CMHC 5KVFH 1P84K 1WEJL 1X5KA 4JFFB 2X1OA 1E6JH 3B2VL 3PGDB 2EYSA 3VCLA 2LE9A 4NKDB 4ZDHA 2WUCH 2JIXD 3MV8A 4WW2F 5AWNL 5JW5B 3NCFB 4GRLA 3TA3C 4NRXA 4JZJB 4NRZA 5K9OB 4BFIB 4GRWB 4R8WL 3VA2C 1F97A 2VAAA 2WWKO 5DS8B 4K9EC 3AM8C 1NSNL 4HIHA 4PUBH 5LGJA 2PTVA 4MX7B 3VWKD 5HPOA 1HKLL 4RA0C 2B5IB 3IFOA 3WSQH 3DUHA 2MMXA 4Q6YA 1E28A 4OF5A 5HPMB 1YMMB 5J0BA 4U7SA 1TQBC 2HFEA 1EJOL 5F6HJ 3KWWB 1M05B 3MV7D 1RAMA 1T4KA 1X4ZA 3MRBA 4JANA 1TCRA 3RWIA 4YGVA 1IQDA 1X5LA 4UT7L 2IFFH 3HR5A 4C56E 3C8DA 2MQCA 3AXLA 1UM6L 3RVTC 4ZPVA 1A7QH 1KB9J 3MCG1 4XC1L 5D93B 1CE6B 4N5UA 2C4FU 1CL7H 4O2FA 1OAZH 1NDMA 1A6VL 1G7QA 4P57A 4JREB 1RIUH 3CXHJ 1FP5A 1ZHKB 1MI5A 5JORB 4RISH 3FQWA 1FZOB 1QSFB 1TJGH 2XRAL 1YA5A 3SDAA 3VFPB 2YC1A 1T5WB 5IFAL 3CPLA 3SGDH 4MCYA 5INCA 4PTTB 4MX7A 5HPMA 4OLWL 1K85A 2DLEA 2ATPB 5TQ0H 3GI9H 4H20L 4KHXH 4H20H 3STZB 2VZVA 2HT3D 4OIAA 4B50A 2YK1H 3FQXB 3SPVB 3MV8E 1MREH 1GC1H 4I3RL 3O4OC 1M4KA 2NY1B 3MQIA 4WTZG 3VDAA 1FNEA 3VWJC 1TVBB 2HJKA 3UC0L 4QNPE 4TULL 2NXZC 4JFPB 3CVHB 2XWTB 3SN6N 4XP4H 3PHQB 1NJ9B 3BRFA 2VXTH 3OJMB 3C5ZD 4GKZB 3WUWA 5IMLA 3LN4B 4L8SC 2DQCL 1E28B 2P5ED 4POUB 4JO3H 3RVWD 1OARL 4EQ3A 3UO1H 4HUWA 3T8XA 2DN7A 3P77B 3RX5A 4YXLL 1LGVA 3HG1D 4DKFH 2GTWB 1IAMA 4LCWB 1GGIH 4X4ZA 3QXUA 4ZPVB 4Y1AD 1JPGA 4GRLC 2A6JA 3QUMH 3TA3A 4PJAE 5F8QC 4EDWH 3UCRA 1CTNA 1LWRA 4MNQB 5FYKU 3VMPA 4F9LA 5H2BB 2F9BT 3FT2B 4Y4KA 2H32H 4ZS7H 2E7LA 4KRLB 4IOIB 4RFNC 3DBXA 2PCPA 1TZIB 4K7PX 4E5XA 3GBNL 1G7HB 2FX7L 2EDLA 3C09B 5GSRB 5FOJA 1J8HA 4JG1L 1R0AH 3FQTA 4TVPL 1XZ0B 4WFEE 1MJ8L 1GJIA 1IZJA 3HS0B 1XMWA 3MBXL 4YHYB 1UCTA 2RIKA 3MLTB 1MJJA 4XRCB 3EGSA 2WUCL 4PLKC 3U9PL 4PJHB 3C08L 4HXAL 3X17A 4FQIL 1I9JH 2NX5E 3ZE1F 4UIKH 2ARJB 4ONFH 3FONA 1HHGB 3KXFB 3MRDA 5IIEA 3WBDA 3GK8H 1SJEB 4LEOA 3WHE0 5DZOA 5DR5H 1PEZA 3RWHA 3OKMB 4NGHL 1OPGL 4QRQA 5FOBA 2BP3A 1Z2KA 3NPSB 3VFGH 3QQ4A 4JKPL 5I1IL 2B1AH 3MROA 3ISWA 3WIHH 1OARH 2VNCA 3FT2A 4Y4KB 1A7RL 3MXWH 4GKZA 5JUEH 2Z4QB 2PCPB 4E5XB 2ARJQ 4LBEA 4UUJA 1JP5A 1IL1B 4R97B 1ZLSH 4DGIH 5KVEL 1CGSL 3B9KA 5E9DA 4EQ2A 2GJ6E 4HLJA 5GRZA 25C8H 5SX5H 2ZG2A 4K9EL 4JDZB 2NY0B 4W4OA 2VLRB 3CGTA 3BZEA 3L3DB 4KJWD 2NR6D 3V5KA 3BIKB 4YHLL 2EDFA 2VXQH 2B0SH 4KHTH 4GG8B 1I1FB 5LQBL 3GHBL 4N90D 1QR1B 2CXKA 3ARUA 4X8XA 2DQDH 1S7XB 2OK0L 4D0DA 3B6SB 3IJYA 1GGTA 5DC0A 1I7ZA 4OZFA 1FV1A 1PQZA 4HG4J 3O3EA 5CBAA 2P46B 5J3HD 5ENWB 3QG7L 4LCCC 3L3IB 3TYGL 1QEWA 2X4NB 2FNBA 2EXWD 3OAYK 2CIKB 5FHBH 5L0QB 1U93A 2Y5TA 5KZCD 1HHKA 2ZNWA 3PABB 3HPJA 3SE9H 2YN3A 4A6YB 5F96H 1XGQB 3QDAA 4OM1L 4U6YA 1AXSB 1I3GL 5F3BB 2OR7A 4IIQA 2CRIA 1F13A 1V3KA 2AERT 3H9HA 5I9QC 4JM4L 1FL6A 4NHUA 5ECJE 4X99A 4NQVA 4ISVA 3LIZH 4NDMB 1GC1C 3F7YB 1DBAL 1YMMD 3GFUA 1JL8A 1EEQA 3ARDB 3O3DA 3A67L 1A3QA 5E94B 3MLVH 3F6IA 2DQHH 2I60H 3QQ4B 5C0CD 1GL4B 4W4NA 4X6DF 2D0HA 1I7ZB 3KPSD 5C0AD 4D0BB 1JWUB 4NO2B 1SJXA 1UVQA 4P3WA 5GGQH 3QT2A 4Y5VB 3TBTB 3NA4A 3M07A 4KJQC 3F62A 1Z9LA 4PB9H 4HPOH 4ZPTA 4L8SB 1NUDA 1P1ZB 1CXHA 4RRPA 3R8QA 1HHKB 4PBVC 2W1NA 5IQ7L 5J12B 1I9JL 4YXKH 2VLMD 4NP4H 4HH9A 4NUGL 2E8ZA 4PJFB 5JHDD 5AUMB 1GAFH 2FJHA 3CJJA 3MBXH 3ARDA 5F1NB 1BIIA 3G6DH 5EU7E 5HGHA 4ORGA 1FAIH 4M1GL 4ENEC 4BK4A 4KJPD 2DQIH 4NNPL 4XPBH 1CF8L 2G2RB 4WDIA 1MHHB 1PG7H 2R56L 4ODTL 2NQCA 4I0CC 1XF5A 3OF6A 4PJAF 5I1DB 2PF6A 4I0PB 