3DVWA

Crystal structure of reduced dsba1 from neisseria meningitidis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
PAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAHLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTAFDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural study of the homologues of the thiol-disulfide oxidoreductase DsbA in Neisseria meningitidis.
pubmed doi rcsb
molecule keywords Thiol:disulfide interchange protein DsbA
molecule tags Oxidoreductase
source organism Neisseria meningitidis mc58
total genus 71
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dvwA00
2DIYA 1ST9A 1GSUA 1M99A 2ZUPA 3FKFA 3GMFA 4KH7A 2DJ1A 4MCUA 1E6BA 10GSA 1ZOFA 3ZIJA 2K6VA 4MMMA 1U87A 2GT6A 4F0CA 3D0ZA 1A23A 2LQQA 5ECOB 1LJRA 2GTUA 2LRNA 4XIHA 3LXZA 2OA7A 2DBCA 3LJRA 3I9V2 1XOAA 2GQMA 2CAQA 2M46A 4MK3A 1QQ2A 3DD3A 4PNFA 1S3AA 2B1KA 4D73B 2O8VB 1O81A 1X5CA 3KTLA 4MLYA 4JR6A 5GSTA 4F9ZA 4ZL8A 2I4AA 4XRAA 5IM9A 2IMIA 2GT5A 1Q4JA 1BYEA 2OJLA 1SD9A 4G19A 5EL8A 2YPMA 3BOAA 4PQ1A 2JU5A 1JLVA 4ILFA 2NVLA 5JCWA 1GULA 1R26A 3RBTA 2R6KA 3MNGA 2YCDA 2MBSA 2LRTA 2O85A 2FWFA 3HYPA 1GSFA 1V2AA 1FB6A 2V1MA 2AV4A 4POBA 4XTSA 4PQIA 4IP1A 4IBPA 4I2UA 4KGIA 1N2AA 3FRCA 3R2QA 2YWMA 1O73A 4MA9A 3E3EA 3HZ4A 2K8SA 1EOGA 3M9KA 5IOWA 4LMWA 3LXTA 1FB0A 1XWKA 2JZSA 6GSWA 2NTOA 2DJ3A 2NDOA 2GQLA 3DKSA 1XOBA 4XCSA 2QSIA 4GLTA 1KTEA 4AJ7A 1GH2A 2YN1A 3QMXA 2LEGA 2O89A 5EY6A 3C7MA 1K0OA 3C1SA 1R5AA 2LKUA 4XS4A 2VOCA 3L0HA 1RQMA 1SD8A 3BBYA 1QGVA 1VF1A 2O87A 3VK9A 2YWNA 2JL4A 5B6MA 1O7UA 1TI3A 4K0NA 2K18A 2WB9A 1ZCPA 5H5QA 4PQHA 4TKYA 2CZ3A 1YF0A 2XPDA 4MPFA 3WGDA 1PL1A 1X0RA 3GUSA 2JACA 5CP1A 4MP4A 1TP9A 2RUEA 1B9XC 3CTFA 2HZEA 4WF4A 5DALA 1XWBA 5GZZB 1S3DA 3ZMKA 20GSA 2FD3A 3CRUA 1K0NA 4L0UA 4KW6A 1UN2A 2DJKA 4KSMA 3TKSC 1XWCA 5DCGA 1G7EA 3G7IA 3D6IA 3J7Yb 2YZUA 4NV5A 2P5QA 1XIYA 5IMFA 3UL3A 3VWVA 3VWUA 2L5LA 2OBIA 1EGOA 1XBSA 2M80A 2YNXA 1QK8A 1FAAA 3CXGA 1GTBA 1U3AA 3HY2A 2X8HA 4K1FA 5B8BA 4EXJA 3H93A 6GSSA 5F06A 4NHZA 4IGJA 4TR3A 1XW5A 2L57A 1I9DA 1HD2A 19GSA 4ACSA 2VCXA 4LMVA 3LGCA 5ECPB 1TK8B 2Z9SA 1NHYA 3EWLA 4ZILA 3UOMA 2E2GA 2LSTA 2GSTA 2VIMA 1PSQA 2V32A 1GTAA 1THXA 5D9WA 4HEA2 1EEJA 2V6OA 1X9WB 4LL4B 4OFNA 3DEXA 4RI6A 3GKMA 2DSAA 3IR4A 3RDWA 3F4RA 1XWGA 3HJMA 1ILOA 3WT1A 2N5AA 1WJKA 4NV2A 3KMNA 2VCVA 1X5EA 5IOXA 2H1GA 3DMLA 5JCGA 1A2JA 1J08A 4JZQA 6GSUA 2H19A 1PKZA 1AIUA 3NIVA 2H71A 2DC5A 2TIRA 4GRFA 2VLVA 5H5RA 1G6YA 3ME7A 1WE0A 5ECNB 2HXKA 3F6FA 2IIYA 1W89A 6GSYA 3DVWA 4IELA 2HRFA 2YJHA 3DWVA 4N10A 3FY7A 3CBUA 5G5EA 5AGYA 2H76A 2JADA 1V9WA 4K9ZA 3I6AA 4AGSA 1G0TA 3FZ9A 2YANA 3Q18A 4EDYA 1HNBA 3GURA 4BA7A 4O92A 4P3YB 4KDXA 4K6XA 4GSSA 4MF7A 4POMA 4TR1B 4ECIA 1DUGA 1Y25A 1MDIA 2GSQA 2B5EA 5ABRA 2N5FA 3U6VA 2N5BA 3P90A 2IFQA 4XS6A 2FHEA 1GSQA 1H4OA 3HA9A 3TOTA 2JZTA 3TKRA 4BWSA 3SBCA 2VCTA 4YQUA 2V2GA 4KB3A 2B3SA 3FK8A 2VAFA 3GKXA 2HZFA 2VD0A 3I69A 5KN1A 1NHOA 4L0WA 2VCQA 3BCIA 2MMZA 4NXIA 3GNJA 1DE1A 5G2ZA 1X5DA 2BMXA 2XBIA 4RI7A 3UMAA 1EOHA 4BWQA 5HFIA 5IMVA 4PGTA 2P0GA 1TJDA 3J7Yk 3TKQA 4RUVA 1FVJA 3W6GA 1X9SB 2H73A 1M7TA 1M9BA 1V98A 3APOA 5A4UA 3GYKA 4BPYA 1TRUA 2AB6A 3F9UA 4K7NA 1QXHA 3ERGA 2GDRA 4K2DA 1ZGNA 3QD9A 3VURA 4PX1A 3QAWA 4GF0A 2LQOA 3DYRA 3LYPA 3F0IA 1SL0B 5J41A 3LG6A 1QMVA 3FZ5A 2C80A 3KIJA 5G1KA 4XHMA 3IHQA 3L78A 1ERWA 4K7OA 5D9TA 5KEJA 3GKNA 5F8BA 1Z3EA 2L4CA 3LEFA 4MJEA 1XVQA 2H74A 3BD2A 3ZLPA 1SENA 5DBQA 2E7PA 5J3RA 4DVCA 2H6YA 4BVYA 1T3BA 2VLTA 5LNKe 2MMAA 1A8YA 2J9HA 3EU3A 3US3A 3IAS2 4O32A 1NSWA 3ZFBA 3GKKA 4EUYA 1F37A 1PN9A 3HJPA 2CT6A 1IYIA 2GS3A 1BQ7A 3H1NA 2R5GA 2H75A 2KOKA 3C73A 1VGLA 4GTUA 3E9JB 3IK7A 5E4WA 1GUKA 1XPVA 4HZ2A 4I97A 2P5RA 1WP0A 1M2DA 3CSHA 4EO3A 4X43A 3RHCA 2VUPA 4KAEA 4F82A 3KCMA 5IO0A 1ZYEA 1VF2A 4FH8A 2G2QA 3TJBA 1F6MC 3C71A 3TRPA 3GL3A 1EEMA 3DXBA 3CTGA 3GSTA 2L6DA 1GSDA 2V41A 4EL1A 1ML6A 2OBKA 3UJ1A 3FHKA 3TJJA 3FR6A 2JSZA 4RQXA 2AJQB 2IMKA 1SKSB 2H72A 3GHAA 3GH6A 2LV3A 3DVXA 1CQGA 4MF6A 4YAVA 1TRVA 5G5FA 4QL9A 3MSZA 5EVOA 2HZEB 4XRDA 5DALB 5DJLA 3JCML 3LQ7A 2HT9A 1A0FA 3V1WA 4Q5FA 3O6TA 5DCHA 4JRRA 4JE1A 18GSA 1MTCA 3ISOA 3QFAC 3Q19A 1JHBA 4HDEA 4WR5A 2KUCA 2I9HA 5IPGA 1R5PA 3UVHA 3ZVJD 3TRXA 2HYXA 1K0AA 4KX4A 3AY8A 4IW9A 2X64A 5A5KA 3NOFA 2FUG2 4ZBAA 4MZBA 3M8NA 1XZOA 4MJCA 4ZL9A 1YF1A 2C0EA 4LA1A 1Z6NA 4JU5A 5IMDA 1T4YA 2QKEA 1WMJA 3P2AA 5C04A 4V1Ap 5DVBA 4V2LA 4AJ6A 2YV7A 1FVKA 2WS2A 4FIWA 2LJKA 5HFKA 5IO2A 2WJUA 3Q6OA 3GN3A 4KCAA 8GSSA 2PERA 3GA4A 4TXVA 2XPEA 2C4JA 3KGKA 1GTIA 1M2BA 5CNWA 4WF5A 4CW9A 2XC2A 2B7JA 3D22A 1TRWA 1MD4A 2PPTA 4BL7A 5CRGA 3OR5A 4KCEA 1EP7A 3MWHA 1WRYA 4K8MA 4PXOA 2YWOA 2GQKA 1K0DA 1OAZA 4O5RA 2TRCP 3GRXA 4NAXA 2GGTA 2X99A 1K3YA 3RPPA 16GSA 1HNCA 1YDKA 4GQCA 4EVMA 1C72A 2GZZA 2MMNA 2VL9A 3WT2A 3HVVA 1Q98A 4ECBA 1RW1A 4TW5A 2CV4A 1SJZA 3TOUA 1YZXA 2GVPA 4NPBA 3G7YA 4E8HA 1SKWB 3UAPA 2PN8A 2GLRA 1T7PB 3UBKA 3VWWA 3GV1A 5DDLA 2LS5A 2EC4A 5CO3A 4EDZA 4WBRD 1WIKA 5LD0A 11GSA 1XFLA 2WZ9A 5D8IA 2H6XA 4PURA 3IA1A 4IN0A 1O8WA 3PH9A 2IFQB 1ERUA 3PINA 1YJ6A 1OVNA 4O7HA 5IPHA 4WXTA 4KE3A 4G2EA 1Z7PA 4N30A 4HS1A 3KXOA 2VCZA 3GFKA 3UBLA 4TRXA 2FNOA 2IJYA 2LRCA 4J57E 5D73A 5ELAA 4KDYA 1F3AA 1K0BA 4EF0A 1A0RP 5ECIB 1T8EB 1VF3A 3VPQA 2WCIA 2H66A 3VI7A 2FA4A 3H79A 5CREA 1GNWA 3K8NA 3QAGA 3EC3A 2X8CA 4EC0A 2RM6A 1K0MA 2YOIA 1S3CA 2GSRA 4KA0A 3ZRDA 1XCCA 2ZNMA 2WFCA 1BG5A 5D9VA 2E2MA 1PA3A 1ZYQB 2B6MA 2KP1A 4HI7A 5CYYA 4MH2A 4Q5NA 3ZMLA 4IJIA 3TRQA 1K3LA 2L6CA 2DJ0A 1SJIA 3ZITA 1N8JA 5ELGA 3UVTA 3HXSA 1PQNA 2H30A 5COHA 4TR0A 4MZWA 2HRNA 2CVDA 1EV9A 1TOFA 2R2JA 4DSRA 1JFUA 3VLNA 4V2MA 1SU9A 3CSJA 3ZL5A 4HOJA 2WDUA 4Q5QA 2B1LA 2ZCTA 3BJ5A 4AJ8A 4OCEA 1VF4A 2A4VA 5IMCA 2YJ7A 2DJ2A 2LNTA 4IJ3A 3A5WA 1TTZA 2P31A 3IRAA 4ML6A 2I3YA 1OE8A 3N9JA 4IP6A 4DEJA 3CRTA 1G6WA 2HI7A 4GSTA 3P8WA 1GSYA 3HHVA 3PR8A 1AXDA 1J0FA 2DIZA 5AIVA 3NZNA 2V6KA 5B6NA 4YQVA 3M3MA 5ECQB 3EMPA 2NBSA 3FEUA 2KP2A 3KZQA 5D96A 3C1RA 1OC9A 1TK0B 4F03A 1ZL9A 1BAYA 1TU7A 1Z5YE 5DQYA 2MYGA 3TJKA 1F2EA 5J9CA 2H0IA 4DSQA 1JZOA 3QFBC 2VM1A 1M2AA 3G9BA 5IIZA 4MABA 1GSEA 2FGXA 3HKRA 1USBA 2AAWA 3F3RA 1PX6A 1JLWA 3KP9A 1WWJA 5ECRB 3U5RE 3H8QA 2IN3A 4WETA 3HVXA 4QL7A 1A2LA 1O6JA 3M0FA 2I1UA 3CSIA 3QR6A 2F9SA 2YWIA 4TXOB 1U3IA 1XWAA 2FWEA 3ERFA 2HSHA 3SWLA 1V57A 2L59A 5JWRB 5F0GA 4GCIA 1ERVA 1GP1A 5HFGA 4KUNA 4I2TA 2QC7A 3TDGA 4QQ7A 4POLA 1GRXA 4V2NA 3GTUB 5L71A 4FO5A 3TKPA 4ML1A 5B7CA 1A8LA 2PBJA 4PUAA 3F4SA 1GUMA 3EVIA 3QDNA 3FW2A 1UVZA 2VL3A 22GSA 4Z7XA 1A2MA 2R4VA 2F3MA 1YQ1A 3DRNA 4CHSA 3Q74A 2FWGA 2J23A 5HR2A 2ON5A 2IWTA 5F07A 2HFDA 4JR4A 4ZXGA 2OE1A 1YKAA 1CQHA 2FLSA 2HLSA 1SL1B 1SYXA 2FA8A 3IK9A 1GNEA 5FT3A 3D5JA 3KM6A 2O7KA 1TKDB 3EU4A 1GWCA 3O76A 4J56E 3IC4A 3HJOA 2K8VA 1EP8A 4PUFC 1ON4A 2C0FA 1R7HA 3CYNA 2CX4A 2EIRA 4EE0A 1SJ6A 4WBJA 4MZCA 2YZHA 2R37A 4FYBA 2PUKC 5HQPA 2CVBA 3VPTA 3FR3A 5HR1A 3GL5A 4KNDA 3M1GA 4NWYA 1B9YC 2IL3A 2XBQA 2VLUA 3IOSA 4K7IA 4IKHA 3F63A 3DGQA 3ZTLA 3N5OA 4GQFA 5DQSA 3F8UA 4YQMA 5A4WA 1BX9A 3BCKA 1I5GA 4ID0A 1UC7A 1U6TA 5IQYA 1XW6A 3P7XA 4TVEA 1PD21 1AW9A 4Q5RA 4OWYA 2DLXA 2K9FA 3VFIA 4G9HA 4N11A 3IBHA 3IXRA 4OFMA 2C0DA 4RQRA 5JWQB 4IQ1A 2DJJA 3QOUA 2LJRA 3TJFA 4OO4A 2EIOA 2QGVA 4HJ2A 5ECSA 2HSYA 4TN8A 4TOPA 4OO5A 5E59A 1O8XA 1OYJA 1MEKA 1ZZYA 4TXOA 5GAND 2YV9A 3H4KA 2R3XA 3LSZA 3GIXA 4XS1A 2C3NA 4L8EA 3VI5A 1BEDA 1T1VA 4OMVA 3F6DA 4X0XA 3EE2A 1PGTA 3APSA 2MZCA 3GTUA 3ZREA 3L9UA 4HUAA 2TRXA 14GSA 1F9MA 2H1BA 2LNSA 3QAVA 5G30A 2WULA 1XVWA 1EWXA 5A4VA 2C8UA 4GSNA 1Z7RA 1GSSA 3ME8A 3HDCA 2WGRA 1MDJA 2MBTA 5D93A 2OACA 4DSSA 2OADA 3ZYWA 1ERTA 1IYHA 2YP6A 3WD6A 3KJYA 5DJMA 5LCZA 1Z6MA 5ECLB 2GZYA 1EZKA 2VL2A 2IMFA 2M72A 3FYGA 5G31A 5ID2B 3GX0A 4MDCA 2L5OA 4FYUA 5GSSA 2LJAA 1KEBA 4JEDA 2BJXA 4JBBA 5JWOB 2RLIA 1FHEA 4HQZA 5AIXA 2OKAA 4ZIJA 1B4QA 4GWRA 5CRDA 3G7JA 4ECCA 1R4WA 3CMIA 4MJAA 3LFLA 17GSA 3ZIVA 1OE7A 2ON7A 1F3BA 5CAXA 1SL2B 1A24A 1PX7A 2HE3A 5ECMB 3E0UA 1GLPA 3L9VA 3WGXA 2LUSA 4MH3A 5HR3A 1DBYA 5DAKA 3UIWA 5KN0A 2H6ZA 3QCPA 3UEMA 2VM2A 4V1Ag 2FCHA 4WKWA 3HCZA 4GXZA 1V58A 2H1DA 1QUWA 1TRSA 1B4PA 2PU9C 3I43A 4KSOA 5G1LA 1LBKA 2A2SA 1EGRA 3DIEA 5B8AA 1B8XA 13GSA 3LYKA 4FYCA 4E8EA 2H1AA 1OC9B 3FZAA 4F0BA 4PNGA 2VCWA 5AN1A 1T00A 1TU8A 5CRHA 3L4NA 2NPBA 4OCFA 2CX3A 4BVXA 4H86A 4OD7A 3A2WA 1K0CA 1JZRA 3KTBA 3IDVA 2H70A 3HD5A 5CRWA 1B48A 1GL8A 1AC1A 5EPFA 2ALBA 1WOUA 4IS0A 4YAPA 1TDIA 4D73A 1XXUA 2F51A 1NM3A 2C0GA 2WRTA 1H75A 1ZMAA 3RHBA 2OE0A 3KEBA 1X9MB 2DMMA 5H5SA 1WPIA 2B5XA 3IV4A 3D21A 1RK4A 4NMUA 4I8BA 4WEYA 3LWAA 1SK2A 4N0VA 2A2RA 2VD1A 5IMZA 5ID2A 3C8EA 5KN3A 2H01A 1DSBA 2BTOT 4NHWA 3VWXA 2RM5A 2AUVA 3M9JA 4LLRA 6GSVA 3KH7A 2OE3A 5FWGA 3KH9A 1OC8A 4L5OA 4OFTA 1FW1A 5C00A 4ZB9A 3RPNA 1THOA 2VO4A 3W8SA 4HU9A 5AISA 1YEPA 3UARA 1HYUA 3A3TA 1TI1A 2AYTA 3IPZA 3GX8A 1URMA 6GSXA 3RAZA 2D2ZA 5ECKB 5ECHB 4IHUA 3W8JA 1W4VA 4WR4A 2PWJA 3HZ8A 4CDOA 2HNLA 2PVQA 3WGEA 3F3QA 4HJMA 2KHPA 3FR9A 2IPAA 3A2XA 1SK0A 1AUCA 12GSA 2B5YA 1ACVA 2CQ9A 3D4TA 1TW9A 6GSTA 2MMOA 2FY6A 1GUHA 2XHFA 1PMTA 1Y6EA 3KMOA 3EYTA 3O3TA 2CVKA 1AQWA 4ULXA 1YKCA 1PL2A 1KBNA 1E2YA 2C1YA 4EKZA 3GSSA 3EURA 5KN2A 3A2VA 3GH9A 4KDUA 3ZZXA 1HQOA 3KD0A 4AF2A 7GSSA 1QFNA 1FG4A 1UA5A 2G0FA 4G10A 1JZDA 1M9AA 4HU7A 3ED3A 4YH2A 3D4MA 2H0GA 1YY7A 2E0QA 2CZ2A 1OC3A 2DMLA 2PGTA 3TKSA 3ZVJA 1AAZA 1AQVA 4MPGA 2REMA 1ABAA 3TKSE 2FWHA 3TCOA 5HR0A 3MDKA 1EV4A 4POKA 4ECJA 1XW9A 1PKWA 5GAPD 2VL2C 4LL1B 9GSSA 4ZBBA 1GTUA 1HNAA 3ZFLA 5J4UA 4N0ZA 2GZPA 2F8FA 4DSSB 3S9FA 1PRXA 4I6XA 1FOVA 5J9BA 1FO5A 4IVFA 2ES7A 3EINA 4ZB6A 4X1UA 1DE2A 4I5QA 4K0GA 1G7OA 3F4TA 2B7KA 4F2IA 1OKTA 2AHEA 4HQSA 2C3QA 1O85A 1OKDA 3TJGA 2IMEA 4ZB8A 2JZRA 1BJXA 1U88A 2F8AA 3APQA 3WYWA 5D9XA 4ZL7A 3EMXA 3MAKA 2LTKA 1AQXA 2H0HA 3LORA 3QPMA 2RUFA 4MJBA 1K3OA 1MDKA 4ISDA 3L9SA 5F05A 4IQAA 3HVSA 1M0UA 4J2FA 3ERWA 5JCUA 5J5NA 5INYA 2X8GA 2CA8A 4HZ4A 5IMAA 1JZWA 3TUEA 4ZBDA 1J9BA 5ENUA 1SKRB 2GSSA 3TB2A 5DAKB 2KLXA 1SYRA 1VRSD 3IE3A 1GLQA 4MF5A 1YEXA 1MD3A 3KP8A 4TR1A 1LU4A 2I81A 3IAM2 3PGTA 1SK1A 2PMTA 2PVOC 5FHIA 4TR4A 1NW2A 2H8LA 1Z9HA 4XS4B 3FZ4A 1T4ZA 4L5LA 3TGZA 1TXXA 2EIQA 2JSYA 2RIIA 2L4QA 1TK5B 1KNGA 1V40A 2C3TA 2IMDA 2CAIA
