3DVWA

Crystal structure of reduced dsba1 from neisseria meningitidis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
PAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAHLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTAFDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Biochemical and structural study of the homologues of the thiol-disulfide oxidoreductase DsbA in Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Oxidoreductase
total genus 71
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dvwA00
3GN3A 4JEDA 5LCZA 1B4PA 1T8EB 3GFKA 1K3YA 2EIQA 3GIXA 1G0TA 3KGKA 2H74A 1ON4A 3US3A 1FHEA 1XXUA 1SL0B 2H8LA 2BTOT 4JBBA 4OD7A 1SJZA 3DEXA 5G5EA 1DE1A 2F8FA 3O3TA 1ACVA 5KN2A 4PQHA 3HHVA 4GSSA 2LJAA 2AAWA 2I4AA 4EL1A 3LSZA 4TR4A 4DSQA 14GSA 1Z7PA 2IMDA 5E59A 4LLRA 4PXOA 4GSTA 4MJCA 2C3TA 3ZLPA 2IMFA 4KE3A 4HS1A 3ZITA 1XZOA 2H75A 4AJ6A 1OVNA 2VCXA 4ML6A 4TXOB 6GSWA 4EDYA 4ZIJA 4ML1A 3F4TA 2NBSA 2MBSA 3PH9A 5ELGA 16GSA 2ES7A 4OFMA 3DIEA 3ERGA 3Q18A 2CAQA 4EF0A 5HR0A 4BA7A 1LU4A 3GNJA 2FHEA 2H70A 4MCUA 2WCIA 1SENA 2PVQA 2VCWA 1GNEA 4X43A 2JSYA 1H75A 2F3MA 5A4WA 4GQCA 3EYTA 3HJMA 1WIKA 2DC5A 3GTUB 3F6DA 6GSUA 5ECKB 1O8XA 5JWQB 4YQVA 2IL3A 2YWOA 1SJIA 1AC1A 3MDKA 3WYWA 4WF4A 1GNWA 1WP0A 4F82A 3IA1A 1OE8A 3ED3A 2F8AA 2VD0A 5HR3A 1XIYA 5J4UA 4TXOA 2YWNA 3D5JA 3VI5A 3VI7A 3TCOA 3GRXA 2IPAA 1GRXA 2BMXA 2LNTA 2LS5A 5CAXA 5KN3A 1E2YA 2E7PA 4ZL8A 1OE7A 5KN0A 4RI7A 4V2MA 1SL1B 1OC8A 1V2AA 4PNFA 2H73A 4WXTA 5ENUA 3TKSC 3EINA 1URMA 1U87A 2PMTA 2I9HA 5HQPA 3M0FA 5C00A 1GLPA 2OA7A 1RQMA 1Z5YE 1XWCA 3APSA 3GTUA 1A2JA 4GCIA 3L9UA 2G2QA 4HUAA 2RLIA 1EEMA 1RK4A 2WGRA 2L6DA 4JZQA 2JZSA 4RQRA 1PN9A 5CO3A 2QSIA 1A8YA 1UN2A 2LJKA 3E3EA 2H1AA 5EY6A 2EC4A 2OE0A 3FY7A 3FHKA 4MPGA 6GSSA 4HU7A 4NXIA 5F07A 3C1RA 2GZZA 5ECHB 3SWLA 1HNBA 4L0WA 1XOBA 2KHPA 4LA1A 3GKXA 4GXZA 3IPZA 1ZMAA 2XHFA 3EU4A 3ZVJA 1BYEA 3G7YA 5A4UA 1YZXA 1PD21 5GSSA 1PRXA 5E4WA 3DVXA 5ECLB 5ECSA 5JWOB 5DALB 3CSHA 4KGIA 1K0AA 1M2AA 5INYA 1QFNA 3C7MA 1TU7A 2H76A 2B7JA 4N10A 3E0UA 3O6TA 3P7XA 2LKUA 3EU3A 4V1Ag 3G7JA 5JWRB 4EE0A 5ECMB 1ZOFA 4OWYA 4O92A 4O7HA 2YOIA 3QAVA 4MA9A 1TK8B 3BCKA 5CRGA 1M9AA 1GLQA 4MZWA 1RW1A 4CW9A 3GURA 1PGTA 1UVZA 1O85A 2QGVA 4Q5QA 1BQ7A 3I6AA 5ECOB 3FK8A 1A0FA 2NPBA 4G2EA 3NZNA 1GUHA 2XPDA 5DALA 3KZQA 1G7OA 2FY6A 2D2ZA 3ZTLA 3KH7A 1K0OA 5J5NA 4EVMA 1B8XA 3UVHA 2HYXA 1SD9A 3WT1A 2E2GA 2O89A 3HA9A 3BJ5A 2R3XA 1GWCA 1PQNA 3ZREA 3HYPA 1SJ6A 2VCTA 1MDKA 1AW9A 4TVEA 5D9XA 1V58A 3P2AA 1B4QA 1TP9A 1BJXA 4BWQA 4Q5NA 1YJ6A 1IYIA 4F03A 1S3DA 1TI3A 5JCWA 3M8NA 7GSSA 4PNGA 4KCEA 4LL4B 3D6IA 4F9ZA 2WS2A 4X1UA 3I69A 1USBA 1XVQA 5C04A 1ZYQB 1VRSD 2TIRA 3I43A 4K0NA 4KCAA 2PUKC 4CHSA 4P3YB 4EUYA 4JE1A 2GSQA 3GKKA 4KX4A 5IMZA 1ERUA 4L5LA 3LQ7A 1QQ2A 4GRFA 3QMXA 2DIYA 3A3TA 2HI7A 3VK9A 1Z6MA 2EIOA 3F63A 1BAYA 2NVLA 5JCUA 1GSDA 1QUWA 3F0IA 2WB9A 1GSSA 1IYHA 2ZCTA 3K8NA 2JACA 1WPIA 3IRAA 3TOUA 1TI1A 4K8MA 2ALBA 2I81A 5IMFA 2C0FA 6GSYA 3CYNA 2FUG2 2PERA 2LJRA 5EPFA 10GSA 2OACA 3F8UA 3VWUA 1PL1A 1Z3EA 2GTUA 3EURA 4ZB9A 2MMZA 4IVFA 3ZIVA 1EEJA 1DE2A 4LMVA 1PMTA 1YKAA 3KXOA 4FYCA 4O32A 1T4ZA 3VFIA 4YAVA 3W6GA 2LSTA 2B5EA 3ZL5A 4K9ZA 3I9V2 4PGTA 2GSRA 2BJXA 3FZ5A 3NOFA 2H0HA 1GTIA 2CQ9A 4V2LA 2LQOA 1VF3A 1V9WA 1TDIA 1NW2A 1OC9B 5H5RA 1PX6A 1ERTA 2R2JA 4GWRA 3ZFBA 2FWGA 1FB0A 1XOAA 1EV4A 3KEBA 4XS4B 1F2EA 19GSA 1C72A 2K8SA 2L59A 2MMNA 2B1LA 5JCGA 3LJRA 1Z7RA 4MJBA 4I8BA 1XW6A 4HEA2 3D4TA 5J9CA 2GZYA 1CQHA 2HZEB 4JU5A 1WJKA 2YP6A 3H79A 2QKEA 1HYUA 3QR6A 2P5RA 4KNDA 4Q5FA 4NPBA 4BL7A 3APQA 1OC9A 1I9DA 1LJRA 2L4CA 3N5OA 4D73B 1G6YA 1VF2A 1EZKA 3IK7A 1R4WA 1YEXA 4KDYA 2LTKA 1X5EA 4XS1A 3VLNA 4MMMA 4MH3A 4MABA 4XS4A 5HFIA 1A0RP 2V1MA 1OKTA 1XCCA 2X8CA 2V41A 2H19A 4XRDA 5GSTA 4F0BA 3LXTA 1YF1A 2HZEA 4YAPA 3KCMA 3QCPA 3P8WA 1EP8A 1Q98A 4OO4A 4XRAA 2L5LA 4GTUA 3UOMA 1XWAA 2VLUA 1SKWB 4IP6A 1THOA 2C4JA 3TKQA 3QD9A 2F51A 4ECCA 4X0XA 4D73A 4NAXA 2DMMA 2HNLA 1X0RA 4J2FA 2VCZA 3F4SA 5DVBA 3AY8A 3CTGA 5GAND 3FYGA 2HFDA 4BVXA 1V40A 2IN3A 13GSA 5HFKA 1A2LA 1ERVA 2C3NA 4K7OA 20GSA 2YV9A 4NHZA 4PUFC 4L8EA 3M3MA 4ZL7A 3DD3A 3RPNA 2HE3A 5B6MA 4I2TA 5J3RA 3CMIA 4MF6A 2CVBA 3W8JA 2H30A 2PPTA 4OO5A 1F9MA 4ZL9A 2H6ZA 11GSA 5G31A 5LNKe 5D73A 6GSVA 2H0IA 5G30A 3IR4A 4WETA 2A2RA 2VCVA 1EV9A 3TGZA 3WGEA 4XHMA 1U88A 1TTZA 2GS3A 4KA0A 3FR9A 2LNSA 2H1GA 3JCML 1Y25A 4FYBA 1XPVA 1O81A 3GMFA 3QDNA 1WRYA 2FGXA 3CXGA 4HQSA 4LMWA 4L5OA 3EE2A 3LORA 2JL4A 3UAPA 5KEJA 3VPTA 5IMVA 5H5SA 4TR3A 4IW9A 1TRSA 2HXKA 2CA8A 2OE3A 4MZBA 2JU5A 5HR1A 2AB6A 3M1GA 2CVKA 5GZZB 4POKA 2HZFA 2LUSA 3FZAA 1LBKA 4KB3A 2R6KA 3ERWA 2PBJA 3EWLA 4N11A 2GQKA 2WDUA 1AQWA 5J9BA 2KLXA 3BOAA 2VLTA 2CX3A 3LYPA 2IIYA 3DYRA 3H8QA 3IC4A 1XWKA 3CRUA 4EC0A 1MDJA 4HZ4A 3GX8A 2XBQA 1KNGA 4EKZA 8GSSA 5D96A 1SKRB 2DIZA 3VWXA 1X9WB 5DCHA 1ABAA 3GL3A 3D0ZA 3BBYA 5IIZA 4I5QA 1TRWA 3L4NA 3APOA 2QC7A 1F3BA 1GSQA 3RHBA 2DMLA 1GSUA 5AIXA 3QOUA 3UIWA 4I6XA 2AV4A 2CT6A 4KW6A 3QFAC 4K1FA 3J7Yk 2VL3A 3ZFLA 1PA3A 1FW1A 5F06A 2O85A 5CRHA 4AJ8A 1SU9A 4MZCA 1ZGNA 4N0VA 5IMCA 2YWMA 2AJQB 2E0QA 2N5AA 1XBSA 2GQMA 4ECBA 3UJ1A 1A23A 3CSJA 4FO5A 3CRTA 3LFLA 2H71A 4FIWA 1GUKA 4HJMA 3QPMA 1B9XC 1O73A 2B1KA 2YJ7A 3WD6A 1EGOA 2DJ3A 2YV7A 1GSFA 1F37A 5F05A 3MNGA 4WR4A 3VWWA 2L5OA 2M46A 2H1BA 1A24A 4RQXA 5F8BA 1T7PB 4MLYA 3GHAA 3DKSA 1G7EA 3BCIA 2Z9SA 1SYRA 3FZ4A 4WEYA 1KBNA 3LXZA 2MZCA 2YANA 2VLVA 4MK3A 2AHEA 2H1DA 4IQ1A 3TRPA 3UARA 2M80A 3S9FA 5CNWA 1YDKA 3KTLA 2RM5A 2WZ9A 2KP1A 5IOXA 5DBQA 3QFBC 1GP1A 4F0CA 1GTBA 4HZ2A 2KOKA 4BWSA 2IFQB 1K3LA 1JZRA 2XC2A 3PR8A 2ZNMA 4IJ3A 3VWVA 4ZB8A 4KH7A 4RI6A 3ZIJA 4I97A 2FWHA 3FRCA 3Q74A 3WGDA 1EWXA 2GZPA 2JSZA 4K6XA 5F0GA 2H6YA 4HOJA 3R2QA 1PKZA 2H72A 2JZRA 1T4YA 3MWHA 3TDGA 1QXHA 2JZTA 1DSBA 4ZBBA 6GSTA 4QL9A 4O5RA 5G1LA 3HKRA 4IS0A 3H4KA 2I3YA 3H93A 1X5DA 4XIHA 3TKSA 1M2DA 2A2SA 1GSYA 3V1WA 3GKMA 2CZ3A 1THXA 3OR5A 2IFQA 1DBYA 2CAIA 3DGQA 6GSXA 5LD0A 1CQGA 4JR4A 4ULXA 1G6WA 2V32A 3HDCA 2KP2A 2WRTA 2VCQA 2VM2A 3BD2A 4JR6A 4OFTA 4Q5RA 1I5GA 4POLA 1JFUA 2IMEA 2WJUA 2HRNA 4FYUA 1MD3A 1TW9A 5FT3A 5IMDA 3MSZA 1Q4JA 2VIMA 3N9JA 1EP7A 4IKHA 4XS6A 2HSHA 3E9JB 5CREA 2YZUA 3ZZXA 1FO5A 3KJYA 1JZOA 5DAKB 1VF1A 3TUEA 1SK2A 2N5BA 3CTFA 2HLSA 3C73A 5D9WA 1ERWA 2DJJA 4MF5A 1T1VA 2MBTA 1J0FA 1TRVA 1QK8A 4DVCA 3DXBA 3HD5A 3G9BA 1MEKA 1U3IA 1A2MA 2A4VA 3GH6A 5DQSA 1SD8A 3KM6A 5IO0A 3TJFA 2P31A 4ACSA 3IXRA 4G19A 1U3AA 5ECPB 5KN1A 4ECIA 3FEUA 2HRFA 4EO3A 2KUCA 2I1UA 5DQYA 1XVWA 2FLSA 3IAM2 5DAKA 5DCGA 4FH8A 2O8VB 4DSSB 2B6MA 3IE3A 2YPMA 2GVPA 1OAZA 5B6NA 4TR0A 3QAWA 4IBPA 2VL2C 2GLRA 2DJ0A 2YN1A 1V57A 4LL1B 1GTAA 2XBIA 3PINA 1ILOA 3F6FA 5H5QA 3ISOA 2B5XA 1WE0A 5CRDA 2IMIA 3KIJA 5AN1A 1MD4A 2GQLA 3LGCA 2N5FA 1AAZA 5GAPD 3C1SA 3GSTA 5HR2A 4POMA 3UBLA 1XW5A 1OKDA 4WBJA 5CRWA 3KP8A 4PQ1A 2FA8A 5DDLA 4DSSA 2RUEA 5B7CA 2VO4A 3L9SA 1YF0A 2LRNA 1U6TA 2RM6A 3FW2A 3UL3A 4IJIA 1AQVA 5G2ZA 4MPFA 3O76A 3ZVJD 1K3OA 4E8EA 2FNOA 2TRXA 2DJ1A 1FVJA 3HXSA 4WBRD 3RPPA 3IV4A 5FWGA 3VPQA 1S3AA 3RHCA 5IPGA 4MF7A 1FAAA 5IOWA 2CX4A 1WMJA 2J23A 5AIVA 3NIVA 3GSSA 3P90A 4TR1B 4ECJA 3LG6A 2K18A 4KSOA 2DLXA 2VAFA 2FA4A 2LRTA 4ZB6A 1GUMA 2PN8A 1PL2A 3IAS2 4TW5A 1GL8A 3ZYWA 1KEBA 2IWTA 9GSSA 3ERFA 3HZ8A 3IHQA 5ECIB 3GH9A 2GT5A 4IGJA 2R4VA 4IHUA 4NHWA 3HVSA 1UA5A 1F6MC 5HFGA 4KAEA 1Z6NA 3HY2A 3L0HA 4NV2A 1TRUA 1R5PA 3A5WA 4ZXGA 4PX1A 1TK0B 1UC7A 2H6XA 3L78A 3HJPA 1MDIA 1SL2B 1N2AA 4HQZA 3ME7A 5G1KA 1X5CA 3RBTA 2IJYA 2C80A 4J57E 3Q6OA 1GH2A 4TR1A 4GQFA 3GYKA 2B5YA 1VGLA 2H0GA 3TB2A 4BVYA 1SK0A 1J9BA 4NV5A 3CSIA 2C0GA 1VF4A 3IK9A 5ABRA 4G9HA 4IN0A 1O8WA 3KD0A 5EL8A 1K0DA 2PWJA 4GLTA 1SYXA 2B7KA 4OFNA 1YY7A 3H1NA 2YJHA 1BEDA 5AISA 2M72A 4TKYA 4J56E 4HJ2A 4E8HA 2YCDA 3EVIA 2O87A 1PX7A 2FWEA 2FWFA 4QL7A 4RUVA 2GT6A 1JZWA 4GSNA 1BG5A 4NMUA 4QQ7A 4IELA 4IQAA 2P0GA 1OC3A 4JRRA 3FR6A 3LYKA 2AYTA 5A5KA 2YWIA 1N8JA 2X8GA 2VL2A 3TJBA 1FVKA 2LRCA 2PGTA 2RIIA 2C3QA 4MH2A 3GA4A 3U5RE 3CBUA 5AGYA 1TJDA 1WWJA 2LEGA 5D9TA 2R37A 3J7Yb 3EMXA 2K8VA 2TRCP 2YNXA 4MP4A 4BPYA 1O6JA 5DJLA 4KDXA 1T00A 4L0UA 3HVVA 1QMVA 3TJGA 1EOHA 4WF5A 2HT9A 12GSA 2X99A 2PVOC 1M99A 3KMNA 2EIRA 2NTOA 1HNAA 1HQOA 5IO2A 4KUNA 1OYJA 1AUCA 3RAZA 1GULA 1NSWA 3KH9A 18GSA 1H4OA 5ECQB 1M0UA 4F2IA 4ZILA 2DJKA 2OE1A 3ZRDA 2WFCA 5CYYA 1TU8A 1M2BA 2V6KA 2OBKA 4K7IA 1XWBA 4H86A 2F9SA 3MAKA 3TJKA 2AUVA 4YQUA 2MYGA 2X64A 2VUPA 5D93A 1AIUA 4K7NA 3LEFA 4WKWA 22GSA 4PQIA 5D8IA 1O7UA 4AF2A 2CV4A 4G10A 3UVTA 4HI7A 4XTSA 3WGXA 3TRXA 1HD2A 2OJLA 3HCZA 2VD1A 3EC3A 4V2NA 4PURA 2MMAA 3FZ9A 4ZBDA 5ECNB 3GKNA 5ID2B 5FHIA 5B8AA 1TK5B 3KTBA 3QAGA 1S3CA 2C1YA 4GF0A 5IMAA 3HVXA 3GL5A 1ZZYA 2OBIA 3FKFA 1ML6A 1K0CA 1SKSB 4KSMA 4YQMA 3F3QA 4ZBAA 1M9BA 4HU9A 3ME8A 3U6VA 1XWGA 3TRQA 1JLWA 2HSYA 4TOPA 3HZ4A 3D22A 2REMA 1HNCA 3HJOA 3ZMKA 1TKDB 4TRXA 1TOFA 2P5QA 2LV3A 4AJ7A 5ID2A 2MMOA 2X8HA 2CVDA 3ZMLA 2GDRA 2NDOA 3GV1A 2DSAA 4TXVA 5B8BA 2C0EA 5G5FA 4YH2A 4PUAA 3IBHA 1Y6EA 2OKAA 1B9YC 1SK1A 1J08A 1EGRA 4HDEA 1FG4A 3UBKA 2ZUPA 2DBCA 2V2GA 1W89A 2DJ2A 1EOGA 3EMPA 2GGTA 2GSTA 2VL9A 1GTUA 3VURA 1ST9A 1YKCA 1B48A 4OCFA 4EXJA 4K2DA 4N30A 2GSSA 3TKSE 4CDOA 1PSQA 3A2VA 3GX0A 3D4MA 1Z9HA 2WULA 3RDWA 5EVOA 1GSEA 1NM3A 2PU9C 5IQYA 3SBCA 2E2MA 1K0NA 2L57A 1TXXA 5ECRB 4ILFA 2OADA 1AXDA 2FCHA 1R5AA 4DSRA 4V1Ap 4OMVA 5COHA 2K9FA 1V98A 3F9UA 1YEPA 1JLVA 4K0GA 17GSA 2VM1A 4AGSA 1W4VA 4IP1A 5J41A 3L9VA 2R5GA 2LQQA 2XPEA 2H66A 1WOUA 3Q19A 4MDCA 1XFLA 1JHBA 1X9SB 4Z7XA 1YQ1A 3M9KA 2B3SA 2J9HA 2VOCA 2O7KA 1ZYEA 2YZHA 3KP9A 1JZDA 2ON5A 1FB6A 1A8LA 3DMLA 1FOVA 1QGVA 3M9JA 1KTEA 3D21A 3KMOA 1NHYA 4MJAA 3G7IA 5IM9A 2JADA 4MJEA 3DWVA 4N0ZA 3A2WA 5IPHA 1ZCPA 1ZL9A 2L6CA 2ON7A 4I2UA 1R7HA 1E6BA 4OCEA 3TOTA 2FD3A 1NHOA 4KDUA 3LWAA 3IOSA 2H01A 4XCSA 1F3AA 4NWYA 4DEJA 3FR3A 1DUGA 5CP1A 4EDZA 5ELAA 3C71A 1M7TA 1X9MB 1AQXA 2C8UA 2G0FA 1T3BA 4POBA 1K0MA 1K0BA 4WR5A 3TKRA 2V6OA 1BX9A 5DJMA 3C8EA 1R26A 2IMKA 3IDVA 3A2XA 3F3RA 3TJJA 3DRNA 1XW9A 3F4RA 3GUSA 2CZ2A 4TN8A 5L71A 3UMAA 4ISDA 3UEMA 1PKWA 5A4VA 4ID0A 5D9VA 2L4QA 3DVWA 3WT2A 1MTCA 3PGTA 2C0DA 3W8SA 3TKPA 2K6VA 2RUFA
