3DVRX

Proteinase k by lb nanotemplate method after the first step of high x-ray dose on esrf id14-2 beamline
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvrX00
1Y34E 4MZDA 1TMGE 3DWEX 1GNVA 1GA1A 4NE7A 3DW3X 5CW1A 1T1EA 1MPTA 4NMXB 3TI9A 2SICE 4KPGA 1GNSA 4Z2AA 1WSDA 3DE3X 2TECE 1TECE 4NE9A 3WIVA 3P5BA 3EE6A 4OMDA 2Z30A 3DE6X 3DE2X 5JXHA 1GTJ1 2SNIE 3BGOS 1KE2A 2ID8A 3DE4X 2SECE 3DDZX 2W2NA 1IAVA 3DVQX 4DZTA 1YU6A 2Z58A 1ZVJA 1Y48E 2X8JB 1Y3FE 1SCDA 5FFNA 1P8JA 3AFGA 1P7WA 2G4VA 5ARBA 2WUVA 4YN3A 4H6XA 1KDZA 4M1ZA 1SIBE 2PWAA 1SCBA 2ZWPA 3DE1X 1TO1E 2HD4A 2X8JA 1CSEE 3I37X 3QFHA 3TECE 3I34X 1SBNE 2Z57A 1BFUA 1TM7E 1DUIA 3D9QX 1KDYA 1R0RE 1TM5E 5B1EA 1GTG1 3VSBA 2ST1A 3GT3A 3I30X 1SPBS 1GTL1 2W2MA 1SUAA 1C9JA 1PFGA 4C3UA 3DE7X 1NDUA 3SQOA 1Y3CE 1SCJA 1S02A 1C9NA 1SUBA 1WVMA 3PRKE 2Z2XA 4AKSA 1R64A 1VSBA 1Y9ZA 2XTJA 1NDQA 1IC6A 5SICE 1EA7A 2ID4A 4CFZA 1Q5PA 5JMOA 4LVOA 2SBTA 3DW1X 1TK2A 1AVTA 3DE5X 1BE8A 2DQKA 1S2NA 3DVRX 3A3NA 1BJRE 2IXTA 5AQEA 1NLUA 3LPDA 1BE6A 3T41A 5AMXA 4WOBA 1GCIA 4ZOQI 3I2YX 5K7SA 3CO0S 2HPZA 1TO2E 3F49S 3ZXYA 1SCAA 3DYBA 3SICE 1HT3A 3AJ8A 1AK9A 3A3PA 3VV2A 4CG0A 1AV7A 1P7VA 1SUCA 1Y1KE 1T1IA 1Y33E 4K8RB 1SBIA 2PQ2A 5B1DA 3L1KA 2WUWE 1T1GA 4FONA 4LVNA 1ST2A 4H6WA 1TM1E 5JXGA 5AVJA 5FAXA 1ZVKA 1C9MA 3Q40A 5AVKA 2PMWB 3H42B 3BX1A 5ARCA 1SN7A 1PEKE 1SBTA 1UBNA 1SCNE 2Z56A 1AQNA 1GA6A 4I0WB 1SUDA 3WQBA 1SH7A 1ST3A 1S01A 2DP4E 4WOCA 1Y4DE 3DVSX 2XRMA 3D43A 1XF1A 1OYOA 1V6CA 1TM4E 1YJAA 3CNQS 1BH6A 4CFYA 1WMDA 1DBIA 5ARDA 2P4EA 1MEEA 3A3OA 3Q5GA 4ZARA 1V5IA 2E1PA 1Y3BE 2PKCA 1SBCA 2ZRQA 1OT5A 4DJ5X 4RYDA 1GT91 3LXUX 2WV7A 3EDYA 3VHQA 4KB5A 3WHIA 1BFKA 3VV3A 2Z2ZA 3GT4A 1SUEA 1AF4A 2WWTA 4OMCA 3QTLA 4KG7A 3DE0X 1A2QA 5JXJA 1AU9A 1SIUA 1SIOA 3TI7A 2DUJA 1TM3E 2PYZA 3OSZA 2IY9A 3EIFA 1YJCA 3LPCA 4DWWA 1JEAA 4BWGA 1WMEA 3AJ9A 2ZWOA 1GA4A 1LW6E 1OYVA 2V8BA 4J94A 1SELA 1YJBA 3WIUA 3GCXA 2QTWB 2PWBA 1R6VA 1KE1A 3UNXA 1CNMA 3PTLA 4OV6B 3VYVA 4GI3A 3BPSA 2B6NA 2GKOA 1Y3DE 3F7OA 4HVLA 1C3LA 1KDVA 1PTKA 1SBHA 2W2PA 3ZXXA 1SVNA 1SUPA 5JXIA 3GCWA 3F7MA 1Y4AE 4C3VA 2Z2YA 2PRKA 1EGQA 1THMA 2W2OA 3QMPA 3VTAA 4AKTA 2W2QA 1AH2A 3HJRA 5FBZA 5I9SA 3LPAA 1PJ8A 4H6VA 4JP8A 1WMFA 4B5LA 4HX2A
chains in the Genus database with same CATH superfamily
2ZZMA 2HBYA 3I83A 3OT1A 4H7HA 5K6TA 4U7GA 4GNRA 2XZLA 4ZKDA 2XYGA 5JJIA 3AR8A 4JL8A 4IGFA 4KSBA 4WZZA 1TMGE 2PEYA 1EFLA 3IJPA 3E7WA 3A1SA 4ENPA 1JIUA 2HA3A 3LQQA 7YASA 3LKBA 2X4IA 3NB0A 5C1OA 3JV7A 3CPEA 3CLKA 2BKVA 2G06A 3JARB 3L7IA 3F71A 3K3PA 2X5NA 4WRRA 1B00A 1DRUA 3QY9A 2D74A 1NVXQ 2JEZA 3AHGA 4R1TA 4CMEC 4GT1A 3OEHA 3FSEA 5EZYF 3EF1A 3O0TA 1GKYA 2MYUA 2IPLA 4UCWA 1KC1A 2FDCA 4LRSB 2JIZA 2XUAA 2C96A 1K5PA 2X1HA 2BJVA 1Z33A 4TQGA 1V9LA 3BWXA 4INPA 1L7BA 1YS6A 4C4AA 4ALMA 5JC8A 4RDHA 4PHHA 2CD7A 1I3KA 2AI2A 1J24A 4OLAA 3G2HA 5BURA 2WU0A 4XQEA 2AFIE 1U7UA 3CPJB 1E9EA 3STYA 1RYBA 1QO0A 2I3AA 4LHXA 4NSNA 3ZVRA 1NUTA 2QX6A 4QLBA 1RSZA 1M6EX 1OGJA 1XT6A 5C52B 1JHAA 1ZO8A 2PX8A 3DFMA 1TIPA 3JYLA 1K7SN 4S1NA 3AL3A 4RLSA 4YONB 3VNSA 3EISA 5HA5A 3G2OA 1B6RA 4KACA 4FFSA 4KBFA 2V5VA 3N3BC 2X0KA 2ZXEA 3FWNA 3GRKA 3SMQA 1DUVG 3RHTA 2B25A 4UOZA 1FFXA 4MAFA 4Q9KA 3B1YA 3DDZX 2CFRA 4DAOA 5HS6A 3SQXA 3UK0A 3E84A 5IM5A 5MDHA 3OZGA 2DBVO 5CCBA 3I9KA 4DKXA 5KDDA 5LP6A 2C97A 2XMPA 1FSSA 5FBRB 5T6BA 5TJHA 4DS3A 2JATA 3M83A 4EITA 4UTVA 2QVGA 4A2PA 4HPXB 2IHYA 4RK4A 1XJQA 3IQIX 5TVKA 2JG3A 1NYQA 4PCVA 2CN1A 2D4HA 2UVPB 2B99A 5JO9A 3V97A 4BP8A 4EFDA 3BIXA 1N5RA 5J2TA 5TB5A 1CERA 2YN0A 3I92A 1FFYA 1PK8A 4CG1A 4MEBA 3CT6A 4RPCA 5CDHA 4V39A 1JEYB 4MV9A 1H6CA 4EENA 1U8YA 2YW9A 4PRLA 1X7ZA 2VR1A 1FYXA 4IX1A 4P4GA 3NLLA 2UZ4A 1QE0A 3WZLA 1LQ2A 4RE6A 3U0VA 1SVKA 5G0TA 1Q1GA 4LRTB 4YP9A 4BGIA 1OTYA 2UYQA 3D2AA 1WPGA 3TSZA 4D4GA 2HNBA 4GZ5A 4KLAA 1XJCA 2FETA 2Z6QA 5IDXA 3ESQA 3Q6NA 5FPSA 4LSMA 1Z9BA 4RMGA 5GZ3A 5EUBA 4COOA 4JITA 3TNDA 1D2CA 4YJGA 3LHDA 2A1UB 4NRDA 2VJPA 4JJGA 2OGWA 3HJAA 4IUDS 4DKJA 3EIQA 1MB0A 3P2YA 4ITUA 4RKEA 1JLLB 1MQSA 5SYMA 1NVAA 4XH9B 1FJ2A 1OLUB 3EWNA 4BVBA 1TUIA 1DCTA 1SHZA 4PINA 2BM9A 3JQ8A 1MO6A 4ZU3A 3ETEA 4R71A 4HB2A 3TLZA 1HE8B 3I37X 3QFHA 3WWPA 3AF6A 3ZDAA 4IINA 1I8TA 5F3RA 4CKCB 4B4WA 3GH1A 4DEXA 4NU5A 2PQMA 2KQUA 5A4AA 3MJDA 3WMEA 2FN9A 3GDHA 4M0EA 1GSAA 4Y0AA 3D3WB 2UVDA 4BEWA 3MUOA 4MPDA 3NEAA 2D7JA 4WFKA 1R8JA 1WHTB 3Q8MA 2YHUA 1IRIA 3BSFA 2WUFA 5HUJA 1E66A 5TJ9A 3NM5A 5EWJB 2CSUA 1U2QA 1OSNA 2XODA 3FDJA 4G0ZA 4NJMA 1YKGA 3HDHA 4OYYA 3UATA 5KNDD 1QVRA 4FGJA 2VYND 5I7HA 3OTQA 2WAAA 1P72A 1CQIA 2JFBA 1H5NA 1N2CA 2CXUA 1GTG1 3VSBA 2NPFA 2ST1A 1M34B 3I2KA 3BMQB 2A1IA 2OO7A 2WOJA 1HC7A 3Q0IA 3VXKA 4O2BF 1JSRA 1SZDA 3EYWA 3K72B 3LKVA 3SIPA 5HRCA 4OBXA 5C3MA 1EWQA 4UM9D 3S7TA 4ENQA 1ZUHA 4JI0B 3T3NA 1QBGA 2GF9A 4Y9RA 1XZ8A 2OAGA 3R44A 1HWYA 1Y7TA 4FX5A 4D46A 2HMVA 1T6YA 3IVGA 3RC2A 4E3ZA 4MJXA 3X2SA 2JD2A 3I8SA 4QUEA 3D59A 3AETB 5JWOA 1MX9A 2B4KA 3VAAA 1HK7A 1FQOA 4C7MA 2EWVA 2X22A 4LOAA 4YQZA 3M0EA 1UDCA 3D4IA 2PM8A 3QNUA 3WWEA 3IQZA 3ACBA 