chains in the Genus database with same CATH superfamily
2DIYA 1ST9A 1GSUA 1M99A 2ZUPA 3FKFA 3GMFA 4KH7A 2DJ1A 4MCUA 1E6BA 10GSA 1ZOFA 3ZIJA 2K6VA 4CY6A 4MMMA 1U87A 2GT6A 4F0CA 3D0ZA 1A23A 2LQQA 5ECOB 1LJRA 2GTUA 2LRNA 4XIHA 3LXZA 2OA7A 2DBCA 3LJRA 3I9V2 1XOAA 2GQMA 2CAQA 2M46A 4MK3A 1QQ2A 3DD3A 4PNFA 1S3AA 2B1KA 4D73B 2O8VB 1O81A 1X5CA 3KTLA 4MLYA 4JR6A 5GSTA 4F9ZA 4ZL8A 2I4AA 4XRAA 5IM9A 2IMIA 2GT5A 1Q4JA 1BYEA 2OJLA 1SD9A 4G19A 4Z2RA 5EL8A 2YPMA 3BOAA 4PQ1A 2JU5A 1JLVA 4ILFA 2NVLA 5JCWA 1GULA 1R26A 3RBTA 2R6KA 3LW9A 3MNGA 2YCDA 2MBSA 2LRTA 2O85A 2FWFA 3HYPA 1GSFA 1XG8A 1V2AA 1FB6A 2V1MA 2AV4A 4POBA 4XTSA 4PQIA 4IP1A 4IBPA 4I2UA 4KGIA 1N2AA 3FRCA 3R2QA 2YWMA 1O73A 4MA9A 3E3EA 3HZ4A 1M3IA 2K8SA 1EOGA 3M9KA 5IOWA 4LMWA 3LXTA 1FB0A 1XWKA 2JZSA 6GSWA 2NTOA 2DJ3A 2NDOA 2GQLA 3DKSA 1XOBA 4XCSA 2QSIA 4GLTA 1KTEA 4AJ7A 1GH2A 2YN1A 3QMXA 2LEGA 2O89A 5EY6A 3C7MA 1K0OA 3C1SA 1R5AA 2LKUA 4XS4A 2VOCA 3L0HA 1RQMA 1SD8A 3BBYA 1QGVA 1VF1A 2O87A 3VK9A 2YWNA 2JL4A 5B6MA 1O7UA 1TI3A 4K0NA 2K18A 2WB9A 1ZCPA 5H5QA 4PQHA 4TKYA 2CZ3A 1YF0A 2XPDA 4MPFA 3WGDA 1PL1A 1X0RA 3GUSA 2JACA 5CP1A 4MP4A 1TP9A 2RUEA 1B9XC 3CTFA 2HZEA 4WF4A 5DALA 1XWBA 5GZZB 2HRAA 1S3DA 3ZMKA 20GSA 2FD3A 3CRUA 1K0NA 4L0UA 4KW6A 1UN2A 2DJKA 4KSMA 3TKSC 1XWCA 5DCGA 1G7EA 3G7IA 3D6IA 3J7Yb 2YZUA 4NV5A 2P5QA 1XIYA 5IMFA 3UL3A 3VWVA 3VWUA 2L5LA 2OBIA 1EGOA 1XBSA 2M80A 2YNXA 1QK8A 1FAAA 3CXGA 1GTBA 1U3AA 3HY2A 2X8HA 4K1FA 5B8BA 4EXJA 3H93A 6GSSA 5F06A 4NHZA 4IGJA 4TR3A 2A2PA 1XW5A 2L57A 1I9DA 1HD2A 19GSA 4ACSA 2VCXA 4LMVA 3LGCA 5ECPB 1TK8B 2Z9SA 1NHYA 3EWLA 4ZILA 3UOMA 2E2GA 2LSTA 2GSTA 2VIMA 1PSQA 2V32A 1GTAA 1THXA 5D9WA 4HEA2 2QA1A 1EEJA 2V6OA 1X9WB 4LL4B 4OFNA 3DEXA 4RI6A 3GKMA 2DSAA 3IR4A 3RDWA 3F4RA 1XWGA 3HJMA 1ILOA 3WT1A 2N5AA 1WJKA 4NV2A 3IHGA 3KMNA 2VCVA 1X5EA 5IOXA 2H1GA 3DMLA 5JCGA 1A2JA 1J08A 4JZQA 6GSUA 4USSA 2H19A 1PKZA 1AIUA 3NIVA 2H71A 2DC5A 2TIRA 4GRFA 2VLVA 5H5RA 1G6YA 3ME7A 1WE0A 5ECNB 2HXKA 3F6FA 2IIYA 1W89A 6GSYA 3DVWA 4IELA 2HRFA 2YJHA 3DWVA 4N10A 3FY7A 3CBUA 5G5EA 5AGYA 2H76A 2JADA 1V9WA 4K9ZA 3I6AA 4AGSA 1G0TA 3FZ9A 2YANA 3Q18A 4EDYA 1HNBA 3GURA 4BA7A 4O92A 4P3YB 4KDXA 4K6XA 4GSSA 4MF7A 4POMA 4TR1B 4ECIA 1DUGA 1Y25A 1MDIA 2GSQA 4A5PA 2B5EA 5ABRA 2N5FA 3U6VA 2N5BA 3P90A 2IFQA 4XS6A 2FHEA 1GSQA 1H4OA 3HA9A 3TOTA 2JZTA 3EPTA 3TKRA 4BWSA 3SBCA 2VCTA 4YQUA 2V2GA 4KB3A 2B3SA 3FK8A 5BRTA 2VAFA 3GKXA 2HZFA 2VD0A 3I69A 5KN1A 1NHOA 4L0WA 2VCQA 3BCIA 2MMZA 4NXIA 3GNJA 1DE1A 5G2ZA 1X5DA 2BMXA 2XBIA 4RI7A 3UMAA 1EOHA 4BWQA 5HFIA 5IMVA 4PGTA 2P0GA 1TJDA 3J7Yk 3TKQA 4RUVA 1FVJA 3W6GA 1X9SB 2H73A 1M7TA 1M9BA 1V98A 3APOA 5A4UA 3GYKA 4BPYA 1TRUA 2AB6A 4G0KA 3F9UA 4K7NA 2X49A 1QXHA 3ERGA 2GDRA 4K2DA 1ZGNA 3QD9A 3VURA 4PX1A 3QAWA 4GF0A 4KF9A 2LQOA 3DYRA 3LYPA 3F0IA 1SL0B 5J41A 4X4JA 3LG6A 1QMVA 3FZ5A 2C80A 3KIJA 5G1KA 4Z2TA 4XHMA 3IHQA 3L78A 1ERWA 4K7OA 5D9TA 5KEJA 3GKNA 5F8BA 2HRKA 1Z3EA 2L4CA 3LEFA 4MJEA 1XVQA 2H74A 3BD2A 3ZLPA 1SENA 5DBQA 2E7PA 5J3RA 4K2XA 4DVCA 2QA2A 2H6YA 4BVYA 1T3BA 2VLTA 5LNKe 2MMAA 1A8YA 2J9HA 3EU3A 3US3A 3IAS2 4O32A 1NSWA 3ZFBA 4BL7B 3GKKA 4EUYA 1F37A 1PN9A 3HJPA 2CT6A 1IYIA 2GS3A 1BQ7A 3H1NA 3MIXA 2R5GA 2H75A 2KOKA 4K5RA 3C73A 1VGLA 4GTUA 3E9JB 3IK7A 5E4WA 1GUKA 1XPVA 4HZ2A 4I97A 2P5RA 1WP0A 1M2DA 3A5IA 3CSHA 4EO3A 4X43A 3RHCA 2VUPA 4KAEA 4F82A 3KCMA 5IO0A 1ZYEA 1VF2A 4FH8A 2G2QA 3TJBA 1F6MC 3C71A 3TRPA 3GL3A 1EEMA 3DXBA 3CTGA 3GSTA 2L6DA 1GSDA 2V41A 4EL1A 1ML6A 2OBKA 4G0LA 3UJ1A 3FHKA 3TJJA 3FR6A 2JSZA 4RQXA 2AJQB 2IMKA 1SKSB 2H72A 3GHAA 3GH6A 2LV3A 3DVXA 1CQGA 4MF6A 4YAVA 1TRVA 5G5FA 4QL9A 3MSZA 5EVOA 2HZEB 4XRDA 5DALB 5DJLA 3JCML 3LQ7A 2HT9A 1A0FA 3V1WA 4Q5FA 3O6TA 5DCHA 4JRRA 1FOHA 4JE1A 18GSA 1MTCA 3ISOA 3QFAC 3Q19A 1JHBA 4HDEA 4WR5A 2KUCA 2I9HA 5IPGA 4YKGA 1R5PA 3UVHA 3ZVJD 3TRXA 2HYXA 1K0AA 4KX4A 3AY8A 4IW9A 2X64A 3PPUA 5A5KA 3NOFA 2FUG2 4ZBAA 4MZBA 3M8NA 1XZOA 4MJCA 4ZL9A 1YF1A 2C0EA 4LA1A 1Z6NA 4JU5A 5IMDA 1T4YA 2QKEA 1WMJA 3P2AA 5C04A 4V1Ap 5DVBA 4V2LA 4AJ6A 2YV7A 1FVKA 2WS2A 4FIWA 2LJKA 5HFKA 5IO2A 2WJUA 3Q6OA 3GN3A 4KCAA 8GSSA 2PERA 3GA4A 4TXVA 2XPEA 2C4JA 3KGKA 1GTIA 1M2BA 5CNWA 4WF5A 4CW9A 2XC2A 2B7JA 3D22A 1TRWA 1MD4A 2PPTA 4BL7A 5CRGA 3OR5A 4KCEA 1EP7A 3MWHA 1WRYA 4K8MA 4PXOA 2YWOA 2GQKA 4ICYA 1K0DA 1OAZA 4O5RA 2TRCP 3GRXA 4NAXA 2GGTA 2X99A 1K3YA 3RPPA 16GSA 1HNCA 1YDKA 4GQCA 4EVMA 4EIPA 1C72A 2GZZA 2MMNA 2VL9A 3WT2A 3HVVA 1Q98A 4ECBA 1RW1A 4TW5A 2CV4A 1SJZA 3TOUA 1YZXA 2GVPA 4NPBA 3G7YA 4E8HA 1SKWB 3UAPA 2PN8A 2GLRA 1T7PB 3UBKA 3VWWA 3GV1A 5DDLA 2LS5A 2DKIA 2EC4A 5CO3A 4EDZA 4WBRD 1WIKA 5LD0A 11GSA 1XFLA 2WZ9A 5D8IA 2H6XA 4PURA 3IA1A 4IN0A 1O8WA 3PH9A 2IFQB 1ERUA 3PINA 1YJ6A 1OVNA 4O7HA 5IPHA 4WXTA 4KE3A 4G2EA 1Z7PA 4N30A 4HS1A 3KXOA 2VCZA 3GFKA 3UBLA 4TRXA 3FMWA 2FNOA 2IJYA 2LRCA 4J57E 5D73A 5ELAA 4KDYA 1F3AA 1K0BA 4EF0A 1A0RP 5ECIB 1T8EB 1VF3A 3VPQA 2WCIA 2H66A 3VI7A 2FA4A 3H79A 5CREA 3IC8A 1GNWA 3K8NA 3QAGA 3EC3A 2X8CA 4EC0A 2RM6A 1K0MA 2YOIA 1S3CA 2GSRA 4KA0A 3ZRDA 1XCCA 2ZNMA 2WFCA 1BG5A 5D9VA 2E2MA 1PA3A 1ZYQB 2B6MA 2KP1A 4PTSA 4HI7A 5CYYA 4MH2A 4K5SA 4Q5NA 3ZMLA 4IJIA 3TRQA 1K3LA 2L6CA 2DJ0A 1SJIA 3ZITA 1N8JA 5ELGA 3UVTA 3HXSA 1PQNA 2H30A 5COHA 4TR0A 4MZWA 2HRNA 2CVDA 1EV9A 1TOFA 4FQUA 2R2JA 4DSRA 1JFUA 3VLNA 4V2MA 1SU9A 3CSJA 3ZL5A 4BVYB 4HOJA 2WDUA 4Q5QA 2B1LA 2ZCTA 3BJ5A 4AJ8A 4OCEA 1VF4A 2A4VA 5IMCA 2YJ7A 2DJ2A 2LNTA 4IJ3A 3A5WA 1TTZA 2P31A 3IRAA 4ML6A 2I3YA 1OE8A 1ZYNA 3N9JA 4IP6A 4DEJA 3CRTA 1G6WA 2HI7A 4GSTA 3P8WA 1GSYA 3HHVA 3PR8A 1AXDA 1J0FA 2DIZA 5AIVA 3NZNA 2V6KA 5B6NA 4YQVA 3M3MA 5ECQB 3EMPA 2NBSA 3FEUA 2KP2A 3KZQA 5D96A 3C1RA 1OC9A 1TK0B 4F03A 1ZL9A 1BAYA 1TU7A 1Z5YE 5DQYA 2MYGA 2A4HA 3TJKA 1F2EA 5J9CA 2H0IA 4DSQA 1JZOA 3QFBC 2VM1A 1M2AA 3G9BA 5IIZA 4MABA 1GSEA 2FGXA 3HKRA 1USBA 2AAWA 3F3RA 1PX6A 1JLWA 3KP9A 1WWJA 5ECRB 3U5RE 3H8QA 2IN3A 4WETA 3HVXA 4QL7A 1A2LA 1O6JA 3M0FA 2I1UA 3CSIA 3QR6A 2F9SA 2YWIA 4TXOB 1U3IA 1XWAA 2FWEA 3ERFA 2HSHA 3SWLA 1V57A 2L59A 5JWRB 5F0GA 4GCIA 1ERVA 1GP1A 5HFGA 4KUNA 4I2TA 2QC7A 3TDGA 4QQ7A 4POLA 1GRXA 4V2NA 3GTUB 5L71A 4FO5A 3TKPA 4ML1A 5B7CA 1A8LA 2PBJA 4PUAA 3F4SA 1GUMA 3EVIA 3QDNA 3FW2A 1UVZA 2VL3A 22GSA 4Z7XA 1A2MA 2R4VA 2R0CA 2F3MA 1YQ1A 3DRNA 4CHSA 3Q74A 2FWGA 2J23A 5HR2A 2ON5A 2IWTA 5F07A 2HFDA 4JR4A 4ZXGA 2OE1A 1YKAA 1CQHA 2FLSA 4G0IA 2HLSA 1SL1B 1SYXA 2FA8A 3IK9A 1GNEA 5FT3A 3D5JA 3KM6A 2O7KA 1TKDB 3EU4A 1GWCA 3O76A 4J56E 3IC4A 3HJOA 2K8VA 1EP8A 4PUFC 1ON4A 2C0FA 1R7HA 3CYNA 2CX4A 2EIRA 4EE0A 1SJ6A 4WBJA 4MZCA 2YZHA 2R37A 4FYBA 2PUKC 5HQPA 2CVBA 3VPTA 3FR3A 5HR1A 3GL5A 4KNDA 3M1GA 4NWYA 1B9YC 2DKHA 2IL3A 2XBQA 2VLUA 3IOSA 4K7IA 4IKHA 3F63A 3DGQA 3ZTLA 3N5OA 4CY8A 4GQFA 5DQSA 3F8UA 4YQMA 5A4WA 1BX9A 3BCKA 1I5GA 4ID0A 1UC7A 1U6TA 5IQYA 1XW6A 3P7XA 4TVEA 1PD21 1AW9A 4Q5RA 4OWYA 2DLXA 2K9FA 3VFIA 4G9HA 4N11A 3IBHA 3IXRA 4OFMA 2C0DA 4RQRA 2X4AA 5JWQB 4IQ1A 2DJJA 3QOUA 2LJRA 3TJFA 3R3EA 4OO4A 2EIOA 2QGVA 4HJ2A 5ECSA 2HSYA 4TN8A 4TOPA 4OO5A 5E59A 1O8XA 4Z2UA 1OYJA 1MEKA 1ZZYA 4TXOA 5KOWA 4EIQA 5GAND 2YV9A 3H4KA 2R3XA 3LSZA 3GIXA 4XS1A 2C3NA 4BVXB 4L8EA 3VI5A 1BEDA 1T1VA 4OMVA 3F6DA 4X0XA 3EE2A 1PGTA 3APSA 2MZCA 3GTUA 3ZREA 3L9UA 4HUAA 2TRXA 14GSA 1F9MA 2H1BA 2UZ8A 2LNSA 3QAVA 5G30A 2WULA 1XVWA 1EWXA 5A4VA 2C8UA 4GSNA 1Z7RA 1GSSA 3ME8A 3HDCA 2WGRA 1MDJA 2MBTA 5D93A 2OACA 4O5QA 2OADA 4DSSA 3ZYWA 1ERTA 1IYHA 2YP6A 3WD6A 3KJYA 5DJMA 5LCZA 1Z6MA 5ECLB 2GZYA 4HSCX 1EZKA 2VL2A 2IMFA 2M72A 3FYGA 5G31A 5ID2B 3GX0A 4MDCA 2L5OA 4FYUA 5GSSA 2LJAA 1KEBA 4JEDA 2BJXA 4JBBA 5JWOB 2RLIA 5BMUA 1FHEA 4HQZA 5AIXA 2OKAA 4ZIJA 1B4QA 4GWRA 5CRDA 3G7JA 4ECCA 1R4WA 3CMIA 4MJAA 3LFLA 17GSA 3ZIVA 1OE7A 2ON7A 1F3BA 3MYDA 5CAXA 1SL2B 1A24A 1PX7A 2HE3A 5ECMB 3E0UA 1GLPA 3L9VA 3WGXA 2LUSA 4MH3A 5HR3A 1DBYA 5DAKA 3UIWA 5KN0A 2H6ZA 3QCPA 3UEMA 2VM2A 4V1Ag 2FCHA 4WKWA 3HCZA 4GXZA 1V58A 2H1DA 1QUWA 1TRSA 1B4PA 4YKFA 2PU9C 3I43A 4KSOA 5G1LA 1LBKA 2A2SA 1EGRA 3DIEA 5B8AA 1B8XA 13GSA 3LYKA 4FYCA 4E8EA 2H1AA 1OC9B 3FZAA 4F0BA 4PNGA 2VCWA 5AN1A 1T00A 1TU8A 5CRHA 3L4NA 2NPBA 4OCFA 2CX3A 4BVXA 4H86A 4OD7A 3A2WA 1K0CA 1JZRA 3KTBA 3IDVA 2H70A 3HD5A 