chains in the Genus database with same CATH superfamily
3GN3A 4JEDA 5LCZA 1B4PA 1T8EB 3GFKA 1K3YA 2EIQA 3GIXA 1G0TA 3KGKA 2H74A 1ON4A 3US3A 1FHEA 1XXUA 2QA1A 1SL0B 2H8LA 2BTOT 4JBBA 4OD7A 1SJZA 3DEXA 5G5EA 1DE1A 2F8FA 3O3TA 1ACVA 5KN2A 4PQHA 3HHVA 4GSSA 2LJAA 2AAWA 2I4AA 4EL1A 3LSZA 4TR4A 4DSQA 14GSA 1Z7PA 2IMDA 5E59A 4LLRA 4PXOA 3EPTA 4GSTA 4MJCA 2C3TA 3ZLPA 2IMFA 4KE3A 4HS1A 3ZITA 1XZOA 2H75A 4AJ6A 1OVNA 2VCXA 4ML6A 4TXOB 6GSWA 4EDYA 4ZIJA 4ML1A 3F4TA 2NBSA 2MBSA 3PH9A 5ELGA 4CY8A 16GSA 2ES7A 4OFMA 3DIEA 3ERGA 3Q18A 2CAQA 4EF0A 5HR0A 4BA7A 1LU4A 3GNJA 2FHEA 2H70A 4MCUA 2WCIA 1SENA 2PVQA 2VCWA 1GNEA 3LW9A 4X43A 2JSYA 1H75A 2F3MA 5A4WA 4GQCA 3EYTA 3HJMA 1WIKA 2DC5A 3GTUB 3F6DA 6GSUA 5ECKB 1O8XA 5JWQB 4YQVA 2IL3A 2YWOA 1SJIA 1AC1A 3MDKA 3WYWA 4WF4A 1GNWA 1WP0A 4F82A 3IA1A 1OE8A 3ED3A 2F8AA 2VD0A 5HR3A 1XIYA 4O5UA 5J4UA 4TXOA 2YWNA 3D5JA 3VI5A 3VI7A 3TCOA 3GRXA 2IPAA 1GRXA 2BMXA 2LNTA 2LS5A 5CAXA 5KN3A 1E2YA 2E7PA 4ZL8A 1OE7A 5KN0A 2QA2A 4RI7A 4V2MA 1SL1B 1OC8A 1V2AA 4PNFA 4YKFA 2H73A 4WXTA 5ENUA 3TKSC 3EINA 1URMA 1U87A 2PMTA 2I9HA 5HQPA 3M0FA 5C00A 1GLPA 2OA7A 1RQMA 1Z5YE 1XWCA 3APSA 3GTUA 1A2JA 4GCIA 3L9UA 2G2QA 4HUAA 2RLIA 1EEMA 1RK4A 2WGRA 2L6DA 4JZQA 2JZSA 4RQRA 1PN9A 5CO3A 2QSIA 1A8YA 1UN2A 3FMWA 2LJKA 3E3EA 2H1AA 5EY6A 2EC4A 2OE0A 3FY7A 3FHKA 4MPGA 6GSSA 4HU7A 4NXIA 2HSMA 5F07A 3C1RA 2GZZA 5ECHB 3SWLA 1HNBA 4L0WA 1XOBA 2KHPA 4LA1A 3GKXA 1S3RA 4GXZA 3IPZA 1ZMAA 2XHFA 3EU4A 3ZVJA 1PN0A 3IHGA 1BYEA 3G7YA 5A4UA 1YZXA 3MIXA 1PD21 5GSSA 1PRXA 5E4WA 3DVXA 5ECLB 5ECSA 5JWOB 5DALB 3CSHA 3HVNA 4BIKA 4KGIA 1K0AA 1M2AA 5INYA 1QFNA 3C7MA 1TU7A 2H76A 2B7JA 4N10A 3E0UA 3O6TA 3P7XA 2LKUA 3EU3A 4V1Ag 3G7JA 5JWRB 4EE0A 5ECMB 1ZOFA 4OWYA 4O92A 4O7HA 2YOIA 3QAVA 4MA9A 1TK8B 3BCKA 5CRGA 1M9AA 1GLQA 4MZWA 1RW1A 4CW9A 3GURA 1PGTA 1UVZA 1O85A 2QGVA 4Q5QA 1BQ7A 3I6AA 3FK8A 5ECOB 1A0FA 2NPBA 4G2EA 3NZNA 1GUHA 2XPDA 5DALA 3KZQA 1G7OA 2FY6A 2D2ZA 3ZTLA 3KH7A 1K0OA 5J5NA 4EVMA 1M3IA 1B8XA 3UVHA 2HYXA 1SD9A 3WT1A 2E2GA 2O89A 3HA9A 3BJ5A 2R3XA 1GWCA 1PQNA 3ZREA 3HYPA 1SJ6A 2VCTA 1MDKA 1AW9A 4TVEA 5D9XA 1V58A 3P2AA 4KF9A 1B4QA 1TP9A 1BJXA 4BWQA 4Q5NA 1YJ6A 1IYIA 4F03A 1S3DA 1TI3A 5JCWA 3M8NA 7GSSA 4PNGA 4KCEA 4LL4B 3D6IA 4F9ZA 2WS2A 4X1UA 3I69A 1USBA 1XVQA 1M3JA 5C04A 1ZYQB 1VRSD 2TIRA 3I43A 2X49A 4K0NA 4KCAA 2PUKC 4CHSA 4P3YB 4EUYA 4JE1A 2GSQA 3GKKA 4KX4A 5IMZA 1ERUA 4L5LA 3LQ7A 1QQ2A 4GRFA 3QMXA 2DIYA 3A3TA 2HI7A 3VK9A 1Z6MA 2EIOA 3F63A 1BAYA 2NVLA 5JCUA 1GSDA 1QUWA 3F0IA 2WB9A 1GSSA 1IYHA 2ZCTA 3K8NA 2JACA 1WPIA 3IRAA 3TOUA 1TI1A 4K8MA 2ALBA 2I81A 5IMFA 2C0FA 6GSYA 4USSA 3CYNA 2FUG2 2PERA 2LJRA 5EPFA 10GSA 2OACA 3F8UA 3VWUA 1PL1A 1Z3EA 2GTUA 3EURA 4ZB9A 2MMZA 4IVFA 3ZIVA 1EEJA 1DE2A 4LMVA 1PMTA 1YKAA 3KXOA 4FYCA 4O32A 1T4ZA 3VFIA 4YAVA 3W6GA 2LSTA 2B5EA 3ZL5A 4K9ZA 3I9V2 4PGTA 2GSRA 2BJXA 3FZ5A 3NOFA 2H0HA 1GTIA 4BL7B 2CQ9A 4V2LA 2LQOA 1VF3A 1V9WA 1TDIA 1NW2A 1OC9B 5H5RA 1PX6A 1ERTA 2R2JA 4GWRA 3ZFBA 2A4HA 2FWGA 1FB0A 1XOAA 1EV4A 3KEBA 4XS4B 1F2EA 19GSA 1C72A 2K8SA 2L59A 4CY6A 2MMNA 2B1LA 5JCGA 3LJRA 1Z7RA 4MJBA 4I8BA 1XW6A 4HEA2 3D4TA 5J9CA 2GZYA 1CQHA 2HZEB 4JU5A 1WJKA 4G0KA 2YP6A 3H79A 2QKEA 1HYUA 3QR6A 2P5RA 4KNDA 4Q5FA 4NPBA 4BL7A 3APQA 1OC9A 1I9DA 1LJRA 2L4CA 3N5OA 4D73B 1G6YA 1VF2A 1EZKA 3IK7A 1R4WA 1YEXA 4KDYA 2LTKA 1X5EA 4XS1A 3VLNA 4MMMA 4MH3A 4MABA 4XS4A 5HFIA 1A0RP 4BVXB 2V1MA 1OKTA 1XCCA 2X8CA 2V41A 2H19A 4XRDA 5GSTA 4F0BA 3LXTA 1YF1A 2HZEA 4YAPA 3KCMA 3QCPA 3P8WA 1EP8A 1Q98A 4OO4A 4XRAA 2L5LA 4GTUA 3UOMA 1XWAA 2VLUA 1SKWB 4IP6A 1THOA 2C4JA 3TKQA 3QD9A 2F51A 4ECCA 4X0XA 4D73A 4NAXA 2DMMA 2HNLA 1X0RA 3R3EA 4J2FA 2VCZA 3F4SA 5DVBA 3AY8A 3CTGA 5GAND 3FYGA 2HFDA 4BVXA 1V40A 5BMUA 2IN3A 13GSA 5HFKA 1A2LA 1ERVA 2C3NA 4K7OA 20GSA 2YV9A 4NHZA 4PUFC 4L8EA 3M3MA 4ZL7A 3DD3A 3RPNA 2HE3A 2HRAA 4YKGA 5B6MA 4I2TA 5J3RA 3CMIA 4MF6A 2CVBA 3W8JA 2H30A 2PPTA 4OO5A 1F9MA 4ZL9A 2H6ZA 11GSA 5G31A 5LNKe 5D73A 6GSVA 2H0IA 5G30A 3IR4A 4WETA 2A2RA 2VCVA 1EV9A 3TGZA 3WGEA 4XHMA 1U88A 1TTZA 2GS3A 4KA0A 3FR9A 2LNSA 2H1GA 3JCML 1Y25A 4X4JA 4FYBA 1XPVA 1O81A 3GMFA 3QDNA 1WRYA 4O5QA 2FGXA 3CXGA 4MNNA 4HQSA 4LMWA 4L5OA 3EE2A 3LORA 2JL4A 3UAPA 5KEJA 3VPTA 5IMVA 5H5SA 5KOWA 4TR3A 4IW9A 1TRSA 2HXKA 2CA8A 2OE3A 4MZBA 2JU5A 5HR1A 2AB6A 3M1GA 2CVKA 5GZZB 4POKA 2HZFA 2LUSA 3FZAA 1LBKA 4KB3A 2R6KA 3ERWA 2PBJA 3EWLA 4N11A 2GQKA 2WDUA 1AQWA 5J9BA 2KLXA 3BOAA 2VLTA 2CX3A 3LYPA 2IIYA 3DYRA 3H8QA 3IC4A 1XWKA 3CRUA 4EC0A 1MDJA 4HZ4A 5KOXA 3GX8A 2XBQA 1KNGA 4EKZA 8GSSA 5D96A 1SKRB 2DIZA 3VWXA 1X9WB 5DCHA 1ABAA 3GL3A 3D0ZA 3BBYA 5IIZA 4I5QA 1TRWA 3L4NA 3APOA 2QC7A 1F3BA 1GSQA 3RHBA 2DMLA 1GSUA 5AIXA 3QOUA 3UIWA 4I6XA 2AV4A 2CT6A 4KW6A 3QFAC 4K1FA 3J7Yk 2VL3A 3ZFLA 1PA3A 1FW1A 1PFOA 5F06A 2O85A 5CRHA 4AJ8A 1SU9A 4MZCA 1ZGNA 4N0VA 5IMCA 2YWMA 2AJQB 2E0QA 2N5AA 1XBSA 2GQMA 4ECBA 3UJ1A 1A23A 3CSJA 4FO5A 3CRTA 3LFLA 2H71A 4FIWA 1GUKA 4HJMA 3QPMA 1B9XC 1O73A 2B1KA 2YJ7A 3WD6A 1EGOA 2DJ3A 2YV7A 1GSFA 1F37A 5F05A 3MNGA 4WR4A 3VWWA 2L5OA 2M46A 2H1BA 1A24A 4RQXA 5F8BA 1T7PB 4MLYA 3GHAA 3DKSA 1G7EA 3BCIA 2Z9SA 1SYRA 3FZ4A 4WEYA 1KBNA 3LXZA 2MZCA 2YANA 2VLVA 4MK3A 2AHEA 2H1DA 4IQ1A 3TRPA 3UARA 2M80A 3S9FA 5CNWA 1YDKA 3KTLA 2RM5A 2WZ9A 2KP1A 5IOXA 5DBQA 3QFBC 1GP1A 4F0CA 1GTBA 4HZ2A 2KOKA 4BWSA 2IFQB 1K3LA 1JZRA 2XC2A 3PR8A 2ZNMA 4IJ3A 3VWVA 4ZB8A 4KH7A 4RI6A 3ZIJA 4I97A 2FWHA 3FRCA 3Q74A 3WGDA 1EWXA 2GZPA 2JSZA 4K6XA 5F0GA 2H6YA 4HOJA 3R2QA 1PKZA 2H72A 2JZRA 1T4YA 3MWHA 3TDGA 1QXHA 2JZTA 1DSBA 4ZBBA 6GSTA 4QL9A 4O5RA 5G1LA 2R0CA 2R0PA 3HKRA 4IS0A 3H4KA 2I3YA 3H93A 1X5DA 4XIHA 3TKSA 1M2DA 2A2SA 1GSYA 3V1WA 3GKMA 2CZ3A 1THXA 3OR5A 2IFQA 1DBYA 2CAIA 3DGQA 6GSXA 5LD0A 1CQGA 4JR4A 4ULXA 1G6WA 2V32A 3HDCA 2KP2A 2WRTA 2VCQA 2VM2A 3BD2A 4JR6A 4OFTA 4Q5RA 1I5GA 4POLA 1JFUA 2IMEA 2WJUA 2HRNA 4FYUA 1MD3A 1TW9A 5FT3A 5IMDA 3MSZA 1Q4JA 2VIMA 4G0LA 3N9JA 1EP7A 4IKHA 4XS6A 2HSHA 3E9JB 5CREA 2YZUA 3ZZXA 1FO5A 3KJYA 1JZOA 5DAKB 1VF1A 3TUEA 1SK2A 2N5BA 3CTFA 2HLSA 3C73A 5D9WA 1ERWA 2DJJA 4MF5A 1T1VA 2MBTA 1J0FA 1TRVA 1QK8A 4DVCA 1ZYPA 3DXBA 3HD5A 3G9BA 1MEKA 1U3IA 1A2MA 2A4VA 3GH6A 5DQSA 1SD8A 3KM6A 5IO0A 3TJFA 2P31A 4ACSA 3IXRA 4G19A 1U3AA 5ECPB 5KN1A 4ECIA 3A5IA 3FEUA 2HRFA 4EO3A 2KUCA 2I1UA 5DQYA 1XG8A 1XVWA 2FLSA 3IAM2 5DAKA 5DCGA 4FH8A 2O8VB 4DSSB 2B6MA 3IE3A 2YPMA 2GVPA 1OAZA 5B6NA 4TR0A 3QAWA 4IBPA 2VL2C 4ICYA 2GLRA 2DJ0A 2YN1A 1V57A 4LL1B 1GTAA 2XBIA 3PINA 1ILOA 3F6FA 5H5QA 3ISOA 2B5XA 1WE0A 5CRDA 2IMIA 3KIJA 5AN1A 1MD4A 2GQLA 3LGCA 2N5FA 1AAZA 5GAPD 3C1SA 3GSTA 5HR2A 4POMA 3UBLA 1XW5A 4EIPA 1OKDA 4WBJA 5CRWA 3KP8A 2X4AA 4PQ1A 2FA8A 5DDLA 4DSSA 2RUEA 5B7CA 2VO4A 3L9SA 1YF0A 2LRNA 1U6TA 2RM6A 3FW2A 3UL3A 4IJIA 1AQVA 5G2ZA 4MPFA 3O76A 3ZVJD 1K3OA 4E8EA 2FNOA 2TRXA 2DJ1A 1FVJA 3HXSA 4WBRD 3RPPA 3IV4A 5FWGA 3VPQA 1S3AA 3RHCA 5IPGA 4MF7A 4EIQA 1FAAA 5IOWA 2CX4A 1WMJA 2J23A 5AIVA 3NIVA 3GSSA 3P90A 4TR1B 4ECJA 3LG6A 2K18A 4KSOA 4BVYB 2DLXA 2VAFA 2FA4A 5BRTA 2LRTA 4ZB6A 1GUMA 2PN8A 1PL2A 3IAS2 4TW5A 1GL8A 3ZYWA 1KEBA 2IWTA 4FQUA 9GSSA 3ERFA 3HZ8A 3IHQA 5ECIB 3GH9A 2GT5A 4IGJA 2R4VA 4IHUA 4NHWA 3HVSA 1UA5A 1F6MC 5HFGA 4KAEA 1Z6NA 3HY2A 3L0HA 4NV2A 1TRUA 1R5PA 3A5WA 4ZXGA 4PX1A 1TK0B 1UC7A 2H6XA 3L78A 3HJPA 1MDIA 1SL2B 1N2AA 4HQZA 3ME7A 5G1KA 1X5CA 3RBTA 2IJYA 2C80A 4J57E 3Q6OA 1GH2A 4TR1A 4GQFA 3GYKA 2B5YA 1VGLA 2H0GA 3TB2A 4BVYA 1SK0A 1J9BA 4NV5A 3CSIA 2C0GA 1VF4A 3IK9A 5ABRA 4G9HA 4IN0A 1O8WA 3KD0A 5EL8A 1K0DA 2PWJA 4GLTA 1SYXA 2B7KA 4OFNA 1YY7A 3H1NA 2YJHA 1BEDA 5AISA 2M72A 4TKYA 4J56E 4HJ2A 4E8HA 2YCDA 3EVIA 2O87A 1PX7A 2FWEA 2FWFA 2R0GA 4QL7A 4RUVA 2GT6A 1JZWA 4GSNA 1BG5A 4NMUA 4QQ7A 4IELA 4IQAA 2P0GA 1OC3A 4JRRA 3FR6A 3LYKA 2AYTA 5A5KA 2YWIA 1N8JA 2X8GA 2VL2A 3TJBA 1FVKA 2LRCA 2PGTA 2RIIA 2C3QA 4MH2A 3GA4A 3U5RE 3CBUA 5AGYA 1TJDA 1WWJA 2LEGA 5D9TA 2R37A 3J7Yb 3EMXA 2K8VA 2TRCP 2YNXA 4MP4A 4BPYA 1O6JA 5DJLA 4KDXA 1T00A 4L0UA 3HVVA 1QMVA 3TJGA 1EOHA 4WF5A 2HT9A 12GSA 3CQFA 2X99A 2PVOC 1M99A 3KMNA 2EIRA 2NTOA 1HNAA 1HQOA 5IO2A 4KUNA 1OYJA 1AUCA 4A5PA 3RAZA 1GULA 1NSWA 3KH9A 18GSA 1H4OA 5ECQB 1M0UA 4F2IA 4K5SA 4ZILA 2DJKA 2OE1A 3ZRDA 2WFCA 5CYYA 1TU8A 1M2BA 2V6KA 2OBKA 4K7IA 1XWBA 4H86A 2F9SA 3MAKA 3TJKA 2AUVA 4YQUA 2MYGA 2X64A 2VUPA 5D93A 1AIUA 4K7NA 3LEFA 4WKWA 22GSA 4PQIA 5D8IA 1O7UA 4AF2A 2CV4A 4G10A 3UVTA 4HI7A 4XTSA 3WGXA 3TRXA 1HD2A 2OJLA 1FOHA 2DKIA 3HCZA 2VD1A 3EC3A 4V2NA 4PURA 2MMAA 3FZ9A 4ZBDA 5ECNB 3GKNA 5ID2B 1ZYNA 5FHIA 5B8AA 1TK5B 3KTBA 3QAGA 1S3CA 2C1YA 4GF0A 5IMAA 3HVXA 3GL5A 1ZZYA 2OBIA 3FKFA 1ML6A 1K0CA 