4Y5XA 4YR6B 5FA4B 3G08A 3HC0A 4O9HL 6FABL 3MV11 1SY6H 3O6LH 5LGHH 1K8DA 1QSFD 4MD4A 3QUML 5AZEL 4NO5A 4D3CL 3V8OA 3SKJH 4N0UA 1JV5B 4LSQH 4KRMB 3I85A 4HCRA 3F7YA 1FZJA 1IEBB 3HRZA 3F58L 1FE8L 4RDQG 4JVUA 1EUUA 4Z0XA 3O3DB 1JTTA 5JIPA 1VGKB 1QBLL 1G7JA 2GT9B 1IFHL 4J6RH 1FNLA 2QKIA 4V2CB 3E3QE 1H3WM 3UJTH 3VGEA 5DJYB 3SDAD 3S8WA 1HINH 1DBAH 2WBJC 3ARGB 2Y7QB 5CEZH 3QHZL 1JYXA 1YEFL 5GS0H 1ZAGA 2QLVB 2G2RA 2AEIT 4YJZL 2AGJH 5HYIA 4IIQC 1ZXQA 1CD8A 1S78D 3KHQA 3R0MA 3UPAA 5EOTA 4NQXB 3O6FD 5KOMC 3HG1B 4LKCA 3O11B 4KRPD 1N5AB 1A6VH 5HHPA 1TZHA 1ES0B 3RZCC 3TV3H 3PIQA 3KXFE 3GSUB 4RGNC 5E99L 5ISZE 3HFMH 5SX5K 4HH8A 4ZUUA 4U1MA 5I15H 4HWBA 2XTJE 3BYYA 5DD3L 1NANI 2M1KA 5EFIB 2EECA 4G6FD 1ZE3C 4F33A 4I0PA 3VFUB 3O6KH 4JFEB 5ACZA 5T1LB 1LNUA 5F9OL 2R2BA 1TMCB 4KY1L 2QHRH 5DEZA 5DJXB 1RSFA 1NFDA 2CK0H 3X11A 4G42B 4ODUA 4XBEH 5DMGD 1MFNA 4NQUA 5EOCL 4HV8B 4AQOA 2VDPL 3C5JA 3WFZA 1ZS8B 5HGDA 3QIUB 3REVB 4U1IA 1YPZF 3VDCA 5BOZG 1FO0H 1S9VB 3CDCA 1LHZA 4LVOB 1HH9A 3RNQB 2QKIB 4OSUH 2FEDC 4C54A 1J8KA 1WIPA 1IC5H 2Y6SC 4YH6A 3SO5A 3I2CL 3QISA 2GAZB 5E00A 1U3ZA 3PV6B 3TGXA 1KELL 1WWAX 2EIZB 4G8GD 2FHBA 1F4AA 4XVUD 5FYKD 4HFWB 1BHGA 5IM7A 4YLQT 1D5IH 1QSEA 4NT6A 3ZDZE 5C07B 2GTZB 5E08L 3KPNB 3U7YL 2DS4A 1TNNA 2DYPB 4JANB 3K2MC 3FMGH 4TSBH 1T22A 4FQCH 1D9KD 4NC0B 2JKXA 1EBAA 4OLXL 3FT4A 1L0QA 3RWCB 3P11L 4JG1H 5GRYA 3V6BR 1IC7L 2OZ4L 1DBMH 3VDBA 2BSTA 2FECI 4LIQH 1FN4A 2E27L 4LSRL 1AY1H 1EDQA 4JFDE 5SWZA 3PP3K 4I2XA 3VRJA 1EERB 2VXVL 3MRHB 1XF3A 3MLVL 2N7BA 1PLGH 5IKCB 4NUJA 4YK4B 1X5ZA 2NXYD 2EDWA 2MWCA 4IHOB 2Z31D 2F54B 1JK8A 1E4XI 5IMKA 2HN7A 1MNUH 4OUUB 4F7CB 4M8QA 5T1KA 3X14B 1AGCB 4XP6L 2GTZA 2OTWA 4XPFL 3CSYA 3ECBA 3QNZA 4XPGL 3ULVE 3GDBA 4LCWD 1IGMH 3GMNB 5D2NC 3GMQA 4S1SL 5ACMA 1JWMB 3JSSA 2VDKL 5I1EH 2HTLC 4FQ1L 4QWWD 2NXYB 4S11A 1I85C 1FN4B 4EZMA 2F58H 1Z9MA 4OLZH 5J56B 2XZQL 2FX8L 3NMEA 2VERN 3ZT7A 3GRWH 4D94A 1P84J 1FFNB 4U1HB 1XH3A 4PJEE 5GIRA 4NN7C 2A6KA 1W72B 2JJUA 5MEPB 2CDGA 4NUJB 2ZKHH 1C5CL 4OKDA 5IJVA 1TFHA 4F7CA 5BV7L 2AW2A 4P4KC 4MAYC 4LIQL 1ND0B 3CC5A 3V0WH 3JWOC 4I3SL 4L4VD 1MCJA 2J8HA 4FFVD 3CDGA 4YUEL 1FQ9C 1CICD 3HE7A 3VRJB 4NKQB 2EEBA 5C0BD 1J86A 2A73A 3JVGA 5D1XC 5EO9B 3LQAL 5C0CE 3RVVC 2QL1A 4BJLA 2XA8L 5D9SB 1XF1A 4OV5B 3FO2A 5DJ0A 1U8OB 3T04D 1RU9H 3GSOA 1RJYA 4G80A 1JMXA 1EFXA 4U1LB 4U6XB 5KBNC 5BRZD 4P48A 5JMRA 3LS4L 1WZLA 5JOPE 5GRVK 1HHGA 1S5IL 1CFQA 2BY1A 3CXHK 2H6PA 5IOPB 5B22A 5L7XH 1RZGA 4L4VE 2A6IA 1OW0C 4DEPB 1ED3B 2HKHL 5FGCB 5GRJL 4JHBA 5HGBA 1Q1JH 1UENA 3TO4B 5IMLB 4FZ8L 2CH8A 4UU9A 1TQBB 4JAMA 1CG9A 1FIGL 4HWNA 4S2SA 4Y19D 1P7HL 4CADB 3ET9F 3MODL 3B2UC 2K7QA 3NTCL 4JHWL 3D3VD 4XAKE 3T0WA 2XA8H 5D2NA 5DQDL 3WJJC 1DUYA 4BH7B 2GW5A 2Y25A 1OSZB 4R7DA 1URLA 1T7WA 2CUHA 5K9KB 4J4PD 5DI8B 3QFDA 5HYJB 1EHNA 3WIIH 2FLRT 4LNRA 4QNPF 1ZEAL 4N9OB 4KVCL 1CDIA 1HDMB 4PYGA 4UILH 2AK4B 4JFXB 1HHIB 2YD7A 1MCOH 3LZFH 2F53D 4HGWA 3KJ6L 1GHFL 4PP2B 2EEDA 4CVUA 1ETZB 2EDJA 1B2WH 5B4MD 4GMTL 2NY5C 3WS6C 1JFQL 3ULSA 5I1HL 4KI5D 5DJDB 3T1WA 3MRFB 4HWZB 4LASL 4P4KA 4UQ2A 4K8RD 1TZGL 4EN3A 5K59E 2EIDA 1UA6L 1DQQB 3MRJA 4O02L 1NGWB 3ZO0A 2PTUA 5D7JC 1YN6A 2BVPA 5JXAL 2VLJB 5FDWB 3BHBA 4K07A 5DTFB 4K8RC 5F1IB 3HE7C 3VXUE 4GW1B 7FABH 1ZHNA 3C6SA 1XZ0A 5I1EL 1X5IA 1QA9B 4PJBE 4F7PB 2A2QT 2P5WA 