3DVRX

Proteinase k by lb nanotemplate method after the first step of high x-ray dose on esrf id14-2 beamline
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvrX00
4DJ5X 1YJCA 4CFYA 1A2QA 3QMPA 4OMCA 2WUVA 1PFGA 1GTL1 1SCDA 5JXIA 2XRMA 3F7MA 5JXHA 1SUBA 3UNXA 3WIVA 5ARBA 5FAXA 1SBIA 2PKCA 1BE6A 4K8RB 1BE8A 1GT91 1SBTA 1GA1A 1NDUA 1AF4A 2Z2YA 3EIFA 1TM7E 3Q5GA 2ID4A 1PEKE 1DUIA 2SECE 1C9NA 5CW1A 2Z30A 3DE5X 2Z56A 1C3LA 2WV7A 2PQ2A 1SCBA 1UBNA 3ZXXA 2PWBA 5ARCA 4KB5A 2TECE 1OYOA 1R0RE 3BGOS 3WHIA 5JXGA 3I37X 1SIOA 1C9MA 1XF1A 3PRKE 1TM5E 3A3NA 5B1DA 5K7SA 2W2QA 3DE0X 1PJ8A 4CG0A 3GCXA 1Q5PA 2PRKA 2WWTA 4LVNA 2B6NA 1GA4A 1SBCA 4H6VA 2G4VA 3LXUX 1TO2E 3DDZX 1CNMA 1BFKA 1WMEA 1LW6E 4AKTA 1VSBA 1SCJA 1Y3FE 3LPDA 3D43A 3CNQS 3GT3A 1P7WA 2SICE 3P5BA 1SCNE 3EE6A 4H6XA 2ZWPA 3WQBA 1Y33E 3GT4A 4HVLA 3BX1A 4J94A 1R64A 1Y9ZA 3I30X 3VYVA 4C3VA 1NDQA 2DQKA 4BWGA 1GTJ1 1SBNE 3WIUA 2ZWOA 4C3UA 4NE7A 1Y48E 1AV7A 5AVJA 1S01A 1GTG1 4CFZA 1GNVA 2HPZA 3DE7X 1SUEA 3GCWA 1TM1E 3TI9A 2WUWE 1T1GA 3I34X 4RYDA 1S2NA 2DUJA 1SCAA 3EDYA 3ZXYA 3CO0S 4DWWA 1SPBS 5B1EA 3D9QX 4DZTA 1HT3A 3F49S 3DW3X 1Y3CE 1SIUA 1BJRE 1Y4AE 2DP4E 4KG7A 2Z58A 3AJ8A 4ZOQI 5JXJA 3A3OA 5AVKA 1KDVA 1AU9A 1MEEA 3AJ9A 1SUPA 3DE1X 1P7VA 3DE6X 3BPSA 1BFUA 1CSEE 1THMA 1SH7A 2SNIE 3LPAA 1BH6A 1KE2A 1ST3A 1IAVA 1Y34E 3TECE 4M1ZA 4FONA 3L1KA 4JP8A 2W2OA 1YJBA 3LPCA 3DWEX 3H42B 3QFHA 1KE1A 3DE4X 1Y1KE 3DE2X 1V5IA 3A3PA 3DVSX 3VV3A 1ZVKA 1GNSA 1GCIA 4ZARA 2IY9A 5JMOA 1KDZA 2P4EA 2ZRQA 1TMGE 2PYZA 3TI7A 2SBTA 2W2PA 1T1IA 4H6WA 2Z57A 3DYBA 3PTLA 2Z2XA 1OYVA 3QTLA 1DBIA 1Y3BE 1KDYA 3DE3X 3VSBA 1R6VA 2QTWB 1SIBE 1T1EA 2X8JA 2XTJA 1TECE 2ID8A 3VV2A 5SICE 1YU6A 1SELA 1AH2A 4AKSA 4Z2AA 1ZVJA 5FBZA 2ST1A 2GKOA 1MPTA 4NE9A 3DVQX 2HD4A 1AQNA 2PMWB 1AVTA 2Z2ZA 1SUAA 4LVOA 4KPGA 1SN7A 1S02A 1GA6A 1Y3DE 3T41A 3DW1X 1V6CA 3OSZA 3F7OA 4I0WB 5I9SA 3I2YX 5AQEA 5AMXA 2IXTA 2V8BA 3SICE 1TM4E 4OV6B 1AK9A 4HX2A 1EA7A 1SUDA 3SQOA 4YN3A 1C9JA 2X8JB 3Q40A 1EGQA 1TM3E 4OMDA 3DVRX 4WOCA 1TK2A 1WSDA 3HJRA 4WOBA 1IC6A 1WMFA 4MZDA 1JEAA 1TO1E 4NMXB 1SBHA 5FFNA 1WMDA 1NLUA 4GI3A 5ARDA 2W2MA 4B5LA 1WVMA 2E1PA 1ST2A 3VHQA 2W2NA 1YJAA 3AFGA 3VTAA 1P8JA 1SVNA 1PTKA 1OT5A 1SUCA 1Y4DE 2PWAA
chains in the Genus database with same CATH superfamily
4DJ5X 1DEKA 1SVUA 1U80A 1WDMA 3O8OA 3PGVA 4QBGB 1GU7A 1D9XA 2QM7A 1G6OA 2GAFA 3JYNA 4G36A 4E1BA 2JGKA 1Z4NA 1JKFA 5LC1A 4ZJPA 2QN9A 1KFCB 2GM3A 4TWIA 1PFGA 1NY5A 3E3NA 4L8FA 5DEOA 2HA7A 5CT5A 16PKA 3TSAA 4M6WB 1FSSA 1X8LA 3DEKA 3RUHA 2ZVJA 4EZIA 2ZP1A 4M7PA 4TX1A 2ZIAA 4LJLA 3NKFA 1R15A 1PT8A 5FAXA 2YWRA 1P60A 1KOLA 3TW0A 1WZIA 2M9MA 2XMSA 4W6QA 5ANRB 1SJ9A 3HN7A 4JEIA 4IOMA 4K9SA 1F8GA 2OTCA 2HW8A 3FUVA 3NHFA 2Z4RA 2ZT8A 2JFPA 1E7YA 3R7LA 5BNTA 4KC0A 1UC4B 4RSMA 1PZMA 1D5WA 1JDSA 2GFQA 2HQBA 4ZCLA 4ER0A 5A4FS 3HDGA 1LC3A 2QAGB 1D8AA 1PWHA 2X8AA 2C2WA 3FVRA 4NOLA 4TRMA 1RI5A 4C4SA 4FDAA 2O52A 3LHDA 3KS9A 2JGDB 1IPFA 3FCOA 3KUKA 3TRFA 1OLUA 3O03A 4RGBA 1W52X 3ASVA 2OUKA 2EJBA 2SECE 3ZHQA 2J5XA 2JJQA 5CW1A 2FR8C 2XRYA 3IIIA 2DPMA 4AI6A 1XMPA 3PKJA 4LMPA 2VDVE 4JJ7A 4J76A 1ZKMA 4OUDA 4UVIA 4F6RB 1LZLA 4F3YA 1S5PA 3ORFA 4R6WA 1JT2A 2Z0MA 3WBKA 4AZ0B 4OFZA 1EAMA 2ZDHA 3A1NA 5DULA 5TPWB 2B35A 2HXGA 4P83A 3PPYA 2GERA 2ZUBA 3D3WB 4ZZ3A 1MTOA 3BXOA 5D3ZA 4XWKA 3ZWKA 5IZ4A 1CB7A 5JVDF 5JSZB 4LRSB 1I5EA 1XF1A 2IY7A 3H2IA 1VL6A 4BLSA 5KZMB 1IG3A 1BQ4A 2OXEA 3R23A 4OA8A 3ROGA 3ELUA 4G65A 3UXHA 1HDEA 2WHEA 2ZIXA 4ANFA 1R6DA 2XYGA 3STHA 4FOOA 1RRVA 1VZ3A 4RWZA 5JPIA 3RS0A 3R44A 4CG0A 1BXKA 1JQEA 4WMLA 1TYAE 2BMAA 3O3MB 3FGZA 4C5BA 4DIOA 4ZHQB 1CY4A 1N6HA 1X2BA 2Q3JA 2MOKA 4YT2A 1FC0A 2ODWA 2PY6A 4D99A 1ZGHA 1FUYB 1GA4A 2HJRA 1UIMA 4B46A 4IIJA 5F21A 4P1ZA 4KE9A 2QX8A 3H8SA 4C4XA 1FQKA 4UHDA 1WIWA 4EHAA 4A2CA 1GZ4A 2PXCA 1OD6A 3IV6A 3OZRA 1QQTA 3TBFA 2C5HA 2WR8A 4R8RA 1EFTA 3LUKA 4DMGA 2BTQA 3KTAB 1LDYA 1PV4A 1A2KC 1PIWA 4LF6B 2V4UA 4TL9A 4FFMA 5FOUA 4AZWA 5A5EA 5ICMA 3WXBA 3BMCA 1QYCA 4MCJA 5IUJC 2O8EB 3WWCA 5TARA 5IW8A 1VYUA 1E32A 1N8NA 1F2DA 2PR2A 3KAKA 3PUYA 4GXNA 4NBVA 4UE6A 5F2EA 1PQ4A 4MWEA 2UYGA 1Z07A 1SXHA 4RCVA 4CFSA 1IN6A 4MEAA 3L49A 5C1OA 1OIWA 1Y9AA 1P0PA 2I8CA 3WLMA 2QMZA 1I5OA 2JDIA 2Y6UA 1VC2A 4PZLA 4U00A 5HKBA 1BDHA 2QP3A 3FFAA 1NVWQ 1M5UA 2KBFA 4ZVOA 4GUAA 1T91A 1PYDA 2C77A 3CPJB 3WGLA 4B7ZA 4CM6A 1QGAA 3O2NA 3OT1A 1TGVA 3WS7A 3BZWA 3RAFC 1L5FA 1QG6A 3MUNA 3DWFA 2OGZA 3BFJA 3E35A 3OECA 1A9PA 3T7RA 4I1UA 2Y1OA 2D62A 1YOVA 4Z0PA 3W5HA 1EA5A 1Z0DA 2JJMA 1AKNA 3WLRA 1G9TA 1Y9ZA 1MEJA 3IH5A 1MC8A 4ARZA 2HBRA 1UKEA 3NOXA 4S0XA 3U26A 4B6OA 4DUYB 1WTCA 4EKEA 2EFYA 1F2UA 3CUYA 1JKJA 2AKYA 1KSJA 1QV6A 1XAGA 4JXXA 4JNKA 1JFTA 1VG1A 3ETHA 2HFKA 4TUYF 5TQVA 3IT0A 1OBHA 1YCHA 3LQ2A 3A4MA 1TGYA 1I2MA 3QMVA 4INJA 2PH1A 1TPZA 5IAAA 2H1LA 3EUEA 2OO5A 1I7PA 4GQBA 5A7HA 3NRCA 1X8JA 3OH8A 1RRPA 1W5EA 3DXYA 3B13B 3FPAA 1DEAA 1UBLS 2IF2A 2E37A 4M89A 2LP4Y 2P9CA 1EM8A 5DIZA 2Y0PA 3DE7X 3BZUA 4EPVA 3A0UA 5F7XA 1I3KA 1Z6PA 1M6HA 121PA 1C30A 3BK1A 4J0IA 3A58B 1T2DA 