1UDBA 5KWSA 4JKOA 1OCEA 2GD2A 1J9ZA 1MO2A 3AVXA 1J49A 2P2ZA 1US8A 1PJTA 4LY9A 4BJ3A 5BR7A 3ZBPA 3HP4A 4G8BA 2JFFA 1XROA 4M0LA 5AWFC 1CUBA 1NQWA 4ITRC 5I8WA 2JJ2D 1CUHA 3SKVA 2ZBUA 1M2WA 3N8IA 3HYCA 3VAYA 4YCSA 1KAMA 2WSSD 3PFWO 4HFNA 2VIIA 1ZVVA 4OHUA 2F55A 2V1UA 3ANTA 3WK6A 4TUYB 4IF4A 4RD1A 2YZNA 4AG6A 3ZE1B 2X5OA 3E9EA 1LD3A 4EUSA 2OHVA 2C2ZA 2ZJ8A 2C4TA 4Z0TA 3VDMA 4U02A 1U2RA 1ZK2A 5DPMA 2OO5C 1L5FA 1D0SA 1YFJA 4Z4HA 1IPFA 2XVXA 3I2YX 2QN9A 1L4BA 4UMEA 5TQJA 3ABZA 5KCZA 2E37A 1NN5A 2NXCA 3DWGA 3GJSA 4KUGA 2NTNA 2ZSDA 1GN8A 2AYZA 4H7PA 4JP1A 4M7PA 1MEJA 3O8OA 4KFUA 4YEDA 4ERXA 1QHFA 4G0NA 3PVZA 3HXOA 2FX2A 1S7GA 3L93A 4IWYA 4OQZA 1YXMA 3ORSA 5T7BA 1QH1A 4CIXA 2P90A 3KSMA 3HPQA 3NHBA 3NTOA 4FW8A 3CUYA 4LY3A 4PW0A 3TD9A 4D6PA 2Z6UA 1U3CA 5E7QA 1SOUA 1DSSG 1RJDA 4Z7NB 5KU1A 1NXPA 2F48A 3RWOA 5G1OA 2VAWA 3A58B 2QJOA 2XQGA 3S99A 1U98A 4RVFA 3DF7A 3LUFA 3NRBA 3QQ5A 1XDUA 3WA6A 3VR4A 1JE1A 4IDCA 1XD2A 4MYDA 3TL3A 2P30A 3M6UA 1GTRA 4NICA 4BN5A 1GG5A 1TAGA 3OFJA 5BUCA 3VJRA 3GEEA 3M8KA 4OXRA 1Q1ZA 1P81A 1U80A 2JH3A 2R7AA 2OC4A 4CT0A 4WUTA 3PJFA 1DQYA 1WZIA 4LRXA 3K6KA 2XNDA 4TMXA 3TIGA 3HL4A 3G1WA 3B6KA 2Z5GA 1AE1A 2Q50A 2QAIA 4IM7A 2VSXA 1WQ1R 1N36B 4O5OA 1N6HA 1NONA 5IANA 2F3TA 4A8PA 5DM60 1WEHA 1Z12A 3WAJA 2WUGA 1U9JA 3LGAA 4GKBA 3VR3D 1GAJA 3O75A 3VR5D 3U5ZB 5K51A 4ALKA 1BQ3A 1C2TA 3KK0A 2FP4A 2KB0A 2P2DA 1OGIA 1XTRA 4JYBA 4HL6A 4UVHA 3EQ2A 4UDXX 3VI3B 1V1RA 3DAYA 4O0LA 3SIWA 2CF6A 4YT8A 3F6RA 3HGQA 1JV2B 1SBTA 2H1IA 3R6WA 1GDDA 1E2IA 2OAEA 4GZ6A 1Y8QB 1C4WA 3LUKA 4ZCLA 2C2HA 4HBZA 4CMBA 1M7BA 4QQKA 1GPBA 3G7SA 4KAAA 3E23A 2Q3DA 2ADOA 3BHNA 2ZPAA 3TB6A 2E4VA 5HSGA 4P32A 4EHNA 1AZSC 1BYUA 2CK3A 3E53A 4XOIA 1SXJC 1FYFA 4D4LA 3C97A 3VJKA 1M2KA 2VJQA 4M0KA 5C34B 4CM1A 2Q2QA 5JHHB 1SWVA 4HH1A 2A57A 4KI7A 1WUHS 3H4MA 3ORQA 3C3EA 4OG2A 1RKQA 2OHOA 3BL5A 3I6YA 2WTNA 3KAQA 5SZKB 1C7JA 1KKMA 2C0PA 1E1RA 2XB6A 4US1R 3LUPA 1GPJA 1YJAA 2R6R1 3GARA 3GEHA 4QNMA 3SHTA 2CKMA 2VATA 4QBHA 3UOGA 1G21E 1M76A 2FFRA 1F4LA 5L6LB 3CKKA 3GDWA 1GPAA 4OEHA 2YWHA 4P08A 4M8NE 2PH1A 4MHSA 1MC1A 2CKDA 3HMQA 3DOCA 2BTQA 1QHIA 4NLLA 1ISMA 1DAHA 1JAYA 3LVRE 5FLXA 2FRVA 3OZWA 1VDZA 4F4DA 3HKDB 2AVNA 1TFRA 3DWFA 4PM4A 1C7IA 1DEAA 1GAQA 3G1UA 2DTXA 1W36C 3DDCA 1ONSA 2H7XA 2Q45A 4L07A 1EFDN 3WWOA 1PR0A 2F1KA 3G2PA 3JQCA 3NIBA 4V1CI 5IDQA 2OPBA 2GAOA 4QQNA 3CH6A 1PWHA 1IN5A 3DKVA 3LO8A 2EJUA 3W6ZA 3KQUA 1VGQA 3N0RA 4QDXA 4W5WA 1U6JA 4PSVA 2H48A 3EIHA 4MVYA 3SYMA 3TOVA 3SX2A 3TPCA 3DEIA 4AF7A 1J09A 4F4FA 2YQZA 4KHZA 2CXXA 3OOHA 4QELA 1UFRA 4Q1EA 3RVJA 2GCEA 3A11A 4GOMD 2ZR7A 1GZSA 3O83A 4DC9A 3EVFA 1DKOA 2OBFA 1PR5A 3ZE0B 1ECLA 1G8HA 2P79A 4OMCA 5LLDA 3AETA 3BFJA 5F7JA 1A2QA 2QZJA 3RVMA 1H23A 2W2TA 3OZSA 3QUCA 5CLGA 4V0SA 4LJ8A 5H02A 4RS4A 4JYZA 1U4NA 1TUGA 1Z34A 3SZLA 5JOQA 1R6BX 3VH2A 3WA7A 2GPBA 1DKNA 2RHTA 3EWAA 3FCOA 4RHEA 4F4HA 4XWKA 2PUFA 3VR2A 2ECQA 1IK6A 4OYRA 4UMDA 5BQXA 4NYJR 4GOLD 3PSHA 4TXHA 2WK1A 4LJ4A 4C05A 3TRJA 3P2KA 3UJBA 3VU1A 2V9ZA 1EJBA 2JCBA 1GFZA 5EA2A 2ZJBA 2DB3A 4PTYA 5EJEA 3FZYA 2HSEA 1BX3A 4DSOA 4GP6A 5E4TA 1HE5A 3UMVA 1OWOA 1HEUA 3ZWNA 4BAUA 3KB1A 4PGHA 3WFZA 4Z4QA 1J8FA 4MDHA 3KVRA 1FFCA 1LW6E 1QGDA 2Q5EA 3OTHA 5BT9A 5B58T 3GLIE 1A2BA 1CG6A 1JPUA 4IGAA 4DJJA 4KPYA 3T9BA 2L82A 5IUJC 1K4YA 2YICA 1EVJA 2G6BA 2XNCA 3EXEB 3KLMX 1E3EA 4DR7B 1CUIA 3AF0A 2PXXA 5CJ2A 4ISBA 1YT5A 3KT6A 3W6UA 3WTCA 4BFUA 1FJHA 1VCMA 2XGOA 3RSGA 5I4BA 2FQQA 3T3PB 2KBFA 1JT2A 2IOFA 3DNFA 4JU9A 3VVLA 1HEIA 5FUBA 5IC6A 4OV6B 3ZHCA 3KAKA 4HNTA 2BKXA 3EXHA 2RGWA 1C1YA 1NNLA 3FSRA 4RHCA 3GLKA 4QWMA 4IX9A 1VJCA 2JCGA 1DAGA 3K96A 4FOOA 5C8DA 4B3RB 2I2FA 3DCJA 3EGXA 2ZSUA 1I5OA 2NU8B 2XQFA 5E0OA 3CZMA 3TFOA 2PS0A 4ZVRA 2D1QA 4M37A 1FRNA 1AN0A 1NTRA 1VBMA 5AW5A 2I1QA 6NULA 1XZMA 3NBUA 1GSIA 1XLTC 3AY7A 4ZDJA 1P5ZB 3DWIA 1T6XA 4LJKA 4CM6A 1N33B 2G9QA 2Z09A 3GCDA 3NEPX 4LF7B 1ZXLA 4TWJA 4UTXA 2MMGA 4EKIA 1PZGA 3WGHA 3HB5X 1Z4MA 2CUTA 3QVGB 3GJQA 4KOEC 4TVOA 5EC8A 3TN7A 3NGXA 4B8WA 4QO7A 3ZW7A 2B8JA 3LGXA 3PXDA 4IW3B 1JG7A 4D45A 3CUEF 5CA1F 4P35A 2GEFA 4QJ5A 1QU2A 3TTWA 1NV8A 3FNQA 2ZSEA 2J45A 5L45A 1TEVA 3GBSA 5DIZA 3IUMA 3GRFA 3OQ1A 4ND3A 3JZMA 4E46A 4BO2A 4BV3A 621PA 2NU6B 4TSFA 1KWGA 1BXRA 1MH1A 4MKRA 2PH7A 1BS1A 1ZD8A 3HDQA 4B44A 4MGEA 1ISIA 1JXQA 1XQXA 3ICPA 1TKAA 2GM3A 4YH1A 3NZEA 1E1DA 1W6UA 1QFMA 2QE7A 4PC7A 1C80A 1X87A 4YWHA 1QFYA 4CV0A 1BDIA 4MR9B 1XNGA 3SCZA 3V8NA 1PX0A 3AMVA 4LVCA 3SSOA 2ISSD 4PZCA 3UWOA 2ZSIA 4MZDA 4DQLA 5GADl 1NY5A 3ITEA 4GYYA 3A2KA 3A4VA 2NU9A 1ESCA 4JSYA 1M1ZA 4KL8S 1CIJA 4QGAA 3SG0A 5H59A 1TA9A 2I7VA 1G6HA 2WLTA 4U6NA 1NLMA 2J0SA 3JQAB 1J42A 1V4BA 4I9NA 5H3HA 4QTTB 4CL2A 4DLBA 5A3SA 3RVOA 3SX4A 1JPJA 2HW8A 1Q1QA 2H2HA 4IVRA 3PNBA 1EGVB 3E05A 3QEMB 3H9UA 4TSKA 3NYIA 4U8HA 3QJGA 4I9FA 2D7CA 2B30A 3STXA 4Z2AA 1QRUA 3QXHA 4KXQA 1DEKA 3V4ZA 1BMQA 3QF4A 2H9IA 1TMOA 4PR3A 3B2NA 1HYHA 4MRMA 5TMBA 4KSYA 4E21A 2W00A 5A05A 1VMKA 2O2ZA 1EDZA 2O7NA 3BUSA 3DBHB 3M49A 3LDGA 4XASA 4WL0A 3TZCA 2YNMD 3VNUA 3OQBA 4FDTA 3P5BA 