3DVRX

Proteinase k by lb nanotemplate method after the first step of high x-ray dose on esrf id14-2 beamline
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvrX00
2DUJA 4K8RB 1YJAA 1SBIA 1PTKA 3ZXYA 1JEAA 1CNMA 5AQEA 2PWBA 1Y9ZA 4OV6B 5ARCA 1GCIA 1BH6A 1SCJA 1T1GA 1WVMA 3DE5X 1Y3CE 2SBTA 2QTWB 1GTJ1 1NDUA 3DE0X 3DW3X 3PRKE 1OYOA 4NE9A 4RYDA 2Z2XA 2Z58A 2ID4A 2ST1A 4DZTA 1IAVA 3DE4X 4Z2AA 2XTJA 1PJ8A 5SICE 3WQBA 2Z57A 3DVQX 1T1IA 1SBTA 1OT5A 2Z2YA 3DYBA 4B5LA 5JXJA 1Y33E 3AJ8A 1KE2A 5JXIA 1SVNA 3T41A 3A3NA 1AK9A 2HPZA 2P4EA 1SBCA 2W2QA 3L1KA 3EDYA 1VSBA 3I34X 4JP8A 5AVJA 5AVKA 1P8JA 3LPDA 2DQKA 3Q5GA 1MPTA 2WUWE 1SIUA 4HX2A 1SUEA 2SNIE 1SBNE 5FBZA 2W2PA 2PRKA 1NDQA 1Y3BE 4HVLA 2B6NA 5ARDA 3QFHA 1YJCA 1GNVA 1WMEA 1ST3A 2SICE 4H6XA 1UBNA 3BGOS 3DW1X 1ZVJA 3LPAA 2X8JA 1DBIA 4BWGA 3BPSA 3F7MA 1AF4A 1DUIA 2Z56A 2GKOA 1KDZA 1SBHA 1LW6E 1V6CA 1SUDA 2G4VA 3DE6X 3HJRA 3QMPA 5ARBA 4I0WB 1AQNA 4DJ5X 1THMA 1AV7A 1TM3E 1IC6A 2PYZA 1GTL1 1SH7A 1SUCA 3H42B 3PTLA 2W2MA 1SIBE 1WMDA 1Y34E 4KB5A 1YU6A 1EA7A 3DVSX 3GCXA 3LXUX 2PQ2A 4MZDA 1XF1A 4NE7A 4C3UA 1OYVA 2PWAA 1A2QA 1SCBA 3CNQS 4KG7A 1GA6A 1KE1A 2DP4E 2PMWB 3DDZX 1T1EA 1GA4A 1Y3FE 1C9NA 3F49S 2X8JB 4GI3A 4CFYA 4CG0A 4M1ZA 2ZRQA 3VSBA 1GT91 2PKCA 5JXGA 2Z2ZA 1BFUA 1TM4E 3GCWA 5K7SA 1TMGE 1SCDA 1V5IA 2ZWPA 3AFGA 3BX1A 3EIFA 1AVTA 1S02A 3UNXA 3A3PA 1NLUA 1WMFA 1SUAA 1TM5E 3I2YX 1BJRE 1CSEE 3EE6A 3I37X 4NMXB 1KDVA 3I30X 3WIUA 1C9JA 1SIOA 1C3LA 2XRMA 1SUBA 1P7VA 3A3OA 1SELA 3DE7X 4H6VA 4KPGA 1Y4AE 3CO0S 1S2NA 3GT4A 3VV3A 3Q40A 4H6WA 3AJ9A 5B1EA 3VYVA 3WHIA 1R0RE 2IXTA 2V8BA 3TI7A 4WOBA 1PEKE 1GA1A 3DVRX 1AH2A 3DE3X 2HD4A 1ZVKA 1BE8A 1TK2A 2WWTA 1EGQA 3VV2A 5JMOA 4CFZA 1Y48E 1PFGA 3DE1X 4AKTA 2ZWOA 1GNSA 4OMDA 5I9SA 3D43A 1TO2E 3DE2X 3TI9A 3VHQA 2WUVA 1R64A 1SPBS 2WV7A 1SN7A 3DWEX 3OSZA 3QTLA 1WSDA 2SECE 1R6VA 1SCNE 4OMCA 4C3VA 4AKSA 2ID8A 1S01A 4DWWA 1C9MA 2IY9A 4WOCA 1SCAA 3VTAA 1YJBA 2TECE 4ZARA 3F7OA 4FONA 4J94A 3SQOA 3WIVA 3ZXXA 1ST2A 1SUPA 1BFKA 2E1PA 1Q5PA 2W2NA 1MEEA 2Z30A 4LVNA 4ZOQI 1TM7E 2W2OA 3P5BA 1GTG1 1P7WA 1TECE 1Y1KE 5AMXA 1AU9A 4LVOA 5CW1A 3SICE 3TECE 1Y4DE 1TO1E 3GT3A 1BE6A 1KDYA 5FAXA 1HT3A 4YN3A 5FFNA 1TM1E 5JXHA 1Y3DE 3D9QX 3LPCA 5B1DA
chains in the Genus database with same CATH superfamily
1RXVA 1E77A 2PSDA 3LHIA 2DUJA 4H2DA 1WZIA 2ZIAA 5JH7B 2QBYA 1VXOA 3EVAA 4TLMB 4C08A 4A16A 2CHUA 4C76A 1NJ5A 2ZBRA 1CY1A 2YASA 5EIBC 1F1JA 1WD5A 2G25A 4Y1EA 3T5AA 1QVRA 1M1NB 1WOYA 3O75A 3WGGA 2WSIA 5I7RA 5F1YA 2IX9A 5DU2A 1N1MA 2CLLB 1T0IA 1I2DA 3ADPA 1L7PA 4IMRA 4TRJA 5JZSA 3ILHA 4AQ7A 1JNYA 1I3CA 2Z5VA 4OXYA 2XTJA 3LPDA 3EVBA 1U1EA 3TWOA 1H2RS 1KO4A 2R8ZA 2WICA 3DHYA 4FE7A 4LDJA 3PSHA 2EWMA 3IA2A 4R1NA 1PR9A 4PBTA 3BE4A 1BZYA 1KGSA 3BJMA 1U4OA 3EDMA 3OKPA 4M9QA 1KH1A 2Z83A 3DV0A 3RJZA 2R6FA 3T54A 4H3HB 3ZNPA 4ABYA 1VBKA 1J8YF 2P11A 5T3UA 4ATNA 5CCDA 2HMSA 2YJGA 3AL0C 4Q9IA 3U7EB 4E7PA 2V4UA 4X6YA 2DTDA 4LNHA 2GD1O 1J39A 3FUTA 4PY2A 3UANA 3L0YA 5KNDA 1O2DA 1S7GA 4O0MA 1KK0A 3WWEA 1YDHA 2IV2X 3F6SA 4HZUB 2M6KA 3VHQA 1VCMA 3KJXA 3SD7A 4A23A 4Q0MA 1N0VC 4GPZA 3PTLA 1QKKA 2II6A 3Q5EA 4DIKA 2J4CA 3GEMA 3T3EA 2L19A 1FTYA 1TDJA 2HPVA 3AVWA 3OWOA 6AT1A 1JB9A 5GZ3A 1WO8A 3U7RA 2C54A 3NYRA 1TF2A 1NKTA 1VGQA 3BJRA 3U3OA 4KQWA 1JPVA 2F6RA 1PU2A 1SCQA 3FFAA 1BE1A 1ORIA 2VFAA 4K9MA 1L8OA 2XLBA 3BX1A 2QX4A 3M83A 5U1PA 2GEVA 2ZUCA 3SICE 5JAHA 2CMHA 2NQ8A 1OXKB 3HKDA 4QO7A 2XNSA 5BSWA 2I8CA 1JYSA 2H31A 3E9DA 2OZLA 1ZI9A 1PUXA 1XL1A 2Z8ZA 3GFVA 3PJDA 3ONEA 4UD6A 4XE5A 1TIBA 3TPFA 3V1UA 1IBCA 4O4HA 2A1UB 1SXJA 3EGXB 4QG7A 1P81A 4R69A 1NXTA 4MVXA 3DMGA 2PX3A 4PQRA 4O4LA 4XJVA 2UZAA 4N39A 2NU6A 2FZLA 4X1YA 5B30A 3UCFA 2QB5A 1Z15A 3DYVA 3GJ5A 1W25A 4MDHA 3KJIA 3UV3A 4MR7A 3RYFB 2ZR9A 5EJMA 2WV7A 4CRWB 1CZLA 3UG7A 1PR3A 3LYUA 5IJWA 4G0QA 1FUEA 1GL3A 4YUXA 1R0BA 2D5CA 2WMYA 1TNDA 1NG9A 5H0IA 4DJDC 5KPJA 1H8ED 2QGZA 3DWIA 3HCDA 1PYGA 2CCKA 4E2XA 5E1DA 1JHAA 3JQAA 3G0HA 1N2CA 3NH9A 2ODWA 3H97A 1J2JA 1NMSA 1QHNA 1K27A 1QPBA 1CB0A 4CCWA 3ZU5A 1TECE 4EVQA 5KB3A 3UMYA 1CR6A 3AETA 4XWTA 5JHHB 1JIIA 4RORA 1TO1E 2YN2A 3U4AA 4RGBA 3V97A 1WBBA 2QPAA 3JSXA 4JOBA 3ZHQA 3MD9A 4P4LA 3JALA 3WQQA 2DLCX 1D4AA 1F17A 3GYGA 4YDSA 2R11A 5FDFA 1EM8A 1RKXA 5FAKA 1V5WA 4EY8A 2ZKLA 5AVVA 2JJ1D 2WRZA 5F7ZA 3DXFA 2ZYTX 4ND8A 2HGZA 3JASB 3UV6A 1MUUA 3GLSA 1U0EA 2XTNA 3GELA 1I3LA 3RAEC 3WB2A 1G5FA 3CUUA 3H1BA 4P54A 3X2EA 2BGGA 2EC5A 4FFLA 1HETA 4B43A 4CE6A 1X1DA 3K0EA 2HRQA 4C4XA 2M1ZA 2ZI3A 1TM2A 2O2ZA 2VSXA 1JFSA 3UKJA 4N3GA 1RLIA 1Z2DA 3TE6A 3OF5A 4RWEA 4CR7A 1AKNA 4BBJA 4EX6A 5JXWA 2NZWA 1MO4A 1AZWA 3G0OA 3IALA 1UFOA 1QYXA 3H04A 5LYYA 4P0QB 5JPIA 4A7PA 3O0DA 1GTZA 1PL7A 4IJ5A 4HQOA 4KWCA 4AZSA 4NR0A 2I99A 1IBLB 4RGQA 1PGNA 4MZXA 1QIIA 3ZCVA 4DSAA 2W8BA 3N2EA 1PQYA 2OV6A 1YSCA 2HF7A 2W6OA 3SX0A 4M9UA 5CG1A 2ORED 3C24A 3WLOA 4BHTA 3L0BA 3OD5A 4EQ6B 2C5LA 4UTVA 1JVNA 2FPGA 3EIWA 4GPAA 2NO7A 2JLQA 1RQPA 3WL5A 5KWVA 1OHHD 3AKYA 4IGKA 1S8FA 2CGEA 3QV2A 2CYAA 5PNTA 5HRCA 5AM0A 2HT6A 5CX1A 5AUQA 