1SKSB 4KSMA 4YQMA 3F3QA 4ZBAA 1M9BA 4HU9A 3ME8A 3U6VA 1XWGA 3TRQA 1JLWA 2HSYA 4TOPA 3HZ4A 3D22A 2UZ8A 2REMA 1HNCA 3HJOA 3ZMKA 1TKDB 4TRXA 4HSCX 1TOFA 2P5QA 2LV3A 4AJ7A 5ID2A 2MMOA 2X8HA 2CVDA 3ZMLA 2GDRA 2NDOA 3GV1A 2DSAA 4TXVA 2A2PA 2C0EA 5B8BA 5G5FA 4YH2A 4PUAA 3IBHA 1Y6EA 2OKAA 1B9YC 1SK1A 1J08A 1EGRA 4HDEA 1FG4A 3UBKA 4Z2UA 2ZUPA 2DBCA 2V2GA 1W89A 2DJ2A 1EOGA 3EMPA 2GGTA 2GSTA 4G0IA 2VL9A 1GTUA 3VURA 1ST9A 1YKCA 1B48A 4OCFA 4EXJA 4K2DA 4N30A 2GSSA 3TKSE 4CDOA 1PSQA 3A2VA 4Z2RA 3GX0A 3D4MA 1Z9HA 2WULA 3RDWA 5EVOA 1GSEA 1NM3A 2PU9C 5IQYA 3SBCA 2E2MA 1K0NA 2L57A 1TXXA 3PPUA 5ECRB 4ILFA 2OADA 1AXDA 2FCHA 1R5AA 4K5RA 4DSRA 4V1Ap 4OMVA 5COHA 4K2XA 2K9FA 1V98A 3F9UA 1YEPA 1JLVA 4K0GA 17GSA 2VM1A 4AGSA 1W4VA 4IP1A 5J41A 3L9VA 2R5GA 2LQQA 2XPEA 2H66A 1WOUA 3Q19A 4MDCA 1XFLA 1JHBA 1X9SB 4Z7XA 1YQ1A 3M9KA 4Z2TA 2B3SA 2J9HA 2VOCA 2O7KA 1ZYEA 2YZHA 3KP9A 1JZDA 2ON5A 1FB6A 1A8LA 3DMLA 1FOVA 1QGVA 3M9JA 1KTEA 3D21A 3KMOA 2DKHA 1NHYA 4MJAA 3G7IA 5IM9A 2JADA 4MJEA 3DWVA 4N0ZA 3A2WA 5IPHA 1ZCPA 1ZL9A 2L6CA 2ON7A 3MYDA 4I2UA 1R7HA 1E6BA 4OCEA 3TOTA 2FD3A 1NHOA 4KDUA 3LWAA 3IOSA 2H01A 4XCSA 1F3AA 4NWYA 4DEJA 3FR3A 1DUGA 5CP1A 4EDZA 5ELAA 3C71A 1M7TA 1X9MB 1AQXA 2C8UA 2G0FA 1T3BA 4POBA 1K0MA 1K0BA 4WR5A 3TKRA 2V6OA 1BX9A 5DJMA 3IC8A 3C8EA 1R26A 2IMKA 3IDVA 3A2XA 3F3RA 3TJJA 3DRNA 1XW9A 3F4RA 3GUSA 2CZ2A 2HRKA 4TN8A 5L71A 3UMAA 4ISDA 3UEMA 1PKWA 5A4VA 4ID0A 5D9VA 2L4QA 3DVWA 3WT2A 1MTCA 3PGTA 4PTSA 2C0DA 3W8SA 3TKPA 2K6VA 2RUFA
chains in the Genus database with same CATH topology
3GN3A 4JEDA 5LCZA 1B4PA 1T8EB 3GFKA 1K3YA 2EIQA 3GIXA 1G0TA 3KGKA 2H74A 1ON4A 3US3A 1FHEA 1XXUA 2QA1A 1SL0B 2H8LA 2BTOT 4JBBA 4OD7A 1SJZA 3DEXA 5G5EA 1DE1A 2F8FA 3O3TA 1ACVA 5KN2A 4PQHA 3HHVA 4GSSA 2LJAA 2AAWA 2I4AA 4EL1A 3LSZA 4TR4A 4DSQA 14GSA 1Z7PA 2IMDA 5E59A 4LLRA 4PXOA 3EPTA 4GSTA 4MJCA 2C3TA 3ZLPA 2IMFA 4KE3A 4HS1A 3ZITA 1XZOA 2H75A 4AJ6A 1OVNA 2VCXA 4ML6A 4TXOB 6GSWA 4EDYA 4ZIJA 4ML1A 3F4TA 2NBSA 2MBSA 3PH9A 5ELGA 4CY8A 16GSA 2ES7A 4OFMA 3DIEA 3ERGA 3Q18A 2CAQA 4EF0A 5HR0A 4BA7A 1LU4A 3GNJA 2FHEA 2H70A 4MCUA 2WCIA 1SENA 2PVQA 2VCWA 1GNEA 3LW9A 4X43A 2JSYA 1H75A 2F3MA 5A4WA 4GQCA 3EYTA 3HJMA 1WIKA 2DC5A 3GTUB 3F6DA 6GSUA 5ECKB 1O8XA 5JWQB 4YQVA 2IL3A 2YWOA 1SJIA 1AC1A 3MDKA 3WYWA 4WF4A 1GNWA 1WP0A 4F82A 3IA1A 1OE8A 3ED3A 2F8AA 2VD0A 5HR3A 1XIYA 4O5UA 5J4UA 4TXOA 2YWNA 3D5JA 3VI5A 3VI7A 3TCOA 3GRXA 2IPAA 1GRXA 2BMXA 2LNTA 2LS5A 5CAXA 5KN3A 1E2YA 2E7PA 4ZL8A 1OE7A 5KN0A 2QA2A 4RI7A 4V2MA 1SL1B 1OC8A 1V2AA 4PNFA 4YKFA 2H73A 4WXTA 5ENUA 3TKSC 3EINA 1URMA 1U87A 2PMTA 2I9HA 5HQPA 3M0FA 5C00A 1GLPA 2OA7A 1RQMA 1Z5YE 1XWCA 3APSA 3GTUA 1A2JA 4GCIA 3L9UA 2G2QA 4HUAA 2RLIA 1EEMA 1RK4A 2WGRA 2L6DA 4JZQA 2JZSA 4RQRA 1PN9A 5CO3A 2QSIA 1A8YA 1UN2A 3FMWA 2LJKA 3E3EA 2H1AA 5EY6A 2EC4A 2OE0A 3FY7A 3FHKA 4MPGA 6GSSA 4HU7A 4NXIA 2HSMA 5F07A 3C1RA 2GZZA 5ECHB 3SWLA 1HNBA 4L0WA 1XOBA 2KHPA 4LA1A 3GKXA 4GXZA 3IPZA 1ZMAA 2XHFA 3EU4A 3ZVJA 1PN0A 3IHGA 1BYEA 3G7YA 5A4UA 1YZXA 3MIXA 1PD21 5GSSA 1PRXA 5E4WA 3DVXA 5ECLB 5ECSA 5JWOB 5DALB 3CSHA 4KGIA 1K0AA 1M2AA 5INYA 1QFNA 3C7MA 1TU7A 2H76A 2B7JA 4N10A 3E0UA 3O6TA 3P7XA 2LKUA 3EU3A 4V1Ag 3G7JA 5JWRB 4EE0A 5ECMB 1ZOFA 4OWYA 4O92A 4O7HA 2YOIA 3QAVA 4MA9A 1TK8B 3BCKA 5CRGA 1M9AA 1GLQA 4MZWA 1RW1A 4CW9A 3GURA 1PGTA 1UVZA 1O85A 2QGVA 4Q5QA 1BQ7A 3I6AA 3FK8A 5ECOB 1A0FA 2NPBA 4G2EA 3NZNA 1GUHA 2XPDA 5DALA 3KZQA 1G7OA 2FY6A 2D2ZA 3ZTLA 3KH7A 1K0OA 5J5NA 4EVMA 1B8XA 3UVHA 2HYXA 1SD9A 3WT1A 2E2GA 2O89A 3HA9A 3BJ5A 2R3XA 1GWCA 1PQNA 3ZREA 3HYPA 1SJ6A 2VCTA 1MDKA 1AW9A 4TVEA 5D9XA 1V58A 3P2AA 4KF9A 1B4QA 1TP9A 1BJXA 4BWQA 4Q5NA 1YJ6A 1IYIA 4F03A 1S3DA 1TI3A 5JCWA 3M8NA 7GSSA 4PNGA 4KCEA 4LL4B 3D6IA 4F9ZA 2WS2A 4X1UA 3I69A 1USBA 1XVQA 5C04A 1ZYQB 1VRSD 2TIRA 3I43A 2X49A 4K0NA 4KCAA 2PUKC 4CHSA 4P3YB 4EUYA 4JE1A 2GSQA 3GKKA 4KX4A 5IMZA 1ERUA 4L5LA 3LQ7A 1QQ2A 4GRFA 3QMXA 2DIYA 3A3TA 2HI7A 3VK9A 1Z6MA 2EIOA 3F63A 1BAYA 2NVLA 5JCUA 1GSDA 1QUWA 3F0IA 2WB9A 1GSSA 1IYHA 2ZCTA 3K8NA 2JACA 1WPIA 3IRAA 3TOUA 1TI1A 4K8MA 2ALBA 2I81A 5IMFA 2C0FA 6GSYA 4USSA 3CYNA 2FUG2 2PERA 2LJRA 5EPFA 10GSA 2OACA 3F8UA 3VWUA 1PL1A 1Z3EA 2GTUA 3EURA 4ZB9A 2MMZA 4IVFA 3ZIVA 1EEJA 1DE2A 4LMVA 1PMTA 1YKAA 3KXOA 4FYCA 4O32A 1T4ZA 3VFIA 4YAVA 3W6GA 2LSTA 2B5EA 3ZL5A 4K9ZA 3I9V2 4PGTA 2GSRA 2BJXA 3FZ5A 3NOFA 2H0HA 1GTIA 4BL7B 2CQ9A 4V2LA 2LQOA 1VF3A 1V9WA 1TDIA 1NW2A 1OC9B 5H5RA 1PX6A 1ERTA 2R2JA 4GWRA 3ZFBA 2A4HA 2FWGA 1FB0A 1XOAA 1EV4A 3KEBA 4XS4B 1F2EA 19GSA 1C72A 2K8SA 2L59A 4CY6A 2MMNA 2B1LA 5JCGA 3LJRA 1Z7RA 4MJBA 4I8BA 1XW6A 4HEA2 3D4TA 5J9CA 2GZYA 1CQHA 2HZEB 4JU5A 1WJKA 4G0KA 2YP6A 3H79A 2QKEA 1HYUA 3QR6A 2P5RA 4KNDA 4Q5FA 4NPBA 4BL7A 3APQA 1OC9A 1I9DA 1LJRA 2L4CA 3N5OA 4D73B 1G6YA 1VF2A 1EZKA 3IK7A 1R4WA 1YEXA 4KDYA 2LTKA 1X5EA 4XS1A 3VLNA 4MMMA 4MH3A 4MABA 4XS4A 5HFIA 1A0RP 4BVXB 2V1MA 1OKTA 1XCCA 2X8CA 2V41A 2H19A 4XRDA 5GSTA 4F0BA 3LXTA 1YF1A 2HZEA 4YAPA 3KCMA 3QCPA 3P8WA 1EP8A 1Q98A 4OO4A 4XRAA 2L5LA 4GTUA 3UOMA 1XWAA 2VLUA 1SKWB 4IP6A 1THOA 2C4JA 3TKQA 3QD9A 2F51A 4ECCA 4X0XA 4D73A 4NAXA 2DMMA 2HNLA 1X0RA 3R3EA 4J2FA 2VCZA 3F4SA 5DVBA 3AY8A 3CTGA 5GAND 3FYGA 2HFDA 4BVXA 1V40A 5BMUA 2IN3A 13GSA 5HFKA 1A2LA 1ERVA 2C3NA 4K7OA 20GSA 2YV9A 4NHZA 4PUFC 4L8EA 3M3MA 4ZL7A 3DD3A 3RPNA 2HE3A 2HRAA 4YKGA 5B6MA 4I2TA 5J3RA 3CMIA 4MF6A 2CVBA 3W8JA 2H30A 2PPTA 4OO5A 1F9MA 4ZL9A 2H6ZA 11GSA 5G31A 5LNKe 5D73A 6GSVA 2H0IA 5G30A 3IR4A 4WETA 2A2RA 2VCVA 1EV9A 3TGZA 3WGEA 4XHMA 1U88A 1TTZA 2GS3A 4KA0A 3FR9A 2LNSA 2H1GA 3JCML 1Y25A 4X4JA 4FYBA 1XPVA 1O81A 3GMFA 3QDNA 1WRYA 4O5QA 2FGXA 3CXGA 4MNNA 4HQSA 4LMWA 4L5OA 3EE2A 3LORA 2JL4A 3UAPA 5KEJA 3VPTA 5IMVA 5H5SA 5KOWA 4TR3A 4IW9A 1TRSA 2HXKA 2CA8A 2OE3A 4MZBA 2JU5A 5HR1A 2AB6A 3M1GA 2CVKA 5GZZB 4POKA 2HZFA 2LUSA 3FZAA 1LBKA 4KB3A 2R6KA 3ERWA 2PBJA 3EWLA 4N11A 2GQKA 2WDUA 1AQWA 5J9BA 2KLXA 3BOAA 2VLTA 2CX3A 3LYPA 2IIYA 3DYRA 3H8QA 3IC4A 1XWKA 3CRUA 4EC0A 1MDJA 4HZ4A 5KOXA 3GX8A 2XBQA 1KNGA 4EKZA 8GSSA 5D96A 1SKRB 2DIZA 3VWXA 1X9WB 5DCHA 1ABAA 3GL3A 3D0ZA 3BBYA 5IIZA 4I5QA 1TRWA 3L4NA 3APOA 2QC7A 1F3BA 1GSQA 3RHBA 2DMLA 1GSUA 5AIXA 3QOUA 3UIWA 4I6XA 2AV4A 2CT6A 4KW6A 3QFAC 4K1FA 3J7Yk 2VL3A 3ZFLA 1PA3A 1FW1A 5F06A 2O85A 5CRHA 4AJ8A 1SU9A 4MZCA 1ZGNA 4N0VA 5IMCA 2YWMA 2AJQB 2E0QA 2N5AA 1XBSA 2GQMA 4ECBA 3UJ1A 1A23A 3CSJA 4FO5A 3CRTA 3LFLA 2H71A 4FIWA 1GUKA 4HJMA 3QPMA 1B9XC 1O73A 2B1KA 2YJ7A 3WD6A 1EGOA 2DJ3A 2YV7A 1GSFA 1F37A 5F05A 3MNGA 4WR4A 3VWWA 2L5OA 2M46A 2H1BA 1A24A 4RQXA 5F8BA 1T7PB 4MLYA 3GHAA 3DKSA 1G7EA 3BCIA 2Z9SA 1SYRA 3FZ4A 4WEYA 1KBNA 3LXZA 2MZCA 2YANA 2VLVA 4MK3A 2AHEA 2H1DA 4IQ1A 3TRPA 3UARA 2M80A 3S9FA 5CNWA 1YDKA 3KTLA 2RM5A 2WZ9A 2KP1A 5IOXA 5DBQA 3QFBC 1GP1A 4F0CA 1GTBA 4HZ2A 2KOKA 4BWSA 2IFQB 1K3LA 1JZRA 2XC2A 3PR8A 2ZNMA 4IJ3A 3VWVA 4ZB8A 4KH7A 4RI6A 3ZIJA 4I97A 2FWHA 3FRCA 3Q74A 3WGDA 1EWXA 2GZPA 2JSZA 4K6XA 5F0GA 2H6YA 4HOJA 3R2QA 1PKZA 2H72A 2JZRA 1T4YA 3MWHA 3TDGA 1QXHA 2JZTA 1DSBA 4ZBBA 6GSTA 4QL9A 4O5RA 5G1LA 2R0CA 2R0PA 3HKRA 4IS0A 3H4KA 2I3YA 3H93A 1X5DA 4XIHA 3TKSA 1M2DA 2A2SA 1GSYA 3V1WA 3GKMA 2CZ3A 1THXA 3OR5A 2IFQA 1DBYA 2CAIA 3DGQA 6GSXA 5LD0A 1CQGA 4JR4A 4ULXA 1G6WA 2V32A 3HDCA 2KP2A 2WRTA 2VCQA 2VM2A 3BD2A 4JR6A 4OFTA 4Q5RA 1I5GA 4POLA 1JFUA 2IMEA 2WJUA 2HRNA 4FYUA 1MD3A 1TW9A 5FT3A 5IMDA 3MSZA 1Q4JA 2VIMA 4G0LA 3N9JA 1EP7A 4IKHA 4XS6A 2HSHA 3E9JB 5CREA 2YZUA 3ZZXA 1FO5A 3KJYA 1JZOA 5DAKB 1VF1A 3TUEA 1SK2A 2N5BA 3CTFA 2HLSA 3C73A 5D9WA 1ERWA 2DJJA 4MF5A 1T1VA 2MBTA 1J0FA 1TRVA 1QK8A 4DVCA 1ZYPA 3DXBA 3HD5A 3G9BA 1MEKA 1U3IA 1A2MA 2A4VA 3GH6A 5DQSA 1SD8A 3KM6A 5IO0A 3TJFA 2P31A 4ACSA 3IXRA 4G19A 1U3AA 5ECPB 5KN1A 4ECIA 3A5IA 3FEUA 2HRFA 4EO3A 2KUCA 2I1UA 5DQYA 1XVWA 2FLSA 3IAM2 5DAKA 5DCGA 4FH8A 2O8VB 4DSSB 2B6MA 3IE3A 2YPMA 2GVPA 1OAZA 5B6NA 4TR0A 3QAWA 4IBPA 2VL2C 4ICYA 2GLRA 2DJ0A 2YN1A 1V57A 4LL1B 1GTAA 2XBIA 3PINA 1ILOA 3F6FA 5H5QA 3ISOA 2B5XA 1WE0A 5CRDA 2IMIA 3KIJA 5AN1A 1MD4A 2GQLA 3LGCA 2N5FA 1AAZA 5GAPD 3C1SA 3GSTA 5HR2A 4POMA 3UBLA 1XW5A 4EIPA 1OKDA 4WBJA 5CRWA 3KP8A 2X4AA 4PQ1A 2FA8A 5DDLA 4DSSA 2RUEA 5B7CA 2VO4A 3L9SA 1YF0A 2LRNA 1U6TA 2RM6A 3FW2A 3UL3A 4IJIA 1AQVA 5G2ZA 4MPFA 3O76A 3ZVJD 1K3OA 4E8EA 2FNOA 2TRXA 2DJ1A 1FVJA 3HXSA 4WBRD 3RPPA 3IV4A 5FWGA 3VPQA 1S3AA 3RHCA 5IPGA 4MF7A 4EIQA 1FAAA 5IOWA 2CX4A 1WMJA 2J23A 5AIVA 3NIVA 3GSSA 3P90A 4TR1B 4ECJA 3LG6A 2K18A 4KSOA 4BVYB 2DLXA 2VAFA 2FA4A 5BRTA 2LRTA 4ZB6A 1GUMA 2PN8A 1PL2A 3IAS2 4TW5A 1GL8A 3ZYWA 1KEBA 2IWTA 4FQUA 9GSSA 3ERFA 3HZ8A 3IHQA 5ECIB 3GH9A 2GT5A 4IGJA 2R4VA 4IHUA 4NHWA 3HVSA 1UA5A 1F6MC 5HFGA 4KAEA 1Z6NA 3HY2A 3L0HA 4NV2A 1TRUA 1R5PA 3A5WA 4ZXGA 4PX1A 1TK0B 1UC7A 2H6XA 3L78A 3HJPA 1MDIA 1SL2B 1N2AA 4HQZA 3ME7A 5G1KA 1X5CA 3RBTA 2IJYA 2C80A 4J57E 3Q6OA 1GH2A 4TR1A 4GQFA 3GYKA 2B5YA 1VGLA 2H0GA 3TB2A 4BVYA 1SK0A 1J9BA 4NV5A 3CSIA 2C0GA 1VF4A 3IK9A 5ABRA 4G9HA 4IN0A 1O8WA 3KD0A 5EL8A 1K0DA 2PWJA 4GLTA 1SYXA 2B7KA 4OFNA 1YY7A 3H1NA 2YJHA 1BEDA 5AISA 2M72A 4TKYA 4J56E 4HJ2A 4E8HA 2YCDA 3EVIA 2O87A 1PX7A 2FWEA 2FWFA 2R0GA 4QL7A 4RUVA 2GT6A 1JZWA 4GSNA 1BG5A 4NMUA 4QQ7A 4IELA 4IQAA 2P0GA 1OC3A 4JRRA 3FR6A 3LYKA 2AYTA 5A5KA 2YWIA 1N8JA 2X8GA 2VL2A 3TJBA 1FVKA 2LRCA 2PGTA 2RIIA 2C3QA 4MH2A 3GA4A 3U5RE 3CBUA 5AGYA 1TJDA 1WWJA 2LEGA 5D9TA 2R37A 3J7Yb 3EMXA 2K8VA 2TRCP 2YNXA 