5CRWA 1B48A 1GL8A 1AC1A 5EPFA 2ALBA 1WOUA 4IS0A 3HVNA 4YAPA 1TDIA 4MNNA 4D73A 1XXUA 2F51A 1NM3A 2C0GA 2WRTA 1H75A 3CQFA 1ZMAA 3RHBA 2OE0A 3KEBA 1X9MB 2DMMA 5H5SA 1WPIA 2B5XA 3IV4A 3D21A 1RK4A 4NMUA 4I8BA 4WEYA 3LWAA 1SK2A 4N0VA 2A2RA 2VD1A 5IMZA 5ID2A 3C8EA 5KN3A 2H01A 1DSBA 2BTOT 4NHWA 3VWXA 2RM5A 2AUVA 3M9JA 4LLRA 6GSVA 3KH7A 2OE3A 5FWGA 3KH9A 1OC8A 4L5OA 4OFTA 1FW1A 5C00A 4ZB9A 3RPNA 1THOA 2VO4A 3W8SA 4HU9A 5AISA 1YEPA 3UARA 1HYUA 3A3TA 1TI1A 2AYTA 3IPZA 3GX8A 1URMA 6GSXA 3RAZA 2D2ZA 5ECKB 5ECHB 4IHUA 3W8JA 1W4VA 4WR4A 2PWJA 3HZ8A 4CDOA 2HNLA 2PVQA 3WGEA 3F3QA 4HJMA 1PFOA 2KHPA 3FR9A 1PN0A 2IPAA 3A2XA 1SK0A 1AUCA 12GSA 2B5YA 1ACVA 2CQ9A 3D4TA 1TW9A 6GSTA 2MMOA 2FY6A 1GUHA 2XHFA 1PMTA 1Y6EA 3KMOA 3EYTA 3O3TA 2CVKA 1AQWA 4ULXA 1YKCA 1PL2A 1KBNA 1E2YA 2C1YA 4EKZA 3GSSA 3EURA 5KN2A 3A2VA 3GH9A 4KDUA 3ZZXA 1HQOA 3KD0A 4AF2A 7GSSA 1QFNA 1FG4A 1UA5A 2G0FA 4G10A 1JZDA 1M9AA 4HU7A 3ED3A 4YH2A 3D4MA 2H0GA 1YY7A 2E0QA 2CZ2A 1OC3A 2DMLA 2PGTA 3TKSA 3ZVJA 1AAZA 1AQVA 4MPGA 2REMA 1ABAA 3TKSE 2FWHA 3TCOA 5HR0A 3MDKA 1EV4A 4POKA 4ECJA 2R0GA 1XW9A 1PKWA 5GAPD 2VL2C 4LL1B 9GSSA 4ZBBA 1GTUA 1HNAA 3ZFLA 5J4UA 4N0ZA 2GZPA 2F8FA 4DSSB 3S9FA 1PRXA 4I6XA 1FOVA 5J9BA 1FO5A 4IVFA 2ES7A 3EINA 4ZB6A 4X1UA 1DE2A 4I5QA 4K0GA 1G7OA 3F4TA 2B7KA 2HSMA 4F2IA 1OKTA 2AHEA 4HQSA 2C3QA 1O85A 1OKDA 3TJGA 2IMEA 4ZB8A 2JZRA 1BJXA 1U88A 2F8AA 1ZYPA 3APQA 3WYWA 4BIKA 4O5UA 5D9XA 4ZL7A 3EMXA 3MAKA 2LTKA 1AQXA 2H0HA 3LORA 3QPMA 2RUFA 2R0PA 4MJBA 1K3OA 1MDKA 4ISDA 3L9SA 5F05A 4IQAA 5KOXA 1M3JA 3HVSA 1M0UA 4J2FA 3ERWA 5JCUA 5J5NA 5INYA 2X8GA 2CA8A 4HZ4A 5IMAA 1JZWA 3TUEA 4ZBDA 1J9BA 5ENUA 1SKRB 1S3RA 2GSSA 3TB2A 5DAKB 2KLXA 1SYRA 1VRSD 3IE3A 1GLQA 4MF5A 1YEXA 1MD3A 3KP8A 4TR1A 1LU4A 2I81A 3IAM2 3PGTA 1SK1A 2PMTA 2PVOC 5FHIA 4TR4A 1NW2A 2H8LA 1Z9HA 4XS4B 3FZ4A 1T4ZA 4L5LA 3TGZA 1TXXA 2EIQA 2JSYA 2RIIA 2L4QA 1TK5B 1KNGA 1V40A 2C3TA 2IMDA 2CAIA
chains in the Genus database with same CATH topology
2DIYA 1ST9A 1GSUA 1M99A 2ZUPA 3FKFA 3GMFA 4KH7A 2DJ1A 4MCUA 1E6BA 10GSA 1ZOFA 3ZIJA 2K6VA 4CY6A 4MMMA 1U87A 2GT6A 4F0CA 3D0ZA 1A23A 2LQQA 5ECOB 1LJRA 2GTUA 2LRNA 4XIHA 3LXZA 2OA7A 2DBCA 3LJRA 3I9V2 1XOAA 2GQMA 2CAQA 2M46A 4MK3A 1QQ2A 3DD3A 4PNFA 1S3AA 2B1KA 4D73B 2O8VB 1O81A 1X5CA 3KTLA 4MLYA 4JR6A 5GSTA 4F9ZA 4ZL8A 2I4AA 4XRAA 5IM9A 2IMIA 2GT5A 1Q4JA 1BYEA 2OJLA 1SD9A 4G19A 4Z2RA 5EL8A 2YPMA 3BOAA 4PQ1A 2JU5A 1JLVA 4ILFA 2NVLA 5JCWA 1GULA 1R26A 3RBTA 2R6KA 3LW9A 3MNGA 2YCDA 2MBSA 2LRTA 2O85A 2FWFA 3HYPA 1GSFA 1V2AA 1FB6A 2V1MA 2AV4A 4POBA 4XTSA 4PQIA 4IP1A 4IBPA 4I2UA 4KGIA 1N2AA 3FRCA 3R2QA 2YWMA 1O73A 4MA9A 3E3EA 3HZ4A 2K8SA 1EOGA 3M9KA 5IOWA 4LMWA 3LXTA 1FB0A 1XWKA 2JZSA 6GSWA 2NTOA 2DJ3A 2NDOA 2GQLA 3DKSA 1XOBA 4XCSA 2QSIA 4GLTA 1KTEA 4AJ7A 1GH2A 2YN1A 3QMXA 2LEGA 2O89A 5EY6A 3C7MA 1K0OA 3C1SA 1R5AA 2LKUA 4XS4A 2VOCA 3L0HA 1RQMA 1SD8A 3BBYA 1QGVA 1VF1A 2O87A 3VK9A 2YWNA 2JL4A 5B6MA 1O7UA 1TI3A 4K0NA 2K18A 2WB9A 1ZCPA 5H5QA 4PQHA 4TKYA 2CZ3A 1YF0A 2XPDA 4MPFA 3WGDA 1PL1A 1X0RA 3GUSA 2JACA 5CP1A 4MP4A 1TP9A 2RUEA 1B9XC 3CTFA 2HZEA 4WF4A 5DALA 1XWBA 5GZZB 2HRAA 1S3DA 3ZMKA 20GSA 2FD3A 3CRUA 1K0NA 4L0UA 4KW6A 1UN2A 2DJKA 4KSMA 3TKSC 1XWCA 5DCGA 1G7EA 3G7IA 3D6IA 3J7Yb 2YZUA 4NV5A 2P5QA 1XIYA 5IMFA 3UL3A 3VWVA 3VWUA 2L5LA 2OBIA 1EGOA 1XBSA 2M80A 2YNXA 1QK8A 1FAAA 3CXGA 1GTBA 1U3AA 3HY2A 2X8HA 4K1FA 5B8BA 4EXJA 3H93A 6GSSA 5F06A 4NHZA 4IGJA 4TR3A 2A2PA 1XW5A 2L57A 1I9DA 1HD2A 19GSA 4ACSA 2VCXA 4LMVA 3LGCA 5ECPB 1TK8B 2Z9SA 1NHYA 3EWLA 4ZILA 3UOMA 2E2GA 2LSTA 2GSTA 2VIMA 1PSQA 2V32A 1GTAA 1THXA 5D9WA 4HEA2 2QA1A 1EEJA 2V6OA 1X9WB 4LL4B 4OFNA 3DEXA 4RI6A 3GKMA 2DSAA 3IR4A 3RDWA 3F4RA 1XWGA 3HJMA 1ILOA 3WT1A 2N5AA 1WJKA 4NV2A 3IHGA 3KMNA 2VCVA 1X5EA 5IOXA 2H1GA 3DMLA 5JCGA 1A2JA 1J08A 4JZQA 6GSUA 4USSA 2H19A 1PKZA 1AIUA 3NIVA 2H71A 2DC5A 2TIRA 4GRFA 2VLVA 5H5RA 1G6YA 3ME7A 1WE0A 5ECNB 2HXKA 3F6FA 2IIYA 1W89A 6GSYA 3DVWA 4IELA 2HRFA 2YJHA 3DWVA 4N10A 3FY7A 3CBUA 5G5EA 5AGYA 2H76A 2JADA 1V9WA 4K9ZA 3I6AA 4AGSA 1G0TA 3FZ9A 2YANA 3Q18A 4EDYA 1HNBA 3GURA 4BA7A 4O92A 4P3YB 4KDXA 4K6XA 4GSSA 4MF7A 4POMA 4TR1B 4ECIA 1DUGA 1Y25A 1MDIA 2GSQA 4A5PA 2B5EA 5ABRA 2N5FA 3U6VA 2N5BA 3P90A 2IFQA 4XS6A 2FHEA 1GSQA 1H4OA 3HA9A 3TOTA 2JZTA 3EPTA 3TKRA 4BWSA 3SBCA 2VCTA 4YQUA 2V2GA 4KB3A 2B3SA 3FK8A 5BRTA 2VAFA 3GKXA 2HZFA 2VD0A 3I69A 5KN1A 1NHOA 4L0WA 2VCQA 3BCIA 2MMZA 4NXIA 3GNJA 1DE1A 5G2ZA 1X5DA 2BMXA 2XBIA 4RI7A 3UMAA 1EOHA 4BWQA 5HFIA 5IMVA 4PGTA 2P0GA 1TJDA 3J7Yk 3TKQA 4RUVA 1FVJA 3W6GA 1X9SB 2H73A 1M7TA 1M9BA 1V98A 3APOA 5A4UA 3GYKA 4BPYA 1TRUA 2AB6A 4G0KA 3F9UA 4K7NA 2X49A 1QXHA 3ERGA 2GDRA 4K2DA 1ZGNA 3QD9A 3VURA 4PX1A 3QAWA 4GF0A 4KF9A 2LQOA 3DYRA 3LYPA 3F0IA 1SL0B 5J41A 4X4JA 3LG6A 1QMVA 3FZ5A 2C80A 3KIJA 5G1KA 4Z2TA 4XHMA 3IHQA 3L78A 1ERWA 4K7OA 5D9TA 5KEJA 3GKNA 5F8BA 2HRKA 1Z3EA 2L4CA 3LEFA 4MJEA 1XVQA 2H74A 3BD2A 3ZLPA 1SENA 5DBQA 2E7PA 5J3RA 4K2XA 4DVCA 2QA2A 2H6YA 4BVYA 1T3BA 2VLTA 5LNKe 2MMAA 1A8YA 2J9HA 3EU3A 3US3A 3IAS2 4O32A 1NSWA 3ZFBA 4BL7B 3GKKA 4EUYA 1F37A 1PN9A 3HJPA 2CT6A 1IYIA 2GS3A 1BQ7A 3H1NA 3MIXA 2R5GA 2H75A 2KOKA 4K5RA 3C73A 1VGLA 4GTUA 3E9JB 3IK7A 5E4WA 1GUKA 1XPVA 4HZ2A 4I97A 2P5RA 1WP0A 1M2DA 3A5IA 3CSHA 4EO3A 4X43A 3RHCA 2VUPA 4KAEA 4F82A 3KCMA 5IO0A 1ZYEA 1VF2A 4FH8A 2G2QA 3TJBA 1F6MC 3C71A 3TRPA 3GL3A 1EEMA 3DXBA 3CTGA 3GSTA 2L6DA 1GSDA 2V41A 4EL1A 1ML6A 2OBKA 4G0LA 3UJ1A 3FHKA 3TJJA 3FR6A 2JSZA 4RQXA 2AJQB 2IMKA 1SKSB 2H72A 3GHAA 3GH6A 2LV3A 3DVXA 1CQGA 4MF6A 4YAVA 1TRVA 5G5FA 4QL9A 3MSZA 5EVOA 2HZEB 4XRDA 5DALB 5DJLA 3JCML 3LQ7A 2HT9A 1A0FA 3V1WA 4Q5FA 3O6TA 5DCHA 4JRRA 1FOHA 4JE1A 18GSA 1MTCA 3ISOA 3QFAC 3Q19A 1JHBA 4HDEA 4WR5A 2KUCA 2I9HA 5IPGA 4YKGA 1R5PA 3UVHA 3ZVJD 3TRXA 2HYXA 1K0AA 4KX4A 3AY8A 4IW9A 2X64A 3PPUA 5A5KA 3NOFA 2FUG2 4ZBAA 4MZBA 3M8NA 1XZOA 4MJCA 4ZL9A 1YF1A 2C0EA 4LA1A 1Z6NA 4JU5A 5IMDA 1T4YA 2QKEA 1WMJA 3P2AA 5C04A 4V1Ap 5DVBA 4V2LA 4AJ6A 2YV7A 1FVKA 2WS2A 4FIWA 2LJKA 5HFKA 5IO2A 2WJUA 3Q6OA 3GN3A 4KCAA 8GSSA 2PERA 3GA4A 4TXVA 2XPEA 2C4JA 3KGKA 1GTIA 1M2BA 5CNWA 4WF5A 4CW9A 2XC2A 2B7JA 3D22A 1TRWA 1MD4A 2PPTA 4BL7A 5CRGA 3OR5A 4KCEA 1EP7A 3MWHA 1WRYA 4K8MA 4PXOA 2YWOA 2GQKA 4ICYA 1K0DA 1OAZA 4O5RA 2TRCP 3GRXA 4NAXA 2GGTA 2X99A 1K3YA 3RPPA 16GSA 1HNCA 1YDKA 4GQCA 4EVMA 4EIPA 1C72A 2GZZA 2MMNA 2VL9A 3WT2A 3HVVA 1Q98A 4ECBA 1RW1A 4TW5A 2CV4A 1SJZA 3TOUA 1YZXA 2GVPA 4NPBA 3G7YA 4E8HA 1SKWB 3UAPA 2PN8A 2GLRA 1T7PB 3UBKA 3VWWA 3GV1A 5DDLA 2LS5A 2DKIA 2EC4A 5CO3A 4EDZA 4WBRD 1WIKA 5LD0A 11GSA 1XFLA 2WZ9A 5D8IA 2H6XA 4PURA 3IA1A 4IN0A 1O8WA 3PH9A 2IFQB 1ERUA 3PINA 1YJ6A 1OVNA 4O7HA 5IPHA 4WXTA 4KE3A 4G2EA 1Z7PA 4N30A 4HS1A 3KXOA 2VCZA 3GFKA 3UBLA 4TRXA 3FMWA 2FNOA 2IJYA 2LRCA 4J57E 5D73A 5ELAA 4KDYA 1F3AA 1K0BA 4EF0A 1A0RP 5ECIB 1T8EB 1VF3A 3VPQA 2WCIA 2H66A 3VI7A 2FA4A 3H79A 5CREA 3IC8A 1GNWA 3K8NA 3QAGA 3EC3A 2X8CA 4EC0A 2RM6A 1K0MA 2YOIA 1S3CA 2GSRA 4KA0A 3ZRDA 1XCCA 2ZNMA 2WFCA 1BG5A 5D9VA 2E2MA 1PA3A 1ZYQB 2B6MA 2KP1A 4PTSA 4HI7A 5CYYA 4MH2A 4K5SA 4Q5NA 3ZMLA 4IJIA 3TRQA 1K3LA 2L6CA 2DJ0A 1SJIA 3ZITA 1N8JA 5ELGA 3UVTA 3HXSA 1PQNA 2H30A 5COHA 4TR0A 4MZWA 2HRNA 2CVDA 1EV9A 1TOFA 4FQUA 2R2JA 4DSRA 1JFUA 3VLNA 4V2MA 1SU9A 3CSJA 3ZL5A 4BVYB 4HOJA 2WDUA 4Q5QA 2B1LA 2ZCTA 3BJ5A 4AJ8A 4OCEA 1VF4A 2A4VA 5IMCA 2YJ7A 2DJ2A 2LNTA 4IJ3A 3A5WA 1TTZA 2P31A 3IRAA 4ML6A 2I3YA 1OE8A 1ZYNA 3N9JA 4IP6A 4DEJA 3CRTA 1G6WA 2HI7A 4GSTA 3P8WA 1GSYA 3HHVA 3PR8A 1AXDA 1J0FA 2DIZA 5AIVA 3NZNA 2V6KA 5B6NA 4YQVA 3M3MA 5ECQB 3EMPA 2NBSA 3FEUA 2KP2A 3KZQA 5D96A 3C1RA 1OC9A 1TK0B 4F03A 1ZL9A 1BAYA 1TU7A 1Z5YE 5DQYA 2MYGA 2A4HA 3TJKA 1F2EA 5J9CA 2H0IA 4DSQA 1JZOA 3QFBC 2VM1A 1M2AA 3G9BA 5IIZA 4MABA 1GSEA 2FGXA 3HKRA 1USBA 2AAWA 3F3RA 1PX6A 1JLWA 3KP9A 1WWJA 5ECRB 3U5RE 3H8QA 2IN3A 4WETA 3HVXA 4QL7A 1A2LA 1O6JA 3M0FA 2I1UA 3CSIA 3QR6A 2F9SA 2YWIA 4TXOB 1U3IA 1XWAA 2FWEA 3ERFA 2HSHA 3SWLA 1V57A 2L59A 5JWRB 5F0GA 4GCIA 1ERVA 1GP1A 5HFGA 4KUNA 4I2TA 2QC7A 3TDGA 4QQ7A 4POLA 1GRXA 4V2NA 3GTUB 5L71A 4FO5A 3TKPA 4ML1A 5B7CA 1A8LA 2PBJA 4PUAA 3F4SA 1GUMA 3EVIA 3QDNA 3FW2A 1UVZA 2VL3A 22GSA 4Z7XA 1A2MA 2R4VA 2R0CA 2F3MA 1YQ1A 3DRNA 4CHSA 3Q74A 2FWGA 2J23A 5HR2A 2ON5A 2IWTA 5F07A 2HFDA 4JR4A 4ZXGA 2OE1A 1YKAA 1CQHA 2FLSA 4G0IA 2HLSA 1SL1B 1SYXA 2FA8A 3IK9A 1GNEA 5FT3A 3D5JA 3KM6A 2O7KA 1TKDB 3EU4A 1GWCA 3O76A 4J56E 3IC4A 3HJOA 2K8VA 1EP8A 4PUFC 1ON4A 2C0FA 1R7HA 3CYNA 2CX4A 2EIRA 4EE0A 1SJ6A 4WBJA 4MZCA 2YZHA 2R37A 4FYBA 2PUKC 5HQPA 2CVBA 3VPTA 3FR3A 5HR1A 3GL5A 4KNDA 3M1GA 4NWYA 1B9YC 2DKHA 2IL3A 2XBQA 2VLUA 3IOSA 4K7IA 4IKHA 3F63A 3DGQA 3ZTLA 3N5OA 4CY8A 4GQFA 5DQSA 3F8UA 4YQMA 5A4WA 1BX9A 3BCKA 1I5GA 4ID0A 1UC7A 1U6TA 5IQYA 1XW6A 3P7XA 4TVEA 1PD21 1AW9A 4Q5RA 4OWYA 2DLXA 2K9FA 3VFIA 4G9HA 4N11A 3IBHA 3IXRA 4OFMA 2C0DA 4RQRA 2X4AA 5JWQB 4IQ1A 2DJJA 3QOUA 2LJRA 3TJFA 3R3EA 4OO4A 2EIOA 2QGVA 4HJ2A 5ECSA 2HSYA 4TN8A 4TOPA 4OO5A 5E59A 1O8XA 4Z2UA 1OYJA 1MEKA 1ZZYA 4TXOA 5KOWA 4EIQA 5GAND 2YV9A 3H4KA 2R3XA 3LSZA 3GIXA 4XS1A 2C3NA 4BVXB 4L8EA 3VI5A 1BEDA 1T1VA 4OMVA 3F6DA 4X0XA 3EE2A 1PGTA 3APSA 2MZCA 3GTUA 3ZREA 3L9UA 4HUAA 2TRXA 14GSA 1F9MA 2H1BA 2UZ8A 2LNSA 3QAVA 5G30A 2WULA 1XVWA 