3WE6B 4MA3A 4NN6B 3BPLC 3VMOA 1TVHB 1JPTL 4Q0XH 1I3RB 3UDWA 2OL3B 5IROC 5AZEH 3DV4B 1LO3H 4Z7WA 3UTPD 1CG9B 5DVKA 3S96B 5AAWA 3O2DL 4GW5A 4R3SB 3DO7B 2B39A 5IJKA 1Q9KA 3OR6A 1AGFB 4PLJC 2R9HC 3RA7L 2JTDA 4LCYA 1W0VA 1IT9H 1CLYH 1ZGLA 3OG6B 3IS1X 4EN3B 3C6LD 3RFZC 1S7TB 5EC2B 1MCSA 4HMEA 4IJ3C 1NFKA 4LLQA 4CMMA 1FFPB 3FO9A 2JK5B 5JZ7C 2EO1A 1S7XA 2AEPL 4JR9H 4NQTA 4Q2ZA 4YXKL 3ARVA 3D25A 5DVMA 4JFQA 2OR8A 3L95A 2XFXB 2C5DC 1FPTL 5LBSL 3OBAA 3BZEB 1S5IH 1J88A 4FQXD 3SDDB 1VFUA 4BQ8A 3NH7H 4PJ7F 4OZHF 2AEPH 4JR9L 3UBXA 3SGJA 5B3JE 5IVNA 5BXFB 4G8GE 5BRZA 3GJFB 4WTXA 5IFJA 3DSFL 4N0CC 2DQHL 3O6FB 3CZFA 5TJWK 3KPRD 3E2HB 2IPUG 4YO0A 3QDJA 4AEFA 4FABL 1GGIL 4HG4K 2CKBH 1KTDA 1PDKA 3RU8H 4BZ2L 5D72H 3MZGB 1S5HA 5ENWA 4OZIE 1J05B 1EEYB 2JK5A 5D1ZD 5D2LA 1ZT1B 1NGYA 4JO2H 2DAVA 3S34H 1FDLL 2E9WA 4JE4B 4NIKB 1A3LL 1LO3L 2W0KA 4JHAH 2MSPA 2MCG1 5F3BA 1N64H 3H7BA 4HAGA 2VLJD 2BNQA 1Q9LA 4OI7A 1UB6B 4DGYL 1U91B 4HKXA 5EC1A 1K5NB 4WWKD 3ARWA 3V5HA 3Q1SH 1PZ5B 1DSFL 1PY4A 3CSBA 5CIPA 2AJZB 1WGOA 3G6JA 1U58B 4GAYB 4F7MA 3RTQC 4D9QE 4DAGL 3EYOB 2ZZUT 5JIIA 5K33A 3H3KA 1TZGH 4Z7OE 4XX1E 4F57H 5DRWA 3TYFB 4G9FB 5TDPB 1IGYB 1NLBL 5D7KE 2A38A 4PRID 1KBGL 1B4JL 5HGGS 3WUWG 1CL7I 1M7DA 3OXRA 3LD8B 5EN2A 2CDEB 5HHNB 4Q9QL 4MAYB 1DUZB 2P8PA 3PDGA 5I66A 2CR3A 4FQJL 4PJ9A 4U33A 2VN7A 3V5HB 1A7RH 3ETBF 1CE1H 3VFWA 2AXGB 1S78C 1KN4H 1MVUA 5HHVH 5HVHB 1RQ5A 1MCIA 3BH8A 3AMLA 3U0TA 4YQXH 1W0WA 1VACA 3LEVH 4LVHC 5DJ8B 3QJFA 4ZSOA 3NFSL 3RNKB 4JFFD 4MA8L 4PY8J 3PWLB 4U1SA 3GIVB 4PJEA 1JRHI 2QADD 4U6HA 3AS3A 3SDAC 4Z7VA 2WQRA 5DEGA 5GZOC 3MODH 5ERWB 3PUCA 1KJ3H 4JFDB 2Z31C 3JV6A 2YZ8A 4QHKJ 4UIKL 5K59F 3WN5C 3DVGA 3O6FC 1RZ7L 3OAZH 4G9FA 5TDPA 5D7IF 4WHTA 4LSRH 1UB5B 2R2HB 5FF6B 4LNVA 2JF1A 2XZZA 1F3RB 1JTOA 3U79A 3ARBC 2EDXA 4NZUL 3GSWA 3RGVA 2LU7A 1I4FA 3BQUD 4R8WH 4WNQB 1Q0XL 5F88A 3RWCA 1MFAL 5L88L 1INDL 1OWRM 1WV7T 4L4JA 3FMGL 4HEME 4XNMA 5DC4B 32C2B 1BPVA 2C7UB 2R0KH 3UTZB 1SMAA 4ONGH 3VG0L 3QDGB 3MOAH 3I6LE 5BJTB 3UZEA 1A4KB 1KN2H 4FG6C 3DETC 1Q8MA 2ICWJ 3KPTA 2EEAA 1I8IB 1JCKA 3K0WA 4YXLH 1RZJC 3QEQE 4ODHL 4JQVA 4JPKH 1CCZA 2YD3A 1DE4B 4YDIL 3ULVD 2HA1A 4CVXA 1T1YA 5DD5H 3EYSH 4V1DA 4E41A 3QUZA 4KPHL 4OQTL 4RNRB 5ESAB 2Z0BA 5K93A 2EYSB 3QHFH 3KWWA 4XCCH 5AYQA 15C8H 3EKCA 9CGTA 1SYVA 4NZUH 4M6NH 2HN7B 4RGNE 1EAJA 4FZEH 3TJEH 5I1KH 2DWDB 4ORZC 4Q9RL 2ERJC 1AGCA 3REVA 3QJFB 1AR1C 3MRLB 3TZVC 4PJBF 2WIIB 4RGOH 1WFTA 4YHML 4L9LC 5F7UA 2R4RH 3HB3D 4XPTH 4CAGA 2LV4A 1EIBA 2A83B 4APQD 4G8EA 3U7WH 5CGTA 2F5AH 5IQ9A 1QSFA 5D93C 1BFOB 4LGSB 3NVQA 4MQXD 4YGAB 4H1LH 2XZQH 3DX8B 4FQQA 3GJFK 2BVEA 4HXBL 3PDOB 3GSWB 3KYNA 1U3JA 1WVZA 5CZVL 4QXUH 2FB4H 2MHAA 4QRSA 2F19L 3E6HB 2NY5H 1MFCL 2W60B 4TNVK 2W0FB 4PJIE 4AEIH 4FQXC 4KI1A 1OB1B 1OVZA 4MD0A 2Q6WB 4CU6A 3F12A 3S4SB 4N9GA 4KRPB 3KPSB 2WINB 1V3MA 2ZJSL 2P24A 1MNUL 5CEZL 1ADQA 4N0CD 1KCVH 5J3HC 2BX5A 5C0RL 4UDUA 3LQZA 3OGCB 2R1XB 2GUOB 5CEXB 4AH2B 4RZCB 4GAJH 3T0XA 2PO6B 3TFKC 5FKPA 5CSZA 2GK2A 2JB5L 4G8EB 1AR2A 4G9FD 1T0MA 5D5MB 4TTDC 1EVUA 1RUMH 5DEFB 5EU7C 2QQQA 3U46A 4F80A 1Y0LB 4BUHA 2MCPH 3UXFA 4OCYH 3OJDB 2BNRD 1BZ9B 1PD6A 4OLXH 3TBSB 4CU7A 1KLUA 4JFFA 5DLML 1BGXH 2ATKB 2Z8SA 1MPAH 2KPNA 2GKIA 1CIDA 3MRHA 3ULUC 3RVUC 1HSBB 3DBXB 5MEQB 4MJIB 5C0BE 3NFNB 1PG7L 1OPGH 3FB6B 