4MP4A 4BPYA 1O6JA 5DJLA 4KDXA 1T00A 4L0UA 3HVVA 1QMVA 3TJGA 1EOHA 4WF5A 2HT9A 12GSA 2X99A 2PVOC 1M99A 3KMNA 2EIRA 2NTOA 1HNAA 1HQOA 5IO2A 4KUNA 1OYJA 1AUCA 4A5PA 3RAZA 1GULA 1NSWA 3KH9A 18GSA 1H4OA 5ECQB 1M0UA 4F2IA 4K5SA 4ZILA 2DJKA 2OE1A 3ZRDA 2WFCA 5CYYA 1TU8A 1M2BA 2V6KA 2OBKA 4K7IA 1XWBA 4H86A 2F9SA 3MAKA 3TJKA 2AUVA 4YQUA 2MYGA 2X64A 2VUPA 5D93A 1AIUA 4K7NA 3LEFA 4WKWA 22GSA 4PQIA 5D8IA 1O7UA 4AF2A 2CV4A 4G10A 3UVTA 4HI7A 4XTSA 3WGXA 3TRXA 1HD2A 2OJLA 1FOHA 2DKIA 3HCZA 2VD1A 3EC3A 4V2NA 4PURA 2MMAA 3FZ9A 4ZBDA 5ECNB 3GKNA 5ID2B 1ZYNA 5FHIA 5B8AA 1TK5B 3KTBA 3QAGA 1S3CA 2C1YA 4GF0A 5IMAA 3HVXA 3GL5A 1ZZYA 2OBIA 3FKFA 1ML6A 1K0CA 1SKSB 4KSMA 4YQMA 3F3QA 4ZBAA 1M9BA 4HU9A 3ME8A 3U6VA 1XWGA 3TRQA 1JLWA 2HSYA 4TOPA 3HZ4A 3D22A 2UZ8A 2REMA 1HNCA 3HJOA 3ZMKA 1TKDB 4TRXA 1TOFA 2P5QA 2LV3A 4AJ7A 5ID2A 2MMOA 2X8HA 2CVDA 3ZMLA 2GDRA 2NDOA 3GV1A 2DSAA 4TXVA 2A2PA 2C0EA 5B8BA 5G5FA 4YH2A 4PUAA 3IBHA 1Y6EA 2OKAA 1B9YC 1SK1A 1J08A 1EGRA 4HDEA 1FG4A 3UBKA 4Z2UA 2ZUPA 2DBCA 2V2GA 1W89A 2DJ2A 1EOGA 3EMPA 2GGTA 2GSTA 4G0IA 2VL9A 1GTUA 3VURA 1ST9A 1YKCA 1B48A 4OCFA 4EXJA 4K2DA 4N30A 2GSSA 3TKSE 4CDOA 1PSQA 3A2VA 4Z2RA 3GX0A 3D4MA 1Z9HA 2WULA 3RDWA 5EVOA 1GSEA 1NM3A 2PU9C 5IQYA 3SBCA 2E2MA 1K0NA 2L57A 1TXXA 3PPUA 5ECRB 4ILFA 2OADA 1AXDA 2FCHA 1R5AA 4K5RA 4DSRA 4V1Ap 4OMVA 5COHA 4K2XA 2K9FA 1V98A 3F9UA 1YEPA 1JLVA 4K0GA 17GSA 2VM1A 4AGSA 1W4VA 4IP1A 5J41A 3L9VA 2R5GA 2LQQA 2XPEA 2H66A 1WOUA 3Q19A 4MDCA 1XFLA 1JHBA 1X9SB 4Z7XA 1YQ1A 3M9KA 4Z2TA 2B3SA 2J9HA 2VOCA 2O7KA 1ZYEA 2YZHA 3KP9A 1JZDA 2ON5A 1FB6A 1A8LA 3DMLA 1FOVA 1QGVA 3M9JA 1KTEA 3D21A 3KMOA 2DKHA 1NHYA 4MJAA 3G7IA 5IM9A 2JADA 4MJEA 3DWVA 4N0ZA 3A2WA 5IPHA 1ZCPA 1ZL9A 2L6CA 2ON7A 3MYDA 4I2UA 1R7HA 1E6BA 4OCEA 3TOTA 2FD3A 1NHOA 4KDUA 3LWAA 3IOSA 2H01A 4XCSA 1F3AA 4NWYA 4DEJA 3FR3A 1DUGA 5CP1A 4EDZA 5ELAA 3C71A 1M7TA 1X9MB 1AQXA 2C8UA 2G0FA 1T3BA 4POBA 1K0MA 1K0BA 4WR5A 3TKRA 2V6OA 1BX9A 5DJMA 3IC8A 3C8EA 1R26A 2IMKA 3IDVA 3A2XA 3F3RA 3TJJA 3DRNA 1XW9A 3F4RA 3GUSA 2CZ2A 2HRKA 4TN8A 5L71A 3UMAA 4ISDA 3UEMA 1PKWA 5A4VA 4ID0A 5D9VA 2L4QA 3DVWA 3WT2A 1MTCA 3PGTA 4PTSA 2C0DA 3W8SA 3TKPA 2K6VA 2RUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN3 A;  4JED A;  5LCZ A;  1B4P A;  1T8E B;  3GFK A;  1K3Y A;  2EIQ A;  3GIX A;  1G0T A;  3KGK A;  2H74 A;  1ON4 A;  3US3 A;  1FHE A;  1XXU A;  1SL0 B;  2H8L A;  2BTO T;  4JBB A;  4OD7 A;  1SJZ A;  3DEX A;  5G5E A;  1DE1 A;  2F8F A;  3O3T A;  1ACV A;  5KN2 A;  4PQH A;  3HHV A;  4GSS A;  2LJA A;  2AAW A;  2I4A A;  4EL1 A;  3LSZ A;  4TR4 A;  4DSQ A;  14GS A;  1Z7P A;  2IMD A;  5E59 A;  4LLR A;  4PXO A;  4GST A;  4MJC A;  2C3T A;  3ZLP A;  2IMF A;  4KE3 A;  4HS1 A;  3ZIT A;  1XZO A;  2H75 A;  4AJ6 A;  1OVN A;  2VCX A;  4ML6 A;  4TXO B;  6GSW A;  4EDY A;  4ZIJ A;  4ML1 A;  3F4T A;  2NBS A;  2MBS A;  3PH9 A;  5ELG A;  16GS A;  2ES7 A;  4OFM A;  3DIE A;  3ERG A;  3Q18 A;  2CAQ A;  4EF0 A;  5HR0 A;  4BA7 A;  1LU4 A;  3GNJ A;  2FHE A;  2H70 A;  4MCU A;  2WCI A;  1SEN A;  2PVQ A;  2VCW A;  1GNE A;  4X43 A;  2JSY A;  1H75 A;  2F3M A;  5A4W A;  4GQC A;  3EYT A;  3HJM A;  1WIK A;  2DC5 A;  3GTU B;  3F6D A;  6GSU A;  5ECK B;  1O8X A;  5JWQ B;  4YQV A;  2IL3 A;  2YWO A;  1SJI A;  1AC1 A;  3MDK A;  3WYW A;  4WF4 A;  1GNW A;  1WP0 A;  4F82 A;  3IA1 A;  1OE8 A;  3ED3 A;  2F8A A;  2VD0 A;  5HR3 A;  1XIY A;  5J4U A;  4TXO A;  2YWN A;  3D5J A;  3VI5 A;  3VI7 A;  3TCO A;  3GRX A;  2IPA A;  1GRX A;  2BMX A;  2LNT A;  2LS5 A;  5CAX A;  5KN3 A;  1E2Y A;  2E7P A;  4ZL8 A;  1OE7 A;  5KN0 A;  4RI7 A;  4V2M A;  1SL1 B;  1OC8 A;  1V2A A;  4PNF A;  2H73 A;  4WXT A;  5ENU A;  3TKS C;  3EIN A;  1URM A;  1U87 A;  2PMT A;  2I9H A;  5HQP A;  3M0F A;  5C00 A;  1GLP A;  2OA7 A;  1RQM A;  1Z5Y E;  1XWC A;  3APS A;  3GTU A;  1A2J A;  4GCI A;  3L9U A;  2G2Q A;  4HUA A;  2RLI A;  1EEM A;  1RK4 A;  2WGR A;  2L6D A;  4JZQ A;  2JZS A;  4RQR A;  1PN9 A;  5CO3 A;  2QSI A;  1A8Y A;  1UN2 A;  2LJK A;  3E3E A;  2H1A A;  5EY6 A;  2EC4 A;  2OE0 A;  3FY7 A;  3FHK A;  4MPG A;  6GSS A;  4HU7 A;  4NXI A;  5F07 A;  3C1R A;  2GZZ A;  5ECH B;  3SWL A;  1HNB A;  4L0W A;  1XOB A;  2KHP A;  4LA1 A;  3GKX A;  4GXZ A;  3IPZ A;  1ZMA A;  2XHF A;  3EU4 A;  3ZVJ A;  1BYE A;  3G7Y A;  5A4U A;  1YZX A;  1PD2 1;  5GSS A;  1PRX A;  5E4W A;  3DVX A;  5ECL B;  5ECS A;  5JWO B;  5DAL B;  3CSH A;  4KGI A;  1K0A A;  1M2A A;  5INY A;  1QFN A;  3C7M A;  1TU7 A;  2H76 A;  2B7J A;  4N10 A;  3E0U A;  3O6T A;  3P7X A;  2LKU A;  3EU3 A;  4V1A g;  3G7J A;  5JWR B;  4EE0 A;  5ECM B;  1ZOF A;  4OWY A;  4O92 A;  4O7H A;  2YOI A;  3QAV A;  4MA9 A;  1TK8 B;  3BCK A;  5CRG A;  1M9A A;  1GLQ A;  4MZW A;  1RW1 A;  4CW9 A;  3GUR A;  1PGT A;  1UVZ A;  1O85 A;  2QGV A;  4Q5Q A;  1BQ7 A;  3I6A A;  5ECO B;  3FK8 A;  1A0F A;  2NPB A;  4G2E A;  3NZN A;  1GUH A;  2XPD A;  5DAL A;  3KZQ A;  1G7O A;  2FY6 A;  2D2Z A;  3ZTL A;  3KH7 A;  1K0O A;  5J5N A;  4EVM A;  1B8X A;  3UVH A;  2HYX A;  1SD9 A;  3WT1 A;  2E2G A;  2O89 A;  3HA9 A;  3BJ5 A;  2R3X A;  1GWC A;  1PQN A;  3ZRE A;  3HYP A;  1SJ6 A;  2VCT A;  1MDK A;  1AW9 A;  4TVE A;  5D9X A;  1V58 A;  3P2A A;  1B4Q A;  1TP9 A;  1BJX A;  4BWQ A;  4Q5N A;  1YJ6 A;  1IYI A;  4F03 A;  1S3D A;  1TI3 A;  5JCW A;  3M8N A;  7GSS A;  4PNG A;  4KCE A;  4LL4 B;  3D6I A;  4F9Z A;  2WS2 A;  4X1U A;  3I69 A;  1USB A;  1XVQ A;  5C04 A;  1ZYQ B;  1VRS D;  2TIR A;  3I43 A;  4K0N A;  4KCA A;  2PUK C;  4CHS A;  4P3Y B;  4EUY A;  4JE1 A;  2GSQ A;  3GKK A;  4KX4 A;  5IMZ A;  1ERU A;  4L5L A;  3LQ7 A;  1QQ2 A;  4GRF A;  3QMX A;  2DIY A;  3A3T A;  2HI7 A;  3VK9 A;  1Z6M A;  2EIO A;  3F63 A;  1BAY A;  2NVL A;  5JCU A;  1GSD A;  1QUW A;  3F0I A;  2WB9 A;  1GSS A;  1IYH A;  2ZCT A;  3K8N A;  2JAC A;  1WPI A;  3IRA A;  3TOU A;  1TI1 A;  4K8M A;  2ALB A;  2I81 A;  5IMF A;  2C0F A;  6GSY A;  3CYN A;  2FUG 2;  2PER A;  2LJR A;  5EPF A;  10GS A;  2OAC A;  3F8U A;  3VWU A;  1PL1 A;  1Z3E A;  2GTU A;  3EUR A;  4ZB9 A;  2MMZ A;  4IVF A;  3ZIV A;  1EEJ A;  1DE2 A;  4LMV A;  1PMT A;  1YKA A;  3KXO A;  4FYC A;  4O32 A;  1T4Z A;  3VFI A;  4YAV A;  3W6G A;  2LST A;  2B5E A;  3ZL5 A;  4K9Z A;  3I9V 2;  4PGT A;  2GSR A;  2BJX A;  3FZ5 A;  3NOF A;  2H0H A;  1GTI A;  2CQ9 A;  4V2L A;  2LQO A;  1VF3 A;  1V9W A;  1TDI A;  1NW2 A;  1OC9 B;  5H5R A;  1PX6 A;  1ERT A;  2R2J A;  4GWR A;  3ZFB A;  2FWG A;  1FB0 A;  1XOA A;  1EV4 A;  3KEB A;  4XS4 B;  1F2E A;  19GS A;  1C72 A;  2K8S A;  2L59 A;  2MMN A;  2B1L A;  5JCG A;  3LJR A;  1Z7R A;  4MJB A;  4I8B A;  1XW6 A;  4HEA 2;  3D4T A;  5J9C A;  2GZY A;  1CQH A;  2HZE B;  4JU5 A;  1WJK A;  2YP6 A;  3H79 A;  2QKE A;  1HYU A;  3QR6 A;  2P5R A;  4KND A;  4Q5F A;  4NPB A;  4BL7 A;  3APQ A;  1OC9 A;  1I9D A;  1LJR A;  2L4C A;  3N5O A;  4D73 B;  1G6Y A;  1VF2 A;  1EZK A;  3IK7 A;  1R4W A;  1YEX A;  4KDY A;  2LTK A;  1X5E A;  4XS1 A;  3VLN A;  4MMM A;  4MH3 A;  4MAB A;  4XS4 A;  5HFI A;  1A0R P;  2V1M A;  1OKT A;  1XCC A;  2X8C A;  2V41 A;  2H19 A;  4XRD A;  5GST A;  4F0B A;  3LXT A;  1YF1 A;  2HZE A;  4YAP A;  3KCM A;  3QCP A;  3P8W A;  1EP8 A;  1Q98 A;  4OO4 A;  4XRA A;  2L5L A;  4GTU A;  3UOM A;  1XWA A;  2VLU A;  1SKW B;  4IP6 A;  1THO A;  2C4J A;  3TKQ A;  3QD9 A;  2F51 A;  4ECC A;  4X0X A;  4D73 A;  4NAX A;  2DMM A;  2HNL A;  1X0R A;  4J2F A;  2VCZ A;  3F4S A;  5DVB A;  3AY8 A;  3CTG A;  5GAN D;  3FYG A;  2HFD A;  4BVX A;  1V40 A;  2IN3 A;  13GS A;  5HFK A;  1A2L A;  1ERV A;  2C3N A;  4K7O A;  20GS A;  2YV9 A;  4NHZ A;  4PUF C;  4L8E A;  3M3M A;  4ZL7 A;  3DD3 A;  3RPN A;  2HE3 A;  5B6M A;  4I2T A;  5J3R A;  3CMI A;  4MF6 A;  2CVB A;  3W8J A;  2H30 A;  2PPT A;  4OO5 A;  1F9M A;  4ZL9 A;  2H6Z A;  11GS A;  5G31 A;  5LNK e;  5D73 A;  6GSV A;  2H0I A;  5G30 A;  3IR4 A;  4WET A;  2A2R A;  2VCV A;  1EV9 A;  3TGZ A;  3WGE A;  4XHM A;  1U88 A;  1TTZ A;  2GS3 A;  4KA0 A;  3FR9 A;  2LNS A;  2H1G A;  3JCM L;  1Y25 A;  4FYB A;  1XPV A;  1O81 A;  3GMF A;  3QDN A;  1WRY A;  2FGX A;  3CXG A;  4HQS A;  4LMW A;  4L5O A;  3EE2 A;  3LOR A;  2JL4 A;  3UAP A;  5KEJ A;  3VPT A;  5IMV A;  5H5S A;  4TR3 A;  4IW9 A;  1TRS A;  2HXK A;  2CA8 A;  2OE3 A;  4MZB A;  2JU5 A;  5HR1 A;  2AB6 A;  3M1G A;  2CVK A;  5GZZ B;  4POK A;  2HZF A;  2LUS A;  3FZA A;  1LBK A;  4KB3 A;  2R6K A;  3ERW A;  2PBJ A;  3EWL A;  4N11 A;  2GQK A;  2WDU A;  1AQW A;  5J9B A;  2KLX A;  3BOA A;  2VLT A;  2CX3 A;  3LYP A;  2IIY A;  3DYR A;  3H8Q A;  3IC4 A;  1XWK A;  3CRU A;  4EC0 A;  1MDJ A;  4HZ4 A;  3GX8 A;  2XBQ A;  1KNG A;  4EKZ A;  8GSS A;  5D96 A;  1SKR B;  2DIZ A;  3VWX A;  1X9W B;  5DCH A;  1ABA A;  3GL3 A;  3D0Z A;  3BBY A;  5IIZ A;  4I5Q A;  1TRW A;  3L4N A;  3APO A;  2QC7 A;  1F3B A;  1GSQ A;  3RHB A;  2DML A;  1GSU A;  5AIX A;  3QOU A;  3UIW A;  4I6X A;  2AV4 A;  2CT6 A;  4KW6 A;  3QFA C;  4K1F A;  3J7Y k;  2VL3 A;  3ZFL A;  1PA3 A;  1FW1 A;  5F06 A;  2O85 A;  5CRH A;  4AJ8 A;  1SU9 A;  4MZC A;  1ZGN A;  4N0V A;  5IMC A;  2YWM A;  2AJQ B;  2E0Q A;  2N5A A;  1XBS A;  2GQM A;  4ECB A;  3UJ1 A;  1A23 A;  3CSJ A;  4FO5 A;  3CRT A;  3LFL A;  2H71 A;  4FIW A;  1GUK A;  4HJM A;  3QPM A;  1B9X C;  1O73 A;  2B1K A;  2YJ7 A;  3WD6 A;  1EGO A;  2DJ3 A;  2YV7 A;  1GSF A;  1F37 A;  5F05 A;  3MNG A;  4WR4 