1T3HA 4URVR 3UN1A 3P32A 1XRLA 4IZOA 1D7AA 3OZCA 2Q7XA 4YCJA 2X58A 1CCWA 3BN3A 4L5CA 4X7BA 1GTJ1 3TLBA 2XOXA 1JPNA 3ED5A 3C4VA 2WQ7A 3I5XA 4DSNA 1QG0A 4YREA 2RAVA 2Y0BA 1PJLA 4LRUA 3BIFA 4QDKA 4D4MA 4YDQA 3TDKA 1G4HA 2YCBA 2GN6A 3R23A 5DU2A 2EXXA 1A97A 4R51A 4YJDA 4G1FA 4EHKA 2RHMA 3MGAA 1BS2A 1CBUA 1SK8A 3JXEA 4IJWA 2R84A 5CEJA 4C0AC 3R1IA 1XQ1A 3MM4A 4M1SA 2IW1A 2CNLA 4UMFA 3E9RA 4JJFA 3RRZA 1D6SA 4IHJB 3WDLA 3CIOA 3A3KA 2G7ZA 3EXG2 3DZ8A 4XJXA 1Q7GA 4QFCA 5BYKA 1FX0B 2B1GA 3P2JA 3GOHA 4A0RA 2UU9B 1ZIXA 2W4IA 5DT2A 5BSUA 1FPQA 1VB5A 4E15A 3PNKA 1B6GA 4H16A 5K1ZA 4AIIA 3OPYB 4RJTA 3C1OA 4FR5A 1NQOA 4C06A 5JAQA 2YWBA 2J5BA 3E22B 5LMNB 4QOHA 4DV5B 5BP7A 1IVNA 3BOSA 1CEXA 1GNPA 2VBCA 4JI7B 2P2SA 3JQ9C 4F84A 4WKOA 4W9NA 3K09C 2VZLA 2H63A 4WY8A 4GMDA 3DEFA 5I7VA 5AXBA 1UXKA 4CKBB 5ICGA 1NC3A 3KKEA 4DR5B 1XLVA 3RSOA 1NUUA 2XKAA 3GLHB 4FKZA 1YVDA 5CG2A 2O7QA 4HGRA 3O3OB 4HDMB 1E6UA 1JDUA 2CLLB 2YY7A 2JK1A 2VJMB 3CLHA 1KI6B 2YL2A 3AY6A 2C99A 3HKBB 4N3NA 3KCNA 2ZS8A 4K9OA 2VTDA 3HR7A 2YFQA 2FAXA 3KXDA 3PFIA 1YS1X 4O33A 4RM3A 4B73A 1JLMA 1DAPA 1Q22A 4XM0A 5HTKA 4AAYA 2YDYA 1YB4A 3GNTA 1A8UA 4JYPA 2D13A 2XWPA 1I6MA 2ZPUA 3PE6A 5DTRA 3S5UA 1KYTA 2PDAA 4NCBA 2CV1A 4RIHA 1CY0A 3USZA 4Y0NA 1P8AA 1UH5A 1CRQA 4TKZA 3TQTA 4DLNA 3OEHD 4BNDB 4DRXB 5ES4B 2WFAA 1M7HA 4L4ZA 5DCYA 1RHKA 3QV1A 1CQPA 1EUDB 1VE5A 1Z8DA 2JIZD 3L07A 3PQDA 4I4TF 4B6FA 1I2DA 5IMBA 4YJ3F 5C53B 4XI9A 1PVOA 4HLDA 1XZNA 5HKOA 2J31A 2Z5VA 1SIWA 1K8ZB 3EZ9A 4XRGA 3TF5A 4EBBA 4KN8A 1QO0D 1KI7A 5DLQC 2ZJ1A 5JLJA 3GD5A 3E15A 3LCVB 5EUCA 4DUZB 4KU4A 2R1VB 5JZVA 3P27A 1K7YA 1WW2A 1MIOA 2I4MA 3WNVA 3BK7A 2M2IA 4I1OA 3HHEA 1CVLA 1SC6A 1VE7A 1ZOIA 2ZYWX 4M1OA 2DSNA 2M6RA 5K8CA 1OFVA 5K09A 2ZJ0A 2WHEA 3KFVA 3RH0A 1J2YA 4BE9A 1KR5A 2RGRA 2X6QA 5ADVA 2GETA 5E1OA 1C9JA 3BA6A 3FNIA 4R7GA 3IAHA 3LUDA 4N0DA 4BXOB 5KTRA 1G3IA 3HPRA 3UJPA 1SD5A 2IYYA 4I50F 2RKWA 2VEDA 4RA6B 4O4LF 5ABPA 1W4ZA 4ZK6A 2RI1A 1EK5A 2NZJA 2Y0DA 4TLMB 2FWMX 5ENDA 1MB4A 1DS6A 4FINA 3GU3A 4Z49A 2QMQA 3S1AA 3CEPB 2HN9A 2R48A 3WB9A 2ZM6B 2ECFA 4Q6BA 2A3RA 1PZXA 1KRXA 1KOJA 2AFHA 2PAFA 3F4KA 2GCOB 4IVPA 4P4SA 4B35A 2C0CA 3F2VA 4HN2A 3DFIA 1DT3A 2I3ZA 3W2EA 3FTQA 5ALYA 2FFAA 1AKYA 2ID4A 4N12A 3OQHA 3F67A 3V7WA 4EY6A 1NVKA 1UJNA 4D02A 1WD5A 4EX6A 1H2FA 2GFQA 2WVJA 3DLPX 4ML3A 5EIHA 5KVSA 4TXNA 3H0CA 3TTXA 1ZAYA 4K6CA 4HLCA 1KNXA 5REQB 3UAZA 2NV0A 1AHHA 3B2EA 4G25A 2FH5B 2O8DA 2BKUA 4M4SA 4MUGA 1J2UA 2OECA 3HM2A 3RB8A 2LR0A 4E5NA 4OB7A 3QWHA 1YR9A 4KR0A 4XYMA 5I8PA 4KN5A 2OV6A 2HZ7A 2XDYA 4BEVA 2QTAA 3UMMA 1GD1O 1SG6A 4DMGA 3NHFA 1W5AA 3M7IA 1JIIA 5E3IA 4DZRA 5JH7A 3AVYA 5HZGA 2ODWA 1KBOA 3RYCB 2DWPA 3JQAA 1GCIA 4UPVA 5DM4A 2X7JA 1KQGA 1D0VA 3B9QA 1TYZA 1NZFA 3BIOA 2G88A 3K9QO 4CKYA 4QU0A 2G25A 4A5SA 4JBHA 3K1TA 2ZAMA 3G2NA 5JS2A 3GJRA 3PCXA 4QYIA 3U6KA 2CLSA 3UMFA 3ZY6A 1U2DC 1AQLA 2X13A 1K3TA 4GR4A 1UEJA 4FIDA 4OQYA 1AK9A 2QYTA 3LM8A 2HH9A 3OU7A 3EPLA 1BDMA 2AXEA 2I8LA 5JBIA 4MQBA 2ZDHA 3HCNA 4RMHA 1IG3A 2R6AA 1GPH1 5LUBA 1ULTA 2B69A 1EIZA 2WHYA 1Z4NA 4Z4CA 5DULA 2M6LA 2P8SA 2VFAA 4GI1A 1W49A 5LPNA 2JAUA 2C2MA 1B8UA 1CUGA 2BDUA 3ZLUA 3OE7D 2QU8A 3P9RA 4QBTA 1PWYE 4BVKA 3KPJA 1BO6A 2FPLA 2QF7A 4A8JC 3UMRA 4PNPA 3RPEA 1JKMA 1U0OC 4BQOA 3COJA 4PV7A 1GQYA 3NFRA 3QOXA 2YMMA 3TTSA 4U7DA 1K1EA 3ROQA 4MLDA 5KSWB 2OBMA 2PE5A 4JASB 2HK9A 2RJOA 4UQOA 4ECAA 3CFYA 3HJNA 3QGMA 3O2QB 3AHCA 4EYQA 5FWYB 2PBRA 3BRQA 3W78A 5KOJA 1KYYA 4F4UA 1IQUA 2EYQA 4NDNE 2UUPA 1HE4A 4KW7A 6ABPA 3W2FA 1WB6A 1ILWA 1GNLA 2BF7A 3G0IA 4DG5A 5DNEA 1EVKA 1FRZA 1PZFA 4I3HA 4DMFA 3L77A 2X2EA 2C7BA 2FSUA 5HPYB 3AVVA 5CPFA 1WSBA 5AJYA 1EEHA 3TFQA 3CJRA 4R40A 3SKYA 4ENTA 3NHKA 4W6ZA 5A9TA 3TH5A 1FP1D 2WHPA 3CF2A 4MWBA 2NZWA 3D3QA 4R7ZA 4K6OA 4KZKA 4HRVA 3HY3A 1SH7A 3DXYA 3R8CA 5IJ9B 1K63A 1SVLA 3NQ41 5B4TA 3DTVB 3P45A 4KIUA 1W34A 3IEVA 4FMDB 4IIHA 3ICVA 3PPIA 2VJMA 5E6SA 2HLDA 4QYXA 3DVSX 1U2EA 3EBLA 3OQNA 3ZWVA 1W4BA 2IFTA 3D43A 4D9KA 4YRQA 3L0YA 1JHXA 5HXAA 1KK3A 3FYSA 3DT9A 2O2YA 2PZEA 5JG7A 3U3KA 5IAOA 2O8FB 4NEHB 2AW3A 2W4QA 2GFIA 4BVFA 3LOQA 4TKVB 4YK7A 3V1NA 1OU4A 2LIPA 5KQSA 3CN7A 4LMPA 2ATIA 3GQBB 2QAGA 3TD6A 3GW8A 1XA4A 4TOIA 3RAGA 5BNZA 2VXBA 4H4EA 5HM8A 1EP9A 4O4IF 1JDTA 1OXTA 2RGXA 2Y1FA 1H2EA 3R6LA 5IKPA 3EYAA 1AUQA 1NVDA 2FPIA 2VUHB 3IJEB 2QQEA 2DX7A 2BE7A 3GZTB 4Q39A 4D74A 1RQXA 3P0RA 4M2LA 3RSFA 4RKFA 4DA6A 4XCVA 2QDXA 4FPXA 1BHJA 1NOKA 5ARDA 3QKSB 2R0QC 2OFPA 4KAXA 3RBXA 3TVDA 3LXXA 4GM0A 1HGXA 2A9PA 2Q28A 4TM8A 5DYWA 3WXMA 1RZRA 2YOGA 2MSEB 1Y3BE 3ZBTA 1QPZA 4ND2A 2WMDA 4G1UC 3C70A 2XA2A 4CGYA 3VR4D 3EMVA 4PHCA 1JYSA 2RG7A 4CT4B 5TEWA 4J43A 2PCLA 2AEFA 4XTRA 3LXUX 4RK0A 2OXFA 4RPLA 3NIFB 4RH0A 5EYPB 3U4QA 3A6KA 4D9GA 2GD1O 2XNDD 3PDIB 2AB0A 4Q1CA 1PL7A 1BFKA 1W29A 2QRHA 1LSJA 3LYLA 2LCIA 1PUXA 3MJCA 1EFVA 4JOSA 4RDIA 4S0ZA 4YJHA 3R9KA 4EJSA 5C1PA 3U5TA 1OFHA 1OPRA 2HHHB 2ZUVA 1VCNA 5IM4F 4NQZA 5KHAA 2C5AA 2JAHA 3U16A 5FHQA 3IEUA 5DHAA 1ZR4A 4LZOA 1D0IA 1DELA 2OV3A 4RMNA 4E08A 3HCEA 2EWWA 2QYOA 2JJYA 3L3BA 3RG8A 