2JHCA 3K9NA 1KTIA 1RXIA 3IKLA 1GR0A 5T4BA 2PNJA 3TIFA 4B2IA 1T26A 4HDOB 1TEVA 4F06A 2PO7A 1U98A 2QRVB 4ZIRA 2AMJA 2ZUDA 1ULTA 1FSZA 3RK4A 3GFVA 4DADA 3ZCQA 4OQXA 4R1UA 1Z25A 3FHTA 1Q1GA 1PR2A 1Z33A 4O5AA 2IUTA 2OAP1 3ZZTA 1SVKA 4Y2HA 3VZPA 4C3OB 3U4MA 3TIVA 1JH8A 5EJEA 3HEBA 3NHSA 4BO7A 1XYVA 4F85A 1SD2A 1XAJA 4FYXA 3Q72A 4K88A 5EG5A 5C31A 5KCZA 4RSHA 2Q45A 1MQAA 4TLDA 3WFIA 2PYIA 4ZOLF 4C88A 3FPEA 4NV0A 4RBNA 1XDDA 1LPMA 3PA8A 2GJSA 3RC1A 4AF8A 5TIIA 3J81k 5KTRA 3SQMA 4DZTA 3ZE1B 5L9AA 1O97D 1IYZA 1HT3A 1OROA 2OORA 1CWUA 1PYGA 2IQ5A 3HU1A 3PDWA 4LX0A 1WDWB 4P0TA 5IDYA 3U4HA 1FBTA 2WA1A 1VBFA 1AKRA 3BXZA 2BTOA 4H17A 4NYJQ 3HL4A 3TRIA 3TL6A 4HEQA 2Z6QA 1QDLB 1TYBE 5LWQA 3IBGA 1EEHA 5FV7A 2BMDA 2DP4E 4OLAA 3OEED 3FCAA 3GPCA 3GZNB 3F5SA 3TEMA 2WILA 1QE5A 2WKQA 4FZ5A 5DBOA 1KRWA 4BJHB 1ZBQA 5GPBA 1SZCA 3ER9A 2A4KA 2XUPA 2XXBA 3MJDA 1U8YA 3KHUA 3W9SA 3IAXA 2B1GA 4AMUA 1DVRA 3CF4A 2TS1A 1IWPB 1T9DA 1MRZA 2YQ4A 3DKPA 2Q8NA 4XH9B 3MSXA 4Y67A 3FRIA 1KDVA 3JQGB 3ODGA 2POQX 2Q1TA 4I2NA 1A72A 2ERCA 1F38A 1E98A 1T9ZA 3MCVA 2Y77A 3D4OA 5EJFA 1EZ4A 5TGZA 4YY3B 3SNHA 1P1KA 1RRGA 2WSMA 3KK0A 4ZVSA 4F1WA 5GOZA 1CFJA 3P19A 3PWSA 2BN4A 1QMGA 2F6RA 2IDMA 4O5OA 5ICCA 4GL2A 2C96A 4UTRA 1B41A 1A9TA 1QWOA 2G5CA 3ETDA 4ZAWA 3PUVA 4P2GA 4CG1A 5K5EA 3WGGA 3EZFA 2JGEA 2PUJA 3LPAA 4ARBA 4ZI3A 1Z0JA 3KKLA 4RVDA 2M98A 5JRJA 1Z13A 5DHPA 2EFGA 3OEYA 4ZYXA 4EEKA 1ZM3A 3EXHA 3IVAA 3OURA 4MGEA 5EE3A 3SJZA 5DX8A 4K9RA 5FJIA 2ZVQX 1M2FA 4D4HA 2ZB2A 2O7VA 2ZLBA 1KU6A 2AFRA 3KE8A 4KOAA 1L5LA 4CWAA 2R7MA 4LW8A 3T3HA 1KMQA 3WWZA 1F8YA 4R8KA 5H3CA 2FMHA 3MGGA 3PS9A 4LV8B 2C92A 1T8RA 5CJ2A 2ZGVA 3IE0A 3NBAA 5D86A 2ID7A 2GBLA 3H42B 4XJTA 4U7DA 1AGXA 1T25A 3DV9A 3KFVA 5HW0A 1A9ZA 2C9YA 1CUZA 3O8RA 5HDQA 4F8YA 4BKUA 5KNDH 3GLGB 1Y82A 2NT3A 4ESEA 5C80A 1JEYB 3VH2A 3K30A 3DOEA 1YMQA 1H3FA 2H4YA 1RYYA 3S40A 1VLZA 1XQYA 5KWEA 1I94B 3B3QA 1N2HA 1R9GA 1XHEA 1KARA 2IIQA 3KSMA 3NNSA 4P2BA 5FADA 1DRUA 3U4DA 4RVGA 2XSZD 3M83A 3CNEA 3DTTA 4KDCA 3ZY2A 3HBMA 1GPMA 3QJGA 5CB8A 1JQ5A 3QFTA 1Q1AA 3UWDA 3ZXIA 4DJTA 5EIXA 1ZM7A 5JZSA 4REQB 4XIFA 4EJ2A 3I9LA 2R8YA 4XWYA 2QYTA 3MJTA 4P4LA 3JWHA 2IOQA 2HPHA 5JMPA 4PLGA 2V0CA 2ZRCA 4A6XA 1FP7A 3DCYA 4JODA 4P3PA 4XSGA 2X0KA 2C8JA 4QLOA 3FDXA 1QAOA 4QSHA 1XEWY 2ERYA 2CLMB 1P9WA 1U0GA 2HPAA 3T34A 1QH0A 2E4YA 1K5HA 4BV8A 2WTBA 1JJFA 1Z34A 4UTVA 3O3OB 2B30A 3RQSA 4MA5A 2W2PA 1DJLA 2IS1A 3DO6A 3HJNA 4UUPA 3SLKA 3TO5A 1E2HA 5K0EA 2A14A 2NVUB 5HNKA 3KOWA 2VO1A 2D4AA 4ZDWA 1M74A 1SU4A 1RJFA 4LAFA 4TMWA 2UVDA 3G9QA 4NEQA 4UD2A 3IE2A 3ST7A 1QTRA 2F4VB 5CCXA 1NUUA 1PSDA 1QO0D 5AJZA 1E9RA 5EHGA 3RUCA 5A5FA 4UE3S 4RZUA 1BWPA 2FJ0A 4KQFA 1P1FA 3IQXA 4F72A 1RR6A 3ZWVA 2EKQA 4E5YA 2ZTHA 5JR3A 5ALLA 3EEOA 4JLAA 1IHUA 5BW4A 4K2HA 2ZS8A 4N5LA 5CD9A 4MEBA 5FP0A 3ZVLA 2WJYA 2QYSA 1NJ1A 1QH8A 3GJQA 3H13A 3I0ZA 1EQAA 1ZICA 3TH5A 3WLKX 1UBHS 2F90A 5IJ0B 3SXUA 1U3DA 3F5FA 1OI4A 2A86A 1GWNA 4CUJA 5KQRA 4KUHA 3U0VA 1K8RA 2BFOA 2GA9A 2QTHA 3HDVA 5DYIA 2Z6AA 3LQFA 1IDOA 2CKMA 1DGQA 1QHFA 5KNCA 3IEPA 4J3NA 4A0GA 2IH4A 1N33B 4KWTA 4YJGB 2RGGA 4GP6A 4EUHA 3UBTA 1OBVA 4IXWA 1P7CA 1RLTA 4L5JA 1QVRA 2ZBDA 5DYYA 3UJPA 4D57A 1OR8A 3IDFA 3K9WA 1CUFA 3BIFA 5AT1A 4KLCA 1ZOPA 3BJZA 3HRHA 4ND2A 4MMZB 1OFGA 5G4KA 3DL4A 3FMFA 2GS9A 1P1JA 2I4IA 2JRCA 1XLWA 4FYHA 4HNAB 2Z3VA 4R6XA 1EFVA 1DJMA 3NH9A 2YHIA 1XZNA 3DLPX 4XUCA 1YL6A 1Q14A 4G6ZA 3LCVB 4OAPA 1GPJA 3BULA 1CETA 1SG6A 4K1XA 3V9AA 3LX8A 3W8FA 1NC3A 2ODBA 2YS6A 1KOJA 4YMWA 2W2LD 3A8TA 1FYFA 3CLUC 1D1PA 1QH1B 1E94E 1X7WB 4M9SA 4MYHA 4O4LA 4ALIA 1O1YA 3DBLB 3HCAA 3EAGA 1RIIA 3QFFA 4IS3A 3TLCA 1WEKA 2C3MA 4ED9A 1JVSA 1N6KA 3ORQA 3QW2A 4XGQA 1V7PC 4FHDA 4P82A 3ZVKA 2OVBA 2YN2A 2NU9B 5AW4A 3KQHA 1NF3A 3EXEB 2CWWA 2C9MA 5CPFA 1ZRMA 2GSDA 1YR7A 4G84A 3W8RA 4DV7B 2XKKA 2XRZA 1VFPA 2P6RA 3ZCXA 2DXIA 3ESAA 2GDJA 4ACAA 4WK2B 2C4VA 1VMDA 4PZAA 2PH3A 4CTMA 1T6ZA 2G5TA 4C2AA 3O9MA 4N76A 3KEFA 1NVMB 3MAAC 2G36A 2WUEA 3M6IA 1KF0A 4R0NA 3GROA 2D7DA 1OFUX 1PWYE 1A5ZA 1OT3A 3CQ9A 2ZB4A 4P7GA 3RVKA 3U7EB 3W5UA 1LX6A 4JBYA 3IUPA 2IW3A 2X8WA 1Y9EA 3HBNA 2AEEA 4WIAA 2C5GA 4J1QA 3P4YA 5EMNA 3KB2A 3ZU3A 5IDWA 3IAM6 4O1IA 3RIHA 3TLMA 2E1RA 4E12A 1HYHA 2QG9A 1VSTA 3HXPA 3H2HA 4IHJA 2PKWA 5JH7F 5DHFA 5DM2A 1DT3A 2EL9A 4WOCA 3S5UA 2FEPA 1DKLA 1F4PA 1T0BA 2G1UA 2WHPB 1VKRA 2Y0BA 1JHUA 3LQ1A 3QYAA 4OI2A 3ZHTA 4BN4A 3TQSA 2J6CA 3DKVA 3E9NA 3MHTA 4XSVA 3BWBA 1Y8QB 3QHQA 4HFNA 4UPVA 2VDRB 3ABZA 2FMKA 4JVLA 1U7TA 2B5VA 3O8QB 4BZXA 4YPVA 1EIWA 2EJTA 1WCIB 4M46A 3THYA 4N5MA 2DERA 3PXCX 1WMDA 4ZC1A 4CL2A 4FFVA 1D2RA 3OHSX 5CA1A 10MHA 4NNJA 4PN3A 3LBFA 1GPNA 3L18A 1T43A 5EMJA 2YIVX 4YJKA 3DDOA 2WHXA 4ZQEA 1F2TB 3TW6A 5ELXA 3X1MA 5K45A 4X1IA 5J3JA 3AO0B 1Z75A 4P4GA 2OCXA 3CCCA 4HSEA 2C8VA 3EVEA 3H7IA 3ITDA 1IXZA 4OM7A 4QODA 3PL5A 5DN9A 3V6LA 4XCVA 4A10A 4DDVA 4F2HA 5J2UB 2ZJBA 1LLCA 1ZISA 2QORA 2QD5A 4WKNA 4Q9KA 1U3VA 4X45A 4XE5A 2IVFA 3PKZA 1NV9A 1P8JA 2TMDA 3QY0A 2AFHE 4K28A 4N54A 4KNVA 4K9DA 4K9KA 4KX3A 5J2TF 3W4IA 4NXMB 2DAPA 2AH5A 