A;  3VWW A;  2L5O A;  2M46 A;  2H1B A;  1A24 A;  4RQX A;  5F8B A;  1T7P B;  4MLY A;  3GHA A;  3DKS A;  1G7E A;  3BCI A;  2Z9S A;  1SYR A;  3FZ4 A;  4WEY A;  1KBN A;  3LXZ A;  2MZC A;  2YAN A;  2VLV A;  4MK3 A;  2AHE A;  2H1D A;  4IQ1 A;  3TRP A;  3UAR A;  2M80 A;  3S9F A;  5CNW A;  1YDK A;  3KTL A;  2RM5 A;  2WZ9 A;  2KP1 A;  5IOX A;  5DBQ A;  3QFB C;  1GP1 A;  4F0C A;  1GTB A;  4HZ2 A;  2KOK A;  4BWS A;  2IFQ B;  1K3L A;  1JZR A;  2XC2 A;  3PR8 A;  2ZNM A;  4IJ3 A;  3VWV A;  4ZB8 A;  4KH7 A;  4RI6 A;  3ZIJ A;  4I97 A;  2FWH A;  3FRC A;  3Q74 A;  3WGD A;  1EWX A;  2GZP A;  2JSZ A;  4K6X A;  5F0G A;  2H6Y A;  4HOJ A;  3R2Q A;  1PKZ A;  2H72 A;  2JZR A;  1T4Y A;  3MWH A;  3TDG A;  1QXH A;  2JZT A;  1DSB A;  4ZBB A;  6GST A;  4QL9 A;  4O5R A;  5G1L A;  3HKR A;  4IS0 A;  3H4K A;  2I3Y A;  3H93 A;  1X5D A;  4XIH A;  3TKS A;  1M2D A;  2A2S A;  1GSY A;  3V1W A;  3GKM A;  2CZ3 A;  1THX A;  3OR5 A;  2IFQ A;  1DBY A;  2CAI A;  3DGQ A;  6GSX A;  5LD0 A;  1CQG A;  4JR4 A;  4ULX A;  1G6W A;  2V32 A;  3HDC A;  2KP2 A;  2WRT A;  2VCQ A;  2VM2 A;  3BD2 A;  4JR6 A;  4OFT A;  4Q5R A;  1I5G A;  4POL A;  1JFU A;  2IME A;  2WJU A;  2HRN A;  4FYU A;  1MD3 A;  1TW9 A;  5FT3 A;  5IMD A;  3MSZ A;  1Q4J A;  2VIM A;  3N9J A;  1EP7 A;  4IKH A;  4XS6 A;  2HSH A;  3E9J B;  5CRE A;  2YZU A;  3ZZX A;  1FO5 A;  3KJY A;  1JZO A;  5DAK B;  1VF1 A;  3TUE A;  1SK2 A;  2N5B A;  3CTF A;  2HLS A;  3C73 A;  5D9W A;  1ERW A;  2DJJ A;  4MF5 A;  1T1V A;  2MBT A;  1J0F A;  1TRV A;  1QK8 A;  4DVC A;  3DXB A;  3HD5 A;  3G9B A;  1MEK A;  1U3I A;  1A2M A;  2A4V A;  3GH6 A;  5DQS A;  1SD8 A;  3KM6 A;  5IO0 A;  3TJF A;  2P31 A;  4ACS A;  3IXR A;  4G19 A;  1U3A A;  5ECP B;  5KN1 A;  4ECI A;  3FEU A;  2HRF A;  4EO3 A;  2KUC A;  2I1U A;  5DQY A;  1XVW A;  2FLS A;  3IAM 2;  5DAK A;  5DCG A;  4FH8 A;  2O8V B;  4DSS B;  2B6M A;  3IE3 A;  2YPM A;  2GVP A;  1OAZ A;  5B6N A;  4TR0 A;  3QAW A;  4IBP A;  2VL2 C;  2GLR A;  2DJ0 A;  2YN1 A;  1V57 A;  4LL1 B;  1GTA A;  2XBI A;  3PIN A;  1ILO A;  3F6F A;  5H5Q A;  3ISO A;  2B5X A;  1WE0 A;  5CRD A;  2IMI A;  3KIJ A;  5AN1 A;  1MD4 A;  2GQL A;  3LGC A;  2N5F A;  1AAZ A;  5GAP D;  3C1S A;  3GST A;  5HR2 A;  4POM A;  3UBL A;  1XW5 A;  1OKD A;  4WBJ A;  5CRW A;  3KP8 A;  4PQ1 A;  2FA8 A;  5DDL A;  4DSS A;  2RUE A;  5B7C A;  2VO4 A;  3L9S A;  1YF0 A;  2LRN A;  1U6T A;  2RM6 A;  3FW2 A;  3UL3 A;  4IJI A;  1AQV A;  5G2Z A;  4MPF A;  3O76 A;  3ZVJ D;  1K3O A;  4E8E A;  2FNO A;  2TRX A;  2DJ1 A;  1FVJ A;  3HXS A;  4WBR D;  3RPP A;  3IV4 A;  5FWG A;  3VPQ A;  1S3A A;  3RHC A;  5IPG A;  4MF7 A;  1FAA A;  5IOW A;  2CX4 A;  1WMJ A;  2J23 A;  5AIV A;  3NIV A;  3GSS A;  3P90 A;  4TR1 B;  4ECJ A;  3LG6 A;  2K18 A;  4KSO A;  2DLX A;  2VAF A;  2FA4 A;  2LRT A;  4ZB6 A;  1GUM A;  2PN8 A;  1PL2 A;  3IAS 2;  4TW5 A;  1GL8 A;  3ZYW A;  1KEB A;  2IWT A;  9GSS A;  3ERF A;  3HZ8 A;  3IHQ A;  5ECI B;  3GH9 A;  2GT5 A;  4IGJ A;  2R4V A;  4IHU A;  4NHW A;  3HVS A;  1UA5 A;  1F6M C;  5HFG A;  4KAE A;  1Z6N A;  3HY2 A;  3L0H A;  4NV2 A;  1TRU A;  1R5P A;  3A5W A;  4ZXG A;  4PX1 A;  1TK0 B;  1UC7 A;  2H6X A;  3L78 A;  3HJP A;  1MDI A;  1SL2 B;  1N2A A;  4HQZ A;  3ME7 A;  5G1K A;  1X5C A;  3RBT A;  2IJY A;  2C80 A;  4J57 E;  3Q6O A;  1GH2 A;  4TR1 A;  4GQF A;  3GYK A;  2B5Y A;  1VGL A;  2H0G A;  3TB2 A;  4BVY A;  1SK0 A;  1J9B A;  4NV5 A;  3CSI A;  2C0G A;  1VF4 A;  3IK9 A;  5ABR A;  4G9H A;  4IN0 A;  1O8W A;  3KD0 A;  5EL8 A;  1K0D A;  2PWJ A;  4GLT A;  1SYX A;  2B7K A;  4OFN A;  1YY7 A;  3H1N A;  2YJH A;  1BED A;  5AIS A;  2M72 A;  4TKY A;  4J56 E;  4HJ2 A;  4E8H A;  2YCD A;  3EVI A;  2O87 A;  1PX7 A;  2FWE A;  2FWF A;  4QL7 A;  4RUV A;  2GT6 A;  1JZW A;  4GSN A;  1BG5 A;  4NMU A;  4QQ7 A;  4IEL A;  4IQA A;  2P0G A;  1OC3 A;  4JRR A;  3FR6 A;  3LYK A;  2AYT A;  5A5K A;  2YWI A;  1N8J A;  2X8G A;  2VL2 A;  3TJB A;  1FVK A;  2LRC A;  2PGT A;  2RII A;  2C3Q A;  4MH2 A;  3GA4 A;  3U5R E;  3CBU A;  5AGY A;  1TJD A;  1WWJ A;  2LEG A;  5D9T A;  2R37 A;  3J7Y b;  3EMX A;  2K8V A;  2TRC P;  2YNX A;  4MP4 A;  4BPY A;  1O6J A;  5DJL A;  4KDX A;  1T00 A;  4L0U A;  3HVV A;  1QMV A;  3TJG A;  1EOH A;  4WF5 A;  2HT9 A;  12GS A;  2X99 A;  2PVO C;  1M99 A;  3KMN A;  2EIR A;  2NTO A;  1HNA A;  1HQO A;  5IO2 A;  4KUN A;  1OYJ A;  1AUC A;  3RAZ A;  1GUL A;  1NSW A;  3KH9 A;  18GS A;  1H4O A;  5ECQ B;  1M0U A;  4F2I A;  4ZIL A;  2DJK A;  2OE1 A;  3ZRD A;  2WFC A;  5CYY A;  1TU8 A;  1M2B A;  2V6K A;  2OBK A;  4K7I A;  1XWB A;  4H86 A;  2F9S A;  3MAK A;  3TJK A;  2AUV A;  4YQU A;  2MYG A;  2X64 A;  2VUP A;  5D93 A;  1AIU A;  4K7N A;  3LEF A;  4WKW A;  22GS A;  4PQI A;  5D8I A;  1O7U A;  4AF2 A;  2CV4 A;  4G10 A;  3UVT A;  4HI7 A;  4XTS A;  3WGX A;  3TRX A;  1HD2 A;  2OJL A;  3HCZ A;  2VD1 A;  3EC3 A;  4V2N A;  4PUR A;  2MMA A;  3FZ9 A;  4ZBD A;  5ECN B;  3GKN A;  5ID2 B;  5FHI A;  5B8A A;  1TK5 B;  3KTB A;  3QAG A;  1S3C A;  2C1Y A;  4GF0 A;  5IMA A;  3HVX A;  3GL5 A;  1ZZY A;  2OBI A;  3FKF A;  1ML6 A;  1K0C A;  1SKS B;  4KSM A;  4YQM A;  3F3Q A;  4ZBA A;  1M9B A;  4HU9 A;  3ME8 A;  3U6V A;  1XWG A;  3TRQ A;  1JLW A;  2HSY A;  4TOP A;  3HZ4 A;  3D22 A;  2REM A;  1HNC A;  3HJO A;  3ZMK A;  1TKD B;  4TRX A;  1TOF A;  2P5Q A;  2LV3 A;  4AJ7 A;  5ID2 A;  2MMO A;  2X8H A;  2CVD A;  3ZML A;  2GDR A;  2NDO A;  3GV1 A;  2DSA A;  4TXV A;  5B8B A;  2C0E A;  5G5F A;  4YH2 A;  4PUA A;  3IBH A;  1Y6E A;  2OKA A;  1B9Y C;  1SK1 A;  1J08 A;  1EGR A;  4HDE A;  1FG4 A;  3UBK A;  2ZUP A;  2DBC A;  2V2G A;  1W89 A;  2DJ2 A;  1EOG A;  3EMP A;  2GGT A;  2GST A;  2VL9 A;  1GTU A;  3VUR A;  1ST9 A;  1YKC A;  1B48 A;  4OCF A;  4EXJ A;  4K2D A;  4N30 A;  2GSS A;  3TKS E;  4CDO A;  1PSQ A;  3A2V A;  3GX0 A;  3D4M A;  1Z9H A;  2WUL A;  3RDW A;  5EVO A;  1GSE A;  1NM3 A;  2PU9 C;  5IQY A;  3SBC A;  2E2M A;  1K0N A;  2L57 A;  1TXX A;  5ECR B;  4ILF A;  2OAD A;  1AXD A;  2FCH A;  1R5A A;  4DSR A;  4V1A p;  4OMV A;  5COH A;  2K9F A;  1V98 A;  3F9U A;  1YEP A;  1JLV A;  4K0G A;  17GS A;  2VM1 A;  4AGS A;  1W4V A;  4IP1 A;  5J41 A;  3L9V A;  2R5G A;  2LQQ A;  2XPE A;  2H66 A;  1WOU A;  3Q19 A;  4MDC A;  1XFL A;  1JHB A;  1X9S B;  4Z7X A;  1YQ1 A;  3M9K A;  2B3S A;  2J9H A;  2VOC A;  2O7K A;  1ZYE A;  2YZH A;  3KP9 A;  1JZD A;  2ON5 A;  1FB6 A;  1A8L A;  3DML A;  1FOV A;  1QGV A;  3M9J A;  1KTE A;  3D21 A;  3KMO A;  1NHY A;  4MJA A;  3G7I A;  5IM9 A;  2JAD A;  4MJE A;  3DWV A;  4N0Z A;  3A2W A;  5IPH A;  1ZCP A;  1ZL9 A;  2L6C A;  2ON7 A;  4I2U A;  1R7H A;  1E6B A;  4OCE A;  3TOT A;  2FD3 A;  1NHO A;  4KDU A;  3LWA A;  3IOS A;  2H01 A;  4XCS A;  1F3A A;  4NWY A;  4DEJ A;  3FR3 A;  1DUG A;  5CP1 A;  4EDZ A;  5ELA A;  3C71 A;  1M7T A;  1X9M B;  1AQX A;  2C8U A;  2G0F A;  1T3B A;  4POB A;  1K0M A;  1K0B A;  4WR5 A;  3TKR A;  2V6O A;  1BX9 A;  5DJM A;  3C8E A;  1R26 A;  2IMK A;  3IDV A;  3A2X A;  3F3R A;  3TJJ A;  3DRN A;  1XW9 A;  3F4R A;  3GUS A;  2CZ2 A;  4TN8 A;  5L71 A;  3UMA A;  4ISD A;  3UEM A;  1PKW A;  5A4V A;  4ID0 A;  5D9V A;  2L4Q A;  3DVW A;  3WT2 A;  1MTC A;  3PGT A;  2C0D A;  3W8S A;  3TKP A;  2K6V A;  2RUF A; 
#chains in the Genus database with same CATH topology
 3GN3 A;  4JED A;  5LCZ A;  1B4P A;  1T8E B;  3GFK A;  1K3Y A;  2EIQ A;  3GIX A;  1G0T A;  3KGK A;  2H74 A;  1ON4 A;  3US3 A;  1FHE A;  1XXU A;  2QA1 A;  1SL0 B;  2H8L A;  2BTO T;  4JBB A;  4OD7 A;  1SJZ A;  3DEX A;  5G5E A;  1DE1 A;  2F8F A;  3O3T A;  1ACV A;  5KN2 A;  4PQH A;  3HHV A;  4GSS A;  2LJA A;  2AAW A;  2I4A A;  4EL1 A;  3LSZ A;  4TR4 A;  4DSQ A;  14GS A;  1Z7P A;  2IMD A;  5E59 A;  4LLR A;  4PXO A;  3EPT A;  4GST A;  4MJC A;  2C3T A;  3ZLP A;  2IMF A;  4KE3 A;  4HS1 A;  3ZIT A;  1XZO A;  2H75 A;  4AJ6 A;  1OVN A;  2VCX A;  4ML6 A;  4TXO B;  6GSW A;  4EDY A;  4ZIJ A;  4ML1 A;  3F4T A;  2NBS A;  2MBS A;  3PH9 A;  5ELG A;  4CY8 A;  16GS A;  2ES7 A;  4OFM A;  3DIE A;  3ERG A;  3Q18 A;  2CAQ A;  4EF0 A;  5HR0 A;  4BA7 A;  1LU4 A;  3GNJ A;  2FHE A;  2H70 A;  4MCU A;  2WCI A;  1SEN A;  2PVQ A;  2VCW A;  1GNE A;  3LW9 A;  4X43 A;  2JSY A;  1H75 A;  2F3M A;  5A4W A;  4GQC A;  3EYT A;  3HJM A;  1WIK A;  2DC5 A;  3GTU B;  3F6D A;  6GSU A;  5ECK B;  1O8X A;  5JWQ B;  4YQV A;  2IL3 A;  2YWO A;  1SJI A;  1AC1 A;  3MDK A;  3WYW A;  4WF4 A;  1GNW A;  1WP0 A;  4F82 A;  3IA1 A;  1OE8 A;  3ED3 A;  2F8A A;  2VD0 A;  5HR3 A;  1XIY A;  4O5U A;  5J4U A;  4TXO A;  2YWN A;  3D5J A;  3VI5 A;  3VI7 A;  3TCO A;  3GRX A;  2IPA A;  1GRX A;  2BMX A;  2LNT A;  2LS5 A;  5CAX A;  5KN3 A;  1E2Y A;  2E7P A;  4ZL8 A;  1OE7 A;  5KN0 A;  2QA2 A;  4RI7 A;  4V2M A;  1SL1 B;  1OC8 A;  1V2A A;  4PNF A;  4YKF A;  2H73 A;  4WXT A;  5ENU A;  3TKS C;  3EIN A;  1URM A;  1U87 A;  2PMT A;  2I9H A;  5HQP A;  3M0F A;  5C00 A;  1GLP A;  2OA7 A;  1RQM A;  1Z5Y E;  1XWC A;  3APS A;  3GTU A;  1A2J A;  4GCI A;  3L9U A;  2G2Q A;  4HUA A;  2RLI A;  1EEM A;  1RK4 A;  2WGR A;  2L6D A;  4JZQ A;  2JZS A;  4RQR A;  1PN9 A;  5CO3 A;  2QSI A;  1A8Y A;  1UN2 A;  3FMW A;  2LJK A;  3E3E A;  2H1A A;  5EY6 A;  2EC4 A;  2OE0 A;  3FY7 A;  3FHK A;  4MPG A;  6GSS A;  4HU7 A;  4NXI A;  2HSM A;  5F07 A;  3C1R A;  2GZZ A;  5ECH B;  3SWL A;  1HNB A;  4L0W A;  