3VI3B 3VU8A 4JYAB 3MAJA 3GRAA 4MRMB 4XYEA 3S28A 2RH4A 2RBGA 2P27A 1CBUA 1E59A 3OTQA 2GPSA 1XZHA 4MV1A 2GK4A 4BLUA 1V1MB 2WD7A 4BEJA 1W2HA 1PR6A 2HUNA 2ZVJA 4UNIA 5C3MA 4BMOB 1TKBA 3GCWA 5L7WA 3GVXA 2VEDA 2VPYA 3MJDA 4FJ0A 3FTEA 1IEXA 2WUFA 4DIMA 3DUFA 1W4ZA 3ETDA 4IEFB 4IHQA 2P68A 2G76A 3WKAA 5CXQA 1W4CA 3P9ZA 5LQCA 2ODBA 4EHKA 4UDNA 2ZXFA 1T4BA 3L2OB 5A4MS 5ULLA 1V3TA 2K7FA 2HHLA 3VYVA 2YZMA 4BMSA 4NHEA 4PLZA 2XMDA 3VDQA 2HK6A 2MR5A 1EFRA 4MVJA 3O8CA 5JALA 3U1VA 1FFYA 3K73O 1QIJA 4OGLA 3RS7A 4EUHA 1TRHA 1UBUS 4C89A 5T64A 1H85A 3TRKA 5FBWB 2CJWB 5IG2A 2IU4A 3DFMA 3VAZA 3O2SB 2C2KA 5GZ1A 1FU7A 5JVDA 4DMHA 1T91A 1ZICA 2BEWB 2CHGA 3S7ZA 1NN3A 1P2SA 2NXNA 2P8SA 5EE3A 3QE9Y 4N7MA 3D7NA 3RUHA 4GAEA 4YT4A 2W7TA 4J0HA 4A27A 1NUUA 3CEHA 5HTOA 2DFVA 1AQ6A 2GUGA 4ML3A 5DHUA 3VOAA 1F60A 5HKKA 2YN4A 5C51B 1G9XA 1K3UB 1MW9X 2VR1A 1J23A 4HN9A 3T7KA 3IT3A 5FI0B 3ST7A 3VFDA 3OQ6A 3VR4H 1C81A 2FEWB 3TTYA 1FBTA 3UXYA 3WB0A 4E1AA 2I0FA 4KXUA 4PFSA 5JBNA 2YV2A 5JJCA 4P8RA 1CJUC 4FE3A 4TWBA 3UB2A 1ZM4A 3LPCA 1ULZA 2HIGA 5ALRA 3CG4A 2JPDA 3DG9A 3EAGA 4IOKA 4YTEA 4ZCRA 2A7XA 4D25A 2WMDA 2ZUBA 5KC9A 2BGJA 4CGYA 3ROZA 5JNWA 3WLIA 3COSA 3O9ZA 1P7YA 3ES9A 4YJHB 3NNSA 4XYMA 2R9VA 4E03A 2AMJA 2QENA 1FNDA 1YRWA 2VZ8A 3W1VA 3WQBA 2BKEA 2HHAA 5IT4A 4IAOA 4EA8A 1JIKA 4PYRA 3LIIA 1SXJB 3B6ZA 3EGXA 4L8GA 1WX1A 3G9XA 2C7VA 3EDYA 1M2HA 5IAKA 3CEJA 5LZ2A 1JHPA 3KEFA 5BR1A 1U3DA 2XYQA 4ZT3A 4EPYA 1L4NA 2IEYA 4AKHA 5JWHA 1ZKMA 2I34A 3BH0A 1XU7A 1F6BA 4EF4A 4OYYA 1UKEA 2HWUA 4M87A 1G7CA 4H7FA 1ND5A 2GA8A 3DZGA 3RANA 3V42A 2W2VA 3KXDA 3NUGA 4M22A 4I9UA 4YI3A 5E4TA 2B4QA 5T4HA 3EC2A 3FDXA 4RJTA 2AMLA 1ENPA 1U98A 2JZNA 1GAXA 2JFPA 3BOSA 4QL3A 5K0LA 4HWSA 3UBTA 3ZHZA 2DZDA 1RWKA 2ZT7A 3E8SA 4YQZA 1KZHA 2W93A 3JQ7A 4DR6B 3PDUA 3BMXA 4XGNA 3IBYA 5TQVA 2ZRNA 4Z49A 4NCHA 4MA4A 4CIWA 1NI5A 1UKCA 1WXQA 1YIAA 2W71A 1BFDA 3ICPA 3N74A 1D6JA 4Y1RB 5A0TA 2P6RA 1FRQA 2QN9A 1S2OA 2JEZA 2OENG 3E3NA 4RO0A 2QN8A 4UE6A 4EB6A 4UQLA 3I1FA 1WDMA 1C30B 4YT2A 3U6BA 3IJ5A 2R4TA 4QOJA 4UVIA 1ZWLA 5TB5A 4F9EA 3WKBA 2Q7XA 4F4FA 5GADl 1DEHA 3GDWA 1QRRA 2FPKA 3TPZA 4A6XA 2R8XA 1OZAA 3AR5A 6REQA 3C8ZA 1KRWA 4ZYUA 2EATA 1C3VA 2FWIA 3CO0S 1DC7A 2Z95A 3G2KA 4RAQA 4YMLA 3NV9A 5B1IA 2XCQA 1UBTS 4JDPA 2GJ9A 2Q2VA 5DHQA 1YBMA 2QLNA 1H1TA 2B5OA 3C4JA 4JZKA 3K09A 3D0RA 3OUTA 1V7ZA 5A1JA 3A1SA 2ZWOA 2Q6KA 1V11A 3KTAA 3PFCA 4OFBA 2A9JA 2A8YA 2IE0A 1EJ6A 4MDFA 4MWSA 4KFCA 3I45A 1D7AA 3EWIA 5K3AA 2AN9A 4OX9B 2VJMA 3B9PA 1QR2A 2OORA 3SYNA 3UB4A 4YJFB 4CKWB 3U3DA 3OTIA 2XHZA 1OV4A 1Z06A 2Z1MA 3RGWS 3U7QA 3HH8A 4C0LA 2UZ4A 1VMEA 1ECCA 1AN0A 1XLVA 2AI3A 3LWNA 2YICA 4UHDA 2Q07A 1JQ5A 3JVIA 3WISA 1E2FA 3LS2A 4ZRDA 2XQFA 2CLFB 4NG4A 2KW5A 2CLOB 4TVBA 3FKSD 4GHWA 4IFBA 4ZEOA 2CLSA 2IEAA 3O1LA 2BGTA 1M6YA 3D81A 4UM9B 1BYIA 3UMVA 4I4IA 1YQQA 4TL9A 2Y2UA 4MX8A 1EYZA 4EFLA 1UOQA 1ID1A 4KYTA 3SDBA 3AHFA 2VPTA 3TLBA 2IQ5A 5JSYA 4KMOA 1XRPA 3RUIA 3LX4A 3RE1A 1AKQA 3DUFB 3PHHA 3KJGA 3TZBA 2GUWA 2GN4A 4CLDA 2CHFA 1B23P 5BYBA 2C31A 2QVBA 2OAQ1 1CC1S 3MMPA 4FHDA 3AM1A 2JS7A 5EA2A 1CUSA 1GAEO 3PYMA 2UU9B 2W6MA 1PJQA 3O73A 4ZVUA 4ZI7B 5EJEA 5AHRA 1SBCA 3H8VA 2W48A 2VUHB 2ZI7A 2GBFA 2V54A 4H16A 2MSDB 5HQTA 1YF3A 3HYCA 1X14A 1YMUA 4FOPA 2JI4A 2UV8A 3PGA1 2VJLA 1YR9A 1GGMA 2R6HA 3LCJA 5BNIA 4MPJA 5JROA 1UWLA 1X7ZB 2OG2A 4NMWA 3SC6A 4EGFA 4OSOA 4B6GA 1T5OA 4BVBA 5JVDB 3PHLA 4KITB 3B52X 3G8CA 3LXXA 1R50A 4QTYA 3GLFE 2C0CA 1NVKA 3GRKA 4TV9A 3AUXA 1GT6A 4I0WB 5EYPA 2OMEA 1EFHA 4V0SA 4TXJA 2XYHA 4PE5B 7AT1A 1WZUA 4IIEA 5HDBB 1KEUA 1EXDA 3HCPA 2EARA 3D8HA 3N8KA 4QBTA 3PRJA 2A94A 4UUPA 1AMNA 3AG5A 5B3JA 4EHHA 4ZYWA 4E94A 2GK6A 1E1QA 1E9AA 1OJ7A 3TBFA 4DFDA 1CQIB 4I55B 3S2UA 4GMHA 1HNNA 3OA0A 3AU8A 1Q1EA 2ZSEA 3F98A 4BO2A 4EY6A 4ZK6A 2O1WA 2ACEA 2QMZA 3GJ4A 3FGZA 1M67A 3VH2A 4YRQA 3TRIA 3EPRA 1KMIY 4MP8A 3ZY6A 3NTVA 1KFJB 3PEYA 1V43A 1U8EA 4JJGA 1EFUA 3WL3A 4D41A 1KZ4A 2XOEA 2G72A 1NJGA 3JS5A 3GUCA 3FWZA 1N92A 3WIBA 1GLGA 2VRNA 3M5CA 2RIPA 1P62B 4RADA 2WE7A 4AF6A 3REQA 3U4CA 3PPIA 1Y48E 4N40A 3D4NA 4Y0AA 4KPYA 3GB9A 3ORFA 4J7AA 2D2VA 5J5AA 5BUCA 3TZKA 4C20A 4HVAA 2IHYA 1OZFA 2LR0A 4ZU6X 2WFZA 4HK4A 1WUKS 4Y6GB 4D1YA 4YCNA 4G89A 1CRPA 4I4TF 4DV3B 4QPPA 2ID8A 1ZOPA 3NEJA 4BB6A 5IT5A 3GP8A 3ILYA 1CZUA 1KF0A 1WDKA 2YFQA 4PG7A 3TW8B 5FWYA 4P4SB 3PEEA 3FTNA 3AF1A 4Q3DA 2J3DA 1FTQA 3TLJA 4X90A 4B0OA 2KHZA 2WLSA 3H75A 1U11A 4GKAA 1N3IA 1RZUA 3E1KA 4N0QA 3GZJA 5CW1A 1PT8A 1W34A 3A27A 1HDOA 1JFVA 4WGGA 1IHYA 2OD2A 1NVAA 3JQ8B 1A2OA 1C8KA 1PX2A 1XTRA 3K9WA 2XIQA 5KTMA 1Y7PA 1LC0A 2RHDA 1JLLA 5E2BA 1PV4A 2I8LA 2V3CC 4E31A 3V9AA 2YL2A 5K5EA 3L02A 4WY8A 1P1CA 1XDBA 1BVHA 3ZDXB 2IS4A 1ZCBA 3ONNA 4EO7A 4EECA 2XWBF 2QMUA 2RHLA 3B3FA 1YHZA 1QLHA 2O7SA 5FBKA 5ADWA 2P7HA 5CCBA 2BIFA 5I45A 3R3UA 3PE4A 3U3MA 1Z5GA 1OYOA 3H2ZA 4KWIA 4QYIB 4NK4A 4NU0A 4RK4A 5ALMA 3N59A 1X74A 4A6EA 1YS6A 1GKLA 1Q2XA 4YGYA 2GESA 1FW8A 3K2BA 2XWSA 4K1LA 3VR5H 2H2GA 3UUWA 3L4BA 4MWEA 4DDVA 2WHEA 2J08A 2VDQB 4J0QA 3I04A 2PANA 4HMQA 3GGPA 1NV9A 3O2JA 