4TUOA 4JRXD 3QQ3B 3VXRD 3TT3L 4GG6A 3NZHH 2IBGA 1X5HA 3BI9X 1KFAH 3AGVA 3LRHA 4OLYH 5FYLH 2BOCA 1EHXA 3SE4A 1F4XH 4MJIE 5D1XA 2QQLL 1N0XH 5I16A 1KNOB 3C08H 4PJGE 1NQBA 2YSSA 5LWYL 1XGUA 1EO8H 1I8LA 1N3NB 3CK0L 4L4TE 1I7TA 3IFPA 4NWUH 1KJVB 4JFZL 5DRXB 2UVFA 2Z91A 3SKOA 1G0XA 1R3KA 3OJDA 4MNQE 1ZA6B 2HJFB 1R0AL 1SEBB 3HZYB 4UV7L 4XC3H 4X0KB 4UIMB 3P4NB 2XT1B 4OD3H 4YIQA 2PR4H 3GBNH 3HUJF 4KTDL 1NL0H 3PGCB 1A2YB 3VXRB 3QFDB 4BH8B 4M5ZL 4N5EC 3NIFF 3X12A 2Q8BL 5FKPB 5CKAA 3EDEA 4JPVL 1JMZA 5DQJB 4FOMA 3SJVD 3QUYD 2WANA 1CLYL 4OCRH 3VG9C 2WV3A 3ILQD 4KGLA 2XI9A 1ETZA 3FO2B 3RA7H 1KJ2L 4PJ5A 1SMOA 1FL5B 1KCRH 4XCEB 5INCB 5J13B 1HILA 4RGMB 1BVLB 2A1WH 4E0RA 4ZO6A 3C6LB 1JNHA 1ZHNB 5CBEB 1KPRA 1UQSB 1DLFH 2R2EA 4WEMB 1VGEL 3I75B 1P5UA 1HKFA 2BSRA 3SY0B 2PO6D 4M7LL 3E6FB 4CGTA 1RZGB 2YPLD 3MO1A 2H26B 1ADQH 1CDYA 2X1PA 4PJGB 3G04A 3CUPB 4D9LL 3ZTJH 4LRIC 2I5YL 3DNKA 4UIMA 2EZ0C 3LEYH 1TJHH 5EIQA 1FRGL 2R0WL 3OKLA 1JZ7A 4GAGH 2AJUL 4F7TA 2CIKA 4JJHA 5F89B 4F57L 4WI6A 1WAAA 4PTUB 3ZLQC 1DQJA 3G5YB 3A6CL 4P2QB 4RWYH 3U36B 5ID0A 3WS6A 2X05A 1MCWM 1X5JA 5I1HH 4HJ0D 2ZNXA 3I6GA 1HILB 1MCPH 2A74B 3H9HB 4LCYB 1U8IB 3VWJB 1GXEA 4NJAH 4FMFA 3GNMH 4Y19B 2HG5B 5CS7A 1MJ7H 1MCOL 3LZFL 4EBQL 1HIML 4I0PD 3TIEA 4CN6A 4M6OL 3QH3A 4Y1AE 4HS6B 3PHOB 4C56A 2BVTA 3MXWL 1HHJB 4NM4H 3E6FA 1NAKH 4PRDA 4JDVA 2IADB 4XX1G 4KQ4H 4HGWB 3U7AA 1CFTB 1S7WB 1LP9E 4G6AD 3QPXL 4JRYD 3WL9A 3HCVA 5KSUB 4P46B 2X4QA 2NW2B 4MMZC 4KVNH 4NGHH 2CKBL 3W9EA 1BZ7B 3ULUL 2XFXA 4L8SA 3ARFB 5FUOH 1XIWD 4Z7VE 4PTUA 3BUTA 3NIGE 3AS1A 4U0QB 2C3XA 3GM8A 4QRUA 3G6JE 4KUCD 1KIPB 5ADOH 1QFWM 1UYWH 1UM4H 2EE9A 5EORH 4JCLA 4I4WB 2CRMA 2EYTB 1R3JA 2DTMH 1RZFH 3GRWA 1KV3A 1T7YA 1Z9SA 3KPPB 2YD8A 5DQ9A 5IVXA 3QH3B 3KVQA 3MRPA 1RIHH 1W8OA 1KJ2B 1ZVSA 4B5EA 3QFJA 2IADA 5DJZB 1G9NL 2PTTB 3DX7B 2XTLA 4PJAB 1E0OB 1RUKL 4KTYA 1DL7L 5IB2B 4ALAL 1QFPA 1D5ZA 3OKKB 5CAYB 1JWSA 4O2EA 5CHNB 4GG8A 2O26U 4KI5F 3JTTB 4WI8A 4G8IB 1FGVH 4GW1A 5CILH 1JZ6A 4PJFE 1AE6L 1HK6A 4XTRD 2JCCF 3GMRA 5F6IB 4HIEB 2QHLA 2DF3A 4ZXBC 3CFIC 1GPOL 3Q6FA 5M95B 4OFYA 2BSSB 3RY4A 4C83A 1HIMH 4JFDD 1AD0B 3T4AB 5IMMA 1AH1A 5F3HA 2IANA 3ROOB 1QPPA 4R4FL 5L0QC 3NBNA 3L95B 1R5WB 3WL9B 1LP9A 4LMQE 3LSOB 5F6HI 4OZIF 1WQVT 3GBML 1ZWIA 1GZQA 3SCMB 5EU4B 5DVLA 2VLRD 2JIXA 2VQUA 3MV7A 3WNPA 3PP3H 4LLQB 3TJHC 4Y4HD 5C08A 4FXKA 3D39D 5J8OA 3D9AH 3HZKB 1QFHA 5SWQA 1GGUA 4OZFG 2R29L 4MXVE 5JA8B 5JIHA 3HI1B 3U2SB 3VFMA 5TE4H 3U4EB 5B39A 3G5VA 5IMOB 2NY0C 4PJGF 3GSQB 1WT5A 5IF0A 5T1KD 5CEYA 4QT5A 1HSAA 5FK9A 4IOFD 4OD1L 3IFLL 4GKNA 3NAAL 3RVTD 3PL6C 5C3LD 2ZOKA 4S1SH 2AJSH 3O4LA 3KXFD 5DD6B 2G9HB 3MXVL 1GGCL 2X89A 3O11A 2YA0A 4NNYA 4CNIB 5CZXC 5SWZE 5E8PA 4HPYH 4WW1A 4L8CA 4XXDA 3M1BA 1A4KA 1TVDA 3Q6GH 4IRSA 1QQDA 2HT4C 4HKJB 4J3XA 5CUSL 2NXZD 1NLDL 2ADIA 3QIWA 1CXLA 2VLME 3MSPA 3VXSD 1F6FB 4QXTB 3KYOA 3VI3E 3FKUS 4LLVA 2EDHA 4OD2B 5IG7B 2AK4D 2R0LL 2NY2C 3WLWC 3WN5A 3VWKB 1FZMA 3N9GH 5I1CL 3W9DB 1H3PH 3ZL4L 5DK0B 3ARBA 4ZOBA 4XP5L 1KIQA 3RGVC 3IFNL 2AJYH 1F6AB 1NDGB 1XCQA 4L3CB 5DURD 4Z78A 1KPUA 4N8VA 3BYTA 3BDXA 3UJJH 4JFHD 2XWJB 4LSTL 1FZJB 3LQAH 4IRJC 4JY6A 3QEQD 3ARDC 5FHAH 3UO1L 5IK3B 3RVXD 4MLIA 5ABDE 3BIAX 4Y16D 2DQCH 4POYA 4U05A 1A4JA 3C9NB 5SWZB 1DCLA 5GGRY 3SDCA 3C87A 2H9GA 3WNMA 2VXTL 1XF3B 3MUGA 5JDSA 