1XOB A;  2KHP A;  4LA1 A;  3GKX A;  1S3R A;  4GXZ A;  3IPZ A;  1ZMA A;  2XHF A;  3EU4 A;  3ZVJ A;  1PN0 A;  3IHG A;  1BYE A;  3G7Y A;  5A4U A;  1YZX A;  3MIX A;  1PD2 1;  5GSS A;  1PRX A;  5E4W A;  3DVX A;  5ECL B;  5ECS A;  5JWO B;  5DAL B;  3CSH A;  3HVN A;  4BIK A;  4KGI A;  1K0A A;  1M2A A;  5INY A;  1QFN A;  3C7M A;  1TU7 A;  2H76 A;  2B7J A;  4N10 A;  3E0U A;  3O6T A;  3P7X A;  2LKU A;  3EU3 A;  4V1A g;  3G7J A;  5JWR B;  4EE0 A;  5ECM B;  1ZOF A;  4OWY A;  4O92 A;  4O7H A;  2YOI A;  3QAV A;  4MA9 A;  1TK8 B;  3BCK A;  5CRG A;  1M9A A;  1GLQ A;  4MZW A;  1RW1 A;  4CW9 A;  3GUR A;  1PGT A;  1UVZ A;  1O85 A;  2QGV A;  4Q5Q A;  1BQ7 A;  3I6A A;  3FK8 A;  5ECO B;  1A0F A;  2NPB A;  4G2E A;  3NZN A;  1GUH A;  2XPD A;  5DAL A;  3KZQ A;  1G7O A;  2FY6 A;  2D2Z A;  3ZTL A;  3KH7 A;  1K0O A;  5J5N A;  4EVM A;  1M3I A;  1B8X A;  3UVH A;  2HYX A;  1SD9 A;  3WT1 A;  2E2G A;  2O89 A;  3HA9 A;  3BJ5 A;  2R3X A;  1GWC A;  1PQN A;  3ZRE A;  3HYP A;  1SJ6 A;  2VCT A;  1MDK A;  1AW9 A;  4TVE A;  5D9X A;  1V58 A;  3P2A A;  4KF9 A;  1B4Q A;  1TP9 A;  1BJX A;  4BWQ A;  4Q5N A;  1YJ6 A;  1IYI A;  4F03 A;  1S3D A;  1TI3 A;  5JCW A;  3M8N A;  7GSS A;  4PNG A;  4KCE A;  4LL4 B;  3D6I A;  4F9Z A;  2WS2 A;  4X1U A;  3I69 A;  1USB A;  1XVQ A;  1M3J A;  5C04 A;  1ZYQ B;  1VRS D;  2TIR A;  3I43 A;  2X49 A;  4K0N A;  4KCA A;  2PUK C;  4CHS A;  4P3Y B;  4EUY A;  4JE1 A;  2GSQ A;  3GKK A;  4KX4 A;  5IMZ A;  1ERU A;  4L5L A;  3LQ7 A;  1QQ2 A;  4GRF A;  3QMX A;  2DIY A;  3A3T A;  2HI7 A;  3VK9 A;  1Z6M A;  2EIO A;  3F63 A;  1BAY A;  2NVL A;  5JCU A;  1GSD A;  1QUW A;  3F0I A;  2WB9 A;  1GSS A;  1IYH A;  2ZCT A;  3K8N A;  2JAC A;  1WPI A;  3IRA A;  3TOU A;  1TI1 A;  4K8M A;  2ALB A;  2I81 A;  5IMF A;  2C0F A;  6GSY A;  4USS A;  3CYN A;  2FUG 2;  2PER A;  2LJR A;  5EPF A;  10GS A;  2OAC A;  3F8U A;  3VWU A;  1PL1 A;  1Z3E A;  2GTU A;  3EUR A;  4ZB9 A;  2MMZ A;  4IVF A;  3ZIV A;  1EEJ A;  1DE2 A;  4LMV A;  1PMT A;  1YKA A;  3KXO A;  4FYC A;  4O32 A;  1T4Z A;  3VFI A;  4YAV A;  3W6G A;  2LST A;  2B5E A;  3ZL5 A;  4K9Z A;  3I9V 2;  4PGT A;  2GSR A;  2BJX A;  3FZ5 A;  3NOF A;  2H0H A;  1GTI A;  4BL7 B;  2CQ9 A;  4V2L A;  2LQO A;  1VF3 A;  1V9W A;  1TDI A;  1NW2 A;  1OC9 B;  5H5R A;  1PX6 A;  1ERT A;  2R2J A;  4GWR A;  3ZFB A;  2A4H A;  2FWG A;  1FB0 A;  1XOA A;  1EV4 A;  3KEB A;  4XS4 B;  1F2E A;  19GS A;  1C72 A;  2K8S A;  2L59 A;  4CY6 A;  2MMN A;  2B1L A;  5JCG A;  3LJR A;  1Z7R A;  4MJB A;  4I8B A;  1XW6 A;  4HEA 2;  3D4T A;  5J9C A;  2GZY A;  1CQH A;  2HZE B;  4JU5 A;  1WJK A;  4G0K A;  2YP6 A;  3H79 A;  2QKE A;  1HYU A;  3QR6 A;  2P5R A;  4KND A;  4Q5F A;  4NPB A;  4BL7 A;  3APQ A;  1OC9 A;  1I9D A;  1LJR A;  2L4C A;  3N5O A;  4D73 B;  1G6Y A;  1VF2 A;  1EZK A;  3IK7 A;  1R4W A;  1YEX A;  4KDY A;  2LTK A;  1X5E A;  4XS1 A;  3VLN A;  4MMM A;  4MH3 A;  4MAB A;  4XS4 A;  5HFI A;  1A0R P;  4BVX B;  2V1M A;  1OKT A;  1XCC A;  2X8C A;  2V41 A;  2H19 A;  4XRD A;  5GST A;  4F0B A;  3LXT A;  1YF1 A;  2HZE A;  4YAP A;  3KCM A;  3QCP A;  3P8W A;  1EP8 A;  1Q98 A;  4OO4 A;  4XRA A;  2L5L A;  4GTU A;  3UOM A;  1XWA A;  2VLU A;  1SKW B;  4IP6 A;  1THO A;  2C4J A;  3TKQ A;  3QD9 A;  2F51 A;  4ECC A;  4X0X A;  4D73 A;  4NAX A;  2DMM A;  2HNL A;  1X0R A;  3R3E A;  4J2F A;  2VCZ A;  3F4S A;  5DVB A;  3AY8 A;  3CTG A;  5GAN D;  3FYG A;  2HFD A;  4BVX A;  1V40 A;  5BMU A;  2IN3 A;  13GS A;  5HFK A;  1A2L A;  1ERV A;  2C3N A;  4K7O A;  20GS A;  2YV9 A;  4NHZ A;  4PUF C;  4L8E A;  3M3M A;  4ZL7 A;  3DD3 A;  3RPN A;  2HE3 A;  2HRA A;  4YKG A;  5B6M A;  4I2T A;  5J3R A;  3CMI A;  4MF6 A;  2CVB A;  3W8J A;  2H30 A;  2PPT A;  4OO5 A;  1F9M A;  4ZL9 A;  2H6Z A;  11GS A;  5G31 A;  5LNK e;  5D73 A;  6GSV A;  2H0I A;  5G30 A;  3IR4 A;  4WET A;  2A2R A;  2VCV A;  1EV9 A;  3TGZ A;  3WGE A;  4XHM A;  1U88 A;  1TTZ A;  2GS3 A;  4KA0 A;  3FR9 A;  2LNS A;  2H1G A;  3JCM L;  1Y25 A;  4X4J A;  4FYB A;  1XPV A;  1O81 A;  3GMF A;  3QDN A;  1WRY A;  4O5Q A;  2FGX A;  3CXG A;  4MNN A;  4HQS A;  4LMW A;  4L5O A;  3EE2 A;  3LOR A;  2JL4 A;  3UAP A;  5KEJ A;  3VPT A;  5IMV A;  5H5S A;  5KOW A;  4TR3 A;  4IW9 A;  1TRS A;  2HXK A;  2CA8 A;  2OE3 A;  4MZB A;  2JU5 A;  5HR1 A;  2AB6 A;  3M1G A;  2CVK A;  5GZZ B;  4POK A;  2HZF A;  2LUS A;  3FZA A;  1LBK A;  4KB3 A;  2R6K A;  3ERW A;  2PBJ A;  3EWL A;  4N11 A;  2GQK A;  2WDU A;  1AQW A;  5J9B A;  2KLX A;  3BOA A;  2VLT A;  2CX3 A;  3LYP A;  2IIY A;  3DYR A;  3H8Q A;  3IC4 A;  1XWK A;  3CRU A;  4EC0 A;  1MDJ A;  4HZ4 A;  5KOX A;  3GX8 A;  2XBQ A;  1KNG A;  4EKZ A;  8GSS A;  5D96 A;  1SKR B;  2DIZ A;  3VWX A;  1X9W B;  5DCH A;  1ABA A;  3GL3 A;  3D0Z A;  3BBY A;  5IIZ A;  4I5Q A;  1TRW A;  3L4N A;  3APO A;  2QC7 A;  1F3B A;  1GSQ A;  3RHB A;  2DML A;  1GSU A;  5AIX A;  3QOU A;  3UIW A;  4I6X A;  2AV4 A;  2CT6 A;  4KW6 A;  3QFA C;  4K1F A;  3J7Y k;  2VL3 A;  3ZFL A;  1PA3 A;  1FW1 A;  1PFO A;  5F06 A;  2O85 A;  5CRH A;  4AJ8 A;  1SU9 A;  4MZC A;  1ZGN A;  4N0V A;  5IMC A;  2YWM A;  2AJQ B;  2E0Q A;  2N5A A;  1XBS A;  2GQM A;  4ECB A;  3UJ1 A;  1A23 A;  3CSJ A;  4FO5 A;  3CRT A;  3LFL A;  2H71 A;  4FIW A;  1GUK A;  4HJM A;  3QPM A;  1B9X C;  1O73 A;  2B1K A;  2YJ7 A;  3WD6 A;  1EGO A;  2DJ3 A;  2YV7 A;  1GSF A;  1F37 A;  5F05 A;  3MNG A;  4WR4 A;  3VWW A;  2L5O A;  2M46 A;  2H1B A;  1A24 A;  4RQX A;  5F8B A;  1T7P B;  4MLY A;  3GHA A;  3DKS A;  1G7E A;  3BCI A;  2Z9S A;  1SYR A;  3FZ4 A;  4WEY A;  1KBN A;  3LXZ A;  2MZC A;  2YAN A;  2VLV A;  4MK3 A;  2AHE A;  2H1D A;  4IQ1 A;  3TRP A;  3UAR A;  2M80 A;  3S9F A;  5CNW A;  1YDK A;  3KTL A;  2RM5 A;  2WZ9 A;  2KP1 A;  5IOX A;  5DBQ A;  3QFB C;  1GP1 A;  4F0C A;  1GTB A;  4HZ2 A;  2KOK A;  4BWS A;  2IFQ B;  1K3L A;  1JZR A;  2XC2 A;  3PR8 A;  2ZNM A;  4IJ3 A;  3VWV A;  4ZB8 A;  4KH7 A;  4RI6 A;  3ZIJ A;  4I97 A;  2FWH A;  3FRC A;  3Q74 A;  3WGD A;  1EWX A;  2GZP A;  2JSZ A;  4K6X A;  5F0G A;  2H6Y A;  4HOJ A;  3R2Q A;  1PKZ A;  2H72 A;  2JZR A;  1T4Y A;  3MWH A;  3TDG A;  1QXH A;  2JZT A;  1DSB A;  4ZBB A;  6GST A;  4QL9 A;  4O5R A;  5G1L A;  2R0C A;  2R0P A;  3HKR A;  4IS0 A;  3H4K A;  2I3Y A;  3H93 A;  1X5D A;  4XIH A;  3TKS A;  1M2D A;  2A2S A;  1GSY A;  3V1W A;  3GKM A;  2CZ3 A;  1THX A;  3OR5 A;  2IFQ A;  1DBY A;  2CAI A;  3DGQ A;  6GSX A;  5LD0 A;  1CQG A;  4JR4 A;  4ULX A;  1G6W A;  2V32 A;  3HDC A;  2KP2 A;  2WRT A;  2VCQ A;  2VM2 A;  3BD2 A;  4JR6 A;  4OFT A;  4Q5R A;  1I5G A;  4POL A;  1JFU A;  2IME A;  2WJU A;  2HRN A;  4FYU A;  1MD3 A;  1TW9 A;  5FT3 A;  5IMD A;  3MSZ A;  1Q4J A;  2VIM A;  4G0L A;  3N9J A;  1EP7 A;  4IKH A;  4XS6 A;  2HSH A;  3E9J B;  5CRE A;  2YZU A;  3ZZX A;  1FO5 A;  3KJY A;  1JZO A;  5DAK B;  1VF1 A;  3TUE A;  1SK2 A;  2N5B A;  3CTF A;  2HLS A;  3C73 A;  5D9W A;  1ERW A;  2DJJ A;  4MF5 A;  1T1V A;  2MBT A;  1J0F A;  1TRV A;  1QK8 A;  4DVC A;  1ZYP A;  3DXB A;  3HD5 A;  3G9B A;  1MEK A;  1U3I A;  1A2M A;  2A4V A;  3GH6 A;  5DQS A;  1SD8 A;  3KM6 A;  5IO0 A;  3TJF A;  2P31 A;  4ACS A;  3IXR A;  4G19 A;  1U3A A;  5ECP B;  5KN1 A;  4ECI A;  3A5I A;  3FEU A;  2HRF A;  4EO3 A;  2KUC A;  2I1U A;  5DQY A;  1XG8 A;  1XVW A;  2FLS A;  3IAM 2;  5DAK A;  5DCG A;  4FH8 A;  2O8V B;  4DSS B;  2B6M A;  3IE3 A;  2YPM A;  2GVP A;  1OAZ A;  5B6N A;  4TR0 A;  3QAW A;  4IBP A;  2VL2 C;  4ICY A;  2GLR A;  2DJ0 A;  2YN1 A;  1V57 A;  4LL1 B;  1GTA A;  2XBI A;  3PIN A;  1ILO A;  3F6F A;  5H5Q A;  3ISO A;  2B5X A;  1WE0 A;  5CRD A;  2IMI A;  3KIJ A;  5AN1 A;  1MD4 A;  2GQL A;  3LGC A;  2N5F A;  1AAZ A;  5GAP D;  3C1S A;  3GST A;  5HR2 A;  4POM A;  3UBL A;  1XW5 A;  4EIP A;  1OKD A;  4WBJ A;  5CRW A;  3KP8 A;  2X4A A;  4PQ1 A;  2FA8 A;  5DDL A;  4DSS A;  2RUE A;  5B7C A;  2VO4 A;  3L9S A;  1YF0 A;  2LRN A;  1U6T A;  2RM6 A;  3FW2 A;  3UL3 A;  4IJI A;  1AQV A;  5G2Z A;  4MPF A;  3O76 A;  3ZVJ D;  1K3O A;  4E8E A;  2FNO A;  2TRX A;  2DJ1 A;  1FVJ A;  3HXS A;  4WBR D;  3RPP A;  3IV4 A;  5FWG A;  3VPQ A;  1S3A A;  3RHC A;  5IPG A;  4MF7 A;  4EIQ A;  1FAA A;  5IOW A;  2CX4 A;  1WMJ A;  2J23 A;  5AIV A;  3NIV A;  3GSS A;  3P90 A;  4TR1 B;  4ECJ A;  3LG6 A;  2K18 A;  4KSO A;  4BVY B;  2DLX A;  2VAF A;  2FA4 A;  5BRT A;  2LRT A;  4ZB6 A;  1GUM A;  2PN8 A;  1PL2 A;  3IAS 2;  4TW5 A;  1GL8 A;  3ZYW A;  1KEB A;  2IWT A;  4FQU A;  9GSS A;  3ERF A;  3HZ8 A;  3IHQ A;  5ECI B;  3GH9 A;  2GT5 A;  4IGJ A;  2R4V A;  4IHU A;  4NHW A;  3HVS A;  1UA5 A;  1F6M C;  5HFG A;  4KAE A;  1Z6N A;  3HY2 A;  3L0H A;  4NV2 A;  1TRU A;  1R5P A;  3A5W A;  4ZXG A;  4PX1 A;  1TK0 B;  1UC7 A;  2H6X A;  3L78 A;  3HJP A;  1MDI A;  1SL2 B;  1N2A A;  4HQZ A;  3ME7 A;  5G1K A;  1X5C A;  3RBT A;  2IJY A;  2C80 A;  4J57 E;  3Q6O A;  1GH2 A;  4TR1 A;  4GQF A;  3GYK A;  2B5Y A;  1VGL A;  2H0G A;  3TB2 A;  4BVY A;  1SK0 A;  1J9B A;  4NV5 A;  3CSI A;  2C0G A;  1VF4 A;  3IK9 A;  5ABR A;  4G9H A;  4IN0 A;  1O8W A;  3KD0 A;  5EL8 A;  1K0D A;  2PWJ A;  4GLT A;  1SYX A;  2B7K A;  4OFN A;  1YY7 A;  3H1N A;  2YJH A;  1BED A;  5AIS A;  2M72 A;  4TKY A;  4J56 E;  4HJ2 A;  4E8H A;  2YCD A;  3EVI A;  2O87 A;  1PX7 A;  2FWE A;  2FWF A;  2R0G A;  4QL7 A;  4RUV A;  2GT6 A;  1JZW A;  4GSN A;  1BG5 A;  4NMU