5B2ZA 1G21B 2V55B 4NIMA 3AIKA 2GYWA 1GLNA 1DSSG 2MSCB 4IQFA 1F2VA 2IYRA 4OQPA 3WBKA 1HZZA 2QE6A 2DH6A 4JROA 3NANA 3QE3A 3PUYA 4W63A 1DQNA 4DMGA 5I48A 2YRXA 4CL8A 2XA1A 4OBXA 2BFDA 4YROA 3A0RB 4J91A 4BFLA 4ENQA 4OA5A 1PL8A 2WJWA 2P6MA 1J00A 2OVBA 5AM1A 1OWMA 4ZCTA 2R1UA 3NCTA 2WSLA 2PLWA 3EXIB 5DWQA 1GZ5A 2VYCA 3M6MD 4I5GA 4MNTA 1J1IA 4DCUA 2HQRA 4CLEA 2BV3A 4ZQHA 2WQZA 3UMFA 3OFJA 3D7SA 3ZE7A 2OCBA 3DPIA 2GBIA 4LJ4A 3CXUA 4OGFA 4U39A 2ZITA 5DKFA 3RYIB 1GUBA 1YK0A 4YT8A 1H2HA 1L6IA 4HDKA 3O9VA 4KQKA 3H5OA 4ZRMA 4TYWA 4D5EA 4Y30A 4DV5B 2ZKIA 3UA3A 4Z7OB 1GQFA 3QBTA 4XIIA 1GKIA 2JF0A 3BL8A 4DQKA 4G9EA 4BGUA 3ZGLA 3GJ6A 2C2GA 2YJ4A 5DNYB 5J59A 2G3YA 4UC0A 5CG2A 3IIEA 1XP5A 3HBNA 5A4IS 2EZ4A 1Z6QA 2QN2A 3IXLA 5F73A 1E3JA 1TEXA 4ZHQF 4XUGB 2X4GA 4DEYA 2J31A 1E9CA 4YJDA 1EZ4A 2QRJA 1E61A 3BN3A 4Y2TA 1UK7A 4V24A 1K6MA 5TJHA 1KEPA 1KOJA 4MO2A 1AD2A 3LXRA 4IGAA 2D5LA 3DFFA 2FDCA 5EPOA 3RS2A 2IY9A 4TXHA 1J2RA 5C1BA 5E6UB 1PWEA 3HM9A 2QVZX 5JH7F 4YLEA 4PC2A 2VKTA 3QHQA 4DWOA 3RWBA 1XCGB 3KU4A 3WLFA 2BDUA 4RVCA 3DAHA 3ZHRA 1V6AA 1II8A 4KLRA 3EEYA 2IYZA 1ZISA 4O3MA 2DKOA 5JJKA 3RREA 3FKSA 5BP7A 4OUDA 3ZI4A 4YCLA 3NHAA 4FUQA 1XQ1A 3KG2A 5KKCA 2H4HA 4LWZA 4Y2UA 3VR6A 3T0FA 4EJMA 3IKLA 1C8VB 4Q24A 4CTNA 5IMBA 5K0BA 3DTYA 1V47A 2GZSA 5ALGA 1MJNA 4F5DA 2GM4A 2ZTUA 3USZA 2I67A 5D5PA 5FUVA 1CQIA 3AF6A 2CXHA 4XQ0A 3NH6A 2O1EA 3JQRA 4REQA 4Z9YA 1BRTA 1I3OA 2LE0A 3CRW1 3BG5A 4IO1A 4TV8A 2FMTA 4GDFA 3QBDA 2CB0A 4JQYA 4FHFA 4R2XA 2AOXA 1T1IA 3C1OA 1Z4QA 4TWRA 1H2WA 2QL7A 2A1IA 2M6SA 2NOAA 3PX3A 5G0SA 5BY2A 3B85A 4D4HA 1J0EA 4FEAA 1J9EA 4I19A 1W0KD 3I34X 5LLDA 1VL5A 2NSJA 3AWDA 5DYNA 2DQKA 1JL3A 1H66A 4RS3A 4N54A 4HX2A 2NPOA 3K0FA 3HEAA 4YCMA 1Z5OA 2VF2A 5HZGA 4PICA 4EKEA 1KO1A 3VUFA 2IE8A 2C9MA 5IW8A 4UJ5A 3RU2A 2PRIA 1QU2A 1W1WA 2J9GA 4Y0VA 1EBFA 2ZDQA 2UZIR 3DOJA 2G07A 1RI3A 3Q3VA 4OQDA 5I9TA 5TDHA 1M54A 5F21A 1TVEA 1BDJA 3G0GA 2GAFA 3CUSA 4EEZA 3FVRA 5IDQA 4ZTUB 3H42B 1OAOC 4I9NA 3MAAC 1SQFA 4EG1A 5BRNA 2ZTVA 1M5UA 4IZHA 1QO7A 1CHDA 1UMBA 3C6ZA 3TSWA 5REQB 4BNVA 3LL4A 1DL5A 2C83A 3RSLA 4LOHA 2RMKA 4X95A 3UH0A 5M2QA 2A92A 2AHOA 2G0NA 4B3FX 1XKTA 3MFYA 3IAEA 4D9CA 1Q83A 2C4NA 2PZEA 5HCNA 5E3IA 3CZQA 2YZGA 3NIGB 2O14A 3VZSA 2PBZA 3DBLA 5EZ6B 2WKPA 1NLUA 3CR3C 1EFCA 1Z2EA 1BJKA 2LKDA 4IDDA 421PA 1WY5A 4KTTE 2PK3A 1YL5A 2QSUA 3SP1A 3FMIA 2AV6A 2I54A 4BC1A 3QNMA 1BG6A 2J6BA 4KGZA 4LHEA 3SXUB 4BV2A 1ULAA 4F1JA 4P4TA 2PFKA 3SF0A 4HB4A 3V2IA 1EGQA 1G9SA 2IZ6A 4WA7A 2O5CA 2PZFA 4Y9RA 4ER5A 1NNSA 5EJGA 4F4DA 5KWSA 5GY7A 2WP0A 2REXB 5KYWB 1C4OA 3D7KA 4UMDA 1HURA 5J2TF 3TI9A 1SCUA 1SBZA 1XDWA 4RA6A 1NRXA 3SSOA 4M0UA 3T5DA 1QTNA 2V3WA 2VH1A 5LQMA 3JWIA 1G21A 2VQ6A 3HVIA 3PJRA 4E4YA 4JITA 1BVRA 2X5KO 3F7OA 4UZSA 1CE8B 3EC7A 1L4YA 2JIMA 1YZTA 3BTOA 5TMPA 2PDAA 4M53A 1M6HA 1MGOA 1U31A 1AM4D 1OH6A 1AUXA 3R5HA 2OPBA 4P86A 4UCFA 3DBIA 2B4KA 3NEPX 5UKDA 3SS7X 2Q2OA 3SYLA 3TNJA 4BJ6A 1N9ZA 3SZLA 3MYYA 4OQEA 4Q4JA 1C9YA 3D64A 3FPCA 2QK4A 2IT1A 4U9UA 1I1QB 1DJNA 1Y3DE 2CCJA 3AX6A 3FCOA 3P5SA 1W36B 3MJHA 4CN9A 3DJYA 2YWFA 1NURA 4MAAA 1HG0A 3EXIA 1JFTA 1PGOA 3EXAA 2BP7B 5ALSA 4C4PA 5KIAA 1KXJA 3ELUA 1ZGGA 2ZUFA 3CZMA 4G24A 1DXOA 2I5PO 2VDVE 2WUDA 4AMGA 3RQIA 5DZSA 2NV0A 3AG6A 1KYQA 3H3JA 2QHXA 2X2OA 4RS4A 2IV7A 1D2GA 4K6MA 2ID4A 1N5KA 2P35A 3RJMA 4B33A 1TT5B 4KBGA 3T0IA 2GTIA 1Z0AA 1A4XA 3N8DA 1ZJWA 2RH9B 4AIRA 1FFAA 5FNVF 1F51E 1IWBB 1MABB 1N8KA 4MHSA 1P4SA 5T3YA 1A96A 2JIZA 3E03A 1DC5A 2QD5A 4L4UA 4RC9A 1QB7A 1RJEA 1XIVA 4JYPA 4X9XA 4TKZA 4LF7B 2IPXA 1Y81A 1JEQB 3V7YA 3Q15C 3KLPX 4L3VA 1OLXA 3AUSA 5GOZA 3R9IA 2H11A 2X1MA 3DF9A 3GJYA 4F04A 3SEAA 1E6UA 1LLDA 1QFSA 5J1SB 3W5CA 2JLZA 4BFXA 1E66A 5JJBA 1C8LA 3ZZ1A 5H4GA 2W90A 5GWXA 3H9JA 5FF9A 3C3XA 4EG3A 2WIJA 1ZIOA 2GTHA 2G9RA 4GBGA 3A04A 2GF9A 1KO5A 1KBOA 3IR5A 5EIEA 1SIBE 2FZWA 1W96A 3N76A 3QWHA 1HF3A 4YA6A 1CEEA 4E33A 4DLRA 3BE5A 4XGQA 1JDVA 4V0NA 4M7RA 4B7ZA 3DDZX 5FV4A 3KBOA 1D2HA 1TU3A 3HKCB 3JR3A 4N9QA 4DLNA 5L40A 1M73E 4HGOA 5EC8A 4MQEA 2V7VA 1W88A 2PD4A 5HRAA 5SYMA 2OCAA 3D8SA 4HRYA 4MYUA 5F77A 5ILGA 2LDBA 2XF2A 3VO9A 1ZU5A 4Q9NA 3T3NA 2I3GA 3FTCA 3F5QA 3OPMA 2ZRKA 4PPQA 4CI0B 2FEKA 5ALWA 3GXOA 1SIOA 5SY6A 3DQPA 1VMIA 1WPQA 3O2NA 1MGPA 1YFLA 4LSZA 5IN5A 2AKYA 2DCUA 4QQNA 1T29A 3MTGA 1OVGA 3HWSA 1PNRA 5IC6A 4ZO7A 6PFKA 4YC7A 3QOWA 1K7XB 4FYIA 3FPLA 1MOZA 2AUTA 1ZIYA 4KOEC 2B3TA 4WKPA 5H68A 2R79A 1JTFA 2B2XA 1EH5A 1YBHA 1UOOA 3HWWA 3WL7A 1LLUA 2O3TA 221PA 4JD5A 4KR2A 5M7EA 1UPTA 2Y0CA 1TI7A 3K1YA 4OAOA 3PNVA 1NOIA 4XB1A 1FP4A 5AVUA 1N2HA 4JJFA 4P84A 4FLMA 1VECA 5ADHA 5I6DA 5HK8A 4HP8A 1ISSA 3WA7A 5AOBA 1VKJA 3GG9A 2X3YA 1SM4A 2WT4A 3PR2B 4MLZA 4RFSA 1QX4A 2QQEA 1YZFA 4Q15A 4RZXA 4Y9UA 3TL6A 2WJJA 4ZYTA 1GUAA 2CNKA 2V03A 3QIVA 5TQ0B 2APJA 4LVNA 5BWCA 2Z30A 4LUCA 4M9SA 2D1RA 2W2OA 4ZO6A 2VHQA 5JPCA 1DEOA 1GTG1 2PH5A 5AMXA 3KALA 1G7RA 4Y6RA 1KS9A 2O0MA 2VTBA 4DUGD 2E4VA 4P92A 3KZNA 3TLAA 3UJNA 4JA0A 4ZQBA 1R66A 2BFEA 4YMUA 1UPXA 5D3QA 4R8KA 1HL3A 2J41A 4I66A 4FWBA 3CLTD 1GY8A 3W79A 