1BD2A 4ZFOB 5C70A 4FQQB 4WY7H 4JZJA 5JXED 3VRIB 3BH8B 4MAYD 2CMRL 2QQNH 3Q3GA 1MVUB 3PQYD 1I7UB 4PJIA 3MRMB 3LKNA 1T04A 4L3CA 4CJ1A 4NKIL 1V5JA 3P0GB 4LSPL 3UTTD 1LO2H 5HDBE 4GRWF 2H2SD 5TDNB 2BC4A 4N0FA 5E0QA 1WT5C 1LEIB 2VRAA 4J8RA 2ZUTA 4E9LA 3WDJA 5KVGL 5ALBL 3CLEL 5TQ0L 4YFLI 1R5IA 1KCVL 4G8GA 5BRZE 2EH8L 4PB0H 4L9LA 3PL6A 3ZDZF 1SEQH 2XZCL 4ZFGL 3IS0X 5EPMB 2H2PC 3GMMB 1IAIH 3X11B 4LQFL 2VSDA 4OTXH 2ZCLH 4HUUB 5I6XB 4U4BA 4BSWB 5BS0D 1OHQA 1AQDA 4FFYL 4RNRA 3AU1B 3QDHA 4ZYKA 2B8OT 4N0YL 1MELA 5I1AA 5F71A 2E6JA 1OTUD 2FIRT 4WO4A 4HX1A 1G9NC 1I8KB 4HC1L 3HI5L 1RURL 3CFJA 2AP2A 5L2KD 5ISZA 5M7QA 1C1EH 3DX6A 5FA3B 2F5BL 3RZCA 2OXGA 3LB6D 4Z7NF 1JNNH 5TDOA 1UJ3C 1OGAE 2C1PB 3VXNA 1S7SA 1QBLH 1FNSL 1LEIA 3PP4L 3GGWA 2A73B 1GOHA 4WU7B 3MACH 4Z7UE 1FE8H 3EZ8A 3BN3B 4L8BB 5KANG 5T1LD 3S35H 3KJ4B 3MLWH 3Q0HA 4J7RA 1K3IA 4OFDA 1U6AH 1P6AB 5HYSG 4AL8H 4FNLL 3WO4B 5JTWA 1EMTH 1JYWA 4HAFA 4ZUWA 1RK0A 4A2MA 5K9JL 1RJYB 3VGHA 5ETUB 4TSBL 4Z76B 3L9RB 4F3FA 3EYSL 1L0YA 2KZWA 4P2OB 2QSTA 3GM0A 4KZEL 2DYPA 5GS1C 1CN4A 1GOFA 2D7TL 4U6XA 4X9GA 5DK2B 4KZDL 1VFAA 3GHEL 3JV4A 4M62H 4DKEH 3LPFA 5FCUL 1G6RB 4X8JA 1UC6A 2AQ2A 4N0RA 4PRHA 5IOPA 4LHJB 5D8JL 5J7CC 4IHOA 1KOAA 4LCIH 2E7CA 1BFTA 3QNXB 4K3GA 3RPKA 1L9MA 1JPGB 2A6JB 4BSWA 4XWOD 4ELKA 4E42B 4W81A 1LE5A 3BEWB 1ZHBA 4H5SB 4LRNL 4TVPE 5C1MB 1GVIA 5JPMA 1INDH 4GXVL 5MP6L 4FFZL 1RK0B 2Q7YA 4HJJL 5KANI 5CCKH 2VDPH 1BLNA 5SWSD 2WP3T 1A7NL 2WINA 1EZVY 1MSPA 1XIWA 2X40A 4PRAB 3OKMA 5DYOA 4QEGA 2QHRL 4RMVA 3ZKMD 5ISZB 4M3JA 4O2CA 2VR9A 5DJAB 2JJWA 3SBWA 4GAFB 4DW2H 5TDOB 5D96B 4YC2C 2HWZL 3MPCA 4LNRB 1OAXL 4K3JH 5KSBA 4AH2A 4AIXA 3D69A 3PWPE 3WDHA 4GW4A 3VE0A 4Z77B 4L3AA 3ZT6A 4RIRA 4MXVF 1WAAE 3AS2A 1XAUA 4L3EA 1V8HA 3S37L 3TO2B 3HMWH 1OTTD 5JIKA 3ZT5A 1SBSL 1M71A 4JO4H 3EYUL 3QWOB 5FO8A 4GS7B 5C08D 3H3PH 5JHDA 1BOYA 1ACYL 1MCNA 3P0VL 4IRZL 2PNDA 4P4KB 1BBDH 2VZOA 1TTGA 3MROB 2ATKA 2V9RA 1A21A 4JM2C 3MCLH 3FN0L 3VFRA 3LPGA 1DANU 1UCBH 3TVMB 4QCIA 3HCVB 3GMOB 4Y4KD 1CK0H 4Z95H 3UYPA 5JQ6L 1A6ZB 2VB5A 2XOTA 4JDZA 4P2OC 3L5WB 3QR2A 2BVOA 5DJ6B 1HHJA 2BOCB 1J0KA 4XBPA 4YHOL 4BZ1L 3U0PB 3GSOB 5FYKL 4YHLH 1E6OH 2DKMA 2ATPA 4K23L 4XVSH 4P2OD 5DO2C 1I9RL 4GW5B 1WZKA 1HNFA 4NKOA 2CLVA 5HYSA 4LSQL 2HLAA 1MHEA 3O3AA 3REWA 1N5YL 1K4DA 1X9QA 3QUXC 3MOBH 4PFEA 1KYOK 3P30H 4LCCA 4OM0L 5GZNC 1JGLL 12E8L 2X9WA 4Y4HA 5E8NA 4I77L 1F8TL 4Y4FA 3FRPG 3TM6A 1PG7X 4M00A 2VDML 1NC2D 3CFEA 4WEBL 5IT2H 4PGBA 4Y8DC 3U6RB 2MPAL 1L6ZA 5H94B 1KCSL 2P8LA 3VFVA 3V4PH 4NQEE 4QOKE 5GJSH 4IDLA 1JRHL 1DUYB 1A7OL 3ZKNC 3RBSA 2HH0L 3SDXA 4JM2B 3CMOH 3QEGL 1W0YT 4JAMB 3VD5A 5F9JA 1OF2A 2VTFA 4PJFA 2HFGL 1P5VA 2D3VA 3RVUD 3MGAA 4NJ9H 3KHOA 3UJIH 4WI2A 3V6FA 2ARJA 2AK4A 2X4RA 1QFWI 5DHVB 1IBGL 1D7FA 3SBWC 3MLPA 1XGTB 2BXZA 3MO1B 1KB5B 3T77A 2C1OA 4MXQC 2W91A 1JGVH 4IS6A 3SCMA 3SDDA 4XBPB 1OW0A 2GK0B 2ZPKH 2B7DT 1FJ1B 5E2WH 4UB0H 1DQLL 1G9ML 1P7QB 4NYLB 2F53E 2KZ1B 3GJFH 2IGFH 3H2WA 4FRWA 5I1LA 4XNYL 2OJEB 4L3ED 2E6QA 1XF2A 1OP3H 4UTAL 3MRGA 3CFKB 4JM2A 1FAKT 1A6TA 5KW9L 1SHMA 3LS5L 2BRQA 4U3HA 5K9QG 2K9UA 3WE6A 1YQ2A 2KKQA 4F7MB 1UADC 5I76A 5F7MC 3K46A 1SY6A 2EIEA 3STLA 3SE8L 1QLEH 1JJUA 1XGTA 4KUZH 3QEHA 2IALA 3DTXA 4NC1E 2NPLX 4MJ5B 3GSQA 2Q86B 2YEZB 2G9HA 5EUKB 3TPKA 1Q9KB 1TTUA 2APTA 1Q9LB 5DWUL 3H9YA 