A;  4QQ7 A;  4IEL A;  4IQA A;  2P0G A;  1OC3 A;  4JRR A;  3FR6 A;  3LYK A;  2AYT A;  5A5K A;  2YWI A;  1N8J A;  2X8G A;  2VL2 A;  3TJB A;  1FVK A;  2LRC A;  2PGT A;  2RII A;  2C3Q A;  4MH2 A;  3GA4 A;  3U5R E;  3CBU A;  5AGY A;  1TJD A;  1WWJ A;  2LEG A;  5D9T A;  2R37 A;  3J7Y b;  3EMX A;  2K8V A;  2TRC P;  2YNX A;  4MP4 A;  4BPY A;  1O6J A;  5DJL A;  4KDX A;  1T00 A;  4L0U A;  3HVV A;  1QMV A;  3TJG A;  1EOH A;  4WF5 A;  2HT9 A;  12GS A;  3CQF A;  2X99 A;  2PVO C;  1M99 A;  3KMN A;  2EIR A;  2NTO A;  1HNA A;  1HQO A;  5IO2 A;  4KUN A;  1OYJ A;  1AUC A;  4A5P A;  3RAZ A;  1GUL A;  1NSW A;  3KH9 A;  18GS A;  1H4O A;  5ECQ B;  1M0U A;  4F2I A;  4K5S A;  4ZIL A;  2DJK A;  2OE1 A;  3ZRD A;  2WFC A;  5CYY A;  1TU8 A;  1M2B A;  2V6K A;  2OBK A;  4K7I A;  1XWB A;  4H86 A;  2F9S A;  3MAK A;  3TJK A;  2AUV A;  4YQU A;  2MYG A;  2X64 A;  2VUP A;  5D93 A;  1AIU A;  4K7N A;  3LEF A;  4WKW A;  22GS A;  4PQI A;  5D8I A;  1O7U A;  4AF2 A;  2CV4 A;  4G10 A;  3UVT A;  4HI7 A;  4XTS A;  3WGX A;  3TRX A;  1HD2 A;  2OJL A;  1FOH A;  2DKI A;  3HCZ A;  2VD1 A;  3EC3 A;  4V2N A;  4PUR A;  2MMA A;  3FZ9 A;  4ZBD A;  5ECN B;  3GKN A;  5ID2 B;  1ZYN A;  5FHI A;  5B8A A;  1TK5 B;  3KTB A;  3QAG A;  1S3C A;  2C1Y A;  4GF0 A;  5IMA A;  3HVX A;  3GL5 A;  1ZZY A;  2OBI A;  3FKF A;  1ML6 A;  1K0C A;  1SKS B;  4KSM A;  4YQM A;  3F3Q A;  4ZBA A;  1M9B A;  4HU9 A;  3ME8 A;  3U6V A;  1XWG A;  3TRQ A;  1JLW A;  2HSY A;  4TOP A;  3HZ4 A;  3D22 A;  2UZ8 A;  2REM A;  1HNC A;  3HJO A;  3ZMK A;  1TKD B;  4TRX A;  4HSC X;  1TOF A;  2P5Q A;  2LV3 A;  4AJ7 A;  5ID2 A;  2MMO A;  2X8H A;  2CVD A;  3ZML A;  2GDR A;  2NDO A;  3GV1 A;  2DSA A;  4TXV A;  2A2P A;  2C0E A;  5B8B A;  5G5F A;  4YH2 A;  4PUA A;  3IBH A;  1Y6E A;  2OKA A;  1B9Y C;  1SK1 A;  1J08 A;  1EGR A;  4HDE A;  1FG4 A;  3UBK A;  4Z2U A;  2ZUP A;  2DBC A;  2V2G A;  1W89 A;  2DJ2 A;  1EOG A;  3EMP A;  2GGT A;  2GST A;  4G0I A;  2VL9 A;  1GTU A;  3VUR A;  1ST9 A;  1YKC A;  1B48 A;  4OCF A;  4EXJ A;  4K2D A;  4N30 A;  2GSS A;  3TKS E;  4CDO A;  1PSQ A;  3A2V A;  4Z2R A;  3GX0 A;  3D4M A;  1Z9H A;  2WUL A;  3RDW A;  5EVO A;  1GSE A;  1NM3 A;  2PU9 C;  5IQY A;  3SBC A;  2E2M A;  1K0N A;  2L57 A;  1TXX A;  3PPU A;  5ECR B;  4ILF A;  2OAD A;  1AXD A;  2FCH A;  1R5A A;  4K5R A;  4DSR A;  4V1A p;  4OMV A;  5COH A;  4K2X A;  2K9F A;  1V98 A;  3F9U A;  1YEP A;  1JLV A;  4K0G A;  17GS A;  2VM1 A;  4AGS A;  1W4V A;  4IP1 A;  5J41 A;  3L9V A;  2R5G A;  2LQQ A;  2XPE A;  2H66 A;  1WOU A;  3Q19 A;  4MDC A;  1XFL A;  1JHB A;  1X9S B;  4Z7X A;  1YQ1 A;  3M9K A;  4Z2T A;  2B3S A;  2J9H A;  2VOC A;  2O7K A;  1ZYE A;  2YZH A;  3KP9 A;  1JZD A;  2ON5 A;  1FB6 A;  1A8L A;  3DML A;  1FOV A;  1QGV A;  3M9J A;  1KTE A;  3D21 A;  3KMO A;  2DKH A;  1NHY A;  4MJA A;  3G7I A;  5IM9 A;  2JAD A;  4MJE A;  3DWV A;  4N0Z A;  3A2W A;  5IPH A;  1ZCP A;  1ZL9 A;  2L6C A;  2ON7 A;  3MYD A;  4I2U A;  1R7H A;  1E6B A;  4OCE A;  3TOT A;  2FD3 A;  1NHO A;  4KDU A;  3LWA A;  3IOS A;  2H01 A;  4XCS A;  1F3A A;  4NWY A;  4DEJ A;  3FR3 A;  1DUG A;  5CP1 A;  4EDZ A;  5ELA A;  3C71 A;  1M7T A;  1X9M B;  1AQX A;  2C8U A;  2G0F A;  1T3B A;  4POB A;  1K0M A;  1K0B A;  4WR5 A;  3TKR A;  2V6O A;  1BX9 A;  5DJM A;  3IC8 A;  3C8E A;  1R26 A;  2IMK A;  3IDV A;  3A2X A;  3F3R A;  3TJJ A;  3DRN A;  1XW9 A;  3F4R A;  3GUS A;  2CZ2 A;  2HRK A;  4TN8 A;  5L71 A;  3UMA A;  4ISD A;  3UEM A;  1PKW A;  5A4V A;  4ID0 A;  5D9V A;  2L4Q A;  3DVW A;  3WT2 A;  1MTC A;  3PGT A;  4PTS A;  2C0D A;  3W8S A;  3TKP A;  2K6V A;  2RUF A; 
#chains in the Genus database with same CATH homology
 3GN3 A;  4JED A;  5LCZ A;  1B4P A;  1T8E B;  3GFK A;  1K3Y A;  2EIQ A;  3GIX A;  1G0T A;  3KGK A;  2H74 A;  1ON4 A;  3US3 A;  1FHE A;  1XXU A;  2QA1 A;  1SL0 B;  2H8L A;  2BTO T;  4JBB A;  4OD7 A;  1SJZ A;  3DEX A;  5G5E A;  1DE1 A;  2F8F A;  3O3T A;  1ACV A;  5KN2 A;  4PQH A;  3HHV A;  4GSS A;  2LJA A;  2AAW A;  2I4A A;  4EL1 A;  3LSZ A;  4TR4 A;  4DSQ A;  14GS A;  1Z7P A;  2IMD A;  5E59 A;  4LLR A;  4PXO A;  3EPT A;  4GST A;  4MJC A;  2C3T A;  3ZLP A;  2IMF A;  4KE3 A;  4HS1 A;  3ZIT A;  1XZO A;  2H75 A;  4AJ6 A;  1OVN A;  2VCX A;  4ML6 A;  4TXO B;  6GSW A;  4EDY A;  4ZIJ A;  4ML1 A;  3F4T A;  2NBS A;  2MBS A;  3PH9 A;  5ELG A;  4CY8 A;  16GS A;  2ES7 A;  4OFM A;  3DIE A;  3ERG A;  3Q18 A;  2CAQ A;  4EF0 A;  5HR0 A;  4BA7 A;  1LU4 A;  3GNJ A;  2FHE A;  2H70 A;  4MCU A;  2WCI A;  1SEN A;  2PVQ A;  2VCW A;  1GNE A;  3LW9 A;  4X43 A;  2JSY A;  1H75 A;  2F3M A;  5A4W A;  4GQC A;  3EYT A;  3HJM A;  1WIK A;  2DC5 A;  3GTU B;  3F6D A;  6GSU A;  5ECK B;  1O8X A;  5JWQ B;  4YQV A;  2IL3 A;  2YWO A;  1SJI A;  1AC1 A;  3MDK A;  3WYW A;  4WF4 A;  1GNW A;  1WP0 A;  4F82 A;  3IA1 A;  1OE8 A;  3ED3 A;  2F8A A;  2VD0 A;  5HR3 A;  1XIY A;  4O5U A;  5J4U A;  4TXO A;  2YWN A;  3D5J A;  3VI5 A;  3VI7 A;  3TCO A;  3GRX A;  2IPA A;  1GRX A;  2BMX A;  2LNT A;  2LS5 A;  5CAX A;  5KN3 A;  1E2Y A;  2E7P A;  4ZL8 A;  1OE7 A;  5KN0 A;  2QA2 A;  4RI7 A;  4V2M A;  1SL1 B;  1OC8 A;  1V2A A;  4PNF A;  4YKF A;  2H73 A;  4WXT A;  5ENU A;  3TKS C;  3EIN A;  1URM A;  1U87 A;  2PMT A;  2I9H A;  5HQP A;  3M0F A;  5C00 A;  1GLP A;  2OA7 A;  1RQM A;  1Z5Y E;  1XWC A;  3APS A;  3GTU A;  1A2J A;  4GCI A;  3L9U A;  2G2Q A;  4HUA A;  2RLI A;  1EEM A;  1RK4 A;  2WGR A;  2L6D A;  4JZQ A;  2JZS A;  4RQR A;  1PN9 A;  5CO3 A;  2QSI A;  1A8Y A;  1UN2 A;  3FMW A;  2LJK A;  3E3E A;  2H1A A;  5EY6 A;  2EC4 A;  2OE0 A;  3FY7 A;  3FHK A;  4MPG A;  6GSS A;  4HU7 A;  4NXI A;  2HSM A;  5F07 A;  3C1R A;  2GZZ A;  5ECH B;  3SWL A;  1HNB A;  4L0W A;  1XOB A;  2KHP A;  4LA1 A;  3GKX A;  4GXZ A;  3IPZ A;  1ZMA A;  2XHF A;  3EU4 A;  3ZVJ A;  1PN0 A;  3IHG A;  1BYE A;  3G7Y A;  5A4U A;  1YZX A;  3MIX A;  1PD2 1;  5GSS A;  1PRX A;  5E4W A;  3DVX A;  5ECL B;  5ECS A;  5JWO B;  5DAL B;  3CSH A;  4KGI A;  1K0A A;  1M2A A;  5INY A;  1QFN A;  3C7M A;  1TU7 A;  2H76 A;  2B7J A;  4N10 A;  3E0U A;  3O6T A;  3P7X A;  2LKU A;  3EU3 A;  4V1A g;  3G7J A;  5JWR B;  4EE0 A;  5ECM B;  1ZOF A;  4OWY A;  4O92 A;  4O7H A;  2YOI A;  3QAV A;  4MA9 A;  1TK8 B;  3BCK A;  5CRG A;  1M9A A;  1GLQ A;  4MZW A;  1RW1 A;  4CW9 A;  3GUR A;  1PGT A;  1UVZ A;  1O85 A;  2QGV A;  4Q5Q A;  1BQ7 A;  3I6A A;  3FK8 A;  5ECO B;  1A0F A;  2NPB A;  4G2E A;  3NZN A;  1GUH A;  2XPD A;  5DAL A;  3KZQ A;  1G7O A;  2FY6 A;  2D2Z A;  3ZTL A;  3KH7 A;  1K0O A;  5J5N A;  4EVM A;  1B8X A;  3UVH A;  2HYX A;  1SD9 A;  3WT1 A;  2E2G A;  2O89 A;  3HA9 A;  3BJ5 A;  2R3X A;  1GWC A;  1PQN A;  3ZRE A;  3HYP A;  1SJ6 A;  2VCT A;  1MDK A;  1AW9 A;  4TVE A;  5D9X A;  1V58 A;  3P2A A;  4KF9 A;  1B4Q A;  1TP9 A;  1BJX A;  4BWQ A;  4Q5N A;  1YJ6 A;  1IYI A;  4F03 A;  1S3D A;  1TI3 A;  5JCW A;  3M8N A;  7GSS A;  4PNG A;  4KCE A;  4LL4 B;  3D6I A;  4F9Z A;  2WS2 A;  4X1U A;  3I69 A;  1USB A;  1XVQ A;  5C04 A;  1ZYQ B;  1VRS D;  2TIR A;  3I43 A;  2X49 A;  4K0N A;  4KCA A;  2PUK C;  4CHS A;  4P3Y B;  4EUY A;  4JE1 A;  2GSQ A;  3GKK A;  4KX4 A;  5IMZ A;  1ERU A;  4L5L A;  3LQ7 A;  1QQ2 A;  4GRF A;  3QMX A;  2DIY A;  3A3T A;  2HI7 A;  3VK9 A;  1Z6M A;  2EIO A;  3F63 A;  1BAY A;  2NVL A;  5JCU A;  1GSD A;  1QUW A;  3F0I A;  2WB9 A;  1GSS A;  1IYH A;  2ZCT A;  3K8N A;  2JAC A;  1WPI A;  3IRA A;  3TOU A;  1TI1 A;  4K8M A;  2ALB A;  2I81 A;  5IMF A;  2C0F A;  6GSY A;  4USS A;  3CYN A;  2FUG 2;  2PER A;  2LJR A;  5EPF A;  10GS A;  2OAC A;  3F8U A;  3VWU A;  1PL1 A;  1Z3E A;  2GTU A;  3EUR A;  4ZB9 A;  2MMZ A;  4IVF A;  3ZIV A;  1EEJ A;  1DE2 A;  4LMV A;  1PMT A;  1YKA A;  3KXO A;  4FYC A;  4O32 A;  1T4Z A;  3VFI A;  4YAV A;  3W6G A;  2LST A;  2B5E A;  3ZL5 A;  4K9Z A;  3I9V 2;  4PGT A;  2GSR A;  2BJX A;  3FZ5 A;  3NOF A;  2H0H A;  1GTI A;  4BL7 B;  2CQ9 A;  4V2L A;  2LQO A;  1VF3 A;  1V9W A;  1TDI A;  1NW2 A;  1OC9 B;  5H5R A;  1PX6 A;  1ERT A;  2R2J A;  4GWR A;  3ZFB A;  2A4H A;  2FWG A;  1FB0 A;  1XOA A;  1EV4 A;  3KEB A;  4XS4 B;  1F2E A;  19GS A;  1C72 A;  2K8S A;  2L59 A;  4CY6 A;  2MMN A;  2B1L A;  5JCG A;  3LJR A;  1Z7R A;  4MJB A;  4I8B A;  1XW6 A;  4HEA 2;  3D4T A;  5J9C A;  2GZY A;  1CQH A;  2HZE B;  4JU5 A;  1WJK A;  4G0K A;  2YP6 A;  3H79 A;  2QKE A;  1HYU A;  3QR6 A;  2P5R A;  4KND A;  4Q5F A;  4NPB A;  4BL7 A;  3APQ A;  1OC9 A;  1I9D A;  1LJR A;  2L4C A;  3N5O A;  4D73 B;  1G6Y A;  1VF2 A;  1EZK A;  3IK7 A;  1R4W A;  1YEX A;  4KDY A;  2LTK A;  1X5E A;  4XS1 A;  3VLN A;  4MMM A;  4MH3 A;  4MAB A;  4XS4 A;  5HFI A;  1A0R P;  4BVX B;  2V1M A;  1OKT A;  1XCC A;  2X8C A;  2V41 A;  2H19 A;  4XRD A;  5GST A;  4F0B A;  3LXT A;  1YF1 A;  2HZE A;  4YAP A;  3KCM A;  3QCP A;  3P8W A;  1EP8 A;  1Q98 A;  4OO4 A;  4XRA A;  2L5L A;  4GTU A;  3UOM A;  1XWA A;  2VLU A;  1SKW B;  4IP6 A;  1THO A;  2C4J A;  3TKQ A;  3QD9 A;  2F51 A;  4ECC A;  4X0X A;  4D73 A;  4NAX A;  2DMM A;  2HNL A;  1X0R A;  3R3E A;  4J2F A;  2VCZ A;  3F4S A;  5DVB A;  3AY8 A;  3CTG A;  5GAN D;  3FYG A;  2HFD A;  4BVX A;  1V40 A;  5BMU A;  2IN3 A;  13GS A;  5HFK A;  1A2L A;  1ERV A;  2C3N A;  4K7O A;  20GS A;  2YV9 A;  4NHZ A;  4PUF C;  4L8E A;  3M3M A;  4ZL7 A;  3DD3 A;  3RPN A;  2HE3 A;  2HRA A;  4YKG A;  