1EWXA 5A4VA 2C8UA 4GSNA 1Z7RA 1GSSA 3ME8A 3HDCA 2WGRA 1MDJA 2MBTA 5D93A 2OACA 4O5QA 2OADA 4DSSA 3ZYWA 1ERTA 1IYHA 2YP6A 3WD6A 3KJYA 5DJMA 5LCZA 1Z6MA 5ECLB 2GZYA 1EZKA 2VL2A 2IMFA 2M72A 3FYGA 5G31A 5ID2B 3GX0A 4MDCA 2L5OA 4FYUA 5GSSA 2LJAA 1KEBA 4JEDA 2BJXA 4JBBA 5JWOB 2RLIA 5BMUA 1FHEA 4HQZA 5AIXA 2OKAA 4ZIJA 1B4QA 4GWRA 5CRDA 3G7JA 4ECCA 1R4WA 3CMIA 4MJAA 3LFLA 17GSA 3ZIVA 1OE7A 2ON7A 1F3BA 3MYDA 5CAXA 1SL2B 1A24A 1PX7A 2HE3A 5ECMB 3E0UA 1GLPA 3L9VA 3WGXA 2LUSA 4MH3A 5HR3A 1DBYA 5DAKA 3UIWA 5KN0A 2H6ZA 3QCPA 3UEMA 2VM2A 4V1Ag 2FCHA 4WKWA 3HCZA 4GXZA 1V58A 2H1DA 1QUWA 1TRSA 1B4PA 4YKFA 2PU9C 3I43A 4KSOA 5G1LA 1LBKA 2A2SA 1EGRA 3DIEA 5B8AA 1B8XA 13GSA 3LYKA 4FYCA 4E8EA 2H1AA 1OC9B 3FZAA 4F0BA 4PNGA 2VCWA 5AN1A 1T00A 1TU8A 5CRHA 3L4NA 2NPBA 4OCFA 2CX3A 4BVXA 4H86A 4OD7A 3A2WA 1K0CA 1JZRA 3KTBA 3IDVA 2H70A 3HD5A 5CRWA 1B48A 1GL8A 1AC1A 5EPFA 2ALBA 1WOUA 4IS0A 4YAPA 1TDIA 4MNNA 4D73A 1XXUA 2F51A 1NM3A 2C0GA 2WRTA 1H75A 1ZMAA 3RHBA 2OE0A 3KEBA 1X9MB 2DMMA 5H5SA 1WPIA 2B5XA 3IV4A 3D21A 1RK4A 4NMUA 4I8BA 4WEYA 3LWAA 1SK2A 4N0VA 2A2RA 2VD1A 5IMZA 5ID2A 3C8EA 5KN3A 2H01A 1DSBA 2BTOT 4NHWA 3VWXA 2RM5A 2AUVA 3M9JA 4LLRA 6GSVA 3KH7A 2OE3A 5FWGA 3KH9A 1OC8A 4L5OA 4OFTA 1FW1A 5C00A 4ZB9A 3RPNA 1THOA 2VO4A 3W8SA 4HU9A 5AISA 1YEPA 3UARA 1HYUA 3A3TA 1TI1A 2AYTA 3IPZA 3GX8A 1URMA 6GSXA 3RAZA 2D2ZA 5ECKB 5ECHB 4IHUA 3W8JA 1W4VA 4WR4A 2PWJA 3HZ8A 4CDOA 2HNLA 2PVQA 3WGEA 3F3QA 4HJMA 2KHPA 3FR9A 1PN0A 2IPAA 3A2XA 1SK0A 1AUCA 12GSA 2B5YA 1ACVA 2CQ9A 3D4TA 1TW9A 6GSTA 2MMOA 2FY6A 1GUHA 2XHFA 1PMTA 1Y6EA 3KMOA 3EYTA 3O3TA 2CVKA 1AQWA 4ULXA 1YKCA 1PL2A 1KBNA 1E2YA 2C1YA 4EKZA 3GSSA 3EURA 5KN2A 3A2VA 3GH9A 4KDUA 3ZZXA 1HQOA 3KD0A 4AF2A 7GSSA 1QFNA 1FG4A 1UA5A 2G0FA 4G10A 1JZDA 1M9AA 4HU7A 3ED3A 4YH2A 3D4MA 2H0GA 1YY7A 2E0QA 2CZ2A 1OC3A 2DMLA 2PGTA 3TKSA 3ZVJA 1AAZA 1AQVA 4MPGA 2REMA 1ABAA 3TKSE 2FWHA 3TCOA 5HR0A 3MDKA 1EV4A 4POKA 4ECJA 2R0GA 1XW9A 1PKWA 5GAPD 2VL2C 4LL1B 9GSSA 4ZBBA 1GTUA 1HNAA 3ZFLA 5J4UA 4N0ZA 2GZPA 2F8FA 4DSSB 3S9FA 1PRXA 4I6XA 1FOVA 5J9BA 1FO5A 4IVFA 2ES7A 3EINA 4ZB6A 4X1UA 1DE2A 4I5QA 4K0GA 1G7OA 3F4TA 2B7KA 2HSMA 4F2IA 1OKTA 2AHEA 4HQSA 2C3QA 1O85A 1OKDA 3TJGA 2IMEA 4ZB8A 2JZRA 1BJXA 1U88A 2F8AA 1ZYPA 3APQA 3WYWA 4O5UA 5D9XA 4ZL7A 3EMXA 3MAKA 2LTKA 1AQXA 2H0HA 3LORA 3QPMA 2RUFA 2R0PA 4MJBA 1K3OA 1MDKA 4ISDA 3L9SA 5F05A 4IQAA 5KOXA 3HVSA 1M0UA 4J2FA 3ERWA 5JCUA 5J5NA 5INYA 2X8GA 2CA8A 4HZ4A 5IMAA 1JZWA 3TUEA 4ZBDA 1J9BA 5ENUA 1SKRB 2GSSA 3TB2A 5DAKB 2KLXA 1SYRA 1VRSD 3IE3A 1GLQA 4MF5A 1YEXA 1MD3A 3KP8A 4TR1A 1LU4A 2I81A 3IAM2 3PGTA 1SK1A 2PMTA 2PVOC 5FHIA 4TR4A 1NW2A 2H8LA 1Z9HA 4XS4B 3FZ4A 1T4ZA 4L5LA 3TGZA 1TXXA 2EIQA 2JSYA 2RIIA 2L4QA 1TK5B 1KNGA 1V40A 2C3TA 2IMDA 2CAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIY A;  1ST9 A;  1GSU A;  1M99 A;  2ZUP A;  3FKF A;  3GMF A;  4KH7 A;  2DJ1 A;  4MCU A;  1E6B A;  10GS A;  1ZOF A;  3ZIJ A;  2K6V A;  4MMM A;  1U87 A;  2GT6 A;  4F0C A;  3D0Z A;  1A23 A;  2LQQ A;  5ECO B;  1LJR A;  2GTU A;  2LRN A;  4XIH A;  3LXZ A;  2OA7 A;  2DBC A;  3LJR A;  3I9V 2;  1XOA A;  2GQM A;  2CAQ A;  2M46 A;  4MK3 A;  1QQ2 A;  3DD3 A;  4PNF A;  1S3A A;  2B1K A;  4D73 B;  2O8V B;  1O81 A;  1X5C A;  3KTL A;  4MLY A;  4JR6 A;  5GST A;  4F9Z A;  4ZL8 A;  2I4A A;  4XRA A;  5IM9 A;  2IMI A;  2GT5 A;  1Q4J A;  1BYE A;  2OJL A;  1SD9 A;  4G19 A;  5EL8 A;  2YPM A;  3BOA A;  4PQ1 A;  2JU5 A;  1JLV A;  4ILF A;  2NVL A;  5JCW A;  1GUL A;  1R26 A;  3RBT A;  2R6K A;  3MNG A;  2YCD A;  2MBS A;  2LRT A;  2O85 A;  2FWF A;  3HYP A;  1GSF A;  1V2A A;  1FB6 A;  2V1M A;  2AV4 A;  4POB A;  4XTS A;  4PQI A;  4IP1 A;  4IBP A;  4I2U A;  4KGI A;  1N2A A;  3FRC A;  3R2Q A;  2YWM A;  1O73 A;  4MA9 A;  3E3E A;  3HZ4 A;  2K8S A;  1EOG A;  3M9K A;  5IOW A;  4LMW A;  3LXT A;  1FB0 A;  1XWK A;  2JZS A;  6GSW A;  2NTO A;  2DJ3 A;  2NDO A;  2GQL A;  3DKS A;  1XOB A;  4XCS A;  2QSI A;  4GLT A;  1KTE A;  4AJ7 A;  1GH2 A;  2YN1 A;  3QMX A;  2LEG A;  2O89 A;  5EY6 A;  3C7M A;  1K0O A;  3C1S A;  1R5A A;  2LKU A;  4XS4 A;  2VOC A;  3L0H A;  1RQM A;  1SD8 A;  3BBY A;  1QGV A;  1VF1 A;  2O87 A;  3VK9 A;  2YWN A;  2JL4 A;  5B6M A;  1O7U A;  1TI3 A;  4K0N A;  2K18 A;  2WB9 A;  1ZCP A;  5H5Q A;  4PQH A;  4TKY A;  2CZ3 A;  1YF0 A;  2XPD A;  4MPF A;  3WGD A;  1PL1 A;  1X0R A;  3GUS A;  2JAC A;  5CP1 A;  4MP4 A;  1TP9 A;  2RUE A;  1B9X C;  3CTF A;  2HZE A;  4WF4 A;  5DAL A;  1XWB A;  5GZZ B;  1S3D A;  3ZMK A;  20GS A;  2FD3 A;  3CRU A;  1K0N A;  4L0U A;  4KW6 A;  1UN2 A;  2DJK A;  4KSM A;  3TKS C;  1XWC A;  5DCG A;  1G7E A;  3G7I A;  3D6I A;  3J7Y b;  2YZU A;  4NV5 A;  2P5Q A;  1XIY A;  5IMF A;  3UL3 A;  3VWV A;  3VWU A;  2L5L A;  2OBI A;  1EGO A;  1XBS A;  2M80 A;  2YNX A;  1QK8 A;  1FAA A;  3CXG A;  1GTB A;  1U3A A;  3HY2 A;  2X8H A;  4K1F A;  5B8B A;  4EXJ A;  3H93 A;  6GSS A;  5F06 A;  4NHZ A;  4IGJ A;  4TR3 A;  1XW5 A;  2L57 A;  1I9D A;  1HD2 A;  19GS A;  4ACS A;  2VCX A;  4LMV A;  3LGC A;  5ECP B;  1TK8 B;  2Z9S A;  1NHY A;  3EWL A;  4ZIL A;  3UOM A;  2E2G A;  2LST A;  2GST A;  2VIM A;  1PSQ A;  2V32 A;  1GTA A;  1THX A;  5D9W A;  4HEA 2;  1EEJ A;  2V6O A;  1X9W B;  4LL4 B;  4OFN A;  3DEX A;  4RI6 A;  3GKM A;  2DSA A;  3IR4 A;  3RDW A;  3F4R A;  1XWG A;  3HJM A;  1ILO A;  3WT1 A;  2N5A A;  1WJK A;  4NV2 A;  3KMN A;  2VCV A;  1X5E A;  5IOX A;  2H1G A;  3DML A;  5JCG A;  1A2J A;  1J08 A;  4JZQ A;  6GSU A;  2H19 A;  1PKZ A;  1AIU A;  3NIV A;  2H71 A;  2DC5 A;  2TIR A;  4GRF A;  2VLV A;  5H5R A;  1G6Y A;  3ME7 A;  1WE0 A;  5ECN B;  2HXK A;  3F6F A;  2IIY A;  1W89 A;  6GSY A;  3DVW A;  4IEL A;  2HRF A;  2YJH A;  3DWV A;  4N10 A;  3FY7 A;  3CBU A;  5G5E A;  5AGY A;  2H76 A;  2JAD A;  1V9W A;  4K9Z A;  3I6A A;  4AGS A;  1G0T A;  3FZ9 A;  2YAN A;  3Q18 A;  4EDY A;  1HNB A;  3GUR A;  4BA7 A;  4O92 A;  4P3Y B;  4KDX A;  4K6X A;  4GSS A;  4MF7 A;  4POM A;  4TR1 B;  4ECI A;  1DUG A;  1Y25 A;  1MDI A;  2GSQ A;  2B5E A;  5ABR A;  2N5F A;  3U6V A;  2N5B A;  3P90 A;  2IFQ A;  4XS6 A;  2FHE A;  1GSQ A;  1H4O A;  3HA9 A;  3TOT A;  2JZT A;  3TKR A;  4BWS A;  3SBC A;  2VCT A;  4YQU A;  2V2G A;  4KB3 A;  2B3S A;  3FK8 A;  2VAF A;  3GKX A;  2HZF A;  2VD0 A;  3I69 A;  5KN1 A;  1NHO A;  4L0W A;  2VCQ A;  3BCI A;  2MMZ A;  4NXI A;  3GNJ A;  1DE1 A;  5G2Z A;  1X5D A;  2BMX A;  2XBI A;  4RI7 A;  3UMA A;  1EOH A;  4BWQ A;  5HFI A;  5IMV A;  4PGT A;  2P0G A;  1TJD A;  3J7Y k;  3TKQ A;  4RUV A;  1FVJ A;  3W6G A;  1X9S B;  2H73 A;  1M7T A;  1M9B A;  1V98 A;  3APO A;  5A4U A;  3GYK A;  4BPY A;  1TRU A;  2AB6 A;  3F9U A;  4K7N A;  1QXH A;  3ERG A;  2GDR A;  4K2D A;  1ZGN A;  3QD9 A;  3VUR A;  4PX1 A;  3QAW A;  4GF0 A;  2LQO A;  3DYR A;  3LYP A;  3F0I A;  1SL0 B;  5J41 A;  3LG6 A;  1QMV A;  3FZ5 A;  2C80 A;  3KIJ A;  5G1K A;  4XHM A;  3IHQ A;  3L78 A;  1ERW A;  4K7O A;  5D9T A;  5KEJ A;  3GKN A;  5F8B A;  1Z3E A;  2L4C A;  3LEF A;  4MJE A;  1XVQ A;  2H74 A;  3BD2 A;  3ZLP A;  1SEN A;  5DBQ A;  2E7P A;  5J3R A;  4DVC A;  2H6Y A;  4BVY A;  1T3B A;  2VLT A;  5LNK e;  2MMA A;  1A8Y A;  2J9H A;  3EU3 A;  3US3 A;  3IAS 2;  4O32 A;  1NSW A;  3ZFB A;  3GKK A;  4EUY A;  1F37 A;  1PN9 A;  3HJP A;  2CT6 A;  1IYI A;  2GS3 A;  1BQ7 A;  3H1N A;  2R5G A;  2H75 A;  2KOK A;  3C73 A;  1VGL A;  4GTU A;  3E9J B;  3IK7 A;  5E4W A;  1GUK A;  1XPV A;  4HZ2 A;  4I97 A;  2P5R A;  1WP0 A;  1M2D A;  3CSH A;  4EO3 A;  4X43 A;  3RHC A;  2VUP A;  4KAE A;  4F82 A;  3KCM A;  5IO0 A;  1ZYE A;  1VF2 A;  4FH8 A;  2G2Q A;  3TJB A;  1F6M C;  3C71 A;  3TRP A;  3GL3 A;  1EEM A;  3DXB A;  3CTG A;  3GST A;  2L6D A;  1GSD A;  2V41 A;  4EL1 A;  1ML6 A;  2OBK A;  3UJ1 A;  3FHK A;  3TJJ A;  3FR6 A;  2JSZ A;  4RQX A;  2AJQ B;  2IMK A;  1SKS B;  2H72 A;  3GHA A;  3GH6 A;  2LV3 A;  3DVX A;  1CQG A;  4MF6 A;  4YAV A;  1TRV A;  5G5F A;  4QL9 A;  3MSZ A;  5EVO A;  2HZE B;  4XRD A;  5DAL B;  5DJL A;  3JCM L;  3LQ7 A;  2HT9 A;  1A0F A;  3V1W A;  4Q5F A;  3O6T A;  5DCH A;  4JRR A;  4JE1 A;  18GS A;  1MTC A;  3ISO A;  3QFA C;  3Q19 A;  1JHB A;  4HDE A;  4WR5 A;  2KUC A;  2I9H A;  5IPG A;  1R5P A;  3UVH A;  3ZVJ D;  3TRX A;  2HYX A;  1K0A A;  4KX4 A;  3AY8 A;  4IW9 A;  2X64 A;  5A5K A;  3NOF A;  2FUG 2;  4ZBA A;  4MZB A;  3M8N A;  1XZO A;  4MJC A;  4ZL9 A;  1YF1 A;  2C0E A;  4LA1 A;  1Z6N A;  4JU5 A;  5IMD A;  1T4Y A;  2QKE A;  1WMJ A;  3P2A A;  5C04 A;  4V1A p;  5DVB A;  4V2L A;  4AJ6 A;  2YV7 A;  1FVK A;  2WS2 A;  4FIW A;  2LJK A;  5HFK A;  5IO2 A;  2WJU A;  3Q6O A;  3GN3 A;  4KCA A;  8GSS A;  2PER A;  3GA4 A;  4TXV A;  2XPE A;  2C4J A;  3KGK A;  1GTI A;  1M2B A;  5CNW A;  4WF5 A;  4CW9 A;  2XC2 A;  2B7J A;  3D22 A;  1TRW A;  1MD4 A;  2PPT A;  4BL7 A;  5CRG A;  3OR5 A;  4KCE A;  1EP7 A;  3MWH A;  1WRY A;  4K8M A;  4PXO A;  2YWO A;  2GQK A;  1K0D A;  1OAZ A;  4O5R A;  2TRC P;  3GRX A;  4NAX A;  2GGT A;  2X99 A;  1K3Y A;  3RPP A;  16GS A;  1HNC A;  1YDK A;  4GQC A;  4EVM A;  1C72 A;  2GZZ A;  2MMN A;  2VL9 A;  3WT2 A;  3HVV A;  1Q98 A;  4ECB A;  1RW1 A;  4TW5 A;  2CV4 A;  1SJZ A;  3TOU A;  1YZX A;  2GVP A;  4NPB A;  