4CNIA 3MUZ1 1LDPH 1OQOA 3MNVB 5C8JA 4Q97A 3MNZB 4MAUH 1UACL 4LSDA 2CUIA 1IEBA 3JWDL 3ARED 1DBBL 1W8NA 3JTSA 2W38A 1R3IH 2VMFA 4NRYA 1YECL 5EULV 4KHTL 3FZUC 2AK1H 5IB2A 5DHYB 4Y88A 3S88H 3C5SB 5I1LB 3U0TB 4FFWD 1ZTXL 4EJ1C 3U83A 5EWIL 3PWLA 3KR3L 3GMRB 4X5LA 5HI5C 4ZFFA 3P0YH 4GBXD 3WFBH 3QXTA 1L7TL 2EDOA 2JJTC 3LDBC 2HVKA 4G7VH 4UILL 1NBZB 4HULB 2B4CH 5EN2B 3FB8A 1TNMA 2XWBB 4WI3A 2BNUB 4JVWA 3ULVH 4M6AA 3GB7B 3WFHB 4M5YL 3RZWA 2G60L 4XVJL 1FJ1A 1UM6H 1TTFA 5IROA 2X1XR 1J5OH 3KYMA 5GQBA 3BGAA 3VWKA 5DHXB 5B38G 4MB5A 3MNVA 4PJXF 5CP7A 2E3VA 4QRRA 3K3QA 2PW1B 3D6GA 1AD9B 3DROA 1UWXH 3P9WB 1F6AA 5EFIA 4NWTH 3WKML 1ONQA 2Y36H 1B0RB 5F7DB 2Y07L 5I76B 3OKEB 3MR9B 3TNMA 4R4ND 3KLHC 4EI6B 4WHYG 1T2QH 4AYFA 3O6MH 4Y4KC 4P2QE 2DQTH 4YDJA 2L7UA 1UB5A 3SDYL 5I2IA 1MHHA 5D7IE 2YRLA 1AD0A 3OPZH 3V5DA 4G42A 4ODUB 4MQ7A 2VDRH 1BFVH 3BPCA 2O5XL 1DBKL 3BESR 1T7ZA 5KVDH 4HIJB 2VR4A 1FCCA 2CJUL 4W70A 5C0EA 4PG9B 4V1DB 4E41B 3LDBB 3E2HC 5D6DA 5T1MA 3LVEA 2AEQL 2B2XL 3MJGX 4G6MH 4GMSH 4IBLT 1IKFL 3PV6A 1I1AB 1OM3L 3VW3L 4O4YL 3RWFA 3MREB 3TVMD 1XR9B 3NZ8A 1UM5L 4IRJA 5I74B 1MIML 2FO4B 2CKNA 4PJCA 2D9CA 2IPKB 4M7ZB 2DIBA 1INQB 1H8NA 3VXUB 1C08A 2I07B 3LKOA 3QCUL 5E1HB 4MQ7B 5EUOA 1BWMA 4TOYL 3S36H 4LVEA 5L6YH 3KYMB 4XCFH 1GC1L 4I3RH 4OBRA 4OUUA 5ICXA 4R96B 5C2UB 1Z0MA 4G8FA 3QUKB 2UWEF 1JNLL 1TPXC 3GJEA 3NCCB 3QIWB 4HBCL 2FJFB 2VR5A 1K4CB 1MUJA 4C4KT 1B0WA 3VGFA 2VIRB 1MCEA 1ORSA 1WCBB 3E3QC 2R69H 4JRXA 4U1MB 4X6BA 1DZBA 2EE6A 5C7XL 1IGJB 2FJGA 4M1DL 1I9IL 1KCUL 4XAWL 4OZFH 4U1SB 2NXZB 5E56A 1QLFB 1DR9A 3TFKD 4FP8H 1RIUL 4LLUB 3ME0A 1QSVA 2ESVA 3EBAA 4HW6A 5I8CA 2GSIB 2QSCH 2AI0L 1PX3A 5C09E 1U9KA 5DFWH 1WCQA 1I75A 2DBLH 5IHBA 1NCWH 2DQEL 1BP3B 4MVBD 2A9MH 4X4YA 2VC2H 4PRBB 4IOSD 5IVZB 1F58H 3D18A 4TSAL 2ZCHL 3WYRA 1WICA 2RGSA 3GO1L 2NY0D 1A0QH 1QNZL 3B43A 2YN5A 3V95A 5JNYB 4U1JB 1B3JA 4ZSOE 3IDMB 3EOAA 3QIBB 1K4CA 1MUJB 4OAWB 2FWOA 4U1IB 3V4VL 3BEVB 4I5BB 2XACC 4JFOA 3LB6C 1WZ1L 2EC9U 1F02I 1T83C 3BSZL 4ONOA 3V0VB 4M93C 1QKZL 4XNQB 2KDGA 4XNUH 1MCCA 3SE8H 2DRUA 4M7KL 4URTB 1S7VB 1GGBH 2FRGP 4P59L 1HXMB 5J12C 4QRRD 3PWVA 2X4SB 1KNOA 1CGVA 4EVNB 3W5MA 3MA7A 1NC4B 2DD8L 4HDIB 4OCXL 4P2RA 4UAOB 4YBLC 3V4UL 4UNVA 1CGWA 2VSCA 3MA9L 1G1YA 2HFFB 5JMOC 2NY3D 4UINL 1AHWA 2OL3H 5JQHC 3FB6A 3CIQA 3LHPH 3PWPB 4NO3A 4QHNB 1TXKA 1ED3A 2BOBB 4K8RL 5DT1H 2H1PH 3QI9A 2AJVL 3AU1A 1EAPA 1BJ1J 1X7QB 1G6RL 2RHEA 2C3GA 3INUL 3AVEA 3WCYA 1NKRA 4OB5H 1K6QH 5DFTA 2DLFH 2VKXA 4NN5C 1CLOL 5D7SL 4CRPA 3D18B 1IM3B 4JQXA 2LTQC 1NC4A 3RWGB 4DVBB 5J4MA 4OF0A 4X0KA 3T0EE 4WWID 3V52H 3DX6B 4XMKL 3PWVB 4LARH 5FA3A 2Q8AL 4M93B 3BO8B 1VFAB 35C8L 4NPYB 4Y16C 4JPIA 4WU7A 1AHWB 2HFEB 3VFRB 1G6RA 4PD4K 2P24B 1YEKH 4H1LA 3VXTA 1OGAD 2YC1B 2VXSL 5I18H 5FECA 2W9EL 4N68A 2YXMA 1F11B 5MHSE 2B4CC 1DQML 4J2XA 2J3SA 3LH2H 2FECL 3ZYIA 4E42A 4Q6IB 3CLFH 4ZQKB 4HUKB 3UTTA 2X41A 3T2NL 1YUHA 1ITBB 5ADPH 4Y4HB 3MA7B 3HN3A 4JN1L 4UT6L 4B7IA 1ND0A 3CC5B 4Q7DA 5FGBA 2OLDA 3I6GB 4X8JB 4JDTH 5HYQB 1PSKL 3MZTA 3FQWB 3PG2A 5HYJE 5EOQL 4FQXA 4BQ9A 1LO5A 3LKPB 1KLUB 5LG1A 4O58H 5L8JB 8FABA 4XWGH 3UPCA 2HTKC 5T3XH 1RJLA 1J0YA 1OQXA 4JFPA 1QOKA 4ODSL 2V5SA 4DUWA 5I1GH 2OL3A 2W9LA 3UEZA 3GSNA 1OAUL 1AI1L 3K1DA 4ZO7A 3X3GL 2X9YA 1S7QB 4Z7UA 1BM3H 1YY8B 2A6DA 1R3HB 4JDVB 5HDQH 