2YC4C 1BROA 2PWYA 2C7RA 4GBGA 3N0RA 5EHXA 3LKZA 1CVIA 2ZSKA 3GXBA 4WXEA 1B42A 1O2DA 1BS2A 2DHQA 3M4JA 4YJ3F 2AJDA 2GK7A 1UL1X 2DPLA 4LVUA 3AUXA 5F7JA 5A4IS 1JYFA 5I3CA 3BWEA 4I1RA 1WSBA 4EFLA 4X62B 2PGDA 1GTL1 2GXQA 1YA6A 2JGNA 3HR7A 2D5LA 4TTPA 4U2GA 1OJLA 2L0XA 2QYHA 1F1JA 3T99A 1RSZA 1WNTA 2OCYC 5HHTA 3SYNA 1PKXA 2GT1A 4M1TA 5ARBA 3LWNA 4FDUA 4JT4A 3S2GA 2G6BA 2VATA 5LZ2A 5KNBA 4NARA 5LZ7A 2H0QA 1T5HX 4WOKA 1Y6ZA 1OHHA 1Q20A 4HH4A 1Z5WA 5DI9A 4GYWA 3WWEA 4CHTA 1Z5GA 5KJCA 4BPBA 4JU9A 2GCOB 4OL0A 4L02A 1MUUA 4OHMA 2C1XA 3P97A 3OIFA 1R9NA 2Z2YA 4MW9A 5T8KC 5KMGA 4C89A 1N8KA 1ICIA 2FFJA 3EYAA 5HGJA 4AUNA 1B0AA 1Z45A 2CHQA 3CX3A 3LF1A 5DOZA 4EHKA 2AVNA 3WB2A 4J3JA 2BE7A 2BW0A 2VYVA 3AV3A 3UGTA 3CXRA 2XNCA 3BFPA 3TZCA 1N3IA 4BFXA 1Y80A 1UC8A 2WWYA 4MS3B 2HREA 3AEQB 4QGFA 4C6TA 4DCVA 2HCFA 5BSEA 1XEAA 5BWCA 5CAEA 5LP1A 1WKVA 4PLWA 2W6JD 1AZTA 2E82A 4LCJA 2C3OA 5EE1A 4M0PA 3P9CA 3LCUA 4A8JC 5CYFA 1A96A 2HBZA 1W59A 3GNLA 4GRDA 4NAUA 3V1YA 3NHRA 3R7SA 2ROQA 2NU6A 1V26A 1PG0A 1RABA 3AESA 1XIVA 4FMDF 4GMHA 4MA0A 4D8VA 5DSXA 1R0RE 3BGOS 3K5PA 4CMIB 2BCJQ 2MMCA 2Y1CA 3AEYA 4NU0A 1REQA 1JI0A 1U0JA 3X0DA 4F2DA 1LPNA 2YL2A 4H6PA 3U3ZA 3PRKE 4C0WA 4EL0A 3CHYA 5J1SB 2TRSB 1GAXA 3KD2A 5EEHA 3UKDA 3ZIDA 4Y1RA 1EBUA 4J6FA 1DEOA 2A3NA 2I03A 1NZDA 2TSYB 3UVEA 3TQIA 2JLBA 1H0HA 4P31A 5U9CA 3A10A 2QF7A 3P0JA 3THWB 4R2IA 1OUMA 3BUSA 1GN9A 4DLLA 2FFBA 1FXWF 1XLTA 2RGDA 3WIBA 1KEPA 4R2HA 3TUJC 1GGEA 2QN3A 5AXDA 1T3TA 2VQDA 3RC8A 1BE1A 3OUZA 2HRDA 3EBPA 3R3UA 1NHGA 4YXFA 2ORYA 3EHDA 3U1BA 2ECQA 2GEDA 2PZEA 1F5NA 4OQNA 4EI7A 2BEKA 3ZZMA 4ONEA 2QVGA 2Y9PB 4HK4A 4CNQA 1LSOA 1N2CB 4MNTA 4ZKDA 1XDSA 3FRJA 4WESB 3A9UA 1EFAA 2JLVA 3JWPA 4DR4B 3G2KA 4GXQA 4KIJA 2GARA 3G89A 3JPYA 1N4AA 2ATIA 1ZJZA 1VHWA 1LW6E 4JI7B 4IMJB 3BGWA 1JNXX 4D0SA 5AI0A 5JFTA 2UZ1B 2PV0A 2P2CA 3C8UA 3GRKA 2D5BA 1N1GA 5A3SA 4DSOA 6PFKA 1Y3FE 1CULC 2LIPA 3JD4A 1LPBB 3NRBA 1ODSA 4D9BA 2AG0A 4PYKA 3WRWA 3K20A 4FUQA 4Y9SA 3X1JA 1V3TA 2FTKE 7AT1A 1WR8A 4KE8A 1RJ9A 2AHOA 3OY2A 2H63A 3FTNA 3C98A 2H2WA 3HJUA 1CQXA 2Z8XA 1B7GO 3D31A 3NKLA 5DVZA 1Y33E 1FP4B 2CMFA 4YPOA 5BYBA 1JB1A 3OLXA 5ALNA 3SIWA 2FXVA 3D8UA 4GWKA 2LPMA 4AL4A 2DJ5A 4ROSA 5HE8A 3ZY4A 3UTDA 1U1IA 3KG2A 4EHHA 5CDHA 2QS9A 2V5VA 1I2AA 3GRYA 3OMWA 2JJ1A 4AIIA 1AKEA 3NS7A 1Z4IA 2FCAA 3NZEA 4H3HB 4L3OA 3LUBA 3UICA 1UWLA 4UOEA 5HWSA 1R64A 2FUCA 1RHQA 1XKTA 2ADMA 3C6YA 4E51A 4J0CA 3V80A 1K9SA 2OR3A 1YVRA 2XCQA 2ZPAA 2LE0A 3FUTA 4LHZA 4WKBA 3RE1A 4PBRA 3ZCVA 3U3JA 1B0UA 4DR5B 4P86A 4EA9A 5BQXA 2R6GA 5FOQA 1CQJA 2EW8A 5FTJA 3AF5A 5DMHA 3C6QA 3GPDG 3MZ0A 1MORA 3R0XA 4M76B 4C14A 2PZMA 1S01A 2EW1A 1ZJYA 2G67A 3D8HA 4JY7A 4PAMA 5KVQA 2BRUC 3VR5H 1HL3A 1IG0A 2WFMA 3RO7A 4BO4A 4D74A 3UPUA 2W2KA 1XD2B 1C0IA 2ALJA 3HA3A 2A30A 2Z1DA 3NX4A 4F2WA 3QTBA 2R62A 3C1AA 4FYWA 2IHVA 4WXPA 5JI3E 1QYDA 1UK8A 2O2GA 1QGDA 3GAFA 4M3NA 1L7AA 3DBHB 5BMVF 3I1JA 2C7QA 9MHTA 3N75A 3WKEA 3CPEA 2O6LA 2V65A 2FRXA 3M1LA 4GT1A 1XCLA 4KFSA 4WZAA 1ADJA 3LCCA 4DL9A 3H5OA 2VSYA 3BJIC 4ETIA 2RGCA 3RW9A 1P2VA 2Y0CA 1HF3A 1WPGA 2X5JO 3G8BA 4QE3A 2YRFA 3GH3A 3EFOA 4CM5A 1OU4A 3PFHA 3OEHD 4P38A 5AW2A 1LVUA 3D0OA 1YTUA 4FX5A 1NULA 4NAVA 2KQUA 2RK3A 4Z3KA 2HRQA 4DJEC 3ICWA 1KVSA 4R1TA 4BWFB 3PQFA 1FL9A 1E0DA 4EGAA 2JLXA 4IJWA 5AJUA 3HYLA 2CNNA 1N2ZA 4JP5A 1X1QA 5CX1B 4KWHA 4NEHB 4YDHB 3N2KB 3VPAA 2OCPA 1XAHA 1PBTA 3F9RA 3L6BA 2EKZA 4Q9LA 2QLFA 2ZAIA 3ZS8A 1GGJA 4YUWA 3DW3X 1A8SA 1T15A 3H2SA 3KQWA 3WNBA 4JB8A 2L17A 4F5DA 5IP5A 1J99A 2VQ6A 3QUSA 1BJRE 1FDVA 4QU8A 1K4YA 3PRHA 1WSWA 2BZ0A 1TQDA 2O2EA 5CB4F 2R8EA 1LGYA 4OHXA 1QC5A 3GLIE 3SE0A 5AK4A 1WWKA 3BB4A 2CJFA 4NCHA 2REQB 3WKDA 2VJYA 3KQOA 1HFJA 2B25A 3NM4A 1M83A 2H51A 2QTNA 1N9GA 2WHQA 3NHUA 1EDBA 2VN8A 3BK7A 3Q41A 1BIFA 3EZ7A 3FOEC 5L3SB 1RLOA 1WULS 4FYJA 4RFSB 2A8YA 2LCIA 4RZQA 3DE1X 4LHYA 4DRZA 2YN4A 3UY4A 3A9TA 4Z7QB 4ZZ2A 3VM6A 4DNPA 2FOIA 3A4NA 1MFZA 1GJRA 2VR1A 2WWXA 2XY4A 3BQNB 2PIDA 3FTPA 1VCIA 3ENKA 4ZT4A 5D00A 3RKRA 3VPGA 1MB9A 4LXTA 1G8JA 1C7QA 3JR7A 4IOLA 3L0OA 5JWHA 4TLMB 1E2IA 2I7XA 2H2GA 3IVXA 3OM0A 5COAA 3U9SA 5KS2A 3E1KA 2OHIA 4PHGA 4G09A 2VAVA 3NEYA 2OM2A 4XQCA 4INAA 3JD3A 3L4EA 3D2CA 5ICEA 2IK8A 1U3WA 3ZE2B 1JAIA 1GCUA 1ISJA 1NSFA 1PQWA 2C5LA 4ITRC 4KOEC 5AVYA 2XH8A 3NWOA 3QELA 1U04A 3R3JA 1H2FA 4WL0A 5J23A 3UFXB 1HSOA 4HEJA 2ACWA 1RYBA 4OXXA 3TLYA 4CIVA 5I01A 1F0PA 2BMWA 1ESMA 5CFRA 2OILA 2IWHA 5EIAA 3EQZA 1KAMA 5DW0A 4CV1A 1ORDA 3MB8A 1DZIA 3KLMX 1QR6A 3CRVA 4ALLA 1X38A 1WRBA 4HGOA 4BQQA 3BSSA 3OM9A 2JFNA 3MK31 4JGBA 5FNVF 2JARA 3EZNA 4DUGA 3VR6D 1R9JA 5HX7A 1XHFA 1PUIA 3N2IA 4ROTA 4E2WA 1VGQA 3FJYA 3P9IA 4TWJA 3TQOA 1E4VA 2BEUA 1MC4A 1MABA 3L0ZA 4RGQA 3SSOA 5FTNA 2UU9B 3C70A 4F6RA 3DDSA 4U9UA 4CT5A 2FZ4A 3HKBB 3SQXA 1RPNA 5DM60 2IDZA 1U2GA 2BHRA 2P90A 3I61A 2DU8A 4ZTUB 5DXFA 1OAOA 1GCOA 4KPUA 4BNYA 1MD9A 3GG9A 2W42A 3IIEA 1JLLA 4WBNA 5H16A 1P8AA 3U37A 4LZJA 1QOPB 2E4VA 3IAHA 4Y2PA 4BNZA 4YXWD 2LXNA 3QWAA 3UT5B 5C3MA 2H1IA 1YB1A 3AF0A 3SC6A 2R4TA 2HK7A 1AO3A 2BDEA 2GBCA 