3G7Y A;  4E8H A;  1SKW B;  3UAP A;  2PN8 A;  2GLR A;  1T7P B;  3UBK A;  3VWW A;  3GV1 A;  5DDL A;  2LS5 A;  2EC4 A;  5CO3 A;  4EDZ A;  4WBR D;  1WIK A;  5LD0 A;  11GS A;  1XFL A;  2WZ9 A;  5D8I A;  2H6X A;  4PUR A;  3IA1 A;  4IN0 A;  1O8W A;  3PH9 A;  2IFQ B;  1ERU A;  3PIN A;  1YJ6 A;  1OVN A;  4O7H A;  5IPH A;  4WXT A;  4KE3 A;  4G2E A;  1Z7P A;  4N30 A;  4HS1 A;  3KXO A;  2VCZ A;  3GFK A;  3UBL A;  4TRX A;  2FNO A;  2IJY A;  2LRC A;  4J57 E;  5D73 A;  5ELA A;  4KDY A;  1F3A A;  1K0B A;  4EF0 A;  1A0R P;  5ECI B;  1T8E B;  1VF3 A;  3VPQ A;  2WCI A;  2H66 A;  3VI7 A;  2FA4 A;  3H79 A;  5CRE A;  1GNW A;  3K8N A;  3QAG A;  3EC3 A;  2X8C A;  4EC0 A;  2RM6 A;  1K0M A;  2YOI A;  1S3C A;  2GSR A;  4KA0 A;  3ZRD A;  1XCC A;  2ZNM A;  2WFC A;  1BG5 A;  5D9V A;  2E2M A;  1PA3 A;  1ZYQ B;  2B6M A;  2KP1 A;  4HI7 A;  5CYY A;  4MH2 A;  4Q5N A;  3ZML A;  4IJI A;  3TRQ A;  1K3L A;  2L6C A;  2DJ0 A;  1SJI A;  3ZIT A;  1N8J A;  5ELG A;  3UVT A;  3HXS A;  1PQN A;  2H30 A;  5COH A;  4TR0 A;  4MZW A;  2HRN A;  2CVD A;  1EV9 A;  1TOF A;  2R2J A;  4DSR A;  1JFU A;  3VLN A;  4V2M A;  1SU9 A;  3CSJ A;  3ZL5 A;  4HOJ A;  2WDU A;  4Q5Q A;  2B1L A;  2ZCT A;  3BJ5 A;  4AJ8 A;  4OCE A;  1VF4 A;  2A4V A;  5IMC A;  2YJ7 A;  2DJ2 A;  2LNT A;  4IJ3 A;  3A5W A;  1TTZ A;  2P31 A;  3IRA A;  4ML6 A;  2I3Y A;  1OE8 A;  3N9J A;  4IP6 A;  4DEJ A;  3CRT A;  1G6W A;  2HI7 A;  4GST A;  3P8W A;  1GSY A;  3HHV A;  3PR8 A;  1AXD A;  1J0F A;  2DIZ A;  5AIV A;  3NZN A;  2V6K A;  5B6N A;  4YQV A;  3M3M A;  5ECQ B;  3EMP A;  2NBS A;  3FEU A;  2KP2 A;  3KZQ A;  5D96 A;  3C1R A;  1OC9 A;  1TK0 B;  4F03 A;  1ZL9 A;  1BAY A;  1TU7 A;  1Z5Y E;  5DQY A;  2MYG A;  3TJK A;  1F2E A;  5J9C A;  2H0I A;  4DSQ A;  1JZO A;  3QFB C;  2VM1 A;  1M2A A;  3G9B A;  5IIZ A;  4MAB A;  1GSE A;  2FGX A;  3HKR A;  1USB A;  2AAW A;  3F3R A;  1PX6 A;  1JLW A;  3KP9 A;  1WWJ A;  5ECR B;  3U5R E;  3H8Q A;  2IN3 A;  4WET A;  3HVX A;  4QL7 A;  1A2L A;  1O6J A;  3M0F A;  2I1U A;  3CSI A;  3QR6 A;  2F9S A;  2YWI A;  4TXO B;  1U3I A;  1XWA A;  2FWE A;  3ERF A;  2HSH A;  3SWL A;  1V57 A;  2L59 A;  5JWR B;  5F0G A;  4GCI A;  1ERV A;  1GP1 A;  5HFG A;  4KUN A;  4I2T A;  2QC7 A;  3TDG A;  4QQ7 A;  4POL A;  1GRX A;  4V2N A;  3GTU B;  5L71 A;  4FO5 A;  3TKP A;  4ML1 A;  5B7C A;  1A8L A;  2PBJ A;  4PUA A;  3F4S A;  1GUM A;  3EVI A;  3QDN A;  3FW2 A;  1UVZ A;  2VL3 A;  22GS A;  4Z7X A;  1A2M A;  2R4V A;  2F3M A;  1YQ1 A;  3DRN A;  4CHS A;  3Q74 A;  2FWG A;  2J23 A;  5HR2 A;  2ON5 A;  2IWT A;  5F07 A;  2HFD A;  4JR4 A;  4ZXG A;  2OE1 A;  1YKA A;  1CQH A;  2FLS A;  2HLS A;  1SL1 B;  1SYX A;  2FA8 A;  3IK9 A;  1GNE A;  5FT3 A;  3D5J A;  3KM6 A;  2O7K A;  1TKD B;  3EU4 A;  1GWC A;  3O76 A;  4J56 E;  3IC4 A;  3HJO A;  2K8V A;  1EP8 A;  4PUF C;  1ON4 A;  2C0F A;  1R7H A;  3CYN A;  2CX4 A;  2EIR A;  4EE0 A;  1SJ6 A;  4WBJ A;  4MZC A;  2YZH A;  2R37 A;  4FYB A;  2PUK C;  5HQP A;  2CVB A;  3VPT A;  3FR3 A;  5HR1 A;  3GL5 A;  4KND A;  3M1G A;  4NWY A;  1B9Y C;  2IL3 A;  2XBQ A;  2VLU A;  3IOS A;  4K7I A;  4IKH A;  3F63 A;  3DGQ A;  3ZTL A;  3N5O A;  4GQF A;  5DQS A;  3F8U A;  4YQM A;  5A4W A;  1BX9 A;  3BCK A;  1I5G A;  4ID0 A;  1UC7 A;  1U6T A;  5IQY A;  1XW6 A;  3P7X A;  4TVE A;  1PD2 1;  1AW9 A;  4Q5R A;  4OWY A;  2DLX A;  2K9F A;  3VFI A;  4G9H A;  4N11 A;  3IBH A;  3IXR A;  4OFM A;  2C0D A;  4RQR A;  5JWQ B;  4IQ1 A;  2DJJ A;  3QOU A;  2LJR A;  3TJF A;  4OO4 A;  2EIO A;  2QGV A;  4HJ2 A;  5ECS A;  2HSY A;  4TN8 A;  4TOP A;  4OO5 A;  5E59 A;  1O8X A;  1OYJ A;  1MEK A;  1ZZY A;  4TXO A;  5GAN D;  2YV9 A;  3H4K A;  2R3X A;  3LSZ A;  3GIX A;  4XS1 A;  2C3N A;  4L8E A;  3VI5 A;  1BED A;  1T1V A;  4OMV A;  3F6D A;  4X0X A;  3EE2 A;  1PGT A;  3APS A;  2MZC A;  3GTU A;  3ZRE A;  3L9U A;  4HUA A;  2TRX A;  14GS A;  1F9M A;  2H1B A;  2LNS A;  3QAV A;  5G30 A;  2WUL A;  1XVW A;  1EWX A;  5A4V A;  2C8U A;  4GSN A;  1Z7R A;  1GSS A;  3ME8 A;  3HDC A;  2WGR A;  1MDJ A;  2MBT A;  5D93 A;  2OAC A;  4DSS A;  2OAD A;  3ZYW A;  1ERT A;  1IYH A;  2YP6 A;  3WD6 A;  3KJY A;  5DJM A;  5LCZ A;  1Z6M A;  5ECL B;  2GZY A;  1EZK A;  2VL2 A;  2IMF A;  2M72 A;  3FYG A;  5G31 A;  5ID2 B;  3GX0 A;  4MDC A;  2L5O A;  4FYU A;  5GSS A;  2LJA A;  1KEB A;  4JED A;  2BJX A;  4JBB A;  5JWO B;  2RLI A;  1FHE A;  4HQZ A;  5AIX A;  2OKA A;  4ZIJ A;  1B4Q A;  4GWR A;  5CRD A;  3G7J A;  4ECC A;  1R4W A;  3CMI A;  4MJA A;  3LFL A;  17GS A;  3ZIV A;  1OE7 A;  2ON7 A;  1F3B A;  5CAX A;  1SL2 B;  1A24 A;  1PX7 A;  2HE3 A;  5ECM B;  3E0U A;  1GLP A;  3L9V A;  3WGX A;  2LUS A;  4MH3 A;  5HR3 A;  1DBY A;  5DAK A;  3UIW A;  5KN0 A;  2H6Z A;  3QCP A;  3UEM A;  2VM2 A;  4V1A g;  2FCH A;  4WKW A;  3HCZ A;  4GXZ A;  1V58 A;  2H1D A;  1QUW A;  1TRS A;  1B4P A;  2PU9 C;  3I43 A;  4KSO A;  5G1L A;  1LBK A;  2A2S A;  1EGR A;  3DIE A;  5B8A A;  1B8X A;  13GS A;  3LYK A;  4FYC A;  4E8E A;  2H1A A;  1OC9 B;  3FZA A;  4F0B A;  4PNG A;  2VCW A;  5AN1 A;  1T00 A;  1TU8 A;  5CRH A;  3L4N A;  2NPB A;  4OCF A;  2CX3 A;  4BVX A;  4H86 A;  4OD7 A;  3A2W A;  1K0C A;  1JZR A;  3KTB A;  3IDV A;  2H70 A;  3HD5 A;  5CRW A;  1B48 A;  1GL8 A;  1AC1 A;  5EPF A;  2ALB A;  1WOU A;  4IS0 A;  4YAP A;  1TDI A;  4D73 A;  1XXU A;  2F51 A;  1NM3 A;  2C0G A;  2WRT A;  1H75 A;  1ZMA A;  3RHB A;  2OE0 A;  3KEB A;  1X9M B;  2DMM A;  5H5S A;  1WPI A;  2B5X A;  3IV4 A;  3D21 A;  1RK4 A;  4NMU A;  4I8B A;  4WEY A;  3LWA A;  1SK2 A;  4N0V A;  2A2R A;  2VD1 A;  5IMZ A;  5ID2 A;  3C8E A;  5KN3 A;  2H01 A;  1DSB A;  2BTO T;  4NHW A;  3VWX A;  2RM5 A;  2AUV A;  3M9J A;  4LLR A;  6GSV A;  3KH7 A;  2OE3 A;  5FWG A;  3KH9 A;  1OC8 A;  4L5O A;  4OFT A;  1FW1 A;  5C00 A;  4ZB9 A;  3RPN A;  1THO A;  2VO4 A;  3W8S A;  4HU9 A;  5AIS A;  1YEP A;  3UAR A;  1HYU A;  3A3T A;  1TI1 A;  2AYT A;  3IPZ A;  3GX8 A;  1URM A;  6GSX A;  3RAZ A;  2D2Z A;  5ECK B;  5ECH B;  4IHU A;  3W8J A;  1W4V A;  4WR4 A;  2PWJ A;  3HZ8 A;  4CDO A;  2HNL A;  2PVQ A;  3WGE A;  3F3Q A;  4HJM A;  2KHP A;  3FR9 A;  2IPA A;  3A2X A;  1SK0 A;  1AUC A;  12GS A;  2B5Y A;  1ACV A;  2CQ9 A;  3D4T A;  1TW9 A;  6GST A;  2MMO A;  2FY6 A;  1GUH A;  2XHF A;  1PMT A;  1Y6E A;  3KMO A;  3EYT A;  3O3T A;  2CVK A;  1AQW A;  4ULX A;  1YKC A;  1PL2 A;  1KBN A;  1E2Y A;  2C1Y A;  4EKZ A;  3GSS A;  3EUR A;  5KN2 A;  3A2V A;  3GH9 A;  4KDU A;  3ZZX A;  1HQO A;  3KD0 A;  4AF2 A;  7GSS A;  1QFN A;  1FG4 A;  1UA5 A;  2G0F A;  4G10 A;  1JZD A;  1M9A A;  4HU7 A;  3ED3 A;  4YH2 A;  3D4M A;  2H0G A;  1YY7 A;  2E0Q A;  2CZ2 A;  1OC3 A;  2DML A;  2PGT A;  3TKS A;  3ZVJ A;  1AAZ A;  1AQV A;  4MPG A;  2REM A;  1ABA A;  3TKS E;  2FWH A;  3TCO A;  5HR0 A;  3MDK A;  1EV4 A;  4POK A;  4ECJ A;  1XW9 A;  1PKW A;  5GAP D;  2VL2 C;  4LL1 B;  9GSS A;  4ZBB A;  1GTU A;  1HNA A;  3ZFL A;  5J4U A;  4N0Z A;  2GZP A;  2F8F A;  4DSS B;  3S9F A;  1PRX A;  4I6X A;  1FOV A;  5J9B A;  1FO5 A;  4IVF A;  2ES7 A;  3EIN A;  4ZB6 A;  4X1U A;  1DE2 A;  4I5Q A;  4K0G A;  1G7O A;  3F4T A;  2B7K A;  4F2I A;  1OKT A;  2AHE A;  4HQS A;  2C3Q A;  1O85 A;  1OKD A;  3TJG A;  2IME A;  4ZB8 A;  2JZR A;  1BJX A;  1U88 A;  2F8A A;  3APQ A;  3WYW A;  5D9X A;  4ZL7 A;  3EMX A;  3MAK A;  2LTK A;  1AQX A;  2H0H A;  3LOR A;  3QPM A;  2RUF A;  4MJB A;  1K3O A;  1MDK A;  4ISD A;  3L9S A;  5F05 A;  4IQA A;  3HVS A;  1M0U A;  4J2F A;  3ERW A;  5JCU A;  5J5N A;  5INY A;  2X8G A;  2CA8 A;  4HZ4 A;  5IMA A;  1JZW A;  3TUE A;  4ZBD A;  1J9B A;  5ENU A;  1SKR B;  2GSS A;  3TB2 A;  5DAK B;  2KLX A;  1SYR A;  1VRS D;  3IE3 A;  1GLQ A;  4MF5 A;  1YEX A;  1MD3 A;  3KP8 A;  4TR1 A;  1LU4 A;  2I81 A;  3IAM 2;  3PGT A;  1SK1 A;  2PMT A;  2PVO C;  5FHI A;  4TR4 A;  1NW2 A;  2H8L A;  1Z9H A;  4XS4 B;  3FZ4 A;  1T4Z A;  4L5L A;  3TGZ A;  1TXX A;  2EIQ A;  2JSY A;  2RII A;  2L4Q A;  1TK5 B;  1KNG A;  1V40 A;  2C3T A;  2IMD A;  2CAI A; 
#chains in the Genus database with same CATH topology