1EFKA 3ETNA 3BWEA 3VSCA 4BRUA 1VBNA 3WLTA 3H9QA 5L6MB 4KIWA 4BNYA 2OAQ1 2D1RA 3MHPA 4GPIB 4KLCA 4UBJA 2WW8A 5F5XA 1BWSA 4YXWA 1X7WB 2DM6A 3KV1A 3ZWYA 4IUYA 3S2YA 1KJIA 2B4AA 2YZGA 2I55A 5K8JB 2XCOA 1G5HA 2ZE6A 4BQQA 2ICAA 2VJBA 4MS3B 4RXTA 3N2KB 5LXTF 1VJ5A 4EG1A 3HVJA 2RK3A 3H18A 3MC1A 1ZW6A 3JQFA 4H1TA 4OK5A 1H2YA 2BR4A 3FTNA 1RM3A 1OYVA 3IP3A 1PNOA 3SC2B 2CK3D 3W4KA 4EPWA 4F86A 1LJ8A 2J4CA 2XUQA 3HCWA 5IKEA 1ZRHA 2BRUC 2GPNA 4M8SA 5LIPA 3KR0A 3ISTA 4FHGA 3BWVA 2MOKA 3IOEA 2ZR8A 1L8OA 1LB1B 3BFVA 1Q1BA 2XQJA 4ZO9A 4TS4A 1CNMA 4IYRA 2UV8A 4H9GA 3JRNA 1E1RD 1UJ6A 3X1XA 3OTIA 3AL2A 3RANA 5K0ZA 3HGTA 2UUOA 3DSRA 1R0SA 1RJ9A 1PGNA 1PKEA 2H0AA 1XU4A 4GHWA 4GMXA 2GZ2A 4BQRA 5A3QA 5AVTA 2F1IA 1II8A 2XQKA 2XXBA 4UXIA 5FDFA 1VIMA 4W5OA 4ZTUB 1UCFA 5IDYA 5JPDA 5CNJA 2ZOSA 4PNZA 2SKCA 3H4IA 3D81A 3L1JA 4XDYA 3VR6H 1J1IA 2FSSA 2QLLA 2P4UA 2ZJ4A 1ECGA 2WKRA 2GN9A 2J9RA 1WULS 2FW9A 3NM4A 1X8KA 4OHFA 4PCUA 1T9KA 1P4HA 2E4XA 1NWCA 4TS9A 3DL0A 5F9FA 3X44A 2WVGA 2D1FA 3JWPA 1RPTA 4B33A 2QOEA 1YBFA 5T57A 3RS0A 3HA2A 5AJTA 1OI2A 3UO8B 1GJRA 1QRRA 2BHNA 1WTCA 3GCWA 4LDRA 4MVJH 4PRYA 4A0GA 2Q6KA 2J32A 5JBNA 3GROA 5E95A 4BNLA 3HKCA 3DUFA 1BGWA 2Q6LA 3KTDA 4PQYA 2WYIA 4WI1A 4F2DA 1YNSA 4AJJA 2J6HA 4PO3X 5I3CA 1UKZA 3TQSA 4ACBA 1EGQA 1A4UA 3ZD8A 2A35A 4ZI2A 5HUQA 2J87A 4H31A 1K86A 2BBWA 1VYHA 4D26A 1JLHA 3HP7A 1DPFA 2QUZA 4UNSA 2FP3A 3OPXA 1U0TA 4CQLB 2C88A 1I4EB 2BFDB 4EHHA 4D9CA 3PEEA 1KS9A 1E9VA 4D99A 5BSGA 2PUBA 3AG5A 3VR2D 3L1UA 2VCYA 1NR1A 3LFHA 1SZPA 3GLGE 3QEJA 2ZUEA 4CMCA 2J0VA 3QITA 1N3LA 4KR2A 1XZDA 4Z1OA 2FN8A 2XYQA 2BFBA 1DHTA 3CLRC 4KLNA 3R9IA 1M1YE 1T8PA 2HDHA 3IUPA 2P6UA 5G40A 4MICA 2PEZA 3C98A 4EY5A 3IVCA 2GBLA 2CHVA 4W1PA 1A9TA 1AUOA 2BOVA 3ZU3A 5C81A 1EKXA 4NCKA 1RAIA 3ND7A 5C7LO 3O1HB 2UXBB 1TMKA 1VYTA 3FXAA 4XIJA 4CF4A 1F51E 2NGRA 2PA0A 3B1XA 4J8PA 3CONA 4CF6A 2RAPA 3DMNA 4G0QA 5I9TA 3D8UA 1YS2X 3KKLA 1ZMRA 1YZGA 3FN4A 2B5OA 1YRAA 3LX6A 1PTJC 4K6MA 4XARA 4B1FA 1UBSB 2FDRA 3UJ9A 2PSHA 5C8VA 1U7OA 4KR6A 1WZEA 1AXRA 4ZOLB 3D1LA 4H7JA 4D4HA 1LNSA 2PUVA 4HGNA 5DTJA 3SQMA 1NNI1 1UJ4A 1CJUC 4CMGA 4ZN6A 1IUOA 5HBGA 3P4XA 1CY8A 3V2GA 3GJ3A 4F93B 2O07A 2JBHA 1KMHA 1C1XB 3LYUA 4O4JA 5E2BA 3FFWA 2A1TS 4ETIA 4LKOA 4YUAA 2R6GA 4ZQFA 2JI7A 4FKBA 5TT1A 2HQRA 5EHGA 1E6KA 5T64A 3EN0A 4O4HA 1UZAA 4F12A 4F21A 4OHYA 1I51A 5C8XA 3GAZA 2AOVA 3MD9A 5K3FA 3L79A 3NBFA 4AYTA 3KXKA 1Y6FA 1PS9A 5ESRA 4HYEA 5AW0A 2Y1DA 1BXKA 2ZU0C 4K26A 2XT9A 4C89A 1FU8A 1OFIA 3HDYA 4OXIA 3H0EA 2DWUA 5D3ZA 3GUUA 1LH0A 2QMOA 1R9NA 4TQUS 3NHUA 3KSZO 1C7QA 2R5WA 2ZW9A 4XGKA 1RAFA 4BFVA 3ILVA 4IH1A 4BLWA 3AB3A 3GVCA 3BB3A 5EI5A 1UDRA 2XA1A 5K3BA 3A28A 4FKMA 1GGEA 1ISPA 2C7GA 3IO5A 1Z4JA 4Y2UA 2UYHA 2ZBQA 2G40A 1XZFA 3JQEA 4FQ8A 4Z9BA 5HRAA 3CSDA 4RTSA 1WHSA 1NJ8A 2Y93A 4EZIA 1E8NA 1W19A 4AF8A 1I30A 5E7JA 3CCCA 4ZD6A 4EYKA 1P0PA 1X1QA 1WF3A 2VHWA 4YA6A 2XT0A 1ZVMA 5EP1A 4YAJA 1BX1A 4TSFD 5FFNA 3CNLA 3O9MA 2G0TA 3PQ8A 1GARA 2A33A 1P7WA 3PLRA 5BUSA 3ZH9B 4Q0MA 3OQPA 3DV2A 2GARA 3ONNA 2P9EA 1YGYA 4C1BA 4IFIA 4IO0A 1J0CA 1WJGA 2ERCA 4IXNA 2OYCA 1JMKC 2QE7D 3OOYA 4RPGA 1WR8A 3KDAA 4WNAA 4B6GA 1A7AA 4PLHA 1D1SA 2GEKA 3AUXA 4M1ZA 3OBIA 1VL1A 1G66A 4XWOA 4CUKA 3TMYA 5ALNA 1VRWA 3LC0A 3H99A 1SCBA 1XZAA 1NXVA 4M1YA 2C9DA 5GPBA 1EVQA 4RIGA 2RFLA 5BUQA 3AV0B 3M4XA 5IAAA 3RUCA 3O4VA 4JSRA 2QR2A 1M2JA 3I45A 3AEKB 3K09A 1PV4A 3UMYA 1XXHE 3BXPA 3K0BA 3ND9A 2I71A 3C45A 3QLJA 4IRXA 5JWRA 2ANCA 5A06A 3M6VA 2QTRA 3CCBA 1T5DX 4II7A 1E8MA 1YOBA 4IIJF 4LJ7A 3WRYC 3R2JA 5AFSA 4PWZA 4KCGA 1B74A 1SVUA 4Z0NA 2OBNA 3S3TA 3N74A 5DBHX 2G1JA 3R7SA 4Y2HA 1O6ZA 1GPNA 2HRZA 1EVLA 3LH5A 3NGLA 4E5DA 2RAFA 2AG1A 3ITKA 4AN0A 4BLUA 4DRYA 5EHXA 4V02A 2R65A 5FPQA 1NBME 4INZA 1JXAA 2Y71A 3R7WB 3UXYA 1BE0A 1MVOA 3NHMA 4B79A 4BASA 5KWIA 1GZ4A 4BKOA 3ERCA 1KXZA 4O08A 5AHRA 1RRFA 4UCQA 4JUAA 3WBBA 1U9IC 5KKCA 3LV8A 3GAAA 4FOPA 4ADSG 1DCKA 1L6RA 4A27A 3UOAB 1FQJA 3C6YA 2R68A 1ISGA 1VXRA 3FMGA 3DFZA 3ZUPA 1QP8A 3HKEB 2B92A 3O1JC 4CHGA 2W2MA 5L95A 3G68A 1KZYC 2MJLA 2ZVQX 3CG4A 4TZKA 5B1SA 3ANNA 1CR0A 4KIGA 1TZMA 5G3ZA 3RSLA 1NBWB 5CM9C 3WBFA 4E70A 3OLWA 3BAFA 2ONJA 4GGPA 5CXUA 3ZE9A 3RVKA 1QYIA 3E5HA 2EKPA 3JRWA 3YASA 2P4SA 2I22A 2JHFA 2QUIA 3I53A 4FYJA 1D8TA 1SUBA 2IYXA 1JEQB 4B8ZA 3W2TA 3G8AA 1F3OA 4FHFA 1G3UA 3BULA 2O6LA 3DBLB 1C0LA 1VE3A 3FHJA 2QLFA 3ME5A 4KO3S 2A2ZA 4ZVNA 5KYVA 3R5TA 2QVCA 1IXSB 2H59A 4OJQA 3WNDA 3T7DA 2R25B 1GEGA 2C3MA 3NCTA 2VK2A 1M8FA 2XSZA 2VP2A 3INTA 4ABTA 1YI1A 1VLJA 4M1KA 4ZV9A 3ZV4A 3B48A 1KO5A 2IWHA 3LYAA 2CUNA 1L5QA 4FYPA 3UXEA 3ZDXB 1AVTA 2Z1DA 4PXSA 5LM3A 1E2LA 4G24A 3CGWA 1OLOA 3CVYA 4KJXA 1P9WA 4Q4HA 4XWTA 1WXGA 4F6RB 4OP2A 4NBSA 4UATA 1DAKA 2E89A 3TRKA 1BJRE 4IKPA 4IBOA 1O97C 4I2NA 2WM2A 3WGGA 2G36A 4L08A 1NLUA 1VG0B 1SOWA 4LY6A 3RTGA 4GI7A 4LZWA 2XWQA 2D2XA 2H1LA 3FPBA 3IQXA 4QNRA 4NONA 3T1TA 4AY6A 1UDWA 4CL8A 3G1TA 3M9LA 3R9XA 3RV3A 1BU5A 2AFRA 2C5EA 4D3SA 3U37A 1XCPA 2QD3A 3G49A 2BFFA 3QVSA 3F5SA 3FHLA 3N75A 3OF3A 5LQUA 1JR3D 4QYSA 2A0KA 2D2VA 2HPZA 