4CLHA 1JALA 1N0HA 1SG6A 1X1AA 1ZOSA 4OKSA 1PJSA 4RKFA 3HFSA 4E5UA 4QIHA 3WLPA 1JEEA 1JLKA 4AJHA 1VL0A 3WWDA 5F5NA 5DYTA 1X42A 4WZZA 4X44A 4AL4A 1OA1A 3FCEA 5EXDA 4LHZA 4M4SA 1EDZA 5KTYA 1Y80A 2JIPA 3JWPA 4RKWA 4P5DA 4Y2SA 1P7CA 2CLDX 4YY3B 1OKKA 4PU0A 3ANYB 2A9FA 1I4DD 4D45A 2OORC 4YQFA 5JNVA 3MOSA 2VYVA 4OU5A 4PTYA 3AB3A 1P3Y1 3KIPA 5EXXA 4DBVO 4NXNB 1VM6A 1JHVA 1QIDA 2LNDA 3Q1KA 4HATA 3UAGA 1AK9A 3MCVA 4UBIA 4ZTZB 4B17A 1DZIA 2Y2VA 3KVRA 1NAIA 4XD7A 3ETLA 3JQ9A 5AVKA 4ZFNA 1FP7A 1SXJD 2XBUA 2FWAA 1DIGA 1G59A 5CLIA 3VMFA 2GZDA 3DTVA 2GAJA 4Q3BA 4CKYA 3MCWA 4ZICA 4L4XA 4KR9A 3W8NA 4JUBA 5ARDA 4BX8A 5EL0A 1QVAA 4C6RA 2H4JA 1GGVA 5L3QA 4RA6B 1KI6B 2BFMA 3C7DB 5CT9A 1T36A 4HNAA 1LA2A 4C5BA 3HP1A 1V1RB 1DINA 1Q0PA 3IP3A 3ID6C 5CT8A 3H1GA 4XWWA 4HNRA 2BI8A 4MYHA 1G3RA 3FA2A 4TKUB 2ZCJA 2P3QA 3AR6A 3E9YA 2QN1A 3WGYA 1YCGA 2ADFA 3I9KA 3S2SA 1NMEA 4NAHA 2A9RA 3WLLA 2C9CA 2HOQA 2QRUA 1ESCA 4BECA 3SC2B 1A77A 4ANFA 5IZ4A 2JB9A 1JQ3A 1LDNA 2C92A 4RKEA 2WJAA 5ENDA 2UVDA 5LPNA 4DT1B 2O2EA 2IYFA 2TYSB 3LWBA 4YECA 5B7GA 1ONSA 4LZZA 1N0UA 4MQ6A 1TB4A 5LB4A 2ZSHA 1FX1A 2OLKA 3NQ41 3QUCA 3GLHB 3ZX5A 4BV9A 3EN0A 4JR1A 3UWDA 4RZIA 4GKJB 2O8EA 5FWNA 5C0OE 1NR7A 3BWCA 3GRVA 1MIOB 3D5QA 4G5HA 5CVCA 2X9VA 2OC9A 2HV8A 3DOFA 1E96A 1NJ2A 1I0LA 4JJZA 2OEPA 4PNZA 4Q03A 3SR4A 5K0TA 2VQEB 1NMQA 1W8IA 4C14A 5JATA 5K0CA 1K5HA 2NU8A 1M6NA 2EKLA 5DEIA 3WP0A 4BN4A 4CEIB 3FUUA 1ZUNA 2C9DA 3OP4A 1KR2A 1T5SA 3R3HA 4TWAA 1IHUA 2R6JA 4KQ9A 2Z09A 4D3FA 4QGSA 4LG1A 5HQJA 5A5DA 2TS1A 1EUDB 2AWOA 1E7MA 4NBRA 3QUSA 2H3HA 4PVDA 1XC7A 5IN4A 4PWZA 1O0SA 3HBAA 1XQ6A 4RSHA 4UEJA 4BMNA 2G0TA 1CJSA 4DCSA 4ZJYA 4S1TA 2Q4BA 1E58A 5AI9A 4YPVA 4PYQA 3R9XA 4HTFA 2I4LA 3GJ8A 4TXLA 4BX3A 3EGDB 4AKGA 4ME6A 1JLSA 1TQ2A 4YS6A 4JHXA 4BO0A 1UKVY 4MDEA 1E4OA 3LBYA 4WBNA 5I3CA 1OASA 4V0OA 4D3SA 3FNIA 2AK2A 2AEEA 2VCEA 3ANLA 4JT2A 3E61A 3RI3A 2BFNA 3TZCA 3W8FA 4MRVA 1OVMA 1YQ9A 1BKYA 3I73A 4FHZA 3UAXA 3RCBA 3TTUA 1ZQ9A 3VR4A 2VUTA 4BP3A 5GVSA 3QW2A 1QHSA 2GTPA 2R8RA 1CUGA 2RHHA 1FF9A 4CV2A 2IIPA 3L6DA 1PS8A 3PJEA 1KMHA 3OCCA 4JLMA 1LF5A 2PX5A 4WLEA 5IEJA 3M82A 3IP8A 5HOEA 1B8OA 1NV8A 3BFXA 2M98A 4R1UA 4EEKA 1AO0A 3OZVA 3O4RA 1H2BA 2C97A 2WILA 3LA6A 2WP8J 2RHTA 3HHEA 4LAFA 3BD7A 3ESCA 3IVCA 2VG8A 3L1IA 4AD8A 1AQIA 3ND9A 3IDSA 4DF3A 5JZMA 2AQIA 3OESA 2G67A 4AAYA 4AO6A 1NBOA 1P61B 2Q5CA 4CM8B 1QQ7A 1S2GA 4HNHA 4UAVA 3A7EA 3AVOA 3SZMA 4GSYA 4F9FA 3SJBA 1E2JA 3R0QA 4RUKA 1Z4NA 4OHBA 4M9CA 1M6VA 2X7HA 3F6EX 4X8MA 5MF6A 1LK5A 1E9RA 1DBIA 2ARKA 3A6EA 3OLVA 1NC3A 3V1LA 3EGOA 1BYUA 1DCTA 2HW8A 3ESAA 2ZCVA 3KUKA 1PG0A 1RBMA 4JAVC 2Y0BA 1M2OB 3RUCA 5AVWA 4TS9A 2HSDA 2JLYA 1ZH6A 1CHNA 3H5WA 4KB5A 1EZZA 4WJKB 2IUUA 3DVSX 1C0LA 1A7AA 3JQPA 3NOOA 4IO0A 3PL1A 4X71A 4ZO8A 2UDPA 4UNQA 3JQBC 4W9NA 4YK7A 3KWLA 4HGQA 4YACA 3UVEA 1T5BA 3TMKA 2XKAA 3LVQE 1ADFA 3HACA 4LJAA 3IERA 3MAGA 1LVHA 2VBFA 3VNRA 4DANA 4K9RA 2OECA 3S27A 1WMFA 2NN3C 4X1OA 4J0KA 3LCCA 4HWOA 4AW9A 4AY6A 2DULA 2PSHA 4JNKA 5IM5A 4HZUA 4IDCA 1Q7BA 2FZVA 5IJZA 5TGZA 1XXLA 4DC9A 2WHPA 3ADOA 1AGPA 1U1FA 2J3QA 3GNQA 3OHPA 3O31A 3BXPA 1B74A 4BZPA 5C7YA 1UMCB 5JRDS 4O25A 2TSYB 2AQKA 3H0CA 1THZA 4MQMA 2OO5A 4FBMA 2FSUA 5JWOA 4YJ3F 3I9NA 3Q3CA 5DLDA 5BN5A 4GL2A 4ZCSA 5E7JA 1E2KA 2OHVA 2VN8A 5K6AC 2TMYA 2QVLA 2AXNA 2D2XA 5K3FB 3DEIA 5CTAA 3GH1A 5FPKA 3AR7A 4OFXA 2BSXA 3NM6B 2FPOA 5C3UA 2JLWA 4JZYA 3ISJA 4QXOA 3SHVA 3RSCA 4EABA 5AW5A 1DCKA 1CJKC 2O3QA 1D2NA 3GNSA 2QRZA 2IYXA 2B8TA 2GNAA 3IAXA 4ZGGA 4YJGA 1G5PA 3BA1A 3KQOA 3LLVA 1ESZA 3PC3A 3ZY5A 2DWPA 2OHIA 4FDTA 4Q7LA 4REMA 2AYXA 2EYQA 3HNOA 1IM2A 1OLOA 5K2OA 1YDGA 4DKXA 1I30A 4DA6A 4JJ6A 4XQEA 1YVRA 1V8DA 1Q2UA 3HWX1 5AJVB 2PXCA 2E6KA 1FY2A 4O5AA 2FRVA 3AM5A 3SC2A 2DUWA 3BM5A 1KARA 3USCS 1AGNA 3J80A 1AO3A 1RKBA 3L43A 4PGHA 4EPXA 2XADA 5JAIA 1HFJA 3I01M 4MEJA 1QHHA 1VYVA 2NUBA 2QW1A 4J0EA 4TTRA 4B2PA 2FKAA 4ZT6A 5CR9A 3T94A 3LUPA 2DR0A 4DQUA 1SC6A 4A3SA 1W5EA 1PLLA 3QQPA 4DSOA 3JD4A 4QWMA 1CY6A 4UVHA 4Y2RA 1R5OA 3N5CA 1G98A 1U3TA 1F8FA 2ZWAA 3GFTA 4L8YA 1OREA 2PGOA 4Q4DA 1NVMB 2HXSA 4WLVA 5LL6P 4B3MB 4B7UA 3ZUPA 1DKNA 2JGDA 3WQRA 4ARVA 4Q7QA 5A5GA 3K1JA 2C8JA 4TYQA 4KTVE 3L1KA 1R1DA 3G5LA 3H84A 1LI4A 1WCIA 3RSZA 1QGZA 2GETA 1XOIA 2B25A 2PGNA 3JQCA 3K1AA 3MJ4A 2WUWE 4IIXA 5GGYA 1OHHA 5BQ5A 4GF5A 3H9CA 1W5AA 2GCOA 4Y2PA 1Z0FA 4BXOB 3ZWCA 2HJSA 3THRA 2MYPA 4Z9AA 1CQZA 3HUFA 3L5KA 4IQ8A 4TYMA 4JI6B 2X22A 3QELB 3WKDA 4BWGA 4QUKA 1M1YA 1CZRA 2B2NA 3K5WA 3QYFA 2SKDA 1PSZA 3C5HA 4QPDA 2AF3C 3ZKAA 4DMFA 5BQXA 3FIUA 1ODCA 2FEMA 1VG9B 2IL1A 2YRFA 3IE0A 4MYRA 3RWMB 3TOXA 3P0HA 3ZKWB 1DE0A 2AOVA 1RTKA 2DG2A 3AUYA 3RS9A 3SIPA 2QUKA 4YRFA 4FMCB 3WNQA 2C4KA 3G1UA 3C6YA 2CHQA 4XRRA 3ASUA 1IWPB 4G4SP 1F8UA 1AHHA 1ODKA 1YZUA 2NYVA 5HS6A 3WZLA 5F2KA 2IUTA 1K7FB 1NXSA 2PL5A 2ROQA 3D6AA 1ZOIA 1R6XA 2PKCA 4JB8A 1MQ9A 5EWJB 3AESA 3LLMA 4A0QA 3A9SA 1VA5A 4PYMA 1N9KA 2HEIA 3WRXC 4ZVSA 5IXJA 2WB2A 3L3BA 5KVAA 5F3WB 5KSOA 4NDNE 2FVXA 2QUBA 1VHTA 3PRYA 4AJPA 1FXSA 4CLXA 3MMNA 5HJ5A 3UPUA 2FJ0A 2ACWA 