 2DIY A;  1ST9 A;  1GSU A;  1M99 A;  2ZUP A;  3FKF A;  3GMF A;  4KH7 A;  2DJ1 A;  4MCU A;  1E6B A;  10GS A;  1ZOF A;  3ZIJ A;  2K6V A;  4CY6 A;  4MMM A;  1U87 A;  2GT6 A;  4F0C A;  3D0Z A;  1A23 A;  2LQQ A;  5ECO B;  1LJR A;  2GTU A;  2LRN A;  4XIH A;  3LXZ A;  2OA7 A;  2DBC A;  3LJR A;  3I9V 2;  1XOA A;  2GQM A;  2CAQ A;  2M46 A;  4MK3 A;  1QQ2 A;  3DD3 A;  4PNF A;  1S3A A;  2B1K A;  4D73 B;  2O8V B;  1O81 A;  1X5C A;  3KTL A;  4MLY A;  4JR6 A;  5GST A;  4F9Z A;  4ZL8 A;  2I4A A;  4XRA A;  5IM9 A;  2IMI A;  2GT5 A;  1Q4J A;  1BYE A;  2OJL A;  1SD9 A;  4G19 A;  4Z2R A;  5EL8 A;  2YPM A;  3BOA A;  4PQ1 A;  2JU5 A;  1JLV A;  4ILF A;  2NVL A;  5JCW A;  1GUL A;  1R26 A;  3RBT A;  2R6K A;  3LW9 A;  3MNG A;  2YCD A;  2MBS A;  2LRT A;  2O85 A;  2FWF A;  3HYP A;  1GSF A;  1XG8 A;  1V2A A;  1FB6 A;  2V1M A;  2AV4 A;  4POB A;  4XTS A;  4PQI A;  4IP1 A;  4IBP A;  4I2U A;  4KGI A;  1N2A A;  3FRC A;  3R2Q A;  2YWM A;  1O73 A;  4MA9 A;  3E3E A;  3HZ4 A;  1M3I A;  2K8S A;  1EOG A;  3M9K A;  5IOW A;  4LMW A;  3LXT A;  1FB0 A;  1XWK A;  2JZS A;  6GSW A;  2NTO A;  2DJ3 A;  2NDO A;  2GQL A;  3DKS A;  1XOB A;  4XCS A;  2QSI A;  4GLT A;  1KTE A;  4AJ7 A;  1GH2 A;  2YN1 A;  3QMX A;  2LEG A;  2O89 A;  5EY6 A;  3C7M A;  1K0O A;  3C1S A;  1R5A A;  2LKU A;  4XS4 A;  2VOC A;  3L0H A;  1RQM A;  1SD8 A;  3BBY A;  1QGV A;  1VF1 A;  2O87 A;  3VK9 A;  2YWN A;  2JL4 A;  5B6M A;  1O7U A;  1TI3 A;  4K0N A;  2K18 A;  2WB9 A;  1ZCP A;  5H5Q A;  4PQH A;  4TKY A;  2CZ3 A;  1YF0 A;  2XPD A;  4MPF A;  3WGD A;  1PL1 A;  1X0R A;  3GUS A;  2JAC A;  5CP1 A;  4MP4 A;  1TP9 A;  2RUE A;  1B9X C;  3CTF A;  2HZE A;  4WF4 A;  5DAL A;  1XWB A;  5GZZ B;  2HRA A;  1S3D A;  3ZMK A;  20GS A;  2FD3 A;  3CRU A;  1K0N A;  4L0U A;  4KW6 A;  1UN2 A;  2DJK A;  4KSM A;  3TKS C;  1XWC A;  5DCG A;  1G7E A;  3G7I A;  3D6I A;  3J7Y b;  2YZU A;  4NV5 A;  2P5Q A;  1XIY A;  5IMF A;  3UL3 A;  3VWV A;  3VWU A;  2L5L A;  2OBI A;  1EGO A;  1XBS A;  2M80 A;  2YNX A;  1QK8 A;  1FAA A;  3CXG A;  1GTB A;  1U3A A;  3HY2 A;  2X8H A;  4K1F A;  5B8B A;  4EXJ A;  3H93 A;  6GSS A;  5F06 A;  4NHZ A;  4IGJ A;  4TR3 A;  2A2P A;  1XW5 A;  2L57 A;  1I9D A;  1HD2 A;  19GS A;  4ACS A;  2VCX A;  4LMV A;  3LGC A;  5ECP B;  1TK8 B;  2Z9S A;  1NHY A;  3EWL A;  4ZIL A;  3UOM A;  2E2G A;  2LST A;  2GST A;  2VIM A;  1PSQ A;  2V32 A;  1GTA A;  1THX A;  5D9W A;  4HEA 2;  2QA1 A;  1EEJ A;  2V6O A;  1X9W B;  4LL4 B;  4OFN A;  3DEX A;  4RI6 A;  3GKM A;  2DSA A;  3IR4 A;  3RDW A;  3F4R A;  1XWG A;  3HJM A;  1ILO A;  3WT1 A;  2N5A A;  1WJK A;  4NV2 A;  3IHG A;  3KMN A;  2VCV A;  1X5E A;  5IOX A;  2H1G A;  3DML A;  5JCG A;  1A2J A;  1J08 A;  4JZQ A;  6GSU A;  4USS A;  2H19 A;  1PKZ A;  1AIU A;  3NIV A;  2H71 A;  2DC5 A;  2TIR A;  4GRF A;  2VLV A;  5H5R A;  1G6Y A;  3ME7 A;  1WE0 A;  5ECN B;  2HXK A;  3F6F A;  2IIY A;  1W89 A;  6GSY A;  3DVW A;  4IEL A;  2HRF A;  2YJH A;  3DWV A;  4N10 A;  3FY7 A;  3CBU A;  5G5E A;  5AGY A;  2H76 A;  2JAD A;  1V9W A;  4K9Z A;  3I6A A;  4AGS A;  1G0T A;  3FZ9 A;  2YAN A;  3Q18 A;  4EDY A;  1HNB A;  3GUR A;  4BA7 A;  4O92 A;  4P3Y B;  4KDX A;  4K6X A;  4GSS A;  4MF7 A;  4POM A;  4TR1 B;  4ECI A;  1DUG A;  1Y25 A;  1MDI A;  2GSQ A;  4A5P A;  2B5E A;  5ABR A;  2N5F A;  3U6V A;  2N5B A;  3P90 A;  2IFQ A;  4XS6 A;  2FHE A;  1GSQ A;  1H4O A;  3HA9 A;  3TOT A;  2JZT A;  3EPT A;  3TKR A;  4BWS A;  3SBC A;  2VCT A;  4YQU A;  2V2G A;  4KB3 A;  2B3S A;  3FK8 A;  5BRT A;  2VAF A;  3GKX A;  2HZF A;  2VD0 A;  3I69 A;  5KN1 A;  1NHO A;  4L0W A;  2VCQ A;  3BCI A;  2MMZ A;  4NXI A;  3GNJ A;  1DE1 A;  5G2Z A;  1X5D A;  2BMX A;  2XBI A;  4RI7 A;  3UMA A;  1EOH A;  4BWQ A;  5HFI A;  5IMV A;  4PGT A;  2P0G A;  1TJD A;  3J7Y k;  3TKQ A;  4RUV A;  1FVJ A;  3W6G A;  1X9S B;  2H73 A;  1M7T A;  1M9B A;  1V98 A;  3APO A;  5A4U A;  3GYK A;  4BPY A;  1TRU A;  2AB6 A;  4G0K A;  3F9U A;  4K7N A;  2X49 A;  1QXH A;  3ERG A;  2GDR A;  4K2D A;  1ZGN A;  3QD9 A;  3VUR A;  4PX1 A;  3QAW A;  4GF0 A;  4KF9 A;  2LQO A;  3DYR A;  3LYP A;  3F0I A;  1SL0 B;  5J41 A;  4X4J A;  3LG6 A;  1QMV A;  3FZ5 A;  2C80 A;  3KIJ A;  5G1K A;  4Z2T A;  4XHM A;  3IHQ A;  3L78 A;  1ERW A;  4K7O A;  5D9T A;  5KEJ A;  3GKN A;  5F8B A;  2HRK A;  1Z3E A;  2L4C A;  3LEF A;  4MJE A;  1XVQ A;  2H74 A;  3BD2 A;  3ZLP A;  1SEN A;  5DBQ A;  2E7P A;  5J3R A;  4K2X A;  4DVC A;  2QA2 A;  2H6Y A;  4BVY A;  1T3B A;  2VLT A;  5LNK e;  2MMA A;  1A8Y A;  2J9H A;  3EU3 A;  3US3 A;  3IAS 2;  4O32 A;  1NSW A;  3ZFB A;  4BL7 B;  3GKK A;  4EUY A;  1F37 A;  1PN9 A;  3HJP A;  2CT6 A;  1IYI A;  2GS3 A;  1BQ7 A;  3H1N A;  3MIX A;  2R5G A;  2H75 A;  2KOK A;  4K5R A;  3C73 A;  1VGL A;  4GTU A;  3E9J B;  3IK7 A;  5E4W A;  1GUK A;  1XPV A;  4HZ2 A;  4I97 A;  2P5R A;  1WP0 A;  1M2D A;  3A5I A;  3CSH A;  4EO3 A;  4X43 A;  3RHC A;  2VUP A;  4KAE A;  4F82 A;  3KCM A;  5IO0 A;  1ZYE A;  1VF2 A;  4FH8 A;  2G2Q A;  3TJB A;  1F6M C;  3C71 A;  3TRP A;  3GL3 A;  1EEM A;  3DXB A;  3CTG A;  3GST A;  2L6D A;  1GSD A;  2V41 A;  4EL1 A;  1ML6 A;  2OBK A;  4G0L A;  3UJ1 A;  3FHK A;  3TJJ A;  3FR6 A;  2JSZ A;  4RQX A;  2AJQ B;  2IMK A;  1SKS B;  2H72 A;  3GHA A;  3GH6 A;  2LV3 A;  3DVX A;  1CQG A;  4MF6 A;  4YAV A;  1TRV A;  5G5F A;  4QL9 A;  3MSZ A;  5EVO A;  2HZE B;  4XRD A;  5DAL B;  5DJL A;  3JCM L;  3LQ7 A;  2HT9 A;  1A0F A;  3V1W A;  4Q5F A;  3O6T A;  5DCH A;  4JRR A;  1FOH A;  4JE1 A;  18GS A;  1MTC A;  3ISO A;  3QFA C;  3Q19 A;  1JHB A;  4HDE A;  4WR5 A;  2KUC A;  2I9H A;  5IPG A;  4YKG A;  1R5P A;  3UVH A;  3ZVJ D;  3TRX A;  2HYX A;  1K0A A;  4KX4 A;  3AY8 A;  4IW9 A;  2X64 A;  3PPU A;  5A5K A;  3NOF A;  2FUG 2;  4ZBA A;  4MZB A;  3M8N A;  1XZO A;  4MJC A;  4ZL9 A;  1YF1 A;  2C0E A;  4LA1 A;  1Z6N A;  4JU5 A;  5IMD A;  1T4Y A;  2QKE A;  1WMJ A;  3P2A A;  5C04 A;  4V1A p;  5DVB A;  4V2L A;  4AJ6 A;  2YV7 A;  1FVK A;  2WS2 A;  4FIW A;  2LJK A;  5HFK A;  5IO2 A;  2WJU A;  3Q6O A;  3GN3 A;  4KCA A;  8GSS A;  2PER A;  3GA4 A;  4TXV A;  2XPE A;  2C4J A;  3KGK A;  1GTI A;  1M2B A;  5CNW A;  4WF5 A;  4CW9 A;  2XC2 A;  2B7J A;  3D22 A;  1TRW A;  1MD4 A;  2PPT A;  4BL7 A;  5CRG A;  3OR5 A;  4KCE A;  1EP7 A;  3MWH A;  1WRY A;  4K8M A;  4PXO A;  2YWO A;  2GQK A;  4ICY A;  1K0D A;  1OAZ A;  4O5R A;  2TRC P;  3GRX A;  4NAX A;  2GGT A;  2X99 A;  1K3Y A;  3RPP A;  16GS A;  1HNC A;  1YDK A;  4GQC A;  4EVM A;  4EIP A;  1C72 A;  2GZZ A;  2MMN A;  2VL9 A;  3WT2 A;  3HVV A;  1Q98 A;  4ECB A;  1RW1 A;  4TW5 A;  2CV4 A;  1SJZ A;  3TOU A;  1YZX A;  2GVP A;  4NPB A;  3G7Y A;  4E8H A;  1SKW B;  3UAP A;  2PN8 A;  2GLR A;  1T7P B;  3UBK A;  3VWW A;  3GV1 A;  5DDL A;  2LS5 A;  2DKI A;  2EC4 A;  5CO3 A;  4EDZ A;  4WBR D;  1WIK A;  5LD0 A;  11GS A;  1XFL A;  2WZ9 A;  5D8I A;  2H6X A;  4PUR A;  3IA1 A;  4IN0 A;  1O8W A;  3PH9 A;  2IFQ B;  1ERU A;  3PIN A;  1YJ6 A;  1OVN A;  4O7H A;  5IPH A;  4WXT A;  4KE3 A;  4G2E A;  1Z7P A;  4N30 A;  4HS1 A;  3KXO A;  2VCZ A;  3GFK A;  3UBL A;  4TRX A;  3FMW A;  2FNO A;  2IJY A;  2LRC A;  4J57 E;  5D73 A;  5ELA A;  4KDY A;  1F3A A;  1K0B A;  4EF0 A;  1A0R P;  5ECI B;  1T8E B;  1VF3 A;  3VPQ A;  2WCI A;  2H66 A;  3VI7 A;  2FA4 A;  3H79 A;  5CRE A;  3IC8 A;  1GNW A;  3K8N A;  3QAG A;  3EC3 A;  2X8C A;  4EC0 A;  2RM6 A;  1K0M A;  2YOI A;  1S3C A;  2GSR A;  4KA0 A;  3ZRD A;  1XCC A;  2ZNM A;  2WFC A;  1BG5 A;  5D9V A;  2E2M A;  1PA3 A;  1ZYQ B;  2B6M A;  2KP1 A;  4PTS A;  4HI7 A;  5CYY A;  4MH2 A;  4K5S A;  4Q5N A;  3ZML A;  4IJI A;  3TRQ A;  1K3L A;  2L6C A;  2DJ0 A;  1SJI A;  3ZIT A;  1N8J A;  5ELG A;  3UVT A;  3HXS A;  1PQN A;  2H30 A;  5COH A;  4TR0 A;  4MZW A;  2HRN A;  2CVD A;  1EV9 A;  1TOF A;  4FQU A;  2R2J A;  4DSR A;  1JFU A;  3VLN A;  4V2M A;  1SU9 A;  3CSJ A;  3ZL5 A;  4BVY B;  4HOJ A;  2WDU A;  4Q5Q A;  2B1L A;  2ZCT A;  3BJ5 A;  4AJ8 A;  4OCE A;  1VF4 A;  2A4V A;  5IMC A;  2YJ7 A;  2DJ2 A;  2LNT A;  4IJ3 A;  3A5W A;  1TTZ A;  2P31 A;  3IRA A;  4ML6 A;  2I3Y A;  1OE8 A;  1ZYN A;  3N9J A;  4IP6 A;  4DEJ A;  3CRT A;  1G6W A;  2HI7 A;  4GST A;  3P8W A;  1GSY A;  3HHV A;  3PR8 A;  1AXD A;  1J0F A;  2DIZ A;  5AIV A;  3NZN A;  2V6K A;  5B6N A;  4YQV A;  3M3M A;  5ECQ B;  3EMP A;  2NBS A;  3FEU A;  2KP2 A;  3KZQ A;  5D96 A;  3C1R A;  1OC9 A;  1TK0 B;  4F03 A;  1ZL9 A;  1BAY A;  1TU7 A;  1Z5Y E;  5DQY A;  2MYG A;  2A4H A;  3TJK A;  1F2E A;  5J9C A;  2H0I A;  4DSQ A;  1JZO A;  3QFB C;  2VM1 A;  1M2A A;  3G9B A;  5IIZ A;  4MAB A;  1GSE A;  2FGX A;  3HKR A;  1USB A;  2AAW A;  3F3R A;  1PX6 A;  1JLW A;  3KP9 A;  1WWJ A;  5ECR B;  3U5R E;  3H8Q A;  2IN3 A;  4WET A;  3HVX A;  4QL7 A;  1A2L A;  1O6J A;  3M0F A;  2I1U A;  3CSI A;  3QR6 A;  2F9S A;  2YWI A;  4TXO B;  1U3I A;  1XWA A;  2FWE A;  3ERF A;  2HSH A;  3SWL A;  1V57 A;  2L59 A;  5JWR B;  5F0G A;  4GCI A;  1ERV A;  1GP1 A;  5HFG A;  4KUN A;  4I2T A;  2QC7 A;  3TDG A;  4QQ7 A;  4POL A;  1GRX A;  4V2N A;  3GTU B;  5L71 A;  4FO5 A;  3TKP A;  4ML1 A;  5B7C A;  1A8L A;  2PBJ A;  4PUA A;  3F4S A;  1GUM A;  3EVI A;  3QDN A;  3FW2 A;  1UVZ A;  2VL3 A;  22GS A;  4Z7X A;  1A2M A;  2R4V A;  2R0C A;  2F3M A;  1YQ1 A;  3DRN A;  4CHS A;  3Q74 A;  2FWG A;  2J23 A;  5HR2 A;  2ON5 A;  2IWT A;  5F07 A;  2HFD A;  4JR4 A;  4ZXG A;  2OE1 A;  1YKA A;  1CQH A;  2FLS A;  4G0I A;  2HLS A;  1SL1 B;  1SYX A;  2FA8 A;  3IK9 A;  1GNE A;  5FT3 A;  3D5J A;  3KM6 A;  2O7K A;  1TKD B;  3EU4 A;  1GWC A;  3O76 A;  4J56 E;  3IC4 A;  3HJO A;  2K8V A;  1EP8 A;  4PUF C;  1ON4 A;  2C0F A;  1R7H A;  3CYN A;  2CX4 A;  2EIR A;  4EE0 A;  1SJ6 A;  4WBJ A;  4MZC A;  2YZH A;  2R37 A;  4FYB A;  2PUK C;  5HQP A;  2CVB A;  3VPT A;  3FR3 A;  5HR1 A;  3GL5 A;  4KND A;  3M1G A;  4NWY A;  1B9Y C;  2DKH A;  2IL3 A;  2XBQ A;  2VLU A;  3IOS A;  4K7I A;  4IKH A;  3F63 A;  3DGQ A;  3ZTL A;  3N5O A;  4CY8 A;  4GQF A;  5DQS A;  3F8U A;  4YQM A;  5A4W A;  1BX9 A;  3BCK A;  1I5G A;  4ID0 A;  1UC7 A;  1U6T A;  5IQY A;  1XW6 A;  3P7X A;  4TVE A;  1PD2 1;  1AW9 A;  4Q5R A;  4OWY A;  2DLX A;  2K9F A;  3VFI A;  4G9H A;  4N11 A;  3IBH A;  3IXR A;  4OFM A;  2C0D A;  4RQR A;  2X4A A;  5JWQ B;  4IQ1 A;  2DJJ A;  3QOU A;  2LJR A;  3TJF A;  