3KR1A 4OHVA 5IF3A 1SVOA 2BFCA 4N5IX 1H4SA 4I1VA 3CH6A 4MCHA 3SR0A 3EIXA 4DA0A 2C7OA 2WJWA 4IZIA 1ECGA 1JJBA 3AM1A 2DWQA 4JUDX 2JBHA 3SP1A 4IMPA 5DBIA 2EFJA 5DTMA 1KEEB 5KHAA 3UC5A 2BCGY 1Q12A 1SHLA 3DD5A 1WQ1R 1ZN9A 4P54A 1GAJA 2Z2XA 3L7NA 1QKKA 3LDHA 4JOSA 1D6JA 1FTYA 4N5DA 4B84A 4DWJA 1Y3BE 4HDRB 1PFKA 4L0MA 3DR3A 4LC0A 1I2ZA 5DWQA 2HF2A 4PLTA 3AJAA 1AGPA 1SIBE 3HHEA 2GCEA 5B1SA 3VI3B 3WFZA 4A2PA 1DB3A 3NWEA 5ALWA 4D9HA 1J2UA 1Q1ZA 4OF4A 3PHGA 4AULA 2IGTA 2W8BA 3K4PA 5HS6A 4MINA 1YKFA 4UVDA 1UDWA 1XI2A 4RH3A 5EXXA 5AW0A 2YWXA 3IPYA 3V4ZA 2HYIC 1L4FA 3KLOA 1VQ1A 1CQWA 3QU2A 4CKBA 2XRFA 1UMDB 1NW3A 4PLZA 1U7WA 4BNXA 1L7VC 3FSJX 4D4JA 4OLJA 5JBNA 1V5GA 2ZJ5A 5SV2A 3DDWA 3AUUA 3E4DA 4NYMQ 1L3BA 1OZHA 2AL7A 3BL8A 2XMQA 1TL7C 1YB5A 2FMTA 3JQFA 2PKEA 1T9BA 1RYZA 1IPEA 3QE4A 2QUBA 3TOZA 1ZZEA 4S12A 2C2KA 1LDEA 4ZAGA 3QQPA 1NZJA 2R8ZA 3D6TB 3B5IA 1CR6A 4PHHA 4TN5A 2NQ8A 1Z63A 3S7TA 3RJ5A 2PSFA 3QPVA 5IYZB 1P1BA 1R5NA 1V8OA 1NIPA 1YFZA 2QPOA 2VQSA 2G40A 1A95A 3U3XA 1G6HA 3MQ2A 4Q4HA 4PAGA 2ONJA 3JRNA 5KIAA 1ZAKA 1C0KA 2Z2ZA 1H0SA 5BW5A 3QVXA 3VXKA 1ZD9A 4NOMA 1XJWA 4LVOA 3HY4A 1IZ9A 1KZ9A 4N40A 4PBSA 2IL1A 1TQ2A 3ZNOA 4CJXA 4LXHA 4I7EA 2Q1YA 3JZMA 5D3MB 4AK9A 1YFLA 3QV2A 3VTZA 1CUVA 2NT4A 1RHRA 3E5HA 2VCHA 3KWLA 3T41A 3COZA 5FBRB 1HZZC 1B3RA 3AFOA 2ANCA 1T8YA 1S7GA 4ZTZB 1PGNA 1R0WA 1J07A 3F7OA 3NXSA 4MVJM 5DLDA 2YASA 4OYRA 5GONF 4MQFB 4Q1AA 1Z5PA 4COKA 3FVTA 3Q0TA 2PA0A 2WJVA 1PU2A 3RIEA 3GCZA 3QZUA 2GPSA 1DX6A 5K8VA 4X63A 3KCQA 4CYMA 1VPLA 1IMJA 1AKVA 3SC2B 5F9MA 3AU8A 4MAFA 2ZT7A 3BIWA 2K4MA 3ZHXA 4D3SA 1DJNA 1SZJG 2DZDA 1EA7A 2PR7A 3OIUA 2IYLD 4I08A 2YOHA 1UJ6A 3D5EA 4BTEA 1F06A 1XL1A 1W2WB 2QRVA 4M0KA 1TYCA 5DFAA 1FJHA 3NHMA 3CTMA 3EVAA 2I7VA 4QELA 1Z68A 1Y63A 1QTQA 4FNOA 3KL2A 1I2DA 4N49A 4WDQA 4X6YA 3EXIB 3R76A 3AUTA 2VNIA 1K75A 1HMYA 1TAQA 1I01A 1YE5A 1JHVA 4W4TA 2DR0A 3KHTA 3L1VA 1OPXA 4AXBA 2F1KA 1II8A 3AR5A 4R01A 4RWEA 4OGKA 4RH0A 3F2IA 3TRDA 2OSBA 3DOUA 3RV3A 2Q1UA 4KV7A 2HPVA 3TZQA 1Q1NA 2GAAA 5KOJA 5CUQA 2FFQA 3ZIUA 3AETB 4ND5A 3IAUA 3TDNA 3R3VA 1BXGB 3FTDA 5AVUA 1CUGA 1WD5A 3Q4GA 4J0FA 3WSTA 5J2UF 4G0VA 2ZU0C 2BEWB 4JYPA 3KZCA 4U9IS 1KQPA 4BO5A 1FW8A 3OCWA 1XDGA 4IWNA 5JT1A 3BBLA 3WC4A 2ZSFA 2EBFX 4DMKA 2G06A 1Q74A 3OJXA 4FYVA 3T61A 3N9IA 4J0KA 2JBWA 3MINB 3P2KA 3OQMA 3VNBA 5D3KA 1DCTA 3DGEC 1YDWA 1SHZA 2ZWMA 4JLVA 3MQFA 3FYUA 4RDHA 5JY1A 2IODA 3UAOA 2A1UA 3BWYA 3PQ4A 4IEIA 4Q7QA 5LKRA 3HCWA 4PC3A 3JQGA 4PGGA 1HEYA 5ALFA 1J2RA 4DQKA 3A36A 2Q3EA 2ZUWA 3FIJA 5BN4A 2WYUA 1YR6A 5LOVF 1BCSA 4HNUA 4D9MA 2VUSA 3QMMA 3CGWA 1CUBA 1K7CA 1KA9H 4Q3CA 2OXIA 1AO0A 2JG3A 3OP4A 1T2NA 2JEOA 1J42A 2PRIA 3ND6A 2C57A 2ZQ5A 4RK7A 5K0LA 4A8JA 4BEJA 5JCZA 4UJ3A 2XV1A 1D04A 2NO7A 3OZAA 2B8JA 4TOIA 3WDKA 1B2LA 1R0ZA 1FX0A 3LA8A 4BFTA 1SCDA 5EA2A 4C7OA 1TW2A 3RVOA 3DV2A 4UUQA 4C0XA 3WIVA 5EQDA 1E66A 2O3QA 4RD0A 2G17A 2PL5A 3D0RA 3UA3A 4FILA 4EG6A 3OBBA 3U62A 3MG9A 1X7YB 2VDOB 1ZUIA 1EHCA 1I7LA 4FI3F 4RS3A 2R3SA 1D5CA 1U94A 5IAKA 3TZ6A 3RSGA 5L3QB 2MU1A 1XTVA 1STOA 4DHWA 5H4GA 4AQYB 3JAWB 2CLEB 5TNXA 1NDUA 4GOMD 3H7AA 3KYBA 3SHVA 3UJCA 5AVQA 1UQRA 3D1VA 3I9OA 2IXAA 3AVOA 4WXYB 3Q5GA 4PINA 1Y5LA 2OZPA 4L5IA 3GLGA 4V0KA 1GYRA 4U7JA 1PEKE 2Q5JA 3F8SA 4IQ0A 4MP6A 1D2CA 2EATA 3ET4A 4OBBA 4PAOA 2O0JA 2J0UB 2X14A 3B3FA 4AJOA 3FVWA 2B1QA 4R3UC 2WSBA 2QAJA 3KZKA 2CLLB 3ILXA 4WZBE 2YY5A 5CK4A 3UB3A 2CXSA 1E4OA 2HX1A 2ZETA 3F9CA 4N12A 5F33A 2BSQA 5I9IA 4L1KA 2NV2B 2W0SA 1YBFA 1E0AA 3OZFA 3TXXA 5EMMA 2DWOA 3UV7A 4R2MA 3STTA 3GZJA 4DPKA 4M60A 2OZLA 2QX6A 2AI1A 1EVIA 2JH3A 5IZCA 3ZIAD 1EVJA 4TGLA 2HSZA 3I37X 4GQIA 4JQOA 1C9MA 1FP1D 4AJ9A 3LM8A 3VC2A 1YTLA 1M1NA 1MOQA 3NGLA 2GGSA 3PCRB 5B4VA 4O2AB 1EE1A 3RT9A 4YLYA 3E9YA 4GLOA 2W6CX 5DBFA 5HIMA 5KEIA 4KNWA 3WRYC 2DFLA 1T10A 4JUIA 2JH8A 2HA5A 1ZMXA 4DGSA 1BMQA 2JLRA 4HJRA 2GD6A 4JB3A 3STUA 4CXMA 1IEVA 1R18A 2OM6A 1NVVQ 4E46A 2XDWA 1S4MA 1SEVA 4LXUA 1VE9A 4QXRA 5H3LA 1XYGA 1A9YA 1RWVA 2C9ZA 1R0CA 3OE7A 4IOKA 3R8XA 3ZQKA 3DTVB 3M2PA 4BX2A 1LBSA 1UBJS 2QU8A 3K6RA 1HC7A 1UBMS 4INZA 3M0EA 1OLXB 2BDTA 3CMCO 3H87A 3I04M 4AQDA 4QFBA 1D2HA 2B20A 2OPBA 3KBOA 1A97A 1JLSA 4AU1A 1RBZA 1IVSA 1G8GA 1OXBB 4QVGA 5JI2E 3JQBC 2BM0A 2FEMA 4K9PA 2OLKA 2VSOA 1WD7A 4HCJA 3R1IA 5CIWA 3MJSA 2FP4B 3IUJA 1JAZA 1DRKA 2J9ZB 3RC3A 3L8EA 3S2IA 3OQNA 1E79D 5EMHA 3R4VA 4ZMSA 3T5BA 4H27A 4ETMA 4NNOA 4PGFA 3QP9A 3UA4A 3MLBA 3OE5A 3Q2OA 2P69A 4BJ5A 2IYQA 3F6BX 5IFKA 4ZAXA 3RSFA 1C7FA 4MKIA 2G70A 2VDMB 4WZ6A 2WJIA 4Y6OA 3K1YA 5AI9A 2JKVA 1ZEMA 2QMYA 1LLDA 3LW7A 1B6SA 2ASVA 4OFXA 4FCWA 2V5AA 2ZUFA 4MDFA 1JR6A 3N74A 5HQJA 4F6CA 5K0SA 1S2OA 4GR5A 3YASA 2PUDA 1GTVA 3D7NA 3IVMA 4FFWA 4OXIA 4URWR 4HL6A 4HNAA 1CZUA 2OBMA 2I6UA 1DBWA 4WCFB 2XUIA 4FW9A 3GT4A 2PRZA 1E1YA 2IPOA 2P6UA 3WGKA 1NXVA 2RDMA 1MKYA 5D5HA 3TGLA 1X9HA 5ALYA 5F3WB 4XGIA 2RARA 3IR6A 3TG8A 3E1GA 3IJEB 4AG3A 4C3VA 1XA3A 1QH1A 3HB4X 3TX2A 3DTVD 3DBLA 4O4IA 1I4EB 5BPFA 3LCRA 3BE5A 5AKHA 5K4HA 2CMHA 2RAFA 2CFOA 2WM3A 1Y48E 1SCIA 2C8LA 4NVRA 1GRVA 4RFLA 