5B6M A;  4I2T A;  5J3R A;  3CMI A;  4MF6 A;  2CVB A;  3W8J A;  2H30 A;  2PPT A;  4OO5 A;  1F9M A;  4ZL9 A;  2H6Z A;  11GS A;  5G31 A;  5LNK e;  5D73 A;  6GSV A;  2H0I A;  5G30 A;  3IR4 A;  4WET A;  2A2R A;  2VCV A;  1EV9 A;  3TGZ A;  3WGE A;  4XHM A;  1U88 A;  1TTZ A;  2GS3 A;  4KA0 A;  3FR9 A;  2LNS A;  2H1G A;  3JCM L;  1Y25 A;  4X4J A;  4FYB A;  1XPV A;  1O81 A;  3GMF A;  3QDN A;  1WRY A;  4O5Q A;  2FGX A;  3CXG A;  4MNN A;  4HQS A;  4LMW A;  4L5O A;  3EE2 A;  3LOR A;  2JL4 A;  3UAP A;  5KEJ A;  3VPT A;  5IMV A;  5H5S A;  5KOW A;  4TR3 A;  4IW9 A;  1TRS A;  2HXK A;  2CA8 A;  2OE3 A;  4MZB A;  2JU5 A;  5HR1 A;  2AB6 A;  3M1G A;  2CVK A;  5GZZ B;  4POK A;  2HZF A;  2LUS A;  3FZA A;  1LBK A;  4KB3 A;  2R6K A;  3ERW A;  2PBJ A;  3EWL A;  4N11 A;  2GQK A;  2WDU A;  1AQW A;  5J9B A;  2KLX A;  3BOA A;  2VLT A;  2CX3 A;  3LYP A;  2IIY A;  3DYR A;  3H8Q A;  3IC4 A;  1XWK A;  3CRU A;  4EC0 A;  1MDJ A;  4HZ4 A;  5KOX A;  3GX8 A;  2XBQ A;  1KNG A;  4EKZ A;  8GSS A;  5D96 A;  1SKR B;  2DIZ A;  3VWX A;  1X9W B;  5DCH A;  1ABA A;  3GL3 A;  3D0Z A;  3BBY A;  5IIZ A;  4I5Q A;  1TRW A;  3L4N A;  3APO A;  2QC7 A;  1F3B A;  1GSQ A;  3RHB A;  2DML A;  1GSU A;  5AIX A;  3QOU A;  3UIW A;  4I6X A;  2AV4 A;  2CT6 A;  4KW6 A;  3QFA C;  4K1F A;  3J7Y k;  2VL3 A;  3ZFL A;  1PA3 A;  1FW1 A;  5F06 A;  2O85 A;  5CRH A;  4AJ8 A;  1SU9 A;  4MZC A;  1ZGN A;  4N0V A;  5IMC A;  2YWM A;  2AJQ B;  2E0Q A;  2N5A A;  1XBS A;  2GQM A;  4ECB A;  3UJ1 A;  1A23 A;  3CSJ A;  4FO5 A;  3CRT A;  3LFL A;  2H71 A;  4FIW A;  1GUK A;  4HJM A;  3QPM A;  1B9X C;  1O73 A;  2B1K A;  2YJ7 A;  3WD6 A;  1EGO A;  2DJ3 A;  2YV7 A;  1GSF A;  1F37 A;  5F05 A;  3MNG A;  4WR4 A;  3VWW A;  2L5O A;  2M46 A;  2H1B A;  1A24 A;  4RQX A;  5F8B A;  1T7P B;  4MLY A;  3GHA A;  3DKS A;  1G7E A;  3BCI A;  2Z9S A;  1SYR A;  3FZ4 A;  4WEY A;  1KBN A;  3LXZ A;  2MZC A;  2YAN A;  2VLV A;  4MK3 A;  2AHE A;  2H1D A;  4IQ1 A;  3TRP A;  3UAR A;  2M80 A;  3S9F A;  5CNW A;  1YDK A;  3KTL A;  2RM5 A;  2WZ9 A;  2KP1 A;  5IOX A;  5DBQ A;  3QFB C;  1GP1 A;  4F0C A;  1GTB A;  4HZ2 A;  2KOK A;  4BWS A;  2IFQ B;  1K3L A;  1JZR A;  2XC2 A;  3PR8 A;  2ZNM A;  4IJ3 A;  3VWV A;  4ZB8 A;  4KH7 A;  4RI6 A;  3ZIJ A;  4I97 A;  2FWH A;  3FRC A;  3Q74 A;  3WGD A;  1EWX A;  2GZP A;  2JSZ A;  4K6X A;  5F0G A;  2H6Y A;  4HOJ A;  3R2Q A;  1PKZ A;  2H72 A;  2JZR A;  1T4Y A;  3MWH A;  3TDG A;  1QXH A;  2JZT A;  1DSB A;  4ZBB A;  6GST A;  4QL9 A;  4O5R A;  5G1L A;  2R0C A;  2R0P A;  3HKR A;  4IS0 A;  3H4K A;  2I3Y A;  3H93 A;  1X5D A;  4XIH A;  3TKS A;  1M2D A;  2A2S A;  1GSY A;  3V1W A;  3GKM A;  2CZ3 A;  1THX A;  3OR5 A;  2IFQ A;  1DBY A;  2CAI A;  3DGQ A;  6GSX A;  5LD0 A;  1CQG A;  4JR4 A;  4ULX A;  1G6W A;  2V32 A;  3HDC A;  2KP2 A;  2WRT A;  2VCQ A;  2VM2 A;  3BD2 A;  4JR6 A;  4OFT A;  4Q5R A;  1I5G A;  4POL A;  1JFU A;  2IME A;  2WJU A;  2HRN A;  4FYU A;  1MD3 A;  1TW9 A;  5FT3 A;  5IMD A;  3MSZ A;  1Q4J A;  2VIM A;  4G0L A;  3N9J A;  1EP7 A;  4IKH A;  4XS6 A;  2HSH A;  3E9J B;  5CRE A;  2YZU A;  3ZZX A;  1FO5 A;  3KJY A;  1JZO A;  5DAK B;  1VF1 A;  3TUE A;  1SK2 A;  2N5B A;  3CTF A;  2HLS A;  3C73 A;  5D9W A;  1ERW A;  2DJJ A;  4MF5 A;  1T1V A;  2MBT A;  1J0F A;  1TRV A;  1QK8 A;  4DVC A;  1ZYP A;  3DXB A;  3HD5 A;  3G9B A;  1MEK A;  1U3I A;  1A2M A;  2A4V A;  3GH6 A;  5DQS A;  1SD8 A;  3KM6 A;  5IO0 A;  3TJF A;  2P31 A;  4ACS A;  3IXR A;  4G19 A;  1U3A A;  5ECP B;  5KN1 A;  4ECI A;  3A5I A;  3FEU A;  2HRF A;  4EO3 A;  2KUC A;  2I1U A;  5DQY A;  1XVW A;  2FLS A;  3IAM 2;  5DAK A;  5DCG A;  4FH8 A;  2O8V B;  4DSS B;  2B6M A;  3IE3 A;  2YPM A;  2GVP A;  1OAZ A;  5B6N A;  4TR0 A;  3QAW A;  4IBP A;  2VL2 C;  4ICY A;  2GLR A;  2DJ0 A;  2YN1 A;  1V57 A;  4LL1 B;  1GTA A;  2XBI A;  3PIN A;  1ILO A;  3F6F A;  5H5Q A;  3ISO A;  2B5X A;  1WE0 A;  5CRD A;  2IMI A;  3KIJ A;  5AN1 A;  1MD4 A;  2GQL A;  3LGC A;  2N5F A;  1AAZ A;  5GAP D;  3C1S A;  3GST A;  5HR2 A;  4POM A;  3UBL A;  1XW5 A;  4EIP A;  1OKD A;  4WBJ A;  5CRW A;  3KP8 A;  2X4A A;  4PQ1 A;  2FA8 A;  5DDL A;  4DSS A;  2RUE A;  5B7C A;  2VO4 A;  3L9S A;  1YF0 A;  2LRN A;  1U6T A;  2RM6 A;  3FW2 A;  3UL3 A;  4IJI A;  1AQV A;  5G2Z A;  4MPF A;  3O76 A;  3ZVJ D;  1K3O A;  4E8E A;  2FNO A;  2TRX A;  2DJ1 A;  1FVJ A;  3HXS A;  4WBR D;  3RPP A;  3IV4 A;  5FWG A;  3VPQ A;  1S3A A;  3RHC A;  5IPG A;  4MF7 A;  4EIQ A;  1FAA A;  5IOW A;  2CX4 A;  1WMJ A;  2J23 A;  5AIV A;  3NIV A;  3GSS A;  3P90 A;  4TR1 B;  4ECJ A;  3LG6 A;  2K18 A;  4KSO A;  4BVY B;  2DLX A;  2VAF A;  2FA4 A;  5BRT A;  2LRT A;  4ZB6 A;  1GUM A;  2PN8 A;  1PL2 A;  3IAS 2;  4TW5 A;  1GL8 A;  3ZYW A;  1KEB A;  2IWT A;  4FQU A;  9GSS A;  3ERF A;  3HZ8 A;  3IHQ A;  5ECI B;  3GH9 A;  2GT5 A;  4IGJ A;  2R4V A;  4IHU A;  4NHW A;  3HVS A;  1UA5 A;  1F6M C;  5HFG A;  4KAE A;  1Z6N A;  3HY2 A;  3L0H A;  4NV2 A;  1TRU A;  1R5P A;  3A5W A;  4ZXG A;  4PX1 A;  1TK0 B;  1UC7 A;  2H6X A;  3L78 A;  3HJP A;  1MDI A;  1SL2 B;  1N2A A;  4HQZ A;  3ME7 A;  5G1K A;  1X5C A;  3RBT A;  2IJY A;  2C80 A;  4J57 E;  3Q6O A;  1GH2 A;  4TR1 A;  4GQF A;  3GYK A;  2B5Y A;  1VGL A;  2H0G A;  3TB2 A;  4BVY A;  1SK0 A;  1J9B A;  4NV5 A;  3CSI A;  2C0G A;  1VF4 A;  3IK9 A;  5ABR A;  4G9H A;  4IN0 A;  1O8W A;  3KD0 A;  5EL8 A;  1K0D A;  2PWJ A;  4GLT A;  1SYX A;  2B7K A;  4OFN A;  1YY7 A;  3H1N A;  2YJH A;  1BED A;  5AIS A;  2M72 A;  4TKY A;  4J56 E;  4HJ2 A;  4E8H A;  2YCD A;  3EVI A;  2O87 A;  1PX7 A;  2FWE A;  2FWF A;  2R0G A;  4QL7 A;  4RUV A;  2GT6 A;  1JZW A;  4GSN A;  1BG5 A;  4NMU A;  4QQ7 A;  4IEL A;  4IQA A;  2P0G A;  1OC3 A;  4JRR A;  3FR6 A;  3LYK A;  2AYT A;  5A5K A;  2YWI A;  1N8J A;  2X8G A;  2VL2 A;  3TJB A;  1FVK A;  2LRC A;  2PGT A;  2RII A;  2C3Q A;  4MH2 A;  3GA4 A;  3U5R E;  3CBU A;  5AGY A;  1TJD A;  1WWJ A;  2LEG A;  5D9T A;  2R37 A;  3J7Y b;  3EMX A;  2K8V A;  2TRC P;  2YNX A;  4MP4 A;  4BPY A;  1O6J A;  5DJL A;  4KDX A;  1T00 A;  4L0U A;  3HVV A;  1QMV A;  3TJG A;  1EOH A;  4WF5 A;  2HT9 A;  12GS A;  2X99 A;  2PVO C;  1M99 A;  3KMN A;  2EIR A;  2NTO A;  1HNA A;  1HQO A;  5IO2 A;  4KUN A;  1OYJ A;  1AUC A;  4A5P A;  3RAZ A;  1GUL A;  1NSW A;  3KH9 A;  18GS A;  1H4O A;  5ECQ B;  1M0U A;  4F2I A;  4K5S A;  4ZIL A;  2DJK A;  2OE1 A;  3ZRD A;  2WFC A;  5CYY A;  1TU8 A;  1M2B A;  2V6K A;  2OBK A;  4K7I A;  1XWB A;  4H86 A;  2F9S A;  3MAK A;  3TJK A;  2AUV A;  4YQU A;  2MYG A;  2X64 A;  2VUP A;  5D93 A;  1AIU A;  4K7N A;  3LEF A;  4WKW A;  22GS A;  4PQI A;  5D8I A;  1O7U A;  4AF2 A;  2CV4 A;  4G10 A;  3UVT A;  4HI7 A;  4XTS A;  3WGX A;  3TRX A;  1HD2 A;  2OJL A;  1FOH A;  2DKI A;  3HCZ A;  2VD1 A;  3EC3 A;  4V2N A;  4PUR A;  2MMA A;  3FZ9 A;  4ZBD A;  5ECN B;  3GKN A;  5ID2 B;  1ZYN A;  5FHI A;  5B8A A;  1TK5 B;  3KTB A;  3QAG A;  1S3C A;  2C1Y A;  4GF0 A;  5IMA A;  3HVX A;  3GL5 A;  1ZZY A;  2OBI A;  3FKF A;  1ML6 A;  1K0C A;  1SKS B;  4KSM A;  4YQM A;  3F3Q A;  4ZBA A;  1M9B A;  4HU9 A;  3ME8 A;  3U6V A;  1XWG A;  3TRQ A;  1JLW A;  2HSY A;  4TOP A;  3HZ4 A;  3D22 A;  2UZ8 A;  2REM A;  1HNC A;  3HJO A;  3ZMK A;  1TKD B;  4TRX A;  1TOF A;  2P5Q A;  2LV3 A;  4AJ7 A;  5ID2 A;  2MMO A;  2X8H A;  2CVD A;  3ZML A;  2GDR A;  2NDO A;  3GV1 A;  2DSA A;  4TXV A;  2A2P A;  2C0E A;  5B8B A;  5G5F A;  4YH2 A;  4PUA A;  3IBH A;  1Y6E A;  2OKA A;  1B9Y C;  1SK1 A;  1J08 A;  1EGR A;  4HDE A;  1FG4 A;  3UBK A;  4Z2U A;  2ZUP A;  2DBC A;  2V2G A;  1W89 A;  2DJ2 A;  1EOG A;  3EMP A;  2GGT A;  2GST A;  4G0I A;  2VL9 A;  1GTU A;  3VUR A;  1ST9 A;  1YKC A;  1B48 A;  4OCF A;  4EXJ A;  4K2D A;  4N30 A;  2GSS A;  3TKS E;  4CDO A;  1PSQ A;  3A2V A;  4Z2R A;  3GX0 A;  3D4M A;  1Z9H A;  2WUL A;  3RDW A;  5EVO A;  1GSE A;  1NM3 A;  2PU9 C;  5IQY A;  3SBC A;  2E2M A;  1K0N A;  2L57 A;  1TXX A;  3PPU A;  5ECR B;  4ILF A;  2OAD A;  1AXD A;  2FCH A;  1R5A A;  4K5R A;  4DSR A;  4V1A p;  4OMV A;  5COH A;  4K2X A;  2K9F A;  1V98 A;  3F9U A;  1YEP A;  1JLV A;  4K0G A;  17GS A;  2VM1 A;  4AGS A;  1W4V A;  4IP1 A;  5J41 A;  3L9V A;  2R5G A;  2LQQ A;  2XPE A;  2H66 A;  1WOU A;  3Q19 A;  4MDC A;  1XFL A;  1JHB A;  1X9S B;  4Z7X A;  1YQ1 A;  3M9K A;  4Z2T A;  2B3S A;  2J9H A;  2VOC A;  2O7K A;  1ZYE A;  2YZH A;  3KP9 A;  1JZD A;  2ON5 A;  1FB6 A;  1A8L A;  3DML A;  1FOV A;  1QGV A;  3M9J A;  1KTE A;  3D21 A;  3KMO A;  2DKH A;  1NHY A;  4MJA A;  3G7I A;  5IM9 A;  2JAD A;  4MJE A;  3DWV A;  4N0Z A;  3A2W A;  5IPH A;  1ZCP A;  1ZL9 A;  2L6C A;  2ON7 A;  3MYD A;  4I2U A;  1R7H A;  1E6B A;  4OCE A;  3TOT A;  2FD3 A;  1NHO A;  4KDU A;  3LWA A;  3IOS A;  2H01 A;  4XCS A;  1F3A A;  4NWY A;  4DEJ A;  3FR3 A;  1DUG A;  5CP1 A;  4EDZ A;  5ELA A;  3C71 A;  1M7T A;  1X9M B;  1AQX A;  2C8U A;  2G0F A;  1T3B A;  4POB A;  1K0M A;  1K0B A;  4WR5 A;  3TKR A;  2V6O A;  1BX9 A;  5DJM A;  3IC8 A;  3C8E A;  1R26 A;  2IMK A;  3IDV A;  3A2X A;  3F3R A;  3TJJ A;  3DRN A;  1XW9 A;  3F4R A;  3GUS A;  2CZ2 A;  2HRK A;  4TN8 A;  5L71 A;  3UMA A;  4ISD A;  3UEM A;  1PKW A;  5A4V A;  4ID0 A;  5D9V A;  2L4Q A;  3DVW A;  3WT2 A;  1MTC A;  3PGT A;  4PTS A;  2C0D A;  3W8S A;  3TKP A;  2K6V A;  2RUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...