1DQQA 2EE2A 5JW4N 1V7NL 3DURA 1VFMA 4X4XB 4EUPA 2JJSC 3QP3A 1RMFH 4X6EB 2ARWA 4P9HL 4CBPA 5C0JA 3ILQC 4ONHB 2XNAA 4G7YH 1QHOA 2PO6C 3RWEA 4CDGC 5C07E 1MRFH 4PJ8D 4U1LA 5SWSB 4YPGB 1FVDA 4G80B 1LK3H 3C8HA 3UDWC 2OP4L 2DJ4A 5I17B 3PHQA 4KXZI 1FGNL 3MRIB 2ED8A 1D6VL 4LSUH 4DN4H 4FQXB 1KJ2A 5HTSA 1FLTX 5F9AC 3H9SD 1DVFB 1R3HA 1TJIL 4H88L 1DEEB 1ITCA 4U1GC 2APXA 2CXGA 2J8UA 1VERA 1UJ3B 4RMQA 4U6YB 5HHQA 3MMEB 3TA3B 1EFXB 3MFGB 4WRLA 3FB7B 1UZ6E 2VQ1B 1NCCH 4PB9L 4M1CC 1OOAA 4LLMA 3G5XB 5CHNA 3DI3B 3MCKB 5GS0D 1NCNA 5I1JH 1QP1A 1K4DB 2O61B 1H3GA 1CFVL 3WFDL 4Y16A 4XGZB 1H3VA 3GSVB 4AEHH 3OQ3B 4LHUG 3HZVA 5HYJA 4YNYA 4TUKH 3FN9A 1A6UH 3TZVB 3NGBB 5J6HA 3ZE2F 5I17A 1MCKA 3VGAB 3JTSB 4NRYB 4OGZA 1U8HA 3ROLA 1YDPB 4F15B 5C0CA 1S9XB 3AB0B 5ESQA 1K3ZA 4NO2A 3A6OA 4PJHA 3CZFB 4CADA 4GQ9H 3DHMA 1KIRB 5GGSB 1UXSA 1MY7A 3IDUA 4DFHA 3ULSB 5KN5A 3QUZD 2HP4A 1JHKL 4LKXA 4M3KB 4L1DA 5D4QA 5LAXA 2HT3C 3BGFB 1U3HC 3VFMB 4YAQA 2X4RB 2R1YB 4ACPA 5CJBA 1VEMA 2DM4A 1HXYB 3BSZH 3TH3T 2V5MA 5A1AA 4X80L 3H3BC 5B39B 3O9WD 1CVRA 1IILE 5KSAD 3B9KB 4NHCH 5E9DB 4XPHH 4XXCC 3LRGA 1G7MA 3PGFH 1U8HB 1AGBA 4HGKC 3ROLB 3MLYL 1I85A 2JJSA 3H9ZA 3STBA 2AS5M 5GISH 3K2UH 1DUZA 2P8PB 5EU4A 5ESQB 4HWZA 5MEOA 3OZ9L 1D6EA 4LCWE 4P99A 2J8UE 2ZG1A 1G7LB 2QQKL 3VI4F 1Q94A 2CLZA 1D5MB 3KPOA 3WLBA 1MRDL 3C2AL 5AG9A 1IGYA 4G5ZH 1Q38A 4D0DB 1ZT4B 3LV3A 1ZLSL 1JV5A 5C2BH 1M7DB 3HI6H 4ZODA 1JHLL 1AXIB 4JLRB 1U8JA 3K81A 4WI7A 1UWGL 4ZOCA 4WV1B 3PHSA 3WIHL 5E4IA 1X6LA 5T1DL 1XGQA 3ALXA 3CX5K 5BZDA 3IKCA 1MVFA 2D2OA 3ZZ1A 4ESKA 3X3FL 5JPNA 3CFCL 3LEXB 3PABA 2Q87A 5C7XH 5HVHC 3EHBC 3OF6D 1HCVA 1AXTL 2QADB 3R0NA 4WFFE 5D1ZA 3UTSE 1KGCD 3IDYC 1NCUA 4FQHB 1P4IH 5B38A 2RJMA 3RRQA 2XQBH 5IB3B 5D1QA 5KG9B 4HIJA 1JNLH 1JPST 1T1XA 2P4AB 3EOYG 4WWKA 4G3YL 4C57C 3DLQR 1D5ZB 3OKKA 1QFWL 3W0WB 4CN1A 5DMKA 3QDJB 3BOVA 1Q94B 4HEPG 3FO1B 2FO4A 3O6FA 4ZNEA 1JIBA 2V7HA 4DFIA 3FB5B 3GI8L 3W39B 5KVMC 3MBEB 1I1AA 1JZ8A 3UBXI 1EHLH 5ALCL 2V5YA 1MEXL 1Q72L 4G8FB 4XP9H 2EDBA 4HQQH 1DQDH 3EYQC 1A4JB 1F4YL 1DP0A 1RUQL 4X5WA 3LMJL 1NMCB 3HE6C 3LKOB 5EUOB 1BBJA 4Y2DD 3BKCH 1N6QL 3DETD 1EGJL 5ISZD 5AYUL 4AM0B 4GAYA 4WWKB 2H2PD 2D4DA 1J1OH 5F1NA 5KVDL 5F7EH 1UFUA 4TUJB 4YHZL 3R1GL 1A9BB 4KAQH 4JEGB 2MOVA 5JA9A 3ZL4H 4MA7L 3NIFE 5B8CA 5GS3A 4DUXA 1I3VA 4L4TB 4HWEH 3THML 1T1YB 1YYMH 2NXYC 4XXCA 4QTHB 3C2SA 4CJ0A 2DQJL 1IGJA 1QBBA 3CDFA 1D5BB 2OJZH 4UBDD 3FB5A 5T5NF 1EXUA 4DGVL 5E95B 3NPZB 1C12B 4R26H 2J4WL 1CICC 1J1PH 2XQBL 3LN5A 3O4LB 2QV2A 4LKCB 3G6JB 1A1MB 1C5DA 4RA3A 4ZXBB 3UTSD 1NCBL 1I8MB 2BC4B 4N0FB 4PPTA 4I5BA 1T5XA 2HTLD 3GUTA 3WXVL 3B9DA 3RGHA 1X5YA 1UXWB 5A2JH 3MXVH 3O9WA 1FG2A 5ITBH 1KIUA 4P5TD 5M94B 2BSTB 5C0FB 2WZPD 4XCNB 3J8F7 4JY5L 3T3PE 4OCWL 2NY1D 4HD9A 2P45B 3RDTB 1FH5L 1XT5A 3UX9B 3OR7B 3V6OA 4OZGA 5CP3H 4OLUL 3RWIB 1HZHL 3ZKQD 5I8KH 5J13C 5IB4B 5DEFA 3GSUA 5ICXB 2ORBH 4WWKC 3S88L 4K3DL 2UWEB 1TQCB 4XPAH 5IJKC 5DK3A 4MAUL 5TPWL 3QCTL 4P2OA 4RZCA 1KPUB 5EG6C 4RMSA 5GGTH 4JRXB 4PJDA 2HFFA 4KDTA 4UV4L 2G75B 3QQ3A 5C0ND 1VHPA 5CD3B 1UZ6F 4OGYL 4WHTB 4ZS6D 5JDSB 3SKNB 3TBYA 4GH7B 1HQRB 2X4PA 1F90L 2BFVL 3R1GH 4X6CF 4LPYA 3DUSB 4NFBA 4LL9A 1IC4H 2DJSA 5IEHA 3FO0L 1QSEB 1JGUL 43C9B 3MLUL 4F37K 4UTAH 3CMGA 3W11C 4TRPL 2UZIL 5GSVB 4X6BB 1YEGL 5E7FA 2WM0A 5E2WL 3SPVA 1F4YH 