5LR6A 2XOKD 1PE0A 1VLLA 4IP0A 4NZZA 3V3TA 3V3KA 3WK8A 4R2XA 3I53A 1K6JA 5CDGA 2II6A 4YUXA 1EX7A 1MVOA 4GS5A 1E6LA 2QT9A 4XPZA 5DCUA 5FNZA 1VL5A 1ZH0A 3RC2A 4J2HA 3H5TA 2BGKA 4BNWA 1VLMA 4ZYTA 2R6R1 1SZDA 1BEZA 1QPZA 3NRJA 4CF6A 2GCNA 2OHJA 4RHUA 5KAPA 2A9QA 3ZTTA 4CL3A 1ZD1A 5FBLB 1MA3A 1MAUA 4B3XA 2PAAA 1TJYA 1R66A 1WJGA 3W77A 4OXNA 5EZYA 2CLSA 3FFXA 1UP4A 2ZJYA 3R6GA 2J3JA 4A0SA 2D0DA 3LZCA 1Q91A 1S3FA 4ZDJA 1GFIA 1QHEA 2VDWA 2KLBA 2ZE5A 3BS4A 1ZESA 4I6JA 4Q05A 1NXOA 3RI3A 3NDRA 1A77A 3R7WB 1EBFA 5HIKA 1TRHA 2WB2A 2B5OA 5C7OO 1VCHA 1W5BA 1Q21A 2IZ1A 4MW2A 4XD7A 3U3RA 5CA0B 5ERGB 1G7RA 1KXZA 1P6XA 1PL7A 3QI2A 5B58T 2M6LA 3T3DA 3LSYA 5KYTA 1EKXA 2C29D 4KHZA 1NAIA 4MA4A 2H8GA 3DNPA 4B4DA 3RYCB 1W30A 2ZXUA 1YQTA 3GXOA 3H04A 3NG1A 4GZ3A 4YRDA 5K3DA 1WUTA 5CNMA 1XK7A 2Q2OA 2QD1A 2XF8A 1VPTA 2OHFA 2OYRA 3JTEA 2NXJA 4E6PA 4LOAA 3KQPA 4YAEA 4DIUA 1WHTA 1ZOSA 2I8AA 1KIFA 3LUPA 3GWZA 1KO5A 3LP5A 4GBMA 3KEMA 1LEHA 2ZKIA 1YDHA 5JRDS 1IOZA 4R8LA 2NNLD 3I52A 2E6KA 1V4BA 4HWRA 5BSUA 4JZYA 1F3OA 2REBA 2HRZA 2DG2A 3F5QA 2LUOA 3JWJA 5I6DA 4PZEA 2CLHB 3CZPA 1UM9A 3DQZA 2JAWA 4Z2YA 1RQRA 3CX8A 3OJFA 4KDFA 4TMVA 2CHVA 2V7UA 2WJHA 2EF1A 5H7XA 3SVTA 4MR7B 1FPMA 2OLJA 4V0NA 3SIXA 4EW3A 4BPRA 4N8SA 3LXXA 3M3HA 4B7CA 1EWQA 2D8AA 4LZWA 1OFTA 4BOYA 2MSLA 2P4HX 3QVVA 2QMEA 3V34A 3BWCA 1DBQA 2GYYA 2NUAB 1RAGA 2JZCA 5ADUS 2X0JA 1IULA 4FGWA 3SXPA 1H2YA 3R24A 3PUWA 2B3TA 3QJ5A 1Y42X 2X3FA 1CY7A 2C20A 1GSAA 5HILA 1OGJA 2VHWA 2ISQA 4HWPA 2IU0A 5BWNA 2XIJA 3N2EA 3PD0A 3TTSA 4ZVPA 2VHJA 2YTZA 3V1KA 2P5YA 4F97A 4YMTA 3GUUA 1TEZA 2O07A 5IUNC 1N7IA 1E3TA 2WIJA 1IBKB 3A2KA 1L5HB 3HV0A 4CV3A 2Y1XA 1RWNA 3TM5A 1POWA 4BNNA 4Q9JA 2ENWA 3HY6A 5K2OA 3AVVA 2C4NA 4F3NA 4MYTA 2GYUA 3VX3A 3ZWCA 3KDPA 3MJFA 3TNLA 4WJZA 4D9FA 3OESA 1XRJA 3WL5A 2O0KA 4BX9A 5FQOA 3S1AB 3AB7A 4IFIA 1AUVA 2OO3A 3OVMA 3D8TA 5DGDA 4ZT3A 1ULBA 1JRLA 5ADHA 1OB5A 2QJRA 3CRZA 1F1BA 3QFHA 3KT0A 2R47A 1AK1A 1W5AA 4MW6A 3IQFA 1DXHA 1H1TA 4S2EA 1EUQA 3M1YA 4IG9A 5H3HA 3GLRA 4BVKA 1K3UB 4HZGA 5DN6A 5JTUA 1YQGA 1QZXA 1WXDA 1WP9A 3CWCA 3E4CA 4NJEB 3OQBA 2WAMA 4GOND 2H5JA 4G4GA 2J7PD 4Y9RA 2V58A 1R50A 2ZIFA 4UNNA 3A3PA 3KQYA 4YP9A 1MX5A 4JJKA 1FEZA 4FHGA 3TL3A 4ZVLA 3VSEA 2R00A 1OPRA 3ROZA 5FTLA 5JBQA 3PHBE 1B8NA 4Z0NA 1NQOA 3O94A 1MHPA 4FWIB 4BUJA 3FF4A 2VA9A 4YNBA 1L2TA 4QWMA 3F4KA 1NOJA 1DAOA 3M82A 1NTOA 4PQRA 1ABEA 4UNSA 3BREA 1ZINA 1TM2A 3B2QA 2AWNA 4HQLA 3OPYB 3V6MA 4CZ2A 3I3SR 5KJEA 3L2OB 4I5FA 4J7XA 1I80A 1L3CA 4NOJA 3TI7A 1KMCA 3DUFB 2DHCA 3H6KA 4FNAA 3RASA 2IUEA 1EQUA 4M83A 5HK9A 4PHCA 4AROA 4CKWA 2R1VB 4ZRNA 2GJAA 4KYTA 4NEGA 2BAGA 2HLDA 4YAOA 1M0SA 3QTLA 3IP9A 3F98A 3RYFA 1QIHA 1XK6A 4JMPA 4I50F 1GT6A 5DE3A 1NR5A 2Z2JA 4Y6LA 5LJLA 1FTWA 1W48A 1JA0A 1XQWA 1N2CA 3JARB 3L41A 3OZWA 3V8QA 1I3OA 2EQAA 4I55B 2O54A 1PWZA 4I5EA 2HB6A 5JDIA 2PTHA 2QPTA 3LFTA 4GP7A 4YRLA 5TB5A 2DY0A 3W4KA 1U6JA 2IT1A 2UV8A 3CT4A 2P2ZA 2CLFB 2HTEA 1T4CB 5TGTA 3DF7A 5IJAA 5KSZA 5EKXA 1NIJA 4CQMA 1N57A 2FPPB 3TQTA 3TVTA 1TI7A 4FN4A 1GNTA 5AW1A 2OG1A 3RFFA 4CLOB 4AY2A 3BICA 1PEDA 3ROMA 3VAAA 5A3QA 1WM1A 1NQVA 1K27A 4AMVA 2W6ZA 1EP2B 1JQKA 1XZ8A 3EUWA 4I4LA 5IHXA 1V5FA 2WUFA 4QXOA 4YIHA 1X80A 4IF4A 3LP6A 5K9ZA 2B6HA 4C43A 1UBOS 4HBGA 3AVYA 4HLQB 3DFMA 5DISB 2EWWA 1UPBA 4JP2A 2C61A 4KN9S 5KWVA 1GY8A 1IXKA 3LIIA 5EJ5A 1YIAA 1FP4A 5BQPA 4B3BA 1EHYA 4V24A 2JGFA 3N28A 3EEFA 3MCWA 4KK3A 3M4NA 5EPEA 3T8YA 2J0SA 3JSXA 2W6NA 4B7XA 4RK5A 1S1CA 1RADA 3WZLA 3AF2A 3KSDO 2WJPA 1KK0A 1QS0A 4V3CA 2YR0A 5T57A 2PPVA 5J4KA 2A33A 1Y4SA 3VKVA 3OTWA 4XUDA 4AX4A 1LPOA 4GPTA 4DR3B 4HI0E 1CUDA 4C0AC 5ALVA 1RAEA 3OKCA 3V32A 1A27A 5F23A 4PYJA 1IOVA 1PS9A 3DB1A 1T1JA 1CRZA 3IMKA 5HZMA 3A6ZA 1YA4A 3PE3A 1ZCAA 3ED5A 3U7HB 4BVGA 4TSRA 3ET5A 3I73A 1M1XB 3FPGA 5AQ1A 4G4JA 1HT1E 3RIYA 4UZSA 1RBYA 3BBPA 3O8NA 4F5ZA 5PNTA 2B8NA 1XPUA 4I0WB 2XTMA 1QHHA 4XQ0A 5F5XA 2ZK7A 4R2KA 3SZMA 3E7DA 5AMXA 3CUTA 1R27A 3ZK8A 1O5OA 4JJ8A 3RTAA 5IBPA 3VQTA 3TXYA 2QN6A 2JGMA 2ORWA 2RK6A 3FTCA 2YZ2A 2O8BB 1S6YA 2PS9A 3L8CA 1Q0HA 5KX5F 3DBHA 1NYTA 1Z8DA 2OV8A 3LQYA 2AX4A 4F56A 4MVCA 1J9ZA 2AMLA 2VIIA 1NBAA 1Z0KA 2Q3HA 3RABA 3QNWA 4M8KA 5JQGA 1YIOA 5KDDA 5BSGA 1GNPA 3L04A 1C1DA 1HTBA 2VP3A 4RLHA 5L7YA 4JASB 3UK6A 1J1IA 4A0QA 4NFSA 1BD4A 5ILQA 3ZNPA 4V0LA 4AJ2A 4C20A 3VNVA 3GLSA 5HS4A 1IBMB 1ZGZA 3AJDA 1ZXBA 2VUIB 3A4TA 5FORA 2GZ2A 2XMCA 1ZJJA 1P4SA 1JIJA 1UMBB 2X0EA 1TIPA 1V8DA 3ZBTA 4NCKA 4L8WB 1I8TA 1AQUA 5IM4F 4WCDA 4BKPA 4TKUA 2ZSDA 4CLHA 2O48X 3AEXA 3N2KA 3F3SA 3FZQA 1NI3A 2ZFUA 2FK8A 4ZJUA 3T3OA 2RK4A 2WF6A 2EOAA 2VXOA 4QHYA 4RM3A 3B2EA 4G97A 1NR1A 4ZYYA 4IH9A 4NONA 1IY9A 3NHPA 2N46A 3LYAA 4NFHA 3R6LA 1Z6AA 3HDQA 3LBNA 2VPTA 1E60A 3KT6A 5CYPA 5DNYB 3SVZA 5C8VA 2PUGA 2R7NA 1E6EA 1VPVA 1E59A 1G41A 1UPXA 2FWJA 2EAUA 2D13A 2E4AA 3HA7A 1YQDA 4MLPA 4UXJA 4E94A 1BX1A 3RTEA 5F12A 4OHBA 1RXUA 4JI4B 1OTXA 1U7XA 5B1HA 3VR4D 2G80A 5KNCH 4A03A 3WDLA 1IEQA 2ARKA 1A71A 2RJ3A 2N42A 3OCCA 4JC8A 3ZJ5A 5M2QA 1Y7PA 2ZRAA 4LXQA 1VG8A 4I1PA 1SVNA 1SVMA 1X39A 1Q7GA 