1TJNA 4S1WA 1YQGA 3GT4A 3VJMA 4A8TA 2KPOA 3TB6A 1CIJA 4H7JA 3FFWA 1RPAA 5DFAA 4WUTA 5KJFA 2DPGA 3L82B 4BQEA 1GKKA 2NGRA 3T1NA 1JEYB 1KP3A 4ZREA 3C0KA 1XZLA 4OJQA 2X0FA 3T1HB 4FFDA 4S1NA 4HMOA 3Q3GE 4MWZA 3PQ7A 3ZWWA 4CXMA 3EF1A 2XGMA 4KIWA 5C1PA 3GLGE 1YZQA 3LBHA 5EHQA 2J6HA 1GZ4A 1X7GA 1T6NA 1ECPA 1L7QA 3FNHA 3H3XA 3C8HA 3MQ2A 3NBFA 2JGIA 4INJA 5FORA 2AVDA 1D3AA 1P0CA 5AK3A 5KQRA 5KWEA 4RULA 2GDJA 4Z4FA 1L5HB 1DVRA 4QJ3A 1C9MA 1NP7A 5JS1A 4B8YA 4BVGA 4G0WA 3V1MA 2X2EA 2BTEA 3GPCA 3K20A 4BPRA 3H6HA 2CYBA 1NVFA 1O8CA 2AN1A 2P1RA 1T1SA 2WZQA 3SXJA 5HSGA 1GVHA 1TM7E 4BCCA 1JUDA 2AZTA 1HR0B 3FOWA 2G5PA 3TR5A 1QZTA 5MN5A 1VDZA 1Z16A 5E95A 1M7BA 5DTJA 4ZT2A 3R9KA 4CTOA 5JC1A 2V4MA 4PZDA 2GF0A 4M88A 2XUAA 4DR3B 4BMCA 2YDXA 5FPHA 5JTTA 3UJAA 1JILA 1JDBB 5DDIP 2POCA 3ZQUA 1NBME 7ADHA 3V6MA 4ZZ1A 2ZRMA 3UHFA 4B85A 5DP1A 2WE8A 5HFAA 3RU9A 2F1HA 4OI0A 2VF7A 2A78A 2BEWA 2OB2A 1BXKA 5JU6A 4US2R 5FYQA 2WWXA 3OC6A 1FVHA 3LUDA 5AVYA 1KEEA 4J2TA 3RG8A 2O2CA 2ZYHA 2LDXA 2XQVA 2C61A 3C7CB 4Q3NA 5KYTA 1N5JA 1ATZA 1LBQA 1QTIA 2DWOA 3LQQA 2YOFA 3WIDA 4G9GA 1WKCA 1W5FA 2VNKA 2OM2A 3B7PA 3RTGA 4KAAA 4FIDA 4Q7JB 2MJLA 2BSAA 2HO4A 2IA5A 16PKA 1CZOA 1HT2E 3GO4A 3BSYA 1FMLA 1H94A 3E53A 4R1TA 3REOA 2Z5LA 3TLGB 2Y6VA 2ZBVA 2NVUB 4DLKA 3REFA 4O2BA 1V3QE 3ENZA 1OXBB 3X1WA 4EDFA 4MJXA 4E3WA 3NIFB 2W2PA 4CUZA 1J7JA 3MRSA 1BTOA 2YV5A 4RPLA 4LBWA 1I5OA 2C5HA 2WT9A 1VE5A 2I7VA 3NBXX 2IU6A 1OGJA 1ZI6A 3F9IA 1NZFA 4MKHA 1DUIA 4AICA 1M0TA 3D8RA 3NDIA 4Z4IA 1UJNA 2ENWA 3ILXA 1AQNA 4BNWA 3B13B 4TMVA 3FF1A 1MVOA 3PD0A 1GUZA 5IXYA 1TA0A 2AFRA 3F46A 1QBGA 1RYNA 1UC4B 4JC4A 4NE7A 4XPIA 3THOA 4JCCA 3VISA 3BH6A 3HXLA 3PQ8A 3W3ZB 4EHFA 5FWAA 3JATB 4PO9A 5D3ZA 1E0SA 4PLPA 121PA 3CBGA 3PF9A 4TZKA 1TM4E 5F7OA 3U3JA 4ARBA 3E9EA 3I12A 2AI1A 5AM4A 4HUTA 1SVMA 4FX2A 3WLTA 3V8BA 5BNZA 2MMCA 3PNLA 2O6HA 4QODA 4XDYA 2A0KA 2HI0A 2ACKA 3QP9A 1Z6AA 3IIIA 4XEUA 4M0CA 4BMYA 2ZUUA 4LFCB 4URZR 2DERA 1T2FA 2V8BA 3QIAA 3TAHA 1H4QA 4UDXX 3ELWA 5C7IO 3CEAA 5IKPA 2VAXA 4RJ2A 2D1FA 2WAMA 1SOAA 1ULUA 1OWLA 3L8DA 1DJLA 5A0FA 1DIOB 4UXHA 4ZA2A 3GBVA 2DTEA 5GV7A 4CDMA 1K7YA 5F2NA 3HSYA 3DB1A 3NDJA 1Z47A 1QPZA 2X58A 1TK3A 1ORWA 3CZ5A 3HDJA 1GPKA 2C77A 1XTSA 3RYCA 3UO8B 5GZ6A 5K3OA 5LLTA 4KH1A 4UCQA 1B93A 1RNLA 1U2GA 2JAOA 3SK0A 2OWEA 4AG5A 1BQ4A 3G17A 1M1YB 1ZHHA 2WYVA 2R96A 4J90A 4ZI5A 5HKAA 1XMJA 3A1FA 4E1BA 3ZHCA 2GT1A 2ATCA 4AWBA 2K5UA 3K6RA 4GU5A 4EH1A 2QD4A 1K5PA 2DPHA 1OB5A 2I7XA 1YD7A 3GCZA 3QLVA 1L5VA 2HXGA 4ZTBA 3LYAA 2IYPA 4R9NA 3ZHVA 2GXAA 2IGTA 1Z75A 5JAZA 1HTTA 4AFNA 3HDVA 2VHEA 3RK1A 2CZGA 4D0SA 2VSOA 3G23A 1GTVA 3ZK7A 1AB6A 3ZXYA 2J0VA 1NW5A 3M4JA 3BTUA 3C7TA 3F7TA 3PXAA 4PR3A 3R76A 4CL3A 4OV6B 1I14A 5BOSB 4GVXA 2WW8A 4HYTA 1BHSA 1FP6A 3PWSA 1YO6A 3OCVA 4RYDA 1YQUA 1DKRA 2OXTA 2C9ZA 5KVVA 4EARA 4O1HA 3PNQA 3A32A 4PQGA 821PA 4LV8B 4UNRA 1LB1B 4IMJB 3KR0A 2Q1TA 4PLYA 4QFBA 3CVJA 4WNCA 1F5SA 1XJ5A 5A5EA 2PUHA 2WEKA 3FYUC 3IEXA 5FO0A 4HQNA 1QZ3A 4LYHA 3TGLA 4PZ9A 2GEBA 1EHIA 1SIUA 1ULHA 3LVFO 5FBZA 4WN9A 4EDHA 1XPRA 3AR2A 1V7QA 3LHFA 2QT9A 5H8WA 5KKAA 1ZITA 3P2KA 2PIDA 1JTEA 4F21A 3OTWA 1UPCA 1QH9A 1EXMA 5FA5A 1T3TA 3PPXA 4BKRA 3BC1A 5HR5A 5L7YA 1G7SA 1EDDA 3RD5A 1SVOA 5KC8A 3PU6A 1H3EA 2XB2A 1QV7A 2IFTA 4IHJA 2A0XA 2DQ4A 5LC1A 4TMKA 1J8MF 2FMUA 3Q8WA 1AZTA 4HCJA 4HWGA 4N7RA 4RETA 3W6PA 5HYVA 5SYNA 3M1AA 2V0NA 4BMPB 2VYQA 1VHQA 4LSMA 5U9CA 2LVBA 4ITRC 2FW1A 3CF0A 3K6JA 4FSXA 3KLBA 4GLBA 4MI9A 1JKJA 2DSNA 4PM4A 5J4YA 1VG0B 2Q3HA 1TW2A 2Y9PB 4H1HA 2WTUA 1AGYA 1AXRA 4YB8A 1ZMTA 3C4QA 2A86A 4YAJA 2HHCA 5HZHA 2XPCA 3DE7X 3F3SA 1G38A 4WQMA 1FPMA 3IODA 3EZGA 3RVMA 1BMFA 3TZLA 3BRSA 3ZU6A 3EFOA 2IHBA 1R9NA 1KVSA 3DLCA 1KDPA 3DNPA 4DIBA 1PEKE 3EBPA 3VO1A 3W6OA 4S1OA 4G4GA 1NR5A 4RFLA 3G88A 4DMMA 5I4CA 4UHEA 5KDDA 2QLTA 2YZ7A 4M3NA 1X0VA 2XXJA 2BGMA 4WFIA 4JBNA 1KK1A 4RQBA 2DECA 3I9MA 1XALA 1GCGA 4YUAA 1T6XA 2CNWA 4QOSA 4IX1A 2FSPA 1W0KA 1V48A 1FXWA 3JV7A 3F4LA 5A05A 4C29A 3S1SA 3JQGB 2B0CA 3U37A 1X87A 1V9CA 2PMCA 3C3PA 3W5DA 1XFDA 2WNHA 1E60A 2WTEA 4UBNA 3M34A 5A4FS 5KOHB 1XCBA 1OZGA 1YE8A 3AH8A 2ZI9A 4MR8B 4YNBA 5FNZA 2GLUA 1KP2A 3FYDA 4OAPA 4QGFA 4B31A 4D44A 5FBHA 1GN9A 4U2FA 1G19A 5AW7A 1CULC 2UXBB 4F2GA 1C1YA 2XB8A 4LDZA 1G3UA 3G0BA 1T6BY 1EDBA 5KYGA 1I7NA 2NUAA 1UKBA 1EP2B 1XJWA 1F8YA 5AKHA 3Q8MA 3RQSA 1Q7CA 3Q4GA 4K8RB 2XQIA 5BSTA 5A9RA 4YMTA 1U9YA 3TAUA 4RPIA 4X41A 1AKVA 1W30A 1NF8A 2P5YA 3R8FA 3D4IA 1KI3A 1KORA 1ZBQA 4BIMA 2ZT8A 4ZZ3A 1E2QA 4Q1VA 4YMGA 2ILVA 3ADCA 1XDUA 1LU9A 3FWYA 3CLVA 2ST1A 4YEDA 2BR5A 1HLGA 3GRRA 3ENWA 5AW9A 3VDXA 4Z2AA 3RJ9A 4F97A 1WXHA 3EZ2A 4EW6A 2O54A 3A25A 5JAUA 3PWTA 4TLAA 4J43A 5HXAA 1IIBA 2Q0HA 2Q2WA 3V33A 3P0FA 5EHZA 4TT3D 2O8NA 4AXXA 4OHVA 3K1TA 4JNCA 1DFHA 3URMA 1IBMB 3ND6A 2Q99A 3L93A 2PMBA 2XR1A 3JQAB 3L7LA 1L5KA 3W5VA 2C3UA 5CB4F 4BGDA 5TARA 4PNPA 1J8FA 4L5BA 2LCQA 3VJRA 2Q1WA 4DR7B 2PRKA 1UMDA 2Q9BA 5DB4A 2NXCA 3AVTA 3AETB 3I6ZA 2EDCA 4PLWA 3ZLUA 4OXRA 4C1BA 4ZYYA 3WWYA 2XT9A 4BNHA 2JBAA 2FN9A 4UDYX 2BEVA 1VCOA 1UM9A 