5B8CC 1C16A 4PJBB 3P4NA 4HK0B 3DGCR 1MI5E 2ADFH 3ALPA 2OTUB 2FEEI 4ETYA 4YHYC 1I8IA 4H0GA 3MLXH 3EDFA 3NACL 1OAYH 2FATH 4LLUA 5EZIH 5GS2D 4N8PA 1MFEH 1N3NA 1RIVL 4YFDB 5L9DL 1CU4H 2XTJD 2D0FA 5E24E 1KLGB 1RIHL 4KK9D 2NLJB 3SDYH 1CICA 1CDCA 1NCCL 3AFLA 3QWRD 4PGDB 1T22B 4OZGE 4L5FL 4HBQA 2W0PA 3FQRB 4RAVA 3T3MF 1RZKH 4DJMA 1PY9A 1A14L 3WO3B 2XN9E 2X4TB 2X44D 4M6MH 4BFIA 2MNUA 2W60A 1RULL 1DVFC 3EOAB 1INEH 1A6WL 4MNQA 3WXWL 4TNVF 4XB8A 1NGZA 4J1UB 3VCLB 4RFOH 1PFCA 4K3DH 3KGRA 3BRGC 4GRMA 5EZLA 3OG4B 3I50L 2HT2C 4R9HA 1FZKA 3ZTNL 4N9GB 4M8VA 4HLZH 8FABB 1F8TH 2V2XA 4LHUA 2VLKB 3IXAB 2AJXH 2VH5L 3NA9H 5IEHB 3M8OL 2GJZA 3X14A 2VZTA 2A0LD 5AZ2H 1MJ7L 1KB5L 3BKML 4P9MH 5I75C 1SM3H 5IIEB 4J3TA 1QBML 4G43A 4X6EA 1I9RH 5E70A 2RFXB 5JOFA 4I8DA 1CVSC 1MHCA 2HG5A 2IG2H 2VDLL 1HQ4A 2XZAL 1NFDE 2CLRB 3EOTL 5GISL 3WJLA 2OR9L 1OAQH 3PHOA 4MDJB 2Y23A 4XWGL 5KS9A 4UDUB 2IG2L 4EOWH 4EKXA 5DMIH 1R3LA 4U0RB 5EOQH 3G5YA 5HI4C 5J1SC 1K9TA 1CBVL 1S7WA 3BPLB 5E9DE 1UJ3A 3WNNA 3IKKA 3RUGF 3FN0H 2Q7YB 1PEWA 3U0WL 3EYQD 2VITA 3EFFB 4JFYB 3F7PC 2R9HD 3NN8B 3HE6D 4PBWD 1MJUL 3U9UA 4XBGA 4DCQB 2WUBL 3CXDL 4ODVH 3V5KB 1HCFX 2D0GA 1OAKL 2V17H 1WWWX 4B41A 1TQCC 3V6FB 4C4KO 4H1LB 3VXTB 4JFED 3L3IA 5JW4R 4Y16B 3HHRB 3O2DA 1PQZB 3N85H 5CBAB 3OKOB 3C5ZC 3B5GA 4OCMC 5D7LD 3H9SE 4WFHD 3TO4A 1Q72H 5FECB 2PTTA 2GJ6A 3T0DA 1MIEL 3Q5OA 2J12B 1U8KA 3M17A 4OF6A 2XY2A 4N90E 1CDUA 5T5FL 4MZ3A 4OI9A 1YNTB 3IDIB 3GI8H 5FCSH 5FXCH 5JR1H 2P7TB 2P44B 4YXHL 1L7IH 4X7DC 4YBHA 2NZIA 1CFQB 2WAHA 4YE4H 5FB8A 3U9UB 3WFEL 3WO4C 4GRLB 1LEKA 1YEIL 4JFYA 4PJ9D 1OCWH 3D1MC 2MFNA 2O5YL 4CU8A 4X7EC 1JPSH 3BZFB 2FGWL 3GSNB 4EUPG 3G5ZB 3NCYS 3PV7A 3BFOA 5FM4A 3V4PL 1G84A 3S5LA 5FM5O 2ZUUA 3K4ZA 1ORQA 4M48H 4POZD 5I71C 2I27N 3KPOB 5D6DC 3HLAA 3QDGE 4Y89A 5IESL 2HLAB 5DRZB 5T3ZH 43CAB 3KG5A 4PRHE 3QQNA 4TYUA 3U48A 4N8CL 4DK6A 1XCTA 4FA8A 5EDXA 1UWGH 1BD2D 2DB8A 4WTZA 4OGYH 1JVKA 1Y6KR 4HWBH 2P7TA 1MFDL 2MTPA 1RHHA 3WEXA 1H5BB 1JI2A 1U3HA 1G0DA 3H0TB 3DO3A 3MACL 3B8YA 3OZ9H 4GOSA 5HHME 4P4RB 3H42H 1FZOA 5I1GL 5B21A 4DWHA 3MV9D 1J05A 2O5ZH 5D2LB 2ZOKB 4C56B 3GB7A 2J7LA 3ZYZA 3SDXB 1QNZH 1IGCH 4F7TB 5L2JB 3E1F1 3FL7A 1C1EL 1UKQA 1ZLUH 4NHCL 5JPNB 4ELME 5DRNA 2BVYA 1S7RA 3BDYH 1YN6B 3PQYA 4KROB 4S0TD 2X4OB 4HKXB 3ZE1E 5F70A 3MCLL 2VH5H 4WW1B 4PJCE 4U1NB 4O5LL 3CVIL 1YY9D 4H0HB 4JKLA 3SDCD 5T3ZE 1BX2A 2FCBA 3ZKXC 3TA3D 1YNKL 2DJUA 1FFPA 3FO9B 4YAQB 2FB4L 4ZTPH 4AY0A 3ARYA 3BD4A 1I9IH 4JG0H 4QXTA 3CVHA 1J8HE 4TVSa 5TQ2H 3PWNA 5C0AB 3OAUH 3IJYB 2J88H 2C4XA 5KSUA 4HZLA 4PLKD 1JHTB 2R4SH 4X99B 1VDGA 5JW3L 2R4RL 4YHKL 3ARBB 3UBXB 1IEAB 5GZND 4M9PA 1P4BL 2A9NH 1SJHB 2YUVA 5BRZB 3S36L 2CGRL 2WBJB 3CNKA 1FYTA 1M6OB 2IH1B 5JR1L 4CMMB 5CCKL 1XF2B 1UM5H 4XMLH 2N56A 4AMKL 1HXYA 2X5PA 1BD2E 5GSRA 3WNKA 5KZCB 4DQOH 1BF8A 3SGEI 2P5EE 4PJEB 1EEYA 1KENL 1H8SA 3MNZA 3HRPA 3QAZC 3RVXC 3VFUA 4ZPTB 3LHPL 3EJYC 4LSUL 4LPXA 4N8VB 1BD2B 2J6EH 3ABZA 1NBVH 3HMXH 5T5NG 1JWSB 1WUNT 3DGGB 2VISA 3VXSA 4K2UL 3BUYB 1DBJH 3V4UH 5BCAA 1T5XB 5BS0B 3GBLA 3GMPB 4EEEA 1YNLL 1OD7A 2P8MB 2FD6L 2VWEC 1DTUA 2GYSA 4JKKA 1KCKA 2E9IA 5C86A 4PS4H 1H3PL 1CT8A 1F4WH 4PJDE 4PG2A 1R5IB 1ORSB 5IF0B 2NY7L 2XG4A 5DMJB 1E4WH 3L6FA 3PL6B 4HT1H 2ZSWB 4B7LA 1FIEA 2VLLA 2GITA 3UZQA 2YMXL 5T3ZD 3SQBA 2FGZA 5C0AE 4MCZA 5J11B