2GN0A 5DRTA 3TLGB 3ANMA 3EVFA 3ISTA 1OGYA 4DLPA 3LOPA 4RV9A 4V1CB 2FDCA 4EG4A 1ENPA 2Q2VA 4Z9BA 4JIGA 1EGVB 1NXXA 2UDPA 1Z2OX 2FPIA 4PE5B 4URZR 2ZM5A 2WSLA 4WY2A 2VLIA 2GCPA 1FRZA 3C3CA 2YQ5A 5DNDA 3T0IA 1IN1A 1BS9A 2BLLA 4FC7A 4DIDA 3F7MA 3JATB 3ULKA 2H00A 5JECA 1UEJA 2FHPA 1B3BA 2H17A 1HI9A 4FKMA 4OLHA 4XM1A 1LNZA 4C22A 2KM1A 9ATCA 5IT9A 4AUKA 2CLIB 3UKOA 4P53A 5B58C 5B3JA 3VISA 2PX0A 3HY3A 4K86A 5BSFA 2NP7A 3GFSA 4EECA 3TWOA 4QDJA 3KPUA 5DI3A 1GGFA 2CZGA 2GN2A 1WA5A 3KNZA 3Q88A 4OXQA 4DCPA 2SKCA 1U9IC 1PL0A 4HUTA 2IYTA 3RHSA 4DCUA 2VSFA 1R1DA 1T35A 3NWJA 4YROA 2H5EA 1TM7E 2VYND 4UOZA 1H5QA 4QFCA 2FF5A 2XAUA 2WABA 5FAKA 1P45A 1DPGA 4Y18A 1R16A 2F8LA 4OBXA 2FEXA 1BMFA 4IL5A 1EUCB 1EU1A 2VDNB 5HQ3B 3HKBA 1JEEA 5FTMA 2LBPA 2AN5A 4O2AF 5HJ5A 5FBHA 1O54A 1CS0B 1UPFA 2R6FA 4BMOB 3MS7A 3Q7QA 2EIXA 1M2GA 2GB4A 1KEKA 2OXTA 3PTZA 1KY5A 1UJBA 4PPGA 3R77A 4FS8A 1HE1C 3LT0A 4V02A 2OO5C 3AP2A 3UJAA 4HPJB 1KU0A 5HR5A 1AHPA 1PJLA 2WVGA 5TY0A 4CDNA 2IU4A 3X2FA 2ZRJA 1M2OB 5AIBA 1DV1A 1VJ5A 1E2KA 1EEXB 3QWFA 5E1OA 5I9BA 4UEQA 2CV2A 1ECCA 4JGGA 3F6PA 1UKZA 1PJ8A 1FDSA 3I72A 4J7CA 3IPAA 4JYCA 3RAGA 1P19A 4AMGA 1H94A 3NVAA 4WK0B 4BQPA 1Q5PA 2JAUA 2K7ZA 4EB6B 4HAVA 4LVNA 2I9KA 1IY1A 4LXXA 4PEVA 5GV7A 3EGEA 1N6PA 5IKEA 1SBCA 3AP1A 1ZL2A 3NC1C 3HMQA 3RFUA 3ZDQA 3AR2A 1D4ZA 1N0WA 3WBJA 1UBSB 4FINA 3PZRA 1Z0ZA 1GR1A 4GVXA 1DUVG 1MG0A 1NE7A 5CM8B 5T6BA 3D7LA 1GG8A 3HP7A 4TZ0A 1X8XA 1N7JA 4RA6B 4WLUA 4UFPA 5D87A 3GVXA 3R0ZA 4KO8A 2I4LA 3G2OA 4FUTA 3ICCA 4FOTA 3TTTA 4YCNA 1TZBA 2HWKA 1H8HD 5J59A 1Z6TA 4MVJI 2BFDB 4I5GA 1GTMA 5G1PA 3WIDA 1IM5A 1BOFA 3RYIB 1KDTA 3UANA 4B74A 1E2FA 2ZBQA 2X40A 1YS4A 2BKLA 1FRFS 2C84A 4KSYA 4HJXA 4EY4A 1E6KA 3T52A 3OKFA 1J8FA 3ZZUA 4EB8A 1FFGA 3HQ4O 4MVJH 3DFKA 5FOSA 1AUXA 3NV9A 1SRRA 2HSGA 1FLDA 1MIOB 3I8OA 4BRZA 4MO9A 3D4NA 3FRHA 5IT0A 2ZWPA 3CKMA 4HNQA 3FDIA 1QHGA 1NBME 2WYHA 2YFKA 1VE7A 3QOXA 4ZRMA 3WBFA 5GVSA 1ZP6A 3FF1A 1DEXA 1U4OA 3FAZA 5KNBH 5HKAA 1PW7A 4MGHA 2R87A 3ESYA 3MJHA 4ZOEA 2VBGA 4HB2A 4ZV9A 1I3LA 5CGZA 1M8KA 4Q47A 1H2WA 1E9EA 1TADA 3OT4A 2VWGA 4Y1GA 3AFHA 3A9VA 1BWRA 2V97A 5D6NA 2BHTA 1NDQA 1VKHA 2R79A 2OBLA 5A9TA 1G20A 1SBNE 2X4LA 3NOVA 3PNLA 3CLHA 3TEJA 1P62B 4DA8A 2EFHB 3A9RA 4LNUB 3D6MA 1T2EA 5D5QA 3CLUD 4MQFA 5C37A 4HAUA 4ZN6A 3ND9A 1RM3A 5ILGA 2OZVA 1N1MA 1FP6A 3EXHC 4NG4A 2IIBA 3HYCA 4B3IA 2V9PA 3MJEA 1U8ZA 4YT5A 2YJNA 1IUPA 1RI4A 3PFKA 4DRXA 2ZBEA 2ECPA 1RXSA 2OV6A 2VHTA 5K0CA 1W44A 3G02A 3GLHA 4D42A 1NU8A 3I9V1 1KQFA 4ZCRA 4XI9A 1KETA 1U8CB 4E5NA 4IDOA 5GTDA 1KKMA 2PKQP 2RB5A 4R9VA 2WZQA 2GBLC 2XYQA 3AIMA 4MV5A 3RFTA 3EFEA 4Q4CA 5CA0F 1XTQA 2WTNA 3GCWA 4DUPA 3HR8A 3PUJA 4HUJA 3UJBA 3IVRA 4Y6SA 1OFIA 4KE7A 5FI5A 2BH9A 4LZZA 2OA0A 1QQAA 4HQNA 5AM4A 1O0SA 3KC2A 3JVVA 2H08A 3VYSB 1RMQA 4ZI7B 2UXDB 1W6UA 1Z18A 2NXEA 1OI2A 3KZNA 4TXMA 4EF4A 4RIGA 3DVAA 2TMYA 3SMQA 3MCAA 1MOPA 3WLEA 2J07A 4G5XA 4W5OA 1WMAA 3MTJA 3GLUA 3SX2A 2QDXA 4MXDA 3F0TA 5DMXA 2WNHA 2DUJA 1T9KA 4FWBA 4HGPA 3TFQA 2CGEA 3AETA 3CO0S 4G8CA 2GA8A 2RGNC 3KJGA 2HY7A 4TM8A 3FHLA 2GVNA 1O6CA 1SPBS 2YFYA 3F6EX 3TFWA 2Z9BA 1RC1A 5BWBA 3G17A 5ALDA 4LBWA 3WLAA 4ZVUA 1QIKA 3LL4A 2ECFA 3A6KA 3ND7A 5E7IA 2IC5A 5BXYA 3TLBA 5ILOA 1QNFA 3ACCA 1IN4A 3W3AA 4ZCSA 1Y3CE 1XZPA 4FOSA 1HLFA 3MINA 1NTRA 5HP4A 1WL8A 2B83A 4C4YA 4R2WA 3FDZA 1ZSNA 1AURA 3IQIX 4UJ5A 3S4YA 3K70B 3H2YA 3LBHA 3MMZA 3DZIA 4RTMA 1NMEA 3LWDA 2AQKA 4FB5A 1Z56C 5E8RA 2BEVB 5K4AA 3RLIA 3SSAA 1M7GA 2VZ0A 3GUZA 1SQ0A 4LRYA 1YUMA 4YO8A 2Z95A 1NUTA 4QPJC 3K7EA 4H60A 2R1UA 2WMNB 4P3YA 4S04A 2Q50A 1KJNA 2I1QA 2DH5A 3ZCRA 3LLCA 1U5AA 2CNKA 1SMKA 1SOMA 1Z29A 1BFUA 2OFWA 4KUGA 4A8JB 2IBTA 2BWJA 3QU5A 2A3RA 2Y1DA 3QW4B 3ZW9A 5FA8A 1OY1A 2WG0A 2G1JA 3GC6A 1SH7A 3QBVA 1OQAA 4HXFB 3X44A 1DQYA 1GGKA 4X66B 1NJ5A 1K8QA 3B1FA 4BLVA 2JF0A 1XTPA 5ITZA 3NOOA 1MENA 1QX3A 2J30A 2O59A 5DSZA 3I4CA 2M6SA 2OLEA 3ELBA 2NMVA 4JCCA 4CU2A 1XTRA 3IP3A 5BVGB 3BH6A 4PIPA 4LY9A 4CEIB 1B23P 1UOQA 2JI4A 3NAQA 3MC1A 3LPCA 2QE7D 4OKNA 4CIYA 4ENSA 4RU1A 4HB3A 4M36A 4JR2A 2VDLB 1VA4A 3F6YA 3ROTA 4OQLA 1JIQA 2XMRA 4ZKEA 4QG3A 1K97A 5G41A 3LVBA 5BORA 4FGJA 2LKDA 3QYPA 3WWDA 4ETNA 3TJRA 2XUFA 5HIAA 3N2GB 2VTBA 3ZBUA 3RU3A 3RD5A 2IPXA 3MTEA 1GEEA 1R8YA 5DTEA 3G68A 4BZQA 1CUHA 5SZKB 5ALXA 4LJ7A 4QOGA 4XX1A 4E07A 5EHQA 3TGPA 1V5IA 3E3AA 3QVGA 2K6GA 2X76A 3AC0A 1Z8HA 3B1YA 4AD8A 4DV6B 4A82A 2PRSA 3F6CA 1E5VA 3C1TA 4L5AA 5EERA 3HXKA 4GWGA 2JEYA 2YHSA 4UU7A 4IUDS 3WADA 1N5RA 2FSSA 2YJZA 2J87A 4X7RA 5F2NA 1FDIA 2RKBA 1OH5A 1G8FA 4M0LA 1Q0ZA 4QOEA 4YMIA 1RZRA 2IXBA 1OGIA 3P9SA 2JFQA 2OMEA 4Q02A 4DJAA 4URFA 4F45A 5IU6A 1YQUA 4XB2A 1B74A 1C4OA 2YV2A 3ZHVA 1I0ZA 2PYZA 2OOKA 5LLTA 4X8OA 3HGMA 4YQFA 3O0TA 2AEFA 3HN6A 4WNCA 1T9HA 3D4PA 4G4SP 1L5RA 2PMDA 2ZUCA 5KNDD 3CZ9A 4W1PA 1SXJA 2OGSA 2ZJ1A 3K1TA 1TTQB 4JLJA 5I51A 2PU7A 4Y2JA 2WSYB 3VYWA 1YQEA 1G8AA 1OLXA 2O57A 3WOHA 1E7MA 4B2PA 2QTWB 4DLNA 1IHXA 3MXTA 4CKYA 2GD0A 1T1EA 1GCAA 3LBYA 1GPDG 1M3SA 3J7TA 3PNOA 4KO4S 2ONKA 1YRQA 4FFBA 5TE9A 4B8YA 2E4UA 3Q6MA 4L72A 4GMXA 4ZV7A 1Q7RA 3IR7A 1LH0A 3BRCA 2MR5A 1SKYB 3MIIA 4G1CA 4CQJA 5HUHA 4IW3B 1T2UA 4EHIA 1M8JA 4ADSG 1LQTA 2Z09A 4L5CA 4QGBA 1DOHA 2QL6A 5BWOA 4MGYR 2PZLA 2XCIA 1ZCBA 5B3AA 3RAJA 1Z4QA 2DPXA 2WWGA 3BMQB 4Q3KA 3QOYA 2GUWA 4H7IA 3RF6A 2X22A 3SKVA 2WYWA 1JHMA 2VXBA 4RKYA 3O47A 4K6FA 2SCUA 2V7QD 3HUTA 1YCDA 3DKKA 4MROA 3R6TA 3L0SA 3B53X 4RFVA 4X1YB 1RM5A 1EVLA 3NEPX 4RULA 1NBMD 5YASA 3MEQA 2Z8ZA 2G1KA 4B3FX 1EDEA 3KYDB 1H3EA 2Z83A 3V1NA 1T2VA 4DV1B 4MVJP 4BU1A 2XIQA 3MS2A 1OX4B 3DVQX 5HK8A 4XJXA 2AOWA 4HN4B 1DC5A 2ZKLA 1ITZA 4LC1A 5F7OA 2I7TA 5KYXA 4RMGA 4D0RA 4P5PA 3ISJA 4UE2A 4Q1EA 5D8DA 3HP4A 2AV6A 2WT8A 2A9VA 4QT4A 1OWPA 4DLSA 2BFEB 4XYMA 3NASA 2NPFA 3CVVA 3GGPA 4LHXA 5KYVA 2AT1A 3WL8A 3TYXA 3VRHA 2XMDA 1O03A 3X2EA 1VCNA 2A0YA 3AHCA 3U80A 4O59O 4BNIA 2W22A 5WRFA 5KTYA 4HRXA 2QY9A 5BVHB 1IN5A 4YI5A 3PPVA 2RAVA 1QBGA 1ZHFA 5DTRA 5IK2D 2VHUA 3STWA 1U0FA 3VNAA 4QJ3A 4OXYA 4GU5A 2GZSA 1NPDA 1HQCA 1EBBA 1JG1A 1O4VA 4AMBA 2YJGA 4OV6B 1K5DA 1RYNA 1QKIA 2FQWA 3AIKA 4HX2A 4PYIA 4GKKB 5IT4A 5EPUA 3SHTA 5JSUA 3PT9A 2CL5A 4JWTA 3TLKA 1AKTA 2J31A 2PUAA 4MPJA 2DQ4A 4ZVTA 3L7OA 1O77A 4Q4JB 1GPWB 3EZLA 1AM4D 1E18A 1Z8NA 3JZDA 2A0FA 2HC9A 4YN3A 1U8FO 4GUDA 3LOQA 1LSUA 1QU3A 1W4LA 5AM3A 3Q7RA 1JA1A 3QKIA 3AR6A 4LGYA 4FE7A 4PONA 2AYXA 3ZGNA 1JJIA 2QA5A 2VYCA 5CJPA 5C8DA 1U2DC 1V47A 1T2FA 2FMUA 3GLTA 1Y6JA 1DJOA 1LF5A 1W1IA 2X3YA 2XWJI 3GV0A 2CFRA 3Q8XB 2QMOA 3R5KA 4HAZA 4W7SA 4AF7A 5L4SA 3QKRA 2O7RA 1NM5A 2Y05A 3A6FA 4NBNA 3U7FB 1MN6A 2W5UA 4JCOA 3UH0A 2FPRA 2J5KA 5EJ8A 1M73E 3BXPA 3L06A 5HJ2A 4G1BA 1KO8A 1FZQA 1IN7A 2WSSD 3E58A 4PFKA 5JYDA 1T13A 3Q2IA 5AXCA 2IZ7A 2YJ5A 1EXMA 3OU7A 4KQIA 5FFNA 3W6OA 5IC4A 1NWCA 1MG5A 1PT9A 3LCJA 4E2XA 5DNEA 4RK0A 3MWDB 5I7OA 5C7IO 2FG7C 4DLRA 4R40A 2BFPA 1NZFA 1LLFA 2IJGX 1VBNA 4WKGA 4Q3BA 3K9QO 4MK4A 5ALGA 4F4DA 1QQ5A 3ICVA 2G8LA 2EG5A 4UVGA 4WTOA 3RSLA 5ABPA 1XLTC 1FVXA 2RIPA 1ISRA 4IV0A 5T3YA 2RHRA 2C4HA 5K09A 1YJAA 1RWPA 3R5HA 4C06A 3H9JA 2CYAA 4TTVA 3AFGA 5H59A 4ZVMA 4ABTA 5LB4A 1JFLA 1C8LA 3I9FA 3I39X 3PEFA 3FSEA 3I2IA 4LYHA 5FUBA 2XKBA 2CBZA 3H1BA 5HF6A 3QYJA 3OFND 1LXCA 5H80A 3HSSA 4AG6A 3KQVA 1CQZA 1XU7A 1JMVA 1GKLA 2DH6A 2EIHA 5DEIA 4JI1B 5LIPA 3ER8A 1G3RA 4NATA 2AKEA 3TFOA 3VNQA 4MRVA 1S2MA 3SU8A 1FY2A 3ZG6A 4ASUA 4QM6A 1C3JA 7REQA 2QBYB 3C3BA 1G1MA 1W35A 2QZZA 2P1RA 5P21A 4LIPD 1X94A 4QRIA 1L5HA 1HDXA 1X7ZA 3ZKAA 5KTKA 1E2EA 2OV4A 3KWMA 4CR7A 4JLUA 2B94A 1RTKA 2WP0A 2CB0A 2J85A 3F4BA 4MWGA 4QTYA 3IL2A 5LQJA 2WTEA 5TF0A 2PKCA 3PXBA 2OWEA 1LFAA 2CLOB 5DGXA 5CITA 3E82A 4FMCF 1LZKA 4Z9YA 1N5LA 3QG5A 1D2MA 3FOBA 4ZT6A 1MEOA 2NAPA 4QJIA 1P1IA 1F8XA 2B2NA 2QUJA 1LPSA 2W4QA 3EARA 4GM1A 1HE4A 5CLHA 1U0EA 1QIFA 2NZXA 2A35A 1Z28A 2AOUB 2YDXA 3I6ZA 1KSGA 5LZ5A 3D6UA 2R4UA 2XWBF 1WX1A 1HYEA 1YNSA 1HKUA 1V7ZA 1NLZA 1ONOA 4C4AA 2Z56A 2F17A 4RV4A 5ALTA 4P93A 4MUAA 4AP6A 1JN0A 1ONSA 3LYUA 2OVFA 4G0ZA 3UGQA 1JHYA 3P0HA 5JIBA 4XEHA 4YRSA 4Q24A 4GZLA 2WZDA 2LKCA 2WMDA 3M7IA 4MYSA 2GXSA 5CM9C 1UXOA 1UMKA 3IESA 1G9SA 3BERA 4RAOA 5TEWA 5JAPA 2CY0A 4RD3A 4BMCA 1BHJA 1ML4A 2QD2A 1AUOA 3ROEA 1V16A 2B2XA 3C39A 3DYIA 4L8GA 1K7XB 3SBDA 4HQ6A 2Z8YA 3EVBA 3L05A 4GGMX 2O2CA 2MIIA 4GOOD 3T94A 2PGOA 4A5SA 4BBZA 4QPDA 5FHRA 3ESZA 5J2TA 2I6TA 2YV5A 4EVQA 1G8HA 1NI4A 4KMSA 3HYNA 4S3MA 1UK7A 3KJZA 5TSDA 1EH5A 2PK3A 4BNUA 5LQUA 3IAFA 4JMLA 4YJ3A 3LGSA 2OXCA 1HH4A 4JLDA 1QYIA 3OI7A 3ENZA 5HE9A 4A2WA 4MHOA 4Z6KA 2FWMX 5DHSA 2GO1A 3ELWA 5ALRA 4EEZA 2IGBA 4F9GA 3KZ1E 3E3MA 1XDZA 4TPKA 4MAMA 221PA 1A0OA 2HGSA 5FPSA 5F9HA 3KYIB 4HLUA 5HKOA 1OVGA 1LA2A 3BE8A 4JOCA 3DH0A 3S2ZA 4BCCA 4E31A 5IN4A 2QMQA 3JQDA 4YP6A 2C2GA 4XYEA 1QK3A 2G88A 1LNSA 5MHTA 5EMLA 1RMTA 4G1EB 4XFDA 4A6DA 4COOA 3D1JA 4E5KA 1E6CA 3E0QA 1XT6A 1ZNYA 2W0MA 1C3XA 1RJGA 3A31A 4GF5A 3KBBA 3M1AA 2TMGA 1XRPA 3DAHA 1Q0QA 1AF7A 4MQ4A 2VT3A 2GM5A 1M9NA 1I6LA 4DBVO 2ZWIA 4EHNA 1VB3A 3KQLA 3USZA 1VL2A 4ZU1X 4R7ZA 2AVDA 1DBSA 2Z5LA 3LLMA 4UDOA 5MN5A 4YRFA 1JG7A 1BKDR 3B89A 3O21A 3VDXA 3KSAC 3MQ4A 3GT3A 1KJWA 1EJ6A 4XDZA 4LJ8A 2D4HA 1PF7E 2J8ZA 2XW6A 3FNIA 3INYA 3ZZNA 1YF3A 2I34A 1J1UA 2ZSEA 4MUKA 4CDRA 1ZU5A 3DEFA 1E3WA 2CFIA 5ALIA 1I7QB 1FDWA 4R83A 3ORHA 1PGPA 4HQKA 4CM9D 5ENZA 3LKVA 1DFIA 5HIJA 3C14C 1ZUWA 2EJWA 1KPGA 2L69A 2DFKB 2V54A 1JR3E 1YHYA 2HJHA 3DAGA 1P74A 3D7MA 5EE0A 4BZWA 4A8PA 3U09A 1K98A 3DHWC 4N65A 2H2AA 1EX9A 5DBGA 1GDHA 3OIVA 4Q00A 3UJHA 3C3KA 1YMUA 2EWMA 1I9GA 1G8MA 1CF4A 1JPVA 2AXEA 2V8OA 3DZJA 3G2LA 1FTGA 2JI6A 3HI6A 3MWFA 5AI6A 3DOCA 1UEIA 4R2LA 4YAUA 1WEHA 1LTHR 4EELA 5MN6A 2FQ1A 2VH1A 3GUVA 3DHYA 3H84A 4JBWA 3CR3C 4LQDA 4ZU6X 1FXWA 4LA4A 3GHHA 4WNIA 2VJLA 2OBXA 3AVPA 4GD3Q 1I10A 3OZSA 2BGGA 3IIKA 5IM5A 3RVMA 1Z47A 3Q2KA 4ZGBA 4CQNA 1E2JA 3DAPA 2QVXX 4PYRA 5HFNA 2CEAA 4AAYA 5A6VA 1SCUB 2EG9A 1Y7HA 2G07A 3ILYA 1ZNWA 4MS4B 4QX6A 5HBRA 1XFDA 3TNYA 4YRBA 2O3TA 2IYAA 3R9IA 3GFRA 4XWTA 2QAGC 4MARA 2PXHA 5JCOA 3EY4A 4BGUA 2ATCA 3FN4A 2BEJA 4WECA 3P32A 2ADFA 5J47A 2CZQA 1GTSA 1XGKA 4QDOA 2AMVA 3LHIA 3PC2A 4JHLA 2R5WA 4M9RA 4ERXA 2CJXA 2VPZA 2FX5A 1THTA 2XDQB 4B79A 4OIMA 4JI6B 2B7BA 2G9VA 3EW7A 1EJBA 4BUZA 1DDIA 1NVKA 1A3CA 1BFDA 2BL4A 2ODQA 5JNSA 3QJYA 2FZCA 2WUGA 2FWPA 3AGPA 5T5QA 2XOXA 4BB5A 4R68A 1U2GC 3KQQA 3ETGA 4ZZ1A 3BT7A 2XUAA 3OE4A 3O2SB 1UP7A 2G9RA 4EDHA 5F98A 3VAYA 4BMXA 4EYGA 3MT8A 3VR5D 1P1CA 3IMGA 4BECA 5F35A 2NSYA 3TNFA 1NL3A 3PVZA 3GJTA 4ILKA 4ZT7A 3SEAA 4BLOA 2Y27A 1TIKA 4JUBA 5HOEA 2AK2A 1KFBB 2WAXA 4R3NA 1U0TA 1X8KA 4DNOA 2Y1KA 5EXSA 4ZAZA 4XFJA 3MMPA 3D6NB 4D9GA 1BHSA 1NJ2A 1Z73A 3C3WA 3H05A 4RF3A 7ABPA 2PE5A 3JQEA 3PSHA 2BI4A 4N0PA 4TTAA 3R0VA 5AKKA 1JLRA 2YNMA 2OB1A 3U7IA 3CRRA 3VU8A 5A62A 2R1TA 2V0GA 5JCJA 2YINC 4JK3A 1SA0B 1DWQA 3DD1A 3EOBI 3OO0A 4FGLA 2H18A 1YZLA 4GICA 4KJXA 1X86B 3UV3A 3U4QB 1HFKA 3DM9B 1E3IA 1DKRA 3DL7A 2GTPA 3CRW1 4TVSA 4I4TB 2XD4A 1U9CA 1EQ2A 3WLFA 4GKVA 4WV3A 2WQ6A 1AD2A 3TOSA 4DXAA 4RZHA 1M6EX 4DN6A 2WNSA 4P3NA 2EKLA 5HUJA 4A6EA 5JANA 1ID8A 3G5MA 3QH4A 2XUOA 1L8LA 2AOTA 2IRWA 1WBBA 2I6FA 4G89A 4JUCA 4KVGA 1IBLB 1QFMA 3TM4A 4IHQA 4D4LA 3HKCA 4TV8F 3TIIA 1ZGCA 3L02A 4FEEA 5IG2A 5F78A 1HM5A 2QENA 3K9FC 1THMA 3ROXA 1CUYA 1NX6A 2ZRPA 1CE8B 3QEKA 4JB2A 1LDMA 4QXPA 5JAUA 4L3WA 3IV7A 1GSOA 3B60A 3PDIA 4KIUA 1Z22A 1KE2A 1L8XA 3RC9A 3W4JA 2Q7XA 2Y1GA 1QRUA 3JQFC 2J3DA 3C24A 3PLAE 1HE2A 1K8YB 5CDSA 1NP7A 3BWVA 3BMNB 1H2HA 1E2BA 3PNMA 3TINA 1A2BA 2X4GA 1AJEA 3S2EA 5KKNB 5HM6A 3OJLA 4BDTA 1L7QA 2B37A 1XAIA 1F60A 2RAUA 2P2YA 2HO5A 2LGJA 1ZZGA 2QE6A 4QPNA 5HEKA 3FPLA 4PTLA 3FPHA 1MV5A 1BSVA 3CR7A 3GD7A 3O82A 1XPRA 2LTAA 2ZRNA 3L79A 1PFQA 3O8BA 2BP7A 5JQWA 1P73A 4DDTA 1GN8A 4H7JA 4ERNA 4OQFA 1L6IA 1DRJA 5GZ6A 5A3VA 1NFRA 5JMWA 3E8SA 4RKWA 4YCDA 4NLLA 1B1AA 5HQ3A 4Y1FA 3DPSA 4OX9Y 4W9NA 3DTYA 2BCEA 3D0KA 1CR4A 1CS0A 4RVOA 3T9DA 1GPAA 1Q0TA 1FMFA 1NF8A 4IIFA 1GAEO 5ECDA 3VV3A 5JG7A 3KXKA 2XGSA 3RROA 4C9BA 3R9XB 4EG0A 1WUJS 3B9QA 1OSNA 2F3PA 1VG9B 2ZRFA 3AW8A 3VPXA 5CB4A 1K0FA 1CYEA 3KYJB 3P8ZA 3WICA 1ES9A 2A5JA 3Q6IA 1D6MA 2FMXA 5EZSA 1E2UA 1O95A 1B76A 2J59A 4WZZA 1YV9A 3EWSA 3SMVA 1N2XA 2ZRQA 1TKCA 3BGDA 1R4NB 1TZCA 3NW9A 3KQSA 4W1SA 2XB9A 2PL9A 1TIBA 2GFHA 3NTRA 3NDBB 2CK3D 1BXRB 2FVYA 3QEAZ 3CEPB 4DMHA 1HORA 1ZGBA 2DKNA 2RGYA 2MYTA 2WP8J 5BOSB 1RLUA 5ELLA 2SBTA 2H3EA 1MDFA 4GLBA 1DKOA 3FBWA 2G0TA 1TCCA 4EB6A 1WBDA 4EYQA 1J22A 2OZEA 5LZ8A 4CL8A 1NYQA 4GMFA 2FZVA 1C0EA 3M6VA 4CDGA 3ZHYA 3OIGA 1VLQA 4FHCA 1VFNA 1RXYA 2DLNA 1ZKDA 4XX0B 2UZIR 1R4MA 1DO0A 1HE5A 1P2SA 3C3XA 2D5IA 3EQ6A 5AI5A 5B37A 1BC5A 2BE9A 3CN7A 2J3EA 1PDOA 1AT1A 2XTJA 2O06A 5IF9A 1Q0PA 3GVHA 1YMVA 5B53A 3ZWXA 4BIIA 4DT1A 4E5SA 1SHTX 3NHWA 4PPNA 4YDSA 3VSDA 4C3ZA 5CFZA 5A71A 2BFDA 2QLTA 2XPCA 1JQLB 2GAJA 4KQ1A 1OTHA 4RHTA 2IYOA 4IR7A 1C7ZA 4KYVA 4CE6A 1P9NA 4YI3A 3VH3A 2Q8PA 3NHKA 4K6MA 5FYQA 3JASB 1H6DA 1UXHA 1KQ3A 3AR9A 4OU5A 4PO3X 2J6HA 3RS3A 2IIPA 4MQEB 1HDIA 5FI0B 3X1XA 3EEQA 1NRJB 2PMFA 2DULA 2VAXA 2VT2A 1IRIA 1NVGA 3OAAA 4IJKA 4E11A 1OZGA 4WK6A 3EY9A 1MJ5A 2WV9A 4UQLA 1RRFA 3LZDA 4OHWA 3ZY3A 5FNVA 3HVKA 1FB5A 4D4MA 1L7OA 1QGYA 2I87A 2IV3A 2IYFA 5ESDA 3TZEA 5DYWA 3UJ7A 1R8SA 2QRQA 2XJ4A 1QFXA 1CDDA 1JKXA 1PZXA 2BKEA 2X42A 2HTFA 4UUMA 4ZT5A 5JTTA 1Y3HA 3FYUC 4CCYA 3OZCA 4EM6A 4HDKA 3TR6A 1UKVY 3C3EA 1IK4A 2DFVA 3FDFA 1NUHA 3L7BA 5HJEA 3H5VA 1JR3D 5LPNA 4I8IA 1T36B 1OF1A 2OD9A 3PQ6A 4N3GA 3C6BA 4WUVA 2OXFA 2C88A 2H1RA 2XB4A 3Q12A 4PR0A 4XDHA 4KPGA 1WY5A 3NUZA 1D0SA 3TQCA 3MB5A 1U3CA 2JHFA 5JNTA 4K05A 3MTQA 3S7ZA 4D1YA 4YPFA 1PGJA 4LXIA 2ZB7A 1UJ5A 3BCSA 3BL5A 1E6UA 3MWYW 1QLWA 2IFTA 5LMUB 1FUUA 3TE7A 4R3WA 5IVIA 3H18A 1BDBA 1S8AA 2B4AA 2XGMA 4MPPA 2XTAA 1J0BA 2W37A 1XZFA 2HBYA 4EF6A 3JALB 4MI1A 1G21B 4JXJA 3H5IA 1X77A 2AN9A 4AJHA 4QPPA 5KVCA 2CBXA 2J3QA 2V7VA 4EQ6B 2NO9A 2ILVA 3PD7A 3S8YA 1A76A 1JVNA 1LU9A 5ITWA 4DMFA 2D2EA 1IJFA 4YV0A 2GZMA 3CTPA 1NKVA 3CLVA 1Z3IX 4U02A 2O4UX 3VOBA 3PXUA 5L3RA 4TVKA 4Z8YA 2JFVA 3PQ3A 4PZ0A 4DJFC 1V11A 3BRWA 3D5TA 2HHCA 5TQ2B 5EJ4A 3AEZA 3TPZA 5LMNB 2ANBA 3DTNA 2QLBA 2WM8A 2ZR7A 3KB6A 4HMQA 5DV9A 1Q16A 2FPXA 4AURA 3B5JA 1Z08A 1E4EB 1S2LA 1CNFA 2DFDA 4FPXA 1JFFA 3KUXA 1RIFA 4LISA 3UTCA 4RLFA 4ZI7A 2Y1FA 4J0HA 4ZAYA 4O4JF 5KB3A 2JJYA 5K8UA 3QEOA 1U2EA 2GETA 4L4ZA 2DT8A 5JHGB 4GH5A 5CLQA 3OLVA 1KH1A 3EDOA 2JFFA 1UBRS 5BSVA 3HRIA 3PICA 4PG8A 1EK6A 1W29A 1V37A 1XMIA 1T4BA 3WYNA 1BW9B 2C2XA 3PP8A 1ZVMA 5IZCC 3EVNA 1Y3IA 2XZLA 3ZZ1A 1JQDA 2EU8A 4KAXA 2QTVB 3CZMA 5AHXA 1RI1A 1CKEA 1I51A 1YVUA 1B16A 4NMXB 1BHQ1 1MNQA 1Q95A 3HB0A 4GEGA 1Q3TA 3BMOA 4WAUA 5FL7D 3VDRA 1NLUA 2DRIA 2GEFA 1XVVA 2OQ2A 4KXUA 3EB9A 1ACJA 3PWTA 2VS1A 4K9LA 5E7MA 4PCVA 2H06A 1TZMA 4DW8A 2ORIA 3DLTA 1IJBA 1LTKA 1G3MA 3DEZA 3JW8A 4INPA 1VZ2A 1ABBA 4NMWA 3TTXA 5CHEA 2Y92A 4N8EA 4M0EA 4DLZA 3ZJVA 4E4TA 1IHDA 1U6IA 5KREA 3DKRA 1JFSA 4W8HA 1P2BA 3QVLA 4MW4A 1CJMA 3AYXB 4QOSA 4BATA 4BGEA 4BRSA 5GONA 1MB3A 3MYYA 4Z4GA 1W1WA 4LOKA 4TTJA 3UAZA 2YV3A 4AICA 1CVRA 1QYVA 1U3FA 1U9JA 2XB8A 4RX1A 3IELA 3L0IB 3MRVA 2WU0A 1R6UA 4XJVA 4BX8A 1KP9A 2P91A 4QPZA 1Y98A 4KBGA 2CMGA 5FBWB 3AY7A 2H5LA 2O4CA 1H05A 1P4JA 2VSNA 3KEOA 3T1TA 1QYR