2BFFB 2PJZA 4KUHA 5DT2A 4D0GA 1GM5A 3TIGA 1DJQA 2XE7A 4B84A 3KK0A 5CU7A 3WMEA 3O92A 4BJ3A 4CV3A 2ZDGA 1M2VA 2IUFA 2IDKA 1KPHA 2HCJB 2ZAYA 2V0GA 3SHQA 4HAXA 3CUTA 4ZXFA 1V25A 2EJWA 4BNXA 2FEPA 2G7ZA 3S29A 2IHVA 1O5IA 1XFAA 3BKWA 3ASYA 2A88A 4NXMB 1F06A 5FCDA 3NHFA 2BJWA 2NO1A 4X94A 2EJTA 2F48A 1FOEB 5G4LA 4LYAA 3KYDA 4ZU1X 3TBHA 5JCJA 1ISRA 3C3WA 3QXXA 1SC4A 3PPYA 5JD4A 1ECGA 2BMDA 2LKCA 1WSAA 2DFNA 1P9RA 2RJNA 2ZIZA 5AT1A 4I4CA 1UJCA 1HUQA 2FG6C 2VXOA 1QGOA 5GJVC 1XKLA 4WL0A 1NYTA 2HIAA 3DFIA 1T9GS 1R5JA 3WS7A 2VQFB 4IV8A 1RLOA 3FOEC 4HADA 2G9ZA 4AUKA 1RJ9A 1MO2A 2R7NA 2RHBA 3I0ZA 3VM6A 4HB0A 1E9FA 3KTFA 2UUOA 5LP6F 3V1NA 1XYGA 4LMPA 4CMHA 4PXYA 4EHBA 3KVVA 3MTQA 1DHRA 3P45A 4B2YA 3K72B 3QY9A 2FZCA 4H7IA 3E35A 3BB3A 4X64B 3KXIA 1A7UA 2EP5A 3F90A 1Y9DA 1M33A 5A2QA 1QM5A 3HO8A 2RJ3A 3RHTA 4FKMA 5TLSA 2NUTB 3I83A 5CX1B 1EDEA 1OAKA 1X7WB 1FRNA 5EKSA 5AVXA 1L5NA 1GFWA 3SQXA 3F3KA 1CPYA 4X66B 4MRAA 4MULA 3OM8A 3NJRA 3SIWA 4O4IB 4A10A 1R4MA 1ST2A 4FGZA 3OPYA 4FR2A 4QOHA 3EA5A 1LBSA 4Q3KA 3QY0A 2OFOA 1D4FA 1E32A 3R24A 1JBQA 1TE2A 2R8EA 1FPQA 1K97A 1XMVA 2A30A 3A70A 3BF8A 3H9BA 4XDZA 4XUDA 4CIVA 2IOFK 2A58A 1XEAA 4F5YA 3NIDB 2R8BA 4RGVA 3JR7A 4PYJA 4QGGA 4JEIA 4KCGA 4Y6QA 3GFRA 1U4NA 4R2LA 2PX2A 2G80A 2DU8A 1P4JA 4TMFA 5FTWA 2Q4DA 1RLJA 3VNAA 5JAPA 2DEUA 3H6KA 1UWKA 3AERA 4RK0A 1DX9A 2WFMA 4B75A 2ZLBA 1QGED 3LGSA 4EEXA 2R7MA 1J8QA 4EG4A 1Y8AA 2GM5A 3PGVA 1UPBA 5H7XA 5KJ1A 1ILEA 1L4FA 3VNBA 2F1KA 1WMSA 3PNBA 1IBKB 4TZTA 5SYAA 1PW5A 2FOLA 4KPUB 4XLTA 4M0FA 3KQHA 1G64A 2HA4A 3A9TA 1BRMA 3EEQA 3S7TA 2X23A 1KERA 2GGSA 3M1YA 4JLPA 2I62A 4WN3A 4EG6A 3L05A 3ZQ4A 5IX8A 1L4UA 2WJZB 3UF0A 1DRKA 2IOHA 4WE3A 2ABWA 2QRGA 4BX2A 4NHOA 1KU6A 3MPUA 4NU6A 2GRUA 1G3MA 4MVJE 1LCIA 2JHFA 1FDSA 2O59A 3QK7A 5CDUA 1N7HA 4HYEA 1K98A 2OOSA 3QX8A 1WBJB 2Z43A 5K0JA 4DIDA 3R1IA 2RGRA 4J6FA 3BEOA 4DLWA 3MWJA 3IULA 4RTKA 1KNXA 1IG3A 2YZNA 5KNCA 3GD7A 3GDGA 4IDEA 3KUUA 5J1TB 4EJFA 3JQGA 2JLRA 3U7HB 2O7QA 1FFCA 5F33A 1WUTA 1EFVB 1XDZA 2FOXA 1U0OC 1W9HA 2EF0A 4FXPA 4KQCA 2WF8A 3ZIAA 1IB6A 1F38A 1P0MA 1TCUA 4UPEA 3HJBA 3H0KA 3BRWD 1SJ9A 1RPZA 3ABOB 2VWGA 5BQ3A 3GEGA 1Z62A 2I2WA 2WAYA 3MUNA 4TRRA 3WO0A 1YBAA 1GT91 2PA0A 3WNCA 4EIWA 2NUAB 3MWEA 1TMGE 3F8WA 2PSSA 4GUAA 5EFOA 4CIXA 1XRRA 1Z0UA 5JW6A 1QZUA 4K6GA 3I37X 4BMDA 2YNMD 4Z4QA 2XZOA 4UW9A 5JSKA 1K0UA 3QXJA 4KH0A 1YB4A 1IVYA 1U8ZA 1S1CA 1O94C 2X0RA 5TE9A 4NOJA 4QDOA 4WGFA 2OCKA 3IBCA 1UBOS 4HVCA 3G1WA 3NGMA 3IAAA 2CLCX 1PKXA 1OKKD 1GNTA 1XJCA 2QRVB 5BT8A 3L7IA 4C7MA 4RH3A 1WQ3A 2L69A 4JU8A 3D4PA 3INGA 4NAVA 4B6OA 1UT8A 3DZHA 1RWBA 3GGDA 1MTOA 2J1LA 4NATA 3OQVA 2H7CA 2QD3A 4DLVA 4GOJA 1A88A 3QE4A 2CBGA 4B3IA 3VPHA 1KZGB 4M1MA 1L4GA 3R3YA 4W5NA 1YJBA 4Q4HB 4RMHA 4P5PA 3F4KA 2H48A 4P7GA 1R0YA 4DA0A 2VWQA 4KL8S 1NVVR 4MQLA 5I7AA 2AYZA 1ZK3A 2C8KA 3N53A 4C4YA 5ICEA 4M7OA 4XQ9A 1UZUA 4WXPA 4KRGA 1M2VB 1Y4DE 3I8OA 1E3IA 1LLCA 3CNEA 1SU4A 4A92A 4JHLA 3KAKA 3VHLB 1TA4A 2A3NA 4CYMA 2BMVA 4XI9A 3B89A 4G37A 4QDXA 5DGIA 1YNSA 2REOA 2XYPA 3BQMB 4AYXA 4BNTA 3WJAA 1HDZA 5KNBH 4EJ2A 5ARCA 1KJ8A 3WGIA 1IUOA 4R6WA 3P4XA 3DW3X 2RG7A 2IWHA 1GTJ1 3FZQA 3R7LA 3UJ6A 5HK9A 3F74A 4K28A 1KWKA 3W7AA 4J0GA 1VRCA 2LIPA 3THSA 2J3JA 4EG7A 3CSSA 1JWBB 4OI1A 5L51A 2IZ7A 4G0ZA 1DV2A 2QTMA 4F4UA 4OFWA 4MEBA 2MINB 1KI9A 2N75A 1HYQA 1Y9EA 4CZ2A 4DWJA 3I23A 4EB3A 3EPJA 3N2KA 1ZRSA 3C6KA 1JAYA 4QM6A 3KQSA 2FJPA 1AOXA 2PU7A 3HVUA 1THTA 4M9XA 4PSUA 4ZVPA 3LX8A 4K40A 5ES3A 4FSDA 3DAOA 4FMCF 3OEEA 5I4IA 3D7LA 1WJGA 2ZB2A 4YDHB 1SZCA 5E6SA 1D1QA 3VXKA 3BD9A 4XYGA 4NOLA 2X8JA 2DRIA 3DMRA 5FLYA 5LMZA 5JSZB 3A4YA 1AF4A 4XIYA 4QYTA 2G4VA 1U5AA 3EZFA 3PVZA 4IIFA 1B6SA 4ZHQB 5GJCA 1T8WA 3GN1A 4N7JA 3RADC 4TLBA 4BVAA 2W2MA 5DBEX 4CETA 3KKOA 1C4XA 1U2GC 2B9VA 1BQEA 4IOLA 2F4VB 2JIRA 2ZJ8A 1ZK1A 5HEKA 3LGXA 4TWIA 4OB6A 3ZQ6A 1T35A 4QT0A 3IMEA 4AJ2A 1H1LB 4LF4B 1UZAA 3EEBA 2IGBA 4KO3S 3RRFA 3H87A 2ZVQX 4TM8A 3T4UA 3IOYA 4MSUA 3E9QA 3KXLA 1XVLA 1PD1A 2PPLA 3MD0A 3BT7A 2C5BA 5FR2A 3DDUA 1ZOLA 3DT8A 4BRSA 5IVHA 3SYMA 1ZMBA 3KQYA 1VHLA 3M6FA 1E20A 4AY2A 3ROPA 4FE4A 3EGIA 4ZQEA 3N39C 4E70A 3JRXA 2XGSA 2GXQA 2OILA 2VP6A 2ZS9A 3M0EA 2ZJ4A 3D2LA 1QCYA 1Z07A 4H6WA 5CM8B 2RIRA 2CEKA 2WSYB 3NKFA 3K0CC 1DJPA 1H8EA 3HJTA 1P1KA 1YACA 3P9PA 3GEBA 3NTLA 4NZOA 4HDNB 2DBRA 3ORRA 1LV7A 5D3MA 1T4MA 1Z37A 1TUGA 5JO9A 1PVOA 2QNRA 1X2BA 2G28A 4ROTA 1S1MA 5BNFA 3W2HA 1YAJA 2DHRA 4OAQA 1M0EA 3OSZA 5L6MB 1HT1E 2DR3A 4KK3A 2VP0A 3E7PA 4LDQA 5CNMA 3CVWA 4KNWA 4WZAB 5BO5A 1U2DC 4NYIQ 4PLCA 3QXGA 3AIIA 3GBPA 4ZT7A 1BAPA 1NQXA 4LJKA 1P73A 1K7EB 2XUIA 4AJOA 4C6TA 3S1LA 1B8NA 1P1HA 1M3SA 2DFKB 5AJZA 4DGQA 2MYTA 3T61A 2NO5A 4JKIA 4J7CA 1KEKA 4G8BA 1KC3A 4LGCA 1KRHA 1Q7TA 3DO8A 4JLAA 2Q5HA 1VSUA 3P32A 1S3SA 4FOSA 4NABA 1JG4A 4LJYA 4P34A 4QUHA 1V5EA 5JAQA 3CEPB 4BX9A 1RI4A 2QSZA 1L5ZA 1YQDA 2QLJA 4II3A 2D3TA 4WZAE 5B58T 3RT9A 1E2MA 3H2IA 2IHJA 4ENWA 3UMMA 1Z8DA 3EG9A 3CRNA 3FNQA 3GP3A 4RK6A 1CDDA 5AQEA 2BM0A 3HV2A 4R2JA 5L8VA 1MX1A 1FZTA 5EE1A 2W0SA 3A1WA 5G1PA 2XUQA 