3R3E A;  4OO4 A;  2EIO A;  2QGV A;  4HJ2 A;  5ECS A;  2HSY A;  4TN8 A;  4TOP A;  4OO5 A;  5E59 A;  1O8X A;  4Z2U A;  1OYJ A;  1MEK A;  1ZZY A;  4TXO A;  5KOW A;  4EIQ A;  5GAN D;  2YV9 A;  3H4K A;  2R3X A;  3LSZ A;  3GIX A;  4XS1 A;  2C3N A;  4BVX B;  4L8E A;  3VI5 A;  1BED A;  1T1V A;  4OMV A;  3F6D A;  4X0X A;  3EE2 A;  1PGT A;  3APS A;  2MZC A;  3GTU A;  3ZRE A;  3L9U A;  4HUA A;  2TRX A;  14GS A;  1F9M A;  2H1B A;  2UZ8 A;  2LNS A;  3QAV A;  5G30 A;  2WUL A;  1XVW A;  1EWX A;  5A4V A;  2C8U A;  4GSN A;  1Z7R A;  1GSS A;  3ME8 A;  3HDC A;  2WGR A;  1MDJ A;  2MBT A;  5D93 A;  2OAC A;  4O5Q A;  2OAD A;  4DSS A;  3ZYW A;  1ERT A;  1IYH A;  2YP6 A;  3WD6 A;  3KJY A;  5DJM A;  5LCZ A;  1Z6M A;  5ECL B;  2GZY A;  4HSC X;  1EZK A;  2VL2 A;  2IMF A;  2M72 A;  3FYG A;  5G31 A;  5ID2 B;  3GX0 A;  4MDC A;  2L5O A;  4FYU A;  5GSS A;  2LJA A;  1KEB A;  4JED A;  2BJX A;  4JBB A;  5JWO B;  2RLI A;  5BMU A;  1FHE A;  4HQZ A;  5AIX A;  2OKA A;  4ZIJ A;  1B4Q A;  4GWR A;  5CRD A;  3G7J A;  4ECC A;  1R4W A;  3CMI A;  4MJA A;  3LFL A;  17GS A;  3ZIV A;  1OE7 A;  2ON7 A;  1F3B A;  3MYD A;  5CAX A;  1SL2 B;  1A24 A;  1PX7 A;  2HE3 A;  5ECM B;  3E0U A;  1GLP A;  3L9V A;  3WGX A;  2LUS A;  4MH3 A;  5HR3 A;  1DBY A;  5DAK A;  3UIW A;  5KN0 A;  2H6Z A;  3QCP A;  3UEM A;  2VM2 A;  4V1A g;  2FCH A;  4WKW A;  3HCZ A;  4GXZ A;  1V58 A;  2H1D A;  1QUW A;  1TRS A;  1B4P A;  4YKF A;  2PU9 C;  3I43 A;  4KSO A;  5G1L A;  1LBK A;  2A2S A;  1EGR A;  3DIE A;  5B8A A;  1B8X A;  13GS A;  3LYK A;  4FYC A;  4E8E A;  2H1A A;  1OC9 B;  3FZA A;  4F0B A;  4PNG A;  2VCW A;  5AN1 A;  1T00 A;  1TU8 A;  5CRH A;  3L4N A;  2NPB A;  4OCF A;  2CX3 A;  4BVX A;  4H86 A;  4OD7 A;  3A2W A;  1K0C A;  1JZR A;  3KTB A;  3IDV A;  2H70 A;  3HD5 A;  5CRW A;  1B48 A;  1GL8 A;  1AC1 A;  5EPF A;  2ALB A;  1WOU A;  4IS0 A;  3HVN A;  4YAP A;  1TDI A;  4MNN A;  4D73 A;  1XXU A;  2F51 A;  1NM3 A;  2C0G A;  2WRT A;  1H75 A;  3CQF A;  1ZMA A;  3RHB A;  2OE0 A;  3KEB A;  1X9M B;  2DMM A;  5H5S A;  1WPI A;  2B5X A;  3IV4 A;  3D21 A;  1RK4 A;  4NMU A;  4I8B A;  4WEY A;  3LWA A;  1SK2 A;  4N0V A;  2A2R A;  2VD1 A;  5IMZ A;  5ID2 A;  3C8E A;  5KN3 A;  2H01 A;  1DSB A;  2BTO T;  4NHW A;  3VWX A;  2RM5 A;  2AUV A;  3M9J A;  4LLR A;  6GSV A;  3KH7 A;  2OE3 A;  5FWG A;  3KH9 A;  1OC8 A;  4L5O A;  4OFT A;  1FW1 A;  5C00 A;  4ZB9 A;  3RPN A;  1THO A;  2VO4 A;  3W8S A;  4HU9 A;  5AIS A;  1YEP A;  3UAR A;  1HYU A;  3A3T A;  1TI1 A;  2AYT A;  3IPZ A;  3GX8 A;  1URM A;  6GSX A;  3RAZ A;  2D2Z A;  5ECK B;  5ECH B;  4IHU A;  3W8J A;  1W4V A;  4WR4 A;  2PWJ A;  3HZ8 A;  4CDO A;  2HNL A;  2PVQ A;  3WGE A;  3F3Q A;  4HJM A;  1PFO A;  2KHP A;  3FR9 A;  1PN0 A;  2IPA A;  3A2X A;  1SK0 A;  1AUC A;  12GS A;  2B5Y A;  1ACV A;  2CQ9 A;  3D4T A;  1TW9 A;  6GST A;  2MMO A;  2FY6 A;  1GUH A;  2XHF A;  1PMT A;  1Y6E A;  3KMO A;  3EYT A;  3O3T A;  2CVK A;  1AQW A;  4ULX A;  1YKC A;  1PL2 A;  1KBN A;  1E2Y A;  2C1Y A;  4EKZ A;  3GSS A;  3EUR A;  5KN2 A;  3A2V A;  3GH9 A;  4KDU A;  3ZZX A;  1HQO A;  3KD0 A;  4AF2 A;  7GSS A;  1QFN A;  1FG4 A;  1UA5 A;  2G0F A;  4G10 A;  1JZD A;  1M9A A;  4HU7 A;  3ED3 A;  4YH2 A;  3D4M A;  2H0G A;  1YY7 A;  2E0Q A;  2CZ2 A;  1OC3 A;  2DML A;  2PGT A;  3TKS A;  3ZVJ A;  1AAZ A;  1AQV A;  4MPG A;  2REM A;  1ABA A;  3TKS E;  2FWH A;  3TCO A;  5HR0 A;  3MDK A;  1EV4 A;  4POK A;  4ECJ A;  2R0G A;  1XW9 A;  1PKW A;  5GAP D;  2VL2 C;  4LL1 B;  9GSS A;  4ZBB A;  1GTU A;  1HNA A;  3ZFL A;  5J4U A;  4N0Z A;  2GZP A;  2F8F A;  4DSS B;  3S9F A;  1PRX A;  4I6X A;  1FOV A;  5J9B A;  1FO5 A;  4IVF A;  2ES7 A;  3EIN A;  4ZB6 A;  4X1U A;  1DE2 A;  4I5Q A;  4K0G A;  1G7O A;  3F4T A;  2B7K A;  2HSM A;  4F2I A;  1OKT A;  2AHE A;  4HQS A;  2C3Q A;  1O85 A;  1OKD A;  3TJG A;  2IME A;  4ZB8 A;  2JZR A;  1BJX A;  1U88 A;  2F8A A;  1ZYP A;  3APQ A;  3WYW A;  4BIK A;  4O5U A;  5D9X A;  4ZL7 A;  3EMX A;  3MAK A;  2LTK A;  1AQX A;  2H0H A;  3LOR A;  3QPM A;  2RUF A;  2R0P A;  4MJB A;  1K3O A;  1MDK A;  4ISD A;  3L9S A;  5F05 A;  4IQA A;  5KOX A;  1M3J A;  3HVS A;  1M0U A;  4J2F A;  3ERW A;  5JCU A;  5J5N A;  5INY A;  2X8G A;  2CA8 A;  4HZ4 A;  5IMA A;  1JZW A;  3TUE A;  4ZBD A;  1J9B A;  5ENU A;  1SKR B;  1S3R A;  2GSS A;  3TB2 A;  5DAK B;  2KLX A;  1SYR A;  1VRS D;  3IE3 A;  1GLQ A;  4MF5 A;  1YEX A;  1MD3 A;  3KP8 A;  4TR1 A;  1LU4 A;  2I81 A;  3IAM 2;  3PGT A;  1SK1 A;  2PMT A;  2PVO C;  5FHI A;  4TR4 A;  1NW2 A;  2H8L A;  1Z9H A;  4XS4 B;  3FZ4 A;  1T4Z A;  4L5L A;  3TGZ A;  1TXX A;  2EIQ A;  2JSY A;  2RII A;  2L4Q A;  1TK5 B;  1KNG A;  1V40 A;  2C3T A;  2IMD A;  2CAI A; 
#chains in the Genus database with same CATH homology
 2DIY A;  1ST9 A;  1GSU A;  1M99 A;  2ZUP A;  3FKF A;  3GMF A;  4KH7 A;  2DJ1 A;  4MCU A;  1E6B A;  10GS A;  1ZOF A;  3ZIJ A;  2K6V A;  4CY6 A;  4MMM A;  1U87 A;  2GT6 A;  4F0C A;  3D0Z A;  1A23 A;  2LQQ A;  5ECO B;  1LJR A;  2GTU A;  2LRN A;  4XIH A;  3LXZ A;  2OA7 A;  2DBC A;  3LJR A;  3I9V 2;  1XOA A;  2GQM A;  2CAQ A;  2M46 A;  4MK3 A;  1QQ2 A;  3DD3 A;  4PNF A;  1S3A A;  2B1K A;  4D73 B;  2O8V B;  1O81 A;  1X5C A;  3KTL A;  4MLY A;  4JR6 A;  5GST A;  4F9Z A;  4ZL8 A;  2I4A A;  4XRA A;  5IM9 A;  2IMI A;  2GT5 A;  1Q4J A;  1BYE A;  2OJL A;  1SD9 A;  4G19 A;  4Z2R A;  5EL8 A;  2YPM A;  3BOA A;  4PQ1 A;  2JU5 A;  1JLV A;  4ILF A;  2NVL A;  5JCW A;  1GUL A;  1R26 A;  3RBT A;  2R6K A;  3LW9 A;  3MNG A;  2YCD A;  2MBS A;  2LRT A;  2O85 A;  2FWF A;  3HYP A;  1GSF A;  1V2A A;  1FB6 A;  2V1M A;  2AV4 A;  4POB A;  4XTS A;  4PQI A;  4IP1 A;  4IBP A;  4I2U A;  4KGI A;  1N2A A;  3FRC A;  3R2Q A;  2YWM A;  1O73 A;  4MA9 A;  3E3E A;  3HZ4 A;  2K8S A;  1EOG A;  3M9K A;  5IOW A;  4LMW A;  3LXT A;  1FB0 A;  1XWK A;  2JZS A;  6GSW A;  2NTO A;  2DJ3 A;  2NDO A;  2GQL A;  3DKS A;  1XOB A;  4XCS A;  2QSI A;  4GLT A;  1KTE A;  4AJ7 A;  1GH2 A;  2YN1 A;  3QMX A;  2LEG A;  2O89 A;  5EY6 A;  3C7M A;  1K0O A;  3C1S A;  1R5A A;  2LKU A;  4XS4 A;  2VOC A;  3L0H A;  1RQM A;  1SD8 A;  3BBY A;  1QGV A;  1VF1 A;  2O87 A;  3VK9 A;  2YWN A;  2JL4 A;  5B6M A;  1O7U A;  1TI3 A;  4K0N A;  2K18 A;  2WB9 A;  1ZCP A;  5H5Q A;  4PQH A;  4TKY A;  2CZ3 A;  1YF0 A;  2XPD A;  4MPF A;  3WGD A;  1PL1 A;  1X0R A;  3GUS A;  2JAC A;  5CP1 A;  4MP4 A;  1TP9 A;  2RUE A;  1B9X C;  3CTF A;  2HZE A;  4WF4 A;  5DAL A;  1XWB A;  5GZZ B;  2HRA A;  1S3D A;  3ZMK A;  20GS A;  2FD3 A;  3CRU A;  1K0N A;  4L0U A;  4KW6 A;  1UN2 A;  2DJK A;  4KSM A;  3TKS C;  1XWC A;  5DCG A;  1G7E A;  3G7I A;  3D6I A;  3J7Y b;  2YZU A;  4NV5 A;  2P5Q A;  1XIY A;  5IMF A;  3UL3 A;  3VWV A;  3VWU A;  2L5L A;  2OBI A;  1EGO A;  1XBS A;  2M80 A;  2YNX A;  1QK8 A;  1FAA A;  3CXG A;  1GTB A;  1U3A A;  3HY2 A;  2X8H A;  4K1F A;  5B8B A;  4EXJ A;  3H93 A;  6GSS A;  5F06 A;  4NHZ A;  4IGJ A;  4TR3 A;  2A2P A;  1XW5 A;  2L57 A;  1I9D A;  1HD2 A;  19GS A;  4ACS A;  2VCX A;  4LMV A;  3LGC A;  5ECP B;  1TK8 B;  2Z9S A;  1NHY A;  3EWL A;  4ZIL A;  3UOM A;  2E2G A;  2LST A;  2GST A;  2VIM A;  1PSQ A;  2V32 A;  1GTA A;  1THX A;  5D9W A;  4HEA 2;  2QA1 A;  1EEJ A;  2V6O A;  1X9W B;  4LL4 B;  4OFN A;  3DEX A;  4RI6 A;  3GKM A;  2DSA A;  3IR4 A;  3RDW A;  3F4R A;  1XWG A;  3HJM A;  1ILO A;  3WT1 A;  2N5A A;  1WJK A;  4NV2 A;  3IHG A;  3KMN A;  2VCV A;  1X5E A;  5IOX A;  2H1G A;  3DML A;  5JCG A;  1A2J A;  1J08 A;  4JZQ A;  6GSU A;  4USS A;  2H19 A;  1PKZ A;  1AIU A;  3NIV A;  2H71 A;  2DC5 A;  2TIR A;  4GRF A;  2VLV A;  5H5R A;  1G6Y A;  3ME7 A;  1WE0 A;  5ECN B;  2HXK A;  3F6F A;  2IIY A;  1W89 A;  6GSY A;  3DVW A;  4IEL A;  2HRF A;  2YJH A;  3DWV A;  4N10 A;  3FY7 A;  3CBU A;  5G5E A;  5AGY A;  2H76 A;  2JAD A;  1V9W A;  4K9Z A;  3I6A A;  4AGS A;  1G0T A;  3FZ9 A;  2YAN A;  3Q18 A;  4EDY A;  1HNB A;  3GUR A;  4BA7 A;  4O92 A;  4P3Y B;  4KDX A;  4K6X A;  4GSS A;  4MF7 A;  4POM A;  4TR1 B;  4ECI A;  1DUG A;  1Y25 A;  1MDI A;  2GSQ A;  4A5P A;  2B5E A;  5ABR A;  2N5F A;  3U6V A;  2N5B A;  3P90 A;  2IFQ A;  4XS6 A;  2FHE A;  1GSQ A;  1H4O A;  3HA9 A;  3TOT A;  2JZT A;  3EPT A;  3TKR A;  4BWS A;  3SBC A;  2VCT A;  4YQU A;  2V2G A;  4KB3 A;  2B3S A;  3FK8 A;  5BRT A;  2VAF A;  3GKX A;  2HZF A;  2VD0 A;  3I69 A;  5KN1 A;  1NHO A;  4L0W A;  2VCQ A;  3BCI A;  2MMZ A;  4NXI A;  3GNJ A;  1DE1 A;  5G2Z A;  1X5D A;  2BMX A;  2XBI A;  4RI7 A;  3UMA A;  1EOH A;  4BWQ A;  5HFI A;  5IMV A;  4PGT A;  2P0G A;  1TJD A;  3J7Y k;  3TKQ A;  4RUV A;  1FVJ A;  3W6G A;  1X9S B;  2H73 A;  1M7T A;  1M9B A;  1V98 A;  3APO A;  5A4U A;  3GYK A;  4BPY A;  1TRU A;  2AB6 A;  4G0K A;  3F9U A;  4K7N A;  2X49 A;  1QXH A;  3ERG A;  2GDR A;  4K2D A;  1ZGN A;  3QD9 A;  3VUR A;  4PX1 A;  3QAW A;  4GF0 A;  4KF9 A;  2LQO A;  3DYR A;  3LYP A;  3F0I A;  1SL0 B;  5J41 A;  4X4J A;  3LG6 A;  1QMV A;  3FZ5 A;  2C80 A;  3KIJ A;  5G1K A;  4Z2T A;  4XHM A;  3IHQ A;  3L78 A;  1ERW A;  4K7O A;  5D9T A;  5KEJ A;  3GKN A;  5F8B A;  2HRK A;  1Z3E A;  2L4C A;  3LEF A;  4MJE A;  1XVQ A;  2H74 A;  3BD2 A;  3ZLP A;  1SEN A;  5DBQ A;  