4AQYB 2DHRA 4OK3A 2K7FA 3PRJA 1IN1A 2OBXA 4X0EA 1ADYA 5SY4A 4H7KA 4MX8A 1M83A 5A9RA 2Q8NA 4PXAA 3AJ8A 4I66A 1U2GA 3KJIA 5KSYA 2CT8A 3DLIA 2J3JA 7GPBA 3JVDA 3GIWA 4W9MC 3K1AA 1CTQA 1QJCA 4P54A 3ZHVA 1IIBA 1C0EA 3CX8A 3ZWMA 1PG5A 1T5HX 1QJ4A 2N1MA 1XKLA 2NU7A 2OXRA 5CD1A 1T6NA 2Q9UA 1Z6TA 2BP7A 1AK2A 3N5KA 1YZTA 1Z8FA 1Y33E 2H2FA 1FY2A 2FJUA 6Q21A 1DOZA 5FUVA 3JQBC 1BG6A 4PQRA 3SIRA 5BWLA 2NIPA 5TR9A 3H1FA 5CLJA 5CJJA 5D01A 5CX1B 3P9IA 1U2DA 1EGAA 4BNHA 1KAQA 3TD2A 1F8XA 3H84A 2C57A 4QVGA 1VQ1A 3I3SR 4ZVLA 3MCUA 3VH3A 1WBDA 4ZA2A 5FLYA 1XL0A 3S2EA 4F8YA 1EK1A 1JHPA 1WCIB 1KEVA 4UEOA 4FONA 2JNWA 4J0JA 3SU8A 2ZBPA 1KZHA 4TYYA 3OHMA 3C5CA 3E1GA 1PCXA 1Z2PX 2X1LA 2H1WA 1FF9A 1V5WA 4G0OA 4V3BA 1UDAA 3EEIA 1QS0B 1H22A 5EWLB 4DA9A 2XGSA 4F9EA 2EQ5A 5L4SA 3DP9A 4B2PA 2PLRA 4UM5A 4GQAA 4J7UA 3LLUA 1X7YA 2JEOA 2QRVA 1R74A 1WCYA 2XHEA 1K2VN 1UKCA 4HEA1 3W5BA 4WASA 1DZ3A 4F5EA 4B3XA 5ALMA 3T7TA 3DS8A 2KLBA 5DM0A 5DLEA 2QLTA 3C3BA 1NX6A 3IQGX 3SVZA 3SQDA 2YXBA 5BN5B 2IYWA 3SD7A 3GEIA 4LWQA 3PICA 4ZYWA 1DBVO 1T3ZA 4CV2A 3VH1A 5IZCC 3K2QA 2D5BA 3G9QA 5JIBA 5K3EA 2YXDA 4WLUA 1TJ3A 4X54A 1HRDA 2HRRA 2AOWA 5FTJA 4B47A 4DDHA 2QLNA 3R20A 1VSUA 1HURA 5JRDS 1V3VA 2W9XA 4MDYA 2BKLA 2FZ4A 1UMDA 1HT1E 2NXWA 4RAQA 3UIEA 4DV4B 1AB6A 1WW3A 1XQ9A 2QVBA 2XHZA 4K87A 5T67A 1KMQA 4TQAA 3FOEC 3HK2A 2JFNA 2O4UX 2XF2A 3QWFA 4LSGA 4N54A 5J1TB 2FPPA 4QE3A 1L9KA 5A4JA 1CE8A 1AKWA 1VMAA 2VAVA 3JQAD 3FLAA 3PQ6A 5KAPA 3L2OB 4ZYYA 3R0JA 4J1NA 4AS1A 2AOXA 3BF7A 3TW8A 3U44A 4J03A 2XQVA 2WJZB 1GFWA 5L4NA 1ID1A 3JQ7A 3H3JA 3LUJA 4J29A 2N9UA 1OW3B 4MQMA 1FQKA 2FA9A 4R69A 3RD5A 3MMZA 4MDEA 3WJ1A 3BXEA 1UQTA 1I4TD 3EZNA 5IC5A 4KV9A 3N76A 3CVUA 4OFBA 3W8FA 3WJ7A 5HZMA 5JYEA 3EHDA 2PUHA 1TVKA 2OQRA 1EB9A 1UM9B 1G2QA 4IZ6A 4RFLA 3IV9A 5GIPE 2JLBA 4C2UA 5SY9A 3GRUA 5KVVA 4K05A 2OVFA 1PEDA 2QRZA 2WWWA 2EKBA 3BD6A 3P9ZA 3A1FA 4JLJA 4YMHA 2AN5A 5EE1A 5JS7A 1LRKA 3PHBE 4D9FA 5GWXA 4I4NA 2Z9BA 2QUHA 3AKYA 3MMPA 5LP6F 3QI2A 4C6HA 3E70C 1GU7A 1SBYA 2ZRQA 3LDFA 1OT5A 4HYTA 2PUWA 5KHOC 1FDWA 3DMDA 1B6TA 3E8SA 3WYFA 2QA5A 4H3VA 4RTPA 2HIGA 3H8VA 2G72A 1JQ5A 1TM2A 3DEKA 6CHYA 5J2TF 3AUUA 4KDEA 4ZJZA 1JAIA 2YUTA 2MSKA 3U80A 3ZCSA 3A06A 3O1IC 2HRQA 5C4GB 2PD3A 1X9GA 4FNGA 1TRKA 4AY3A 5CB8A 2Z1NA 2R8ZA 4ZQHA 3EVEA 4L75A 5MN6A 1JFRA 4F85A 3CUWA 3P0JA 2O0LA 3HXPA 5DGIA 5EJ5A 5T3UA 1UMBA 5BRAA 3WDSA 2O0KA 2GGSA 2JFHA 4IXDA 4JQYA 5DBEX 4TLBA 4AIRA 1ZOLA 1XDZA 2A9KA 4MPRA 4R9UC 5HK8A 2E6UX 3WI7A 4KIFA 4LZZA 3IBYA 5HS4A 2ZSAA 1R9JA 2QL9A 5L8VA 1OVGA 2VDRB 2RI0A 4G84A 3HNPA 4NHEA 3FRJA 1TZCA 4F8JA 5DO9A 3RS2A 1IJFA 5ICCA 3I52A 2JH9A 3CH5A 3TFWA 4QGGA 3W5CA 3PC8C 4D97A 1ZD5A 1IBMB 2II6A 5HGXA 5HG0A 1IFXA 1UC5B 1CEQA 3L9WA 3ZC3A 4K0KB 3GOQA 4DBLE 1OA1A 4BWGA 2VDKB 1WMEA 4ZCTA 2NPIA 3SMVA 2HLDD 4ZI7B 1YA4A 3BMOA 3PGLA 4HSEA 4OHZA 2V8BA 2Y1GA 2CVPA 5CDSA 1G59A 2XNJA 5B1IA 1ZGGA 4QAQA 1RYMA 1RWXA 1BHQ1 1QTQA 5AHKA 4AURA 2IIQA 2ZRHA 4FILA 5CB4B 3STHA 3VGPA 2K6GA 4NZNA 3LLVA 2GUWA 1MA3A 4OQFA 3BZWA 4EFNA 1JSCA 4TT3A 1G8YA 2J0QA 1I1OA 5GV8A 3V8VA 5B3JC 4QGHA 4PLWA 5IXYA 4ZOCA 3IVRA 4GI3A 5KDOA 5G2OA 5CA0A 1JALA 5EXTA 3F3MA 1V2GA 5KTTA 1QGOA 4NYMR 1QFZA 1J5EB 4IRMA 4H4DA 1M1UA 1F8GA 4KXXA 1KDVA 1SRQA 2C78A 5FKJA 4WOPA 5EKTA 5TGTA 3C7DB 3BWYA 3VDXA 3PPVA 1N7IA 3I01A 4L4XA 3BTUA 2VHZA 5TE9A 3W8DA 2HFJA 4AKIA 2WUDA 4J91A 3IKJA 2CJWB 4NBNA 5CW2A 5H83A 2CLMB 4G09A 4B84A 2RD2A 1Y8ZA 2ZTSA 1N2GA 1KVSA 3R5SA 4LK2A 3RSCA 5EOVA 3RTCA 3ANMA 4BY9E 2ZT5A 1SO8A 3G0GA 3KJZA 1OLSA 3L0IB 5HF5A 3TQOA 3ZZMA 4JC4A 5I3ZA 4YIKA 2WR8A 2AL7A 1SKYE 2C4HA 2NTEA 3ABSB 4OHWA 2P5YA 3IOYA 4R9VA 3TLGA 3EUFA 2HU7A 5F3WB 1MC8A 1XO1A 1K0FA 2JCSA 1W4RA 4PLFA 2PUTA 5LYJB 4FEYA 4L28A 1OAKA 5H8WA 4WXRA 4V0ME 4FFOA 3PI7A 5LNK6 4RQUA 1RC0A 1GV1A 5BSMA 4M8KA 4WEQA 5H9VA 1A71A 3NJ4A 2B8TA 5BR1A 2VDUE 4PWYA 4YP0A 2V3VA 1S7CA 2OY0A 2W2OA 4FDMA 4I6EA 4J6FA 5ESDA 1X9IA 4N5MA 1RRKA 3F8SA 2PX6A 4Q1FA 5DI3B 3R75A 3MCZA 2NZ2A 3RIYA 3WY9A 3VC2A 1OX4B 5BY2A 1T0HB 1E9SA 3FWPA 3PG5A 2PGXA 2BKEA 2EP8A 3LWZA 3ZN2A 3PJGA 4ILEA 4DM7A 1E20A 1Y7LA 3K0AA 1OXSC 4RSMA 4TROA 3DTYA 4DMLA 4N4AA 2ETXA 1I14A 5IT0A 4QQ8A 4YXWD 3L7JA 3RNLA 4FR2A 2IS2A 3DJYA 1F8UA 2PS3A 2GSDA 2ZUWA 2BZ0A 2EKQA 3C6QA 3RRXA 2HBZA 4G1BA 5JSYA 3KWLA 3WKAA 1MRNA 2REQA 2MIIA 3GWGA 3L04A 1R0CA 4MWEA 4RGYA 2J09A 5COBA 4CKWA 3ZU5A 3KC2A 2VRNA 2R6JA 2A6PA 1OAOC 1U28A 4G1MB 4R8SA 1OR8A 3ZGLA 2CHFA 4R41A 1MPTA 1DV1A 3NHAA 4YCAA 4EFLA 1NWHA 4OHPA 4DQUA 2QU7A 2XGGA 4TTTS 3AFMA 1MT3A 3G13A 1VE1A 3D3JA 3ACCA 3C6ZA 1WDWB 4NCHA 3R7LA 3O9VA 1KIFA 1S4MA 1U8CB 1QK4A 3UKOA 1GAWA 4G8CA 2YYZA 4HADA 2PJUA 3DV9A 1Y89A 4P81A 4Z9YA 1RCTE 5DNCA 2KS6A 2O8BB 4CLRA 1XWWA 3VHXA 5K2MA 3OQVA 4PO8A 4DLLA 2GXQA 3FR8A 4RY8A 1KPGA 5DHUA 2PZAA 5IT9A 3NATA 1EVIA 3FJ1A 4RGQA 2BFMA 4P5EA 1UM9A 1PTJA 1U8AA 1Y4ZA 2VEOA 3KWMA 3ZHBA 4BLTA 4RE5A 4BEBA 5B4UA 2LE0A 2WB4A 1I6LA 4YRTA 3T94A 2HQSA 5JQWA 1W7AA 3G0CA 2WTMA 3ZDDA 2QUKA 1RBZA 1OPXA 3E9DA 4ITVA 1THTA 5TPWB 4EF4A 4YRCA 2QZ9A 4F2HA 1TW3A 1FUKA 1JYEA 5JXHA 2ZSKA 2GPJA 1QTRA 2P3QA 1TX4B 2HJGA 3HV2A 2SNIE 2G09A 3BGOS 3I5MA 2JBWA 3EUWA 2CZCA 3KJXA 4UHCA 4ZXFA 2SECE 2Q8PA 5BYAA 4MQ5A 1JG2A 1XRNA 4N39A 4CMAA 1W5TA 1JZTA 1ZHFA 1EAYA 4LXQA 3VNRA 4BUZA 2Z83A 1D1QA 3PVSA 1NDHA 3MA0A 1EDBA 3TZLA 3BE5A 3M4JA 5KVQA 2R79A 3KB6A 2PR2A 5K0TA 1Z7YA 5FXMA 4F4CA 3UH1A 1O89A 1RMTA 1TOAA 4NL4H 4MCIA 5CDFA 4DGQA 4Z86A 1E7SA 3SZUA 1TU3A 4NI5A 3GFRA 1LTHR 1MT0A 1WV0A 3DAHA 1BIFA 3QLUC 4DN6A 5ESXA 4IXWA 3ZOZA 4E4YA 2WYVA 3K31A 3SR4A 1L2TA 4S24A 4OHCA 1G0NA 1FMTA 4Y6PA 5FH9A 3K6JA 4P92A 2CXHA 1VRCA 2PA3A 4RKWA 4EW6A 4ZODA 5ENVA 2J6BA 2PS9A 3FFTA 4AX4A 1VCIA 1XEXB 4ZK2A 1KWKA 4CGZA 3ZIDA 1F48A 3MK31 2PHZA 2PR7A 1RPZA 3A27A 4XQ0A 4LZAA 4QPPA 2V97A 5EP2A 3SK0A 4S05A 3NANA 4MVJM 3FRHA 3JWGA 3UCXA 5ULLA 3OZDA 2BONA 1JJAA 1ZUD1 2HK8A 4FN5A 4D81A 5AUNB 2G6TA 1TUBB 4IH4A 4XR9A 3D8SA 1KY4A 3C5HA 4BYMA 4G5XA 5H0IA 3CLSD 1IY1A 1FLNA 2HCRA 4MPJA 4ZI7A 4RFSA 1PT6A 4QO8A 3GXBA 1YE3A 3FCYA 2ZWPA 4JROA 4RWZA 4WJKB 5EUQB 1DVRA 1AA6A 2OE2A 1F4PA 2HU5A 4XX1A 3T7AA 4I19A 3OPYI 4PHFA 4B80A 4C7OA 1NF8A 3KP1A 4UBOA 3K9CA 4HS4A 3V8RA 4RH1A 5IJ0B 1CSEE 3UZUA 3ONVA 3K9LA 3UW1A 4UFPA 4JWKA 1ITZA 1KEUA 4U7FA 4A03A 4F97A 3AOEA 1JI0A 4P7GA 2VH5R 1Y8CA 2C9MA 2BW0A 5FI3A 4V03A 4AKHA 2AS0A 1HYGA 2V7TA 1WMSA 4LDZA 2D5CA 4FEGA 4YV7A 5BV2P 2LCFA 4OAQA 1P74A 5JCOA 5EUMA 4C4XA 3G9ZA 4P83A 4BQEA 4F96A 2OHXA 5LYJF 3WRYA 3VPDA 4MZXA 1DU4A 3ESBA 4KO2S 3ZI0A 2ZUSA 3HFRA 1U11A 1ZGZA 2PBFA 1KY5A 3E0QA 1EP3B 4FC7A 4JR2A 1JXOA 2XB4A 2RGNA 1ILEA 1BXGB 1OB2A 3L92A 3DEAA 5ISMA 5JSHA 3C87A 1IONA 2UZ0A 4FFPA 2Q1WA 1VG8A 3D3EA 3LK7A 5T8KA 1APBA 3PNVA 1EJ2A 1FS6A 4XA8A 2H4ZA 4L16A 2I65A 2F67A 2QNIA 5F2KA 3SQNA 1J2TA 3PYMA 1MR3F 1NDUA 4TV8B 1C9EA 1URPA 1P31A 1UFKA 2CUZA 2PFSA 1ABEA 3QXXA 4FT4A 1YFZA 5EQJB 5GONF 1Y6GA 4C4OA 1GHTA 3A9CA 1U9IA 1UBJS 4I5DA 2JANA 4KMSA 4LJ9A 1GWNA 3BGSA 3QBJA 2Q7DA 4CEHB 3E3LA 2EYUA 3K6SB 2GJ8A 1RW4A 1UMCA 3D2LA 4GOND 2BEVB 2Z6AA 1LBSA 4DIOA 3HCDA 1LVUA 4IIVA 3WSWA 1YJ5A 2ZR0A 3M6AA 1JEJA 1I33A 4NEGA 1CZLA 1YAJA 2I2BA 4KGDA 2ZIVB 3N0TA 4NARA 3TSAA 2O57A 4A2WA 2PKQP 4D3FA 1WB9A 5DGCA 1XTSA 3ZOKA 3LT1A 1H6AA 3T4XA 1ZUNA 4B7ZA 2AOTB 3MT0A 2OCYC 4BKRA 4ZEXA 1YRWA 2AFIB 3WV4A 1LVHA 4WY5A 1YHNA 4Y1EA 1UBLS 2EWMA 1NX9A 1PR1A 3MQFA 3HJBA 3MTBA 4MCJA 4QPZA 4L0DA 3B6JA 3WYDA 4KYVA 3FJOA 1JH9A 1ZNQO 4DLPA 2CVQA 1LPMA 3RSQA 4JI5B 2Q6IA 2Z2JA 3NIGB 1SCQA 3L18A 3AM3A 1XZGA 1BE6A 4FYKA 3GLQA 4AJHA 1QM5A 4LW8A 5IVKA 2BMVA 1PQ4A 5DSXA 4MWDA 1X86B 2NPOA 4G56A 2A5YB 2PMCA 4K9DA 3ZV6A 3QU9A 2OZLB 2PRIA 1L5LA 1J99A 4PC3A 4WIAA 3CVXA 5AW8A 1V8DA 4DLKA 4I1VA 4F9FA 3KQTA 4YCBA 3T1OA 3DAGA 3L49A 3ZXYA 1QZZA 4JJ4A 1ZKDA 4RK1A 4BGVA 4BJ5A 5J4VA 3RGWS 2D8AA 3HBNA 3O91A 2WHQA 3BXHA 1KR2A 2X76A 3I04A 1AQJA 2NNLD 4XSGA 4PPYA 3O8NA 4FYYA 3FBTA 5HIIA 3UK6A 1E2UA 2WP0A 1KJJA 3B3QA 1HR0B 3A14A 1HH4A 3D0KA 2EW1A 2D8MA 2WAOA 5TPWA 1UT5A 2JBAB 2AKEA 2QVXX 2VC2B 1YZQA 3AIKA 3A6HA 4J16A 9ATCA 4AUKA 1ZAKA 1DAMA 1AD2A 3G6WA 2PKQO 4Y9SA 4F8EA 2FQXA 4ENSA 5AW1A 1UKAA 3C24A 1Q14A 1YV9A 4G0UA 3HEBA 3IDOA 5ES3A 3L1KA 5IUKC 3WMFA 2WUWE 1UPAA 4HNUA 5JS1A 4MUEA 3SDZA 1MABA 1TUEA 4EUKA 1TVMA 2QY6A 4H6WA 4MKXA 2BM0A 2VYVA 2ZPTX 1I3LA 3PWKA 4AJ2A 1HA3A 5P8WA 1SXQA 1Z0JA 1K8XB 3MUNA 4DEVA 3T1HB 3PLAE 3USCS 2IYZA 4A8HA 2KX7A 3ADDA 1CULC 1RWQA 2RH9B 3DBRA 1TZ2A 2H0QA 4MO2A 4X85A 3AESB 3EQ8A 3OLCX 1EDOA 2C5LA 2ZK7A 2NQ2C 2JLAA 4E1BA 4RQBA 2PMWB 1VHLA 4JP3A 4IQ8A 4GVXA 5DT9A 5JUWA 1YS7A 4MKGA 2QZZA 3ET4A 1RMQA 3OEEA 3DTTA 2BFEA 4CYMA 2IF2A 5ALQA 1YZ3A 3AHDA 1K92A 3KUKA 1KIMA 3AYZB 4F6LA 2LD4A 5F5LA 3DT8A 2J6CA 3CRMA 2EAUA 1H65A 2REXB 3ER6A 1HZJA 5FPKA 6REQB 1R4MB 1GQRA 2OA0A 1IN4A 3QKIA 3AY0A 5I7AA 1S3IA 1YQWA 4WOKA 3QXSA 3EEQA 3Q2OA 1NATA 3WZ2A 4ZZ2A 1TUBA 1T0UA 4OA5A 4URXR 2TS1A 3AFHA 3FY4A 4R2LA 1XPRA 3LHFA 2DMRA 4JK3A 2XRMA 5BVGA 3OEYA 2QUBA 1SA0B 3RSZA 4F1JA 5C46F 3SEQA 2P9GA 3ELUA 2ADFA 3F96A 4EJFA 4D5EA 3TO5A 1R9MA 1D2RA 1GZVA 4HQOA 4JR1A 3AL0C 4GE3A 1RP7A 2AMLA 1HZZA 4IFTA 3A36A 4ME6A 1DDGA 4JNKA 4IHKA 1QHYA 4ND8A 3G8DA 2O0HA 2YIJA 3GZNB 4MS4B 2C1XA 1Z29A 1Z2NX 4PG4A 5A71A 5HDBB 1C4OA 5B6JA 5IBCA 5K8VA 1U0BB 1QGAA 3JQQA 4C7BA 2ZE8A 4ZCIA 1ETUA 1DKRA 4KYUA 1ECFA 3ELDA 5K3DA 1X94A 4YMWA 5B7QA 1NQUA 4GVLA 5KYUA 1X7XB 1YSCA 4NAHA 1NE7A 5BV1A 1ECCA 1R7RA 4D5GA 3E1KA 2Z98A 4AL4A 4E14A 2A3NA 1CQXA 3ZPXA 4BNFA 3EZ2A 1VECA 3V1LA 4TKUA 2G5PA 3A6ZA 5LB2A 4I8DA 3S27A 5C8YB 5TS3A 2CL6X 2HWKA 2E5WA 2VPTA 3IE1A 4TX1A 1FVXA 4N82A 1OREA 1U7DA 1UBUS 3B38A 1RI2A 4HQRA 1UBHS 4BLVA 2H7VA 4MB0A 2BHLA 2D4AA 3RR2A 5FOXA 3HYTA 2BGUA 2B1QA 2VZ8A 4F5WA 4H77A 2NACA 2X4DA 4P8RA 5KTKA 4IKEA 2QRMA 4YAKA 1UPBA 1U8ZA 3P52A 3R7AA 3AM1A 1AF4A 4PYMA 4PGGA 3EZXA 4HAVA 2HDNB 3U4CA 1EXNA 5DBFA 1IZ0A 1H8HD 3CMMA 3KAPA 4EBFA 4FUQA 2AF4C 4KSCA 3G5MA 1W93A 4ZQGA 3ZV7A 5L40A 3RYIB 1XL1A 1JWAB 4PYKA 3BORA 5AKKA 5C31A 4Y30A 5BMVB 4NBTA 4CTMA 3KXIA 3M82A 1CUDA 1YUNA 5FI5A 1GCGA 1IDN1 1OXVA 1R0LA 5DKFA 4LJLA 2EF0A 1SQFA 5BOVA 4ZZ3A 2R2AA 3T1QA 4JVOA 1EK6A 1X0XA 2BBSA 2PYZA 2ODAA 4OJYA 4RO0A 4UDOA 5PGMA 4Y6OA 1YR8A 3DM5A 1C0PA 3QBVA 4ZJUA 4CV1A 5CB0A 1OH8A 2H1HA 2VXOA 1XTUA 2VI5A 3ZGYA 2R2GA 1PGQA 2XNKA 4ZMSA 2HU2A 4BNMA 1P77A 5ALFA 3CNEA 4XLTA 5CMLA 3QLVA 5LZ4A 4OX9B 1AF7A 2FR0A 5FD8A 2I9PA 2AJCA 1DAIA 4GPEA 5CH3A 4FXOA 3H4VA 1QQ5A 3K8ZA 4E6EA 2FUKA 4X1IA 5F76A 4IMPA 1KEZA 3K70C 2JLWA 3IPXA 2QTWB 3IHTA 3N8HA 3LHSA 3NASA 5T6MA 3GBVA 1QLWA 1C8LA 1ZK1A 1N9KA 3BK1A 2VDOB 1PZMA 3ZWPA 1DWQA 1HNXB 1L5OA 5BWMA 5CU7A 4FFBB 1FSPA 3IPYA 4MVJP 1ZHOA 2H9AA 1AXGA 1HE2A 1XRPA 1YZLA 3VYVA 1QR6A 3GJ0A 5FL7A 2ZB3A 3V8MA 3M6XA 4ARAA 1GPMA 1NOIA 3FCUB 2XB9A 1Y3DE 2FSPA 3MBIA 2DCMA 1C3LA 2CDAA 4BGDA 3FF4A 5KJ6A 2QM7A 3NKVA 3P26A 1VSVA 4E94A 5ADHA 1PJCA 5CH5A 2X0DA 1XHFA 3BG5A 1MJFA 2X4GA 1UPTA 3QXJA 4G1CA 1AUXA 5TIIA 4BAZA 4W5NA 2JBAA 5FEMA 1R37A 3JD4A 1QLJA 5F12A 1G8AA 1N3YA 1TC1A 5JD4A 4LYFA 2QP4A 3HCRA 3ROEA 3UG7A 3TVYA 3Q8XB 2JHPA 2ODBA 4M55A 3PUIA 3S6JA 2V0NA 3T0FA 1UWKA 2IH5A 2Q3JA 4CI0B 2CLFB 3B70A 2JAPA 4BVLA 2ZJ7A 2J0UB 1A5TA 1DRWA 1PGPA 1KFBB 1MENA 3EY4A 1BQ4A 1XMPA 2WIKA 1F9AA 2P4QA 3GDOA 1U7PA 3IPAA 3R6TA 4RL6A 4ESOA 2CFSA 5F52A 3SQLA 3PT9A 3OJLA 4KGZA 3ZWCA 3EZ6A 3I4FA 3FHTA 4O6VA 4U9UA 2GJ9A 5KNBH 4X1KB 5TNXA 4QM6A 1T4BA 3NKFA 5HKKA 2DPXA 4NPCA 1W96A 2HIHA 5JT1A 1DBWA 2W0SA 2J59A 3GFPA 1C1DB 1JSLA 2VDWA 3RUHA 1B0ZA 5J43A 3FF1A 3FOBA 4NXMB 2MR5A 1W36B 4F3KA 3HO1A 1ZWKA 3KQMA 4YCNA 1CRPA 4G5GA 1UXGA 2AQ8A 2ZI5A 2DF8A 3OPQA 1QYCA 1G5FA 3NDIA 4LX8A 3A2LA 4RD3A 2XTMA 4UZSA 3UB4A 1G21B 1YQGA 2HHLA 2Q2WA 2QXYA 2XMQA 2Z8ZA 1M1NB 1XCMA 3DTNA 2JLRA 1RQGA 3ENVA 2IV3A 3WL5A 3BCRA 2ON6A 2W8BA 2B3DA 2RG1A 3B1WA 3AP3A 1CY4A 2C5GA 1D6NA 2Q2OA 3GFFA 2O52A 3LLMA 4G4GA 1GT6A 1Y34E 1NBAA 3ESXA 1GPWB 2VT3A 4AYWA 6REQA 3HZRA 5JH7F 3ULKA 1BEEA 1NN0A 2P1ZA 2IVFA 1JDVA 2V7QA 2WE7A 3ZWWA 4EHBA 1T5IA 3TW0A 2UZ3A 5CCEA 1GZ6A 5JDCC 2C9BA 5A9SA 1Q50A 1L3IA 4G36A 1LX7A 3N2EA 1QDLB 2YZMA 4LJAA 5LR6A 2A0UA 3ELWA 3FYUA 4KPGA 4QTZA 3CNNA 2HSWA 5EJFA 5FB3A 3WOVA 4A2CA 2GLTA 2CF5A 4NS4A 1ZS9A 1W5EA 1J90A 4OIFA 5CM8B 3T7EA 2DKNA 5EMHA 2IYEA 3CINA 3TSCA 4C7KA 4S04A 4TT3D 3DFUA 4F6CA 4YT2A 1X2EA 1U7HA 3A1WA 1D9XA 3D7MA 5B7PA 2IS6A 2WA2A 2IIBA 5ILOA 2GBCA 2VWQA 3CGGA 1ECJA 3EMBA 3EMKA 4JMLA 1RI3A 4E30A 4U2EA 2I2CA 3ZDRA 1AZLA 4L8YA 1HLDA 3RAEC 4DLSA 5AI0A 1YDMA 1XPOA 1O96A 1WNFA 4B3HA 2W2KB 1M8JA 3DE6X 2BUAA 4E2YA 4KUEA 1O8CA 3M1LA 5KYNA 1ISHA 2WVHA 2H4FA 4IYJA 3SLRA 2AD5A 3N70A 5EXPA 2WNSA 3ZU4A 4ID9A 3M3HA 3MMSA 2YN2A 2PUJA 5DHSA 5I4IA 3Q2IA 5FT9A 2HRCA 4QAJA 4Y6LA 3UBTA 4C2TA 4JMPA 2CV0A 1FP7A 1X80A 3OUTA 2OGSA 1MW8X 2O1SA 1IAQA 2CBXA 4Q7EA 1B73A 4TXMA 4UPDA 5LOVB 1AMNA 2PGOA 3ZGXA 3EZFA 1W2WB 1GZUA 1Q21A 4NBWA 1G2PA 4R98A 3NBAA 3GMTA 1NYLA 3OUUA 2FPGB 4NY1A 2YXEA 3AEUA 1HDIA 2WMNB 3GLIB 1VYUA 3JS5A 4RZ2A 4TKLA 1ZGHA 3S2IA 4F1WA 4RTLA 2A14A 3ZS9A 4U6SA 1SC4A 1QUFA 2R4UA 1I0IA 3IVMA 1M0EA 5KOHB 1VC2A 2EARA 2V6GA 3CRW1 1YDHA 4FFDA 4HZUB 3RFVA 4P6VF 3AFIA 1EFRA 4QUGA 2GCIA 2E1RA 2ZSFA 4S12A 3VVBA 1SUSA 4IDHA 4YJFB 4EUEA 3BBPA 4CV3A 1BDJA 4L3OA 4EKEA 2IS4A 4L4UA 4BNVA 5ALWA 1LPAB 3LWDA 4K9SA 3QTTA 5H80A 1ZDMA 3L4KA 1V3QE 2CEAA 2PSSA 4LHZA 4KX5A 4P3PA 1O9HA 4B3IA 1HETA 3DO8A 1N2OA 1PBNA 2O2IA 5DNVA 2I34A 5EIWA 1P2GA 1HTWA 2Q3LA 1E0SA 3N2IA 1QNFA 1FMJA 2O05A 1RIIA 4H6XA 2YFKA 1MFPA 1E2KA 1QYVA 3BDAA 3KX2A 2Q3MA 2ZYTX 4R1QA 5AUPB 4PLCA 1JQBA 5DWVA 4P3YA 4G9BA 1NT4A 2E4WA 4YBRA 3FDIA 1NUAA 2XNSA 1A8QA 5H7XA 3KUDA 3VZDA 3H1BA 4OMFG 1W87A 2BMDA 3DE1X 3DYIA 3HRHA 3L4BC 4OQNA 2CNOA 3DVAB 5EIBD 3VTZA 1J8QA 2NZUG 3CR8A 3TJZA 2QSUA 4CCYB 1QQAA 1ZM2A 1BE1A 3I9JA 1T0BA 1GCUA 1P3JA 3LBFA 3KQLA 1BD3A 2POCA 4S2EA 2HB6A 4ZAGA 3MAJA 1C0IA 1PS0A 2XYHA 3Q3HA 3WZMA 4F92B 4IWNA 3VKFA 1AV6A 3BMNB 3I2JA 1M5UA 2FEXA 1X77A 1OIXA 1U5BB 3IUNA 3Q1KA 2FSVC 4CIVA 1DT5A 1RDFA 4JD5A 2X9GA 3MPUA 2TMYA 4JLAA 5IABA 4R6WA 3VFDA 1JWBB 4JHLA 2QK4A 2A4KA 4E33A 4TV9B 5FTNA 3BRWA 1P0FA 3G0DA 3RODA 5ED4A 2JZNA 3LL4A 1TK3A 4U5XA 5CIWA 5D00A 4M60A 5B1EA 5AW2A 4JENA 3TL6A 2ORED 3G2LA 3LA8A 4RY2A 1GRNA 5AXCA 2PXHA 3I30X 4MW4A 3E61A 4Y6SA 2C92A 5C37A 4UNRA 1RPNA 3OY2A 3RRBA 3OAAA 2Q0QA 3OU2A 4WXMA 1LLCA 1S9DA 3EXFA 4GRAA 3JPYA 4EA7A 1IZZA 2VJAA 4AG3A 1QGUB 1I36A 4WPGA 3LUBA 1O5OA 4EJMA 1Y3CE 2PBLA 3DKIA 1Q1EA 2PSFA 2WB2A 4YRNA 4JV5B 1S02A 1S89A 3O2JA 3WGZA 4N41A 4RQTA 1ESZA 5LSAA 2VLBA 2WP8J 3D54D 2X6TA 1FZQA 3FVWA 1EFPA 4Y6QA 1A77A 6ADHA 2DFVA 2JLVA 5E0KB 2VPQA 4GYKA 1J5XA 3I1JA 5AJVB 4I99A 4ZQEA 3ESRA 5FIUA 4M49A 3F98A 1AO0A 3H16A 1T4MA 3GMDA 1XEAA 1UJ5A 3WOHA 5E7MA 4E31A 2QG6A 3A2MA 3L7DA 4QUDA 2Y9MB 2QG9A 2LGJA 5HIKA 4HUTA 1DFGA 1Q19A 3DG9A 1O95C 2Y0CA 1BOOA 3C5EA 1IWPB 3K0CC 1KK2A 1M9NA 1Y8RA 3V8PA 4DMRA 4RH3A 5FX2A 1KDRA 1UFOA 3SJ7A 4BO4A 3ESAA 1M1NA 4ROSA 1MVNA 2VAPA 1BE8A 4PAQA 1P7PA 3V4VB 3GELA 1QG2A 1OI7A 1YA6A 3AUKA 3T5PA 2F3QA 4CHTA 3KE9A 1Y4UA 2HCTA 3Q3EA 4M87A 3NC4A 4RIEA 2FRDC 1AURA 1YDGA 4WH0A 1NG1A 3B6EA 4JEMA 3A9UA 4FSHA 1I3NA 2EW8A 1EX1A 1NSYA 1WTAA 1P1RA 2ORVA 3IDQA 1ZPDA 1H1DA 5KQMA 1MDBA 3QVLA 3AEQA 4OQMA 1TK9A 1Y5MA 4PZPA 4BNJA 1HLFA 3MOIA 4TWIA 3FTCA 2JCVA 2J3HA 2V7WA 3BGWA 2EZ8A 2VT2A 2ZTUA 1RT9A 2WNHA 1G38A 3QKTA 2NUPB 3ZWBA 4YCLA 4OQLA 1VYVA 3ZVKA 3JR3A 4MUFA 2E18A 5JYCA 4RZIA 1NMEA 1W94A 1E2NA 1I1NA 4ZO8A 2I87A 4GSKA 4H1WA 5C1BA 4KPFC 4TZTA 5EWMB 2ZTHA 2OLKA 4IHQA 1CEEA 3H13A 3IPLA 2VZ0A 1CJCA 1U2PA 3KR9A 3OJCA 4LSWA 3ABIA 1XTQA 4KWCA 2D2EA 2WD8A 2ZP1A 4GOKA 4M0UA 1F38A 3KSDO 3Q15C 4UDNA 1ANKA 4CKEA 1JAXA 5LZ7A 1FDIA 3Q7PA 5JMPA 4K8RB 4BBPA 1GZDA 1N6KA 1ZRNA 2C9CA 2W6JA 1NMZA 2CLOB 1E60A 2KYRA 2ZCUA 3AZPA 4OB8A 4RAOA 4I4LA 3RG2A 1DUSA 2QR5A 3A9VA 2IYLD 2J3EA 1D03A 4JQSA 4FOLA 3EARA 2VT7A 4CL0A 4DUPA 4EG8A 1Z0AA 4FNMA 3TIVA 5SY6A 1A1SA 3LP6A 1NW5A 3SIXA 5M04A 1HFEL 1JB9A 4TLAA 1XB2A 1X1EA 1ZVQA 2YWFA 1XVUA 1ST2A 3PFGA 2BFCB 3LXMA 1R88A 4RNDB 4TMFA 5T4BA 3OOSA 1C3XA 1E9AA 2AWNA 2CV2A 4N6OA 1PW5A 4LOHA 2LNDA 1L7NA 3RIEA 1MMFB 1NRIA 5EE9A 2PN1A 3QX3A 2ZJYA 3WNCA 4DSUA 4AWXA 1XVVA 3IOMA 4Q9LA 4MV8A 3T61A 1ODIA 4J0FA 4K86A 4ZTZB 4QPDA 5JEEA 2FFJA 1SBZA 5IRCD 1DXYA 1A9XB 1UUFA 5FNVA 4IPTA 2GZSA 4DCCA 4V38A 5LD2C 5FYQA 1LKZA 5CTAA 1AS0A 1SCNE 1N5LA 2O2XA 4JJAA 4PY2A 4EG3A 5JQGA 3KQYA 1XCJA 3HV0A 4RM2A 3UAYA 1ST3A 2CYBA 1TQ4A 2PGJA 4ZEVA 3G0BA 1UFVA 5DISB 3I6MA 4D7AA 3RNOA 3RYHB 3U62A 4MRNA 3UAGA 3PF8A 1BJTA 3Q9NA 5DZSA 2VO1A 2XWBF 1XVIA 3DZJA 2QI9F 4PQFA 4OPMA 2E4ZA 4BFWA 1NBEA 5C51B 1P5HA 1B14A 4YECA 3PDUA 3WGTA 3O90A 1M1XB 5KMGA 2P2CA 4L5BA 1MAHA 1U1FA 4C0XA 2QTZA 3QVVA 3CCFA 4MLZA 4NH4A 2Z5LA 1IUPA 4P58A 2BEWB 2FG7C 3PR2B 4I5EA 2I3BA 3H75A 2QS9A 3KS9A 4O4JF 1YOVA 3AUFA 3GVPA 2YJNA 3IELA 4AJPA 5ICMA 4A6DA 4LZLA 3OJXA 2HA6A 3KZ1E 5CNMA 1N9GB 2ZQZA 1MZPA 3L0SA 4O4HF 4LJ6A 2VBGA 4CTNA 2B2NA 1YMVA 2O50A 2GTHA 1Y6ZA 2UZAA 4NCJA 4WEOA 4U4AA 4UUQA 4DFDA 1J56A 3LKZA 3FA2A 4E7OA 1CS0A 3FCCA 4KRGA 2Z8YA 4PEVA 4ARUA 4ZARA 4BFXA 1CR4A 1W48A 1EFTA 1WWKA 5A3RA 5GM1A 4LXGA 1QV6A 3RIHA 1YO6A 1JFFA 4HDNA 3R3HA 5BWOA 5K0GA 1DFIA 3V3TA 4ZHSA 4Q00A 2Y8EA 3UPDA 4D6YA 5IAEA 1EFCA 3NJ8A 4NOKA 2HQ1A 2IHVA 3F0TA 1WXDA 3IIJA 3M2TA 2I62A 3IERA 4MYRA 1VM6A 3Q5DA 4FNAA 1JHZA 4FZVA 4MV7A 2N46A 5EMKA 2FEKA 2AQIA 4CLOB 4IZHA 5LWQA 3ZK9A 5EMNA 3S29A 2YV3A 3WHIA 4F06A 4LMBA 5JV5A 1HYQA 1GSOA 3GDGA 4DILA 2Z2ZA 2R8OA 3WXBA 1Y7PA 3RARA 5KTPA 2VYVD 1QG4A 1OXKB 4DXHA 1K4MA 5EE0A 2OTCA 1RCUA 1X39A 3KKZA 3PNLA 5A6VA 1P4RA 2PMKA 2QQ0A 4EW2A 1SR8A 2JAXA 4CIAA 1FUEA 5L4LA 5AVYA 1VKOA 2GO7A 3HWRA 5CVVA 5EMJA 1KY2A 3UC9A 1A50B 2AOUA 1EWYA 2WFLB 3N2GB 3CEAA 3H2SA 3QKRA 4MCAA 3W0LB 2B3TA 3SSMA 2PT7A 4ZPJA 2HUPA 1M2VA 3ZG6A 3OEED 3KBOA 2FVYA 3O95A 4CCSA 4QDJA 1UJMA 3T5AA 4HDSB 3UK2A 4CEJA 3KEOA 2YBEA 1P4GA 3FPFA 3FI9A 3N6RA 2E21A 1K6JA 5D86A 3GNSA 4A8JB 4FBGA 2EQBA 2BMAA 3TLMA 1ZBQA 2HA0A 2PCJA 2YV2A 3EIFA 1CNEA 2AJLI 3H1PA 1B2RA 3PR3A 1YR2A 1PVDA 5DJ5A 4KQ9A 3H65A 1RLTA 1YZYA 4MV6A 4FE4A 4Q66C 5FBKA 1QOZA 3VYWA 2X9VA 4DWWA 1JEAA 1NRXA 1YC5A 2PVSA 2IYOA 1MAVA 4MVWA 3CNOA 4EI9A 4PPQA 1FPMA 2I4LA 5THQA 3RAFC 4QG3A 5IX8A 4L8LA 2FSGA 3WIUA 1QOQB 2H7YA 1EWVA 2K87A 4ZAXA 2RHHA 2IE0A 3NX4A 3EIUA 4HHEA 5DWQA 2PWBA 3H83A 1KE1A 3F97A 1N5KA 2DH6A 4RDCA 1JL3A 4DEYA 4WN3A 2AN3A 1AG9A 5EPUA 1QP4A 1SVMA 4Q48A 4KPEC 3FYHA 3ADCA 1W4CA 3SF8B 2B6HA 2CW5A 1RBMA 4NH0A 5ALVA 5J4YA 4OLFA 4ER3A 3VYTB 3S2ZA 4GFDA 5BO5A 2UVQA 1RAGA 4ZKEA 1NW9B 1H85A 2V4MA 4JI3B 4C0BA 4KE9A 1HYBA 3FSJX 3LGSA 5T4FA 1ZUWA 1JFLA 4YXFA 3QPVA 4HY3A 3AB8A 4K40A 3HYSA 1KFJB 3JTMA 2I9KA 3EGWA 4GRDA 2IEAA 2MSLA 1XBTA 3JAMA 5HQ3B 4G0XA 1CUEA 3H9CA 3OUZA 1Q91A 3WJ2A 3P9CA 1EMDA 1PD0A 4BRSA 1RABA 1SHUX 4D43A 5C4IA 2RGCA 2F9FA 4ZHQA 1O9GA 2IE8A 5KC9A 3CWQA 4JVSB 1ZEMA 2Q4RA 4BVHA 3V4RA 3F7MA 4N0MA 1DAEA 2HM7A 1L4EA 2PRKA 3WKCA 3C3JA 5F4BA 1OU0A 3UMJA 1U7WA 5CUQA 2C83A 4BV8A 2W48A 1IEQA 4HAYA 1TD1A 5I7OA 2CXPA 1OY1A 3BB1A 5AM2A 3TLXA 1BHSA 5GJWC 1F8FA 4JT2A 1GITA 4JLMA 2EGHA 5GINE 3FNEA 1CEYA 4XXHA 4AKTA 1F2DA 4WZBA 2HIMA 2W2QA 1AH2A 5I8ZA 3KU1A 4J1TC 4ONEA 5T4HA 2YY5A 1XF9A 2COUA 3B5IA 1O1YA 5I9BA 5AW9A 3VU0A 3W1EA 4POOA 4Z4IA 4CQNA 3QBDA 5EAIA 1KZ7B 1E1CB 1LK7A 2AMYA 3AGQA 2KWIA 3GAMA 3NHWA 5ICEA 5AVZA 1Z2DA 2VTEA 5KVAA 2YIMA 4CLDA 1EPUA 1PFKA 5FPPA 2H51A 1L5WA 1D2AA 3GPDG 1PFUA 3ZXUB 1OYYA 4P5DA 4RHXA 5SZIA 4J0GA 1K7EB 4YO8A 3INNA 1KI3A 3DXZA 1X1BA 2GZMA 1DHRA 2BT4A 1T1EA 3VDQA 3NBQA 2WFMA 3G7NA 1ZISA 3PC3A 4GXNA 3V80A 5HK9A 2JFQA 2I6TA 4XZ3A 5G0VA 3VZRA 2QENA 3LJKA 1E2JA 2V8OA 2O8NA 1J07A 2Z95A 3TSOA 1F7UA 5MGNA 2I4NA 4RD0A 3VR6A 1XPJA 4LYJA 3ZHRA 3AX6A 4DMUB 2FPWA 4MB2A 1EK2A 4GUDA 1R0ZA 2FR8C 3TLAA 3FOWA 5T5QA 1G3QA 1Z36A 1J2EA 1Q0ZA 2NV6A 3A6PC 4ARZB 6PFKA 1YIOA 3EG9B 5FL7D 4HFRA 4X7MA 5JDCA 3LCMA 2IBMA 4YX9A 3IE0A 3PC4A 2HMWA 3Q3CA 5E6RA 2CDCA 1RZVA 3ZDZB 1Z6PA 4HWOA 4EW1A 2BGTA 1WKCA 1O3YA 5CH8A 4ER7A 1D04A 3FG9A 3LVFO 4TKMA 4EDFA 4IILA 1DTWB 1TPZA 5EJAA 3A4IA 2FMTA 2NO9A 2IKSA 5HGJA 5CYFA 1G20E 1LWOA 2YVQA 1JTEA 4OA8A 3RASA 3ZWAA 3WB2A 3GJ8A 4PZAA 4WOJA 1OX5A 1NXTA 3VO9A 3Q87B 1QFJA 2EFCB 3ZE8A 3L8MA 5BSWA 4ZEMA 5K9ZA 2FW7A 2OCAA 1OAAA 3FVRA 4JLVA 4E0BA 4K46A 1RPJA 1FC0A 1RHMA 2GM9A 3CE9A 4UTNA 1LA2A 1TYEB