1NXXA 1F6DA 1NUSA 1U2PA 2X0IA 2XMZA 3CUWA 3Q3EA 4X7MA 3A58B 3LAWA 5H3CA 2FXVA 2FDXA 2Z2XA 4QJ5A 1OLUB 2O1XA 3M5DA 3GLIB 2B1RA 1NHGA 4KVAA 3Q7EA 1GAJA 3T99A 1USIA 1RXUA 3CWCA 4ZMRA 1LPPA 3ET5A 1Y8RB 1BVUA 3ZE2B 1Y33E 1A76A 3K70B 1XAGA 4FC6A 1BDBA 4MQFB 5DIZA 2IELA 5TNXA 4RVOA 4JWTA 2QM3A 4AN4A 1J4AA 1HDIA 5FXMA 4RMJA 3STUA 3M6AA 4A0RA 5BSHA 3MIZA 1QRUA 3DCYA 4CKXA 2B4TO 4FKZA 1UQUA 5CGZA 2ONCA 1GYQA 3KSAC 1Z33A 3TINA 4TUYA 1R6AA 3OKAA 1UBKS 3DR5A 3ZBTA 4X6LA 3E9MA 1D6SA 2JI8A 1C1HA 1DAEA 3T52A 2XCLA 2EJVA 3NB0A 4K0KB 5CJJA 1UPAA 3QSYA 1YJQA 1DC6A 4OD0A 3TXAA 1FL9A 1ISMA 3D4BA 5HIKA 4NH4A 1FFBA 3PFBA 4M60A 3IKTA 4DUYB 2AX4A 3L7MA 5L3VA 2UZ0A 1RLMA 2AFIE 1EJBA 1YHNA 1J2YA 3AR9A 4IIJB 3FCYA 3DO5A 1MC5A 4HBGA 3X3HA 4IQ0A 4KXLA 4B76A 2LXNA 5DCYA 1APBA 2D5IA 3EH2A 3FYUA 1QXSA 3URKA 3AEYA 1JDTA 2GD0A 5J2UB 3ZCUA 2FW6A 2YNMA 3IUSA 4L73A 4TXMA 1G8KA 1OE0A 1ETHA 1SZJG 3NHUA 1CUDA 2PGAA 5D7BA 4P7KA 1UQTA 3ZZ0A 2IITA 4H0NA 4ZVVA 5BW8A 2AT1A 5GONA 1B3BA 3OAAA 3VTKA 4ZCQA 2V5VA 2QX8A 2CE7A 4MGEA 3UV7A 3DVRX 2PWPA 3DE3X 4CKEA 2B98A 4U7PB 4X1KB 3UAWA 2DCMA 1BSVA 3G02A 1EA5A 4K86A 3CVUA 3ZR4B 4RXMA 1DO0A 1U0GA 3DZJA 5ALEA 1BIFA 3H1AA 1SKUA 3K5PA 1L5OA 4MW9A 5KWIA 2B7CA 2R84A 2J9FB 2X4LA 4Z4HA 3G1TA 3KEGA 3WFJA 4MW1A 4N48A 1AX9A 1R6VA 4RD3A 4MGHA 5CBKA 4XDHA 5D8DA 2DHCA 1XN4A 3OPYI 4GM1A 1Q3KA 1L9KA 4LVUA 1J90A 2YS6A 3I9V1 1Y1LA 3T7AA 4JYCA 2JD0A 4LYEA 1H2XA 3GGJA 4M9ZA 3TRFA 3U1BA 1WB9A 3DD1A 3U44A 4RAOA 5EUQB 3T9CA 3NVMB 2Z8YM 2MYNA 5IUKC 3RG2A 4CTJA 5BXQC 4W5OA 3ME5A 3BHIA 3Q88A 2V7QD 2I7CA 1JHYA 2ZJ0A 1P2UA 1OFGA 2P6OA 1K8XB 1EGVB 1IATA 1GRVA 1OWNA 1XZKA 3BDIA 3COPA 3HFRA 1BCSA 3PCRB 5FT9A 3M4XA 3W7VA 2C2WA 2VH5R 4ERXA 3DH0A 4OG2A 1E2HA 2JFOA 4JH0A 4OH1A 4CF3A 2EF1A 3A6PC 3L4EA 1FMCA 2F43B 3HI6A 3PUHA 4IKOA 5HKLA 3ZS9A 3KJEA 4CCAA 1RQXA 1X80B 1EUDA 2PH1A 2QPTA 3C7KA 3JSAA 2QT0A 4ND3A 2D59A 1Q1QA 3JVVA 3PRHA 4MIOA 4PS0A 4TT8A 5I7WA 5M04A 3ERCA 1T1GA 2ADMA 3C3EA 2QN6A 1L4HA 3LV8A 1I36A 2FFQA 4W8OA 1TK9A 4TTJA 1NP6A 1L5LA 3LRPA 5FIUA 3THYB 3LX5A 2ZBGA 3AF5A 3FHLA 3VC1A 4QUJA 1KYTA 3ZJ5A 2QN7A 2FGJA 4K46A 3OURA 4CKZA 4YDQA 5IJ9B 3AUFA 1P3DA 4BS9A 2IXGA 3C6BA 1CRLA 1GZSA 1QFMA 2BHNA 5C80A 1WE2A 2EX0A 3BXOA 3MPOA 1FRZA 3GPBA 2IKSA 2NO0A 3KZKA 3MQFA 5AXBA 4AY3A 5AVJA 1KOGA 1C1XB 5KSYA 4UULA 2IW3A 1G8YA 2RCYA 4YRJA 4ARIA 1G42A 2WJPA 3K4QA 1DZ3A 2ZFUA 3RBVA 3JZDA 1EBBA 4YIHA 2GN6A 1E3LA 3AF3A 1ST3A 3B1VA 4P3YA 5ITZB 1RPTA 1UANA 4LJ6A 1UC8A 1U65A 3AILA 3QUBA 2X0DA 1ZH0A 4RYLA 3V5NA 1XG5A 4WZAA 1F3OA 1KVUA 1OROA 3IOEA 5LZ8A 4BLQA 2BMEA 3DHEA 4MCHA 3A2NA 3M3PA 2ZI5A 1JIQA 4GZ6A 4HR7A 2D1SA 1EP3B 5EZYA 1DRVA 1SURA 1AXEA 1HDXA 3X1MA 1KZ6A 1JAHA 2O8CA 1TZCA 1U8AA 3M4NA 4KP7A 5HIIA 3U39A 3BGVA 4TV8B 1K2WA 2RHCA 1D6MA 3QMWA 1MQSA 4LY6A 3R7NA 1C2YA 1VGRA 2W42A 2UYHA 3G79A 1N78A 1QP4A 2ZRQA 4B4OA 5FUQA 1ADGA 4QARA 1QBKC 2UUPA 1KAHA 1WLYA 4HUJA 3EA4A 5FPTA 2GBLA 3R75A 1G1MA 1RM0A 4BNIA 3RROA 2N1MA 3FHJA 1KZ7B 2NTYC 1M1XB 1CSEE 1ZAYA 1XWWA 4MV9A 4MI3A 3R3JA 2OSVA 2DJIA 3AOEA 3WR5A 2C4UA 2VJCA 4CM9D 1IUNA 4HUQB 3ELDA 3NLLA 4P9NA 2UXDB 4R5MA 5F64A 3R7SA 2HDOA 1N5RA 3DCJA 3PXGA 2CWDA 5A7HA 1AH2A 1A4IA 2CXTA 4BBZA 4WACA 4Q12A 2PBLA 2OCIA 5JMPA 1MP0A 2GHTA 2BAGA 3D6MA 3K1ZA 3MQ4A 5LYJF 2RGDA 2F9FA 3SLRA 3T7SA 1KIAA 1G20A 1UXIA 2HXYA 1RZRD 1XTQA 1R7RA 4JT9A 5AQ1A 1Y3AA 4XCXA 2WHYA 1AURA 2ZYUX 4B2LA 1Y8QA 4WOPA 3V4RA 5EUCA 1Z7GA 2NO6A 4PLTA 5AH0A 3BORA 3N0XA 4QQ8A 1AUPA 4NYJR 4OK6A 4Q9LA 4RJJA 2ZXEA 3HBLA 4EFKA 1BWRA 1SCAA 2PSEA 3UY4A 1IYZA 1KAGA 2TECE 4RIEA 4TUYB 4KMRA 2ZOSA 4XCVA 2GYVA 2I6SA 5FQOA 1NQTA 3PD1A 1X1QA 4AKIA 5E3HA 4JGBA 1O1YA 3SC3A 4L9RA 4V03A 2CV0A 4OU4A 1FFHA 4R9RA 4EKDA 2QTVB 1HOXA 1KJ9A 1IJEA 4JFAA 1FW6A 3AVUA 1ECFA 4C04A 5FTNA 3RKUA 4YAGA 5DX8A 4MAMA 1ZI8A 3IAFA 4U7GA 5EESA 2YCLA 2X4DA 2NZJA 3IO5A 4C30A 4ZEVA 1MMFB 5D85A 5EWLA 3RVQA 2A9PA 5AJWA 3A9UA 4S0XA 1SQ5A 5A04A 4F1WA 2OCGA 5JMWA 1OUMA 3HRIA 2QRLA 1Y1SA 3FCCA 4DDKA 3P4YA 3T9BA 5KEIA 5TMBA 2P9EA 4LISA 3GWZA 3WLKX 1E3DA 3L0ZA 4GG1A 2WJYA 3PXEA 1NNLA 5CFOA 1O95D 5FPYA 5KYKA 2EHJA 3R5FA 1E3WA 5LQJA 3UPTA 5IF9A 3KQLA 4O4LF 1YBVA 5DTQA 1RWWA 2I71A 1OLSB 3C45A 3LKVA 2QXUA 2C3YA 3FFBA 3QSGA 4G41A 2Z4TA 1LPNA 4P4GA 4UVEA 4XVRA 4LJ8A 4KN5A 4CM9A 1YIOA 1JFFA 1R10A 3C3AA 2HF9A 2DLNA 4KWEA 1CE8A 4HAUA 4F72A 2WD7B 5BV8A 1YASA 4D5GA 2F8TA 3K05A 1MPTA 1VE3A 1XZIA 1OBFO 1SEVA 1H4VB 2O3SA 3DEZA 4UU8A 5CA0B 1HE2A 1LSOA 4CMEC 4F5ZA 4IX9A 4RF2A 3PZBA 4GECA 2FZ5A 4U3JB 1HKHA 3BDAA 5ELLA 2L18A 5A6SA 3WICA 5DW0A 1T24A 2FW9A 5BN1A 3KAJA 3EXEB 3VZPA 5C1DA 1O5OA 1H2YA 4UHCA 4LMBA 1C7JA 3QMPA 4OGKA 1VBMA 3WLSA 2BP7A 1RQRA 3F5FA 1HSOA 4EP1A 5ELXA 3ZCTA 1AV7A 1AGXA 1WEHA 1O57A 5GIPE 2IRWA 2QUHA 3Q8KA 4P35A 1UFKA 4BVLA 2CXSA 4ASUD 3CKLA 2H9YA 3AW8A 2Z4RA 5BQFA 1SAYA 2J6CA 1GFSA 2QAGA 2XRYA 3OF2A 4O2RA 5C4MA 2WU1A 4QXMA 1PGPA 3U09A 3BRWA 2PSJA 4N49A 5HF5A 4YWHA 5CFRA 2ORIA 2XDQA 2R6AA 1C7ZA 4JGGA 2HX1A 3OEED 4KDFA 2YWBA 3KPYA 5JCPA 3A10A 3DS8A 5CLGA 5IDWA 1L1FA 1CQJA 2XBLA 3QHAA 3L5OA 3QKRB 2F43A 1MV5A 3WK5A 5BNWA 1A27A 5HS4A 1A9OA 1XKQA 4JVMA 5CBPA 1D5CA 1DX4A 2QJRA 1E7RA 2JZOA 3GUHA 1VA4A 1TMYA 2IF2A 2WWWA 2X1VA 2C2BA 1JEQA 2HQSA 3BMOA 3ZWVA 1UDCA 4MVYA 4UEKA 5GINE 5F76A 4D9EA 5B4UA 1OLXB 1OSNA 3B7WA 4UUNA 4YJKA 2DSTA 2BFBA 2RD2A 1TUBB 2J0UB 3IKVA 4HNSA 4ZAYA 2CNOA 4B6SA 2I1WA 1QV6A 4Q4CA 2PS3A 4GKBA 4JR0A 2OE2A 4QJIA 1UZLA 1Z5UA 2ES4A 4L95C 4Q9JA 2ASVA 1XDDA 2EHDA 3HB4X 3LQ2A 3HS3A 4LX8A 1XAJA 3X1KA 3WBFA 1CJCA 3SJUA 1ZGHA 3AI1A 1XZBA 1HFKA 4FFSA 4PIMA 3DAFA 3GLUA 4EFMA 4AECA 4CDRA 4H7HA 3OQPA 1IY9A 4X3OA 1E0DA 4G1EB 4BWFB 3WDMA 5EZYF 1NVEA 2RAPA 3ICEA 1IRXA 2MYUA 4IILA 1OI4A 1W36C 3WSVA 2NUPA 2HRRA 3HKCA 4D6YA 4IXDA 3D3KA 5DM0A 1OH8A 3PQ6A 3I64A 4EOGA 1W76A 3A3KA 1UT6A 1R6TA 1Y7TA 2B69A 1W5SA 3LZ6A 3N28A 1DDIA 1Q0TA 2VJBA 2OXEA 2ZROA 3NHRA 5DPMA 5LXTF 1V71A 4ZOCA 5AKEA 2IIBA 4NBNA 5BURA 2IEGA 3ICQB 2QR5A 4J75A 1LV8A 2I80A 1N6LA 4WCFC 2P78A 1XELA 4RK1A 3WTBA 2X14A 1BOOA 3OE7D 1RHKA 2AFHE 3L7AA 1L1EA 1RXIA 4MKRA 4ECAA 3EDCA 1E8DA 1EFKA 4M6WB 4E51A 5IZCC 3D8UA 3H5TA 3OFND 4QAQA 1PFVA 2EFJA 2WTBA 5K01A 5F78A 3WGHA 4LDNA 4M1EA 4Q7KA 1P6QA 4KR3A 4V0MA 3S1AB 2H63A 2WJ6A 3DOCA 2J07A 3WYGA 3ZZNA 5BWBA 3QTTA 4UCXA 1M8GA 3OOWA 3G5UA 4L57A 1MZPA 5KREA 2R48A 2ZSAA 5HCIA 2RH5A 1B0UA 2R00C 4TQUS 2B35A 4DJTA 4DLPA 1H2FA 2BZ0A 2F3UA 3LECA 1T9AA 4A9AA 2W6JD 1S2IA 2CD9A 1UM8A 3KL2A 3FMPB 1LX6A 1BS1A 3L40A 1BXGB 2XDAA 1VJCA 1PNOA 2H5EA 3NAZA 3BICA 4I4LA 2FUG6 5G4KA 1CNFA 3E22A 3P19A 3P2IA 4GT1A 1XZNA 3RBXA 1J1ZA 4I36A 4MROA 4EK9A 2YX1A 4KW7A 2DBZA 4XUCA 5TR9A 4HVLA 1X13A 5KYYA 2LGJA 5LJIA 3ONDA 1OA0A 2P65A 2PEYA 5JS2A 1J97A 2O19A 4OLBA 2PNFA 4ZOLB 2FOIA 1BS9A 3FZNA 3GFFA 4AJIA 3THWB 3DE6X 3L0SA 4E0BA 3TRJA 3Q2OA 4XR9A 4HGZA 1O5TA 2DUUA 1ZXBA 3Q98A 2V5AA 4L15A 5DGXA 1E1RA 5DGCA 1ILWA 3CNOA 1G291 1N6RA 3GJTA 2REQA 3G2JA 5G3ZA 1IQPA 1ND6A 1A8UA 1TCBA 1TMOA 1T4CA 2C4MA 2F90A 2QTNA 3RKSA 4GP9A 4CQJA 3MJVA 2A0YA 2GCEA 4J1QA 3LY8A 2CT8A 5EE9A 2ZIEA 2W6ID 4DRXB 5AUPB 1B26A 2NVUA 3HK2A 1PSWA 2BONA 3KQUA 2I3ZA 3EFBA 5GIOE 3CRRA 4GPEA 3BWDD 1KZ9A 1B6GA 1NQOA 2H8GA 2H07A 4WESA 4NARA 4G1VA 3A3PA 1QLJA 3B1WA 2F67A 4I4NA 4IR7A 2ECQA 1E7SA 2XSZA 4LRYA 3A3OA 1QWOA 4YUWA 4MJ7A 3GQBA 1HDRA 1OFHA 2WV9A 3TOVA 1R8JA 2O3UA 5ALDA 4B3RB 5K4GA 4HAZA 5ILQA 2GKSA 3ZHXA 4RVFA 3EF0A 2JFFA 4F6RB 3ETEA 2CBXA 3EJ6A 1UEJA 3UN1A 4BQNA 3MT8A 5DI3B 1EPUA 4Q01A 4XPIB 3N3BC 4DLUA 3QBEA 3KL4A 5LM3A 4M8IA 2J33A 3E7XA 2BI4A 4ETNA 2XNCA 1DRUA 1Z0DA 3FDJA 4RVSA 2AX3A 4KNYA 1E3SA 3VU3A 2OXCA 2F00A 4N3AA 1CJBA 1C7QA 3LKZA 1MBZA 2GD6A 1A9YA 3CT4A 3KTOA 3GPLA 5EAIA 4QGBA 1Q12A 5LWQA 2EJUA 4F8YA 4YRNA 2RC5A 3V8VA 4OYRA 3VO8A 5JH7A 3VHXB 1Q7GA 4DT1A 2Y68A 1E5QA 4RV5A 1C4WA 3Q85A 3RUDA 5IH3A 5JBIA 2P91A 4G5GA 4RNCA 2K4MA 2WVJA 1TF5A 4FDUA 1SK8A 2CL7X 1CP2A 1ULSA 4M1TA 5AVRA 5KSWB 3TSCA 4C22A 3VC7A 1VZ2A 3AXTA 2QZPA 3PJGA 4KHZA 3KDPA 5SY9A 1MH1A 2JIDA 3P4UA 4QATA 5DXJA 1WAMA 3EEIA 1K9SA 3GA7A 4RHUA 4F7DA 2ZB4A 3VTFA 1VL6A 5CLLA 3HXKA 1HSZA 4UBKA 3RT7A 5JNTA 2Y77A 2GH1A 1GTRA 1RD4A 2Z9BA 1PJ3A 1ZYUA 2IYUA 5EZQA 3V2UA 5HM8A 1PTKA 5BR7A 2OBYA 5E7IA 4NMLA 3LW7A 3L7CA 1PW7A 2ORYA 2Y4NA 3UC5A 1G0NA 3G3EA 2O5VA 4AZ0B 4NX2A 2PE5A 3PX7A 1TVCA 4LF9B 1U3CA 5K8LA 2NU7A 2JVJA 4PCAA 4CF7A 1UEIA 1W1UA 1XCOA 1RMYA 3IOMA 3KB2A 4HOYA 4BUZA 3RBZA 2YNMC 3PUKA 3BFJA 1Y1TA 4N0EA 1KHHA 4CDGA 1VIVA 1BX3A 2CFSA 4WOJA 5DGDA 3ZNOA 2NTNA 1QRSA 1IBRA 3A3NA 4N9WA 4KO4S 3D4LA 1GUDA 4MVJP 3RIMA 3UMBA 3OX3A 4DA7A 3KJNA 2A35A 1VCHA 5BMVA 4GM4A 1ES9A 1ZH2A 2C2ZA 3ESZA 4V1CI 3UT5B 1TPZA 2C5EA 3LFUA 4PZCA 2IUSA 2JI6A 4J0JA 2XMPA 2J3HA 2V7WA 3I0MA 4KQHA 5E6RB 2FNAA 3RFTA 1HE8B 4POOA 2PUDA 1WMEA 1A7JA 5JSFA 3QVMA 3AFHA 3OY7A 5FTKA 1WRBA 1XLTA 2GRJA 2P5TB 4ID9A 5H81A 1V37A 2R66A 4Z0TA 3VHRA 2G8LA 3R5XA 4ZGBA 1NBWB 1II0A 2BM1A 4KN8A 3OLQA 4DLSA 4YAEA 2RBKA 2FG5A 1HTWA 1JI3A 1KDVA 1YA6A 1IM8A 3ONWA 4CQNA 4NZ9A 1N2BA 3IEMA 4C01A 3WJ2A 5DULA 3HCOA 5IWCA 5G0UA 3HB7A 3D3WB 2VTDA 3K6KA 4FEYA 3EISA 4CGZA 1P3JA 2DVMA 2Y66A 1HKUA 3A4NA 3D5TA 2PH3A 5K0GA 2D2IA 1C9DB 2AN5A 4PN3A 1V5IA 2CE2X 1VPVA 4WCFB 2RARA 5AWFC 2X0EA 3RRNA 3TW8A 4P58A 4AX8A 4B7CA 3WIUA 4EJSC 1P72A 3CT6A 4JVOA 4CM8A 4QVIA 1A95A 2Z04A 3OWHA 2GN0A 2SHKA 3VPCA 1WZ2A 2Q3EA 3WY9A 1QOQB 4PYNA 1A5ZA 1PJ2A 1M6VB 1REQA 1J22A 1SXHA 2VHYA 4W7SA 3RRBA 3UAOA 3RC1A 4O4JF 1FYFA 3N0TA 4MITA 3O9MA 2WIAA 4PAWA 3KSBC 2ZTSA 5EIOA 1I01A 1TW3A 1UADA 2HCRA 2ZRFA 4D4LA 1NHWA 2WZBA 4L2IB 2R1TA 2VK4A 3G2PA 2CDAA 4RDHA 4WSOA 3EXG1 5LIPA 4AYTA 1JE0A 2ETVA 4RTMA 1ZSVA 2VIIA 4BBAA 3A2MA 3ANMA 4WKNA 3ZHSA 5D86A 1U2TA 3E3OA 5L4SA 3DMHA 1SQ0A 4AXBA 5KUTA 3PQ4A 3L4JA 1DP4A 3ZDEA 4BO8A 4QA9A 2GA9A 1ZU4A 3TXXA 5DYYA 3O83A 3FJYA 1JA9A 2BKXA 4LRWA 4PHCA 5FPQA 3SR0A 3THWA 1P80A 2ZB8A 1JMKC 1I10A 1SEPA 1FJHA 3IPCA 4EUKA 3RUAA 2QZZA 2NIPA 1VKOA 2PT5A 3FDZA 3FAZA 2Q3MA 1JFLA 1DU4A 3NDPA 1EUCB 3W5SA 1NTRA 4LV6A 2HZBA 3K0SA 3NALA 4ZCPA 1HTBA 3KYIB 3EVTA 1GQSA 3K09C 4TT3A 2HMWA 2OFPA 5EWMA 3U31A 4BFWA 2C59A 3QG5A 4OQFA 1P44A 1UMCA 2ZIXB 3DUWA 3FDFA 4I8DA 5C1OA