2E7P A;  5J3R A;  4K2X A;  4DVC A;  2QA2 A;  2H6Y A;  4BVY A;  1T3B A;  2VLT A;  5LNK e;  2MMA A;  1A8Y A;  2J9H A;  3EU3 A;  3US3 A;  3IAS 2;  4O32 A;  1NSW A;  3ZFB A;  4BL7 B;  3GKK A;  4EUY A;  1F37 A;  1PN9 A;  3HJP A;  2CT6 A;  1IYI A;  2GS3 A;  1BQ7 A;  3H1N A;  3MIX A;  2R5G A;  2H75 A;  2KOK A;  4K5R A;  3C73 A;  1VGL A;  4GTU A;  3E9J B;  3IK7 A;  5E4W A;  1GUK A;  1XPV A;  4HZ2 A;  4I97 A;  2P5R A;  1WP0 A;  1M2D A;  3A5I A;  3CSH A;  4EO3 A;  4X43 A;  3RHC A;  2VUP A;  4KAE A;  4F82 A;  3KCM A;  5IO0 A;  1ZYE A;  1VF2 A;  4FH8 A;  2G2Q A;  3TJB A;  1F6M C;  3C71 A;  3TRP A;  3GL3 A;  1EEM A;  3DXB A;  3CTG A;  3GST A;  2L6D A;  1GSD A;  2V41 A;  4EL1 A;  1ML6 A;  2OBK A;  4G0L A;  3UJ1 A;  3FHK A;  3TJJ A;  3FR6 A;  2JSZ A;  4RQX A;  2AJQ B;  2IMK A;  1SKS B;  2H72 A;  3GHA A;  3GH6 A;  2LV3 A;  3DVX A;  1CQG A;  4MF6 A;  4YAV A;  1TRV A;  5G5F A;  4QL9 A;  3MSZ A;  5EVO A;  2HZE B;  4XRD A;  5DAL B;  5DJL A;  3JCM L;  3LQ7 A;  2HT9 A;  1A0F A;  3V1W A;  4Q5F A;  3O6T A;  5DCH A;  4JRR A;  1FOH A;  4JE1 A;  18GS A;  1MTC A;  3ISO A;  3QFA C;  3Q19 A;  1JHB A;  4HDE A;  4WR5 A;  2KUC A;  2I9H A;  5IPG A;  4YKG A;  1R5P A;  3UVH A;  3ZVJ D;  3TRX A;  2HYX A;  1K0A A;  4KX4 A;  3AY8 A;  4IW9 A;  2X64 A;  3PPU A;  5A5K A;  3NOF A;  2FUG 2;  4ZBA A;  4MZB A;  3M8N A;  1XZO A;  4MJC A;  4ZL9 A;  1YF1 A;  2C0E A;  4LA1 A;  1Z6N A;  4JU5 A;  5IMD A;  1T4Y A;  2QKE A;  1WMJ A;  3P2A A;  5C04 A;  4V1A p;  5DVB A;  4V2L A;  4AJ6 A;  2YV7 A;  1FVK A;  2WS2 A;  4FIW A;  2LJK A;  5HFK A;  5IO2 A;  2WJU A;  3Q6O A;  3GN3 A;  4KCA A;  8GSS A;  2PER A;  3GA4 A;  4TXV A;  2XPE A;  2C4J A;  3KGK A;  1GTI A;  1M2B A;  5CNW A;  4WF5 A;  4CW9 A;  2XC2 A;  2B7J A;  3D22 A;  1TRW A;  1MD4 A;  2PPT A;  4BL7 A;  5CRG A;  3OR5 A;  4KCE A;  1EP7 A;  3MWH A;  1WRY A;  4K8M A;  4PXO A;  2YWO A;  2GQK A;  4ICY A;  1K0D A;  1OAZ A;  4O5R A;  2TRC P;  3GRX A;  4NAX A;  2GGT A;  2X99 A;  1K3Y A;  3RPP A;  16GS A;  1HNC A;  1YDK A;  4GQC A;  4EVM A;  4EIP A;  1C72 A;  2GZZ A;  2MMN A;  2VL9 A;  3WT2 A;  3HVV A;  1Q98 A;  4ECB A;  1RW1 A;  4TW5 A;  2CV4 A;  1SJZ A;  3TOU A;  1YZX A;  2GVP A;  4NPB A;  3G7Y A;  4E8H A;  1SKW B;  3UAP A;  2PN8 A;  2GLR A;  1T7P B;  3UBK A;  3VWW A;  3GV1 A;  5DDL A;  2LS5 A;  2DKI A;  2EC4 A;  5CO3 A;  4EDZ A;  4WBR D;  1WIK A;  5LD0 A;  11GS A;  1XFL A;  2WZ9 A;  5D8I A;  2H6X A;  4PUR A;  3IA1 A;  4IN0 A;  1O8W A;  3PH9 A;  2IFQ B;  1ERU A;  3PIN A;  1YJ6 A;  1OVN A;  4O7H A;  5IPH A;  4WXT A;  4KE3 A;  4G2E A;  1Z7P A;  4N30 A;  4HS1 A;  3KXO A;  2VCZ A;  3GFK A;  3UBL A;  4TRX A;  3FMW A;  2FNO A;  2IJY A;  2LRC A;  4J57 E;  5D73 A;  5ELA A;  4KDY A;  1F3A A;  1K0B A;  4EF0 A;  1A0R P;  5ECI B;  1T8E B;  1VF3 A;  3VPQ A;  2WCI A;  2H66 A;  3VI7 A;  2FA4 A;  3H79 A;  5CRE A;  3IC8 A;  1GNW A;  3K8N A;  3QAG A;  3EC3 A;  2X8C A;  4EC0 A;  2RM6 A;  1K0M A;  2YOI A;  1S3C A;  2GSR A;  4KA0 A;  3ZRD A;  1XCC A;  2ZNM A;  2WFC A;  1BG5 A;  5D9V A;  2E2M A;  1PA3 A;  1ZYQ B;  2B6M A;  2KP1 A;  4PTS A;  4HI7 A;  5CYY A;  4MH2 A;  4K5S A;  4Q5N A;  3ZML A;  4IJI A;  3TRQ A;  1K3L A;  2L6C A;  2DJ0 A;  1SJI A;  3ZIT A;  1N8J A;  5ELG A;  3UVT A;  3HXS A;  1PQN A;  2H30 A;  5COH A;  4TR0 A;  4MZW A;  2HRN A;  2CVD A;  1EV9 A;  1TOF A;  4FQU A;  2R2J A;  4DSR A;  1JFU A;  3VLN A;  4V2M A;  1SU9 A;  3CSJ A;  3ZL5 A;  4BVY B;  4HOJ A;  2WDU A;  4Q5Q A;  2B1L A;  2ZCT A;  3BJ5 A;  4AJ8 A;  4OCE A;  1VF4 A;  2A4V A;  5IMC A;  2YJ7 A;  2DJ2 A;  2LNT A;  4IJ3 A;  3A5W A;  1TTZ A;  2P31 A;  3IRA A;  4ML6 A;  2I3Y A;  1OE8 A;  1ZYN A;  3N9J A;  4IP6 A;  4DEJ A;  3CRT A;  1G6W A;  2HI7 A;  4GST A;  3P8W A;  1GSY A;  3HHV A;  3PR8 A;  1AXD A;  1J0F A;  2DIZ A;  5AIV A;  3NZN A;  2V6K A;  5B6N A;  4YQV A;  3M3M A;  5ECQ B;  3EMP A;  2NBS A;  3FEU A;  2KP2 A;  3KZQ A;  5D96 A;  3C1R A;  1OC9 A;  1TK0 B;  4F03 A;  1ZL9 A;  1BAY A;  1TU7 A;  1Z5Y E;  5DQY A;  2MYG A;  2A4H A;  3TJK A;  1F2E A;  5J9C A;  2H0I A;  4DSQ A;  1JZO A;  3QFB C;  2VM1 A;  1M2A A;  3G9B A;  5IIZ A;  4MAB A;  1GSE A;  2FGX A;  3HKR A;  1USB A;  2AAW A;  3F3R A;  1PX6 A;  1JLW A;  3KP9 A;  1WWJ A;  5ECR B;  3U5R E;  3H8Q A;  2IN3 A;  4WET A;  3HVX A;  4QL7 A;  1A2L A;  1O6J A;  3M0F A;  2I1U A;  3CSI A;  3QR6 A;  2F9S A;  2YWI A;  4TXO B;  1U3I A;  1XWA A;  2FWE A;  3ERF A;  2HSH A;  3SWL A;  1V57 A;  2L59 A;  5JWR B;  5F0G A;  4GCI A;  1ERV A;  1GP1 A;  5HFG A;  4KUN A;  4I2T A;  2QC7 A;  3TDG A;  4QQ7 A;  4POL A;  1GRX A;  4V2N A;  3GTU B;  5L71 A;  4FO5 A;  3TKP A;  4ML1 A;  5B7C A;  1A8L A;  2PBJ A;  4PUA A;  3F4S A;  1GUM A;  3EVI A;  3QDN A;  3FW2 A;  1UVZ A;  2VL3 A;  22GS A;  4Z7X A;  1A2M A;  2R4V A;  2R0C A;  2F3M A;  1YQ1 A;  3DRN A;  4CHS A;  3Q74 A;  2FWG A;  2J23 A;  5HR2 A;  2ON5 A;  2IWT A;  5F07 A;  2HFD A;  4JR4 A;  4ZXG A;  2OE1 A;  1YKA A;  1CQH A;  2FLS A;  4G0I A;  2HLS A;  1SL1 B;  1SYX A;  2FA8 A;  3IK9 A;  1GNE A;  5FT3 A;  3D5J A;  3KM6 A;  2O7K A;  1TKD B;  3EU4 A;  1GWC A;  3O76 A;  4J56 E;  3IC4 A;  3HJO A;  2K8V A;  1EP8 A;  4PUF C;  1ON4 A;  2C0F A;  1R7H A;  3CYN A;  2CX4 A;  2EIR A;  4EE0 A;  1SJ6 A;  4WBJ A;  4MZC A;  2YZH A;  2R37 A;  4FYB A;  2PUK C;  5HQP A;  2CVB A;  3VPT A;  3FR3 A;  5HR1 A;  3GL5 A;  4KND A;  3M1G A;  4NWY A;  1B9Y C;  2DKH A;  2IL3 A;  2XBQ A;  2VLU A;  3IOS A;  4K7I A;  4IKH A;  3F63 A;  3DGQ A;  3ZTL A;  3N5O A;  4CY8 A;  4GQF A;  5DQS A;  3F8U A;  4YQM A;  5A4W A;  1BX9 A;  3BCK A;  1I5G A;  4ID0 A;  1UC7 A;  1U6T A;  5IQY A;  1XW6 A;  3P7X A;  4TVE A;  1PD2 1;  1AW9 A;  4Q5R A;  4OWY A;  2DLX A;  2K9F A;  3VFI A;  4G9H A;  4N11 A;  3IBH A;  3IXR A;  4OFM A;  2C0D A;  4RQR A;  2X4A A;  5JWQ B;  4IQ1 A;  2DJJ A;  3QOU A;  2LJR A;  3TJF A;  3R3E A;  4OO4 A;  2EIO A;  2QGV A;  4HJ2 A;  5ECS A;  2HSY A;  4TN8 A;  4TOP A;  4OO5 A;  5E59 A;  1O8X A;  4Z2U A;  1OYJ A;  1MEK A;  1ZZY A;  4TXO A;  5KOW A;  4EIQ A;  5GAN D;  2YV9 A;  3H4K A;  2R3X A;  3LSZ A;  3GIX A;  4XS1 A;  2C3N A;  4BVX B;  4L8E A;  3VI5 A;  1BED A;  1T1V A;  4OMV A;  3F6D A;  4X0X A;  3EE2 A;  1PGT A;  3APS A;  2MZC A;  3GTU A;  3ZRE A;  3L9U A;  4HUA A;  2TRX A;  14GS A;  1F9M A;  2H1B A;  2UZ8 A;  2LNS A;  3QAV A;  5G30 A;  2WUL A;  1XVW A;  1EWX A;  5A4V A;  2C8U A;  4GSN A;  1Z7R A;  1GSS A;  3ME8 A;  3HDC A;  2WGR A;  1MDJ A;  2MBT A;  5D93 A;  2OAC A;  4O5Q A;  2OAD A;  4DSS A;  3ZYW A;  1ERT A;  1IYH A;  2YP6 A;  3WD6 A;  3KJY A;  5DJM A;  5LCZ A;  1Z6M A;  5ECL B;  2GZY A;  1EZK A;  2VL2 A;  2IMF A;  2M72 A;  3FYG A;  5G31 A;  5ID2 B;  3GX0 A;  4MDC A;  2L5O A;  4FYU A;  5GSS A;  2LJA A;  1KEB A;  4JED A;  2BJX A;  4JBB A;  5JWO B;  2RLI A;  5BMU A;  1FHE A;  4HQZ A;  5AIX A;  2OKA A;  4ZIJ A;  1B4Q A;  4GWR A;  5CRD A;  3G7J A;  4ECC A;  1R4W A;  3CMI A;  4MJA A;  3LFL A;  17GS A;  3ZIV A;  1OE7 A;  2ON7 A;  1F3B A;  3MYD A;  5CAX A;  1SL2 B;  1A24 A;  1PX7 A;  2HE3 A;  5ECM B;  3E0U A;  1GLP A;  3L9V A;  3WGX A;  2LUS A;  4MH3 A;  5HR3 A;  1DBY A;  5DAK A;  3UIW A;  5KN0 A;  2H6Z A;  3QCP A;  3UEM A;  2VM2 A;  4V1A g;  2FCH A;  4WKW A;  3HCZ A;  4GXZ A;  1V58 A;  2H1D A;  1QUW A;  1TRS A;  1B4P A;  4YKF A;  2PU9 C;  3I43 A;  4KSO A;  5G1L A;  1LBK A;  2A2S A;  1EGR A;  3DIE A;  5B8A A;  1B8X A;  13GS A;  3LYK A;  4FYC A;  4E8E A;  2H1A A;  1OC9 B;  3FZA A;  4F0B A;  4PNG A;  2VCW A;  5AN1 A;  1T00 A;  1TU8 A;  5CRH A;  3L4N A;  2NPB A;  4OCF A;  2CX3 A;  4BVX A;  4H86 A;  4OD7 A;  3A2W A;  1K0C A;  1JZR A;  3KTB A;  3IDV A;  2H70 A;  3HD5 A;  5CRW A;  1B48 A;  1GL8 A;  1AC1 A;  5EPF A;  2ALB A;  1WOU A;  4IS0 A;  4YAP A;  1TDI A;  4MNN A;  4D73 A;  1XXU A;  2F51 A;  1NM3 A;  2C0G A;  2WRT A;  1H75 A;  1ZMA A;  3RHB A;  2OE0 A;  3KEB A;  1X9M B;  2DMM A;  5H5S A;  1WPI A;  2B5X A;  3IV4 A;  3D21 A;  1RK4 A;  4NMU A;  4I8B A;  4WEY A;  3LWA A;  1SK2 A;  4N0V A;  2A2R A;  2VD1 A;  5IMZ A;  5ID2 A;  3C8E A;  5KN3 A;  2H01 A;  1DSB A;  2BTO T;  4NHW A;  3VWX A;  2RM5 A;  2AUV A;  3M9J A;  4LLR A;  6GSV A;  3KH7 A;  2OE3 A;  5FWG A;  3KH9 A;  1OC8 A;  4L5O A;  4OFT A;  1FW1 A;  5C00 A;  4ZB9 A;  3RPN A;  1THO A;  2VO4 A;  3W8S A;  4HU9 A;  5AIS A;  1YEP A;  3UAR A;  1HYU A;  3A3T A;  1TI1 A;  2AYT A;  3IPZ A;  3GX8 A;  1URM A;  6GSX A;  3RAZ A;  2D2Z A;  5ECK B;  5ECH B;  4IHU A;  3W8J A;  1W4V A;  4WR4 A;  2PWJ A;  3HZ8 A;  4CDO A;  2HNL A;  2PVQ A;  3WGE A;  3F3Q A;  4HJM A;  2KHP A;  3FR9 A;  1PN0 A;  2IPA A;  3A2X A;  1SK0 A;  1AUC A;  12GS A;  2B5Y A;  1ACV A;  2CQ9 A;  3D4T A;  1TW9 A;  6GST A;  2MMO A;  2FY6 A;  1GUH A;  2XHF A;  1PMT A;  1Y6E A;  3KMO A;  3EYT A;  3O3T A;  2CVK A;  1AQW A;  4ULX A;  1YKC A;  1PL2 A;  1KBN A;  1E2Y A;  2C1Y A;  4EKZ A;  3GSS A;  3EUR A;  5KN2 A;  3A2V A;  3GH9 A;  4KDU A;  3ZZX A;  1HQO A;  3KD0 A;  4AF2 A;  7GSS A;  1QFN A;  1FG4 A;  1UA5 A;  2G0F A;  4G10 A;  1JZD A;  1M9A A;  4HU7 A;  3ED3 A;  4YH2 A;  3D4M A;  2H0G A;  1YY7 A;  2E0Q A;  2CZ2 A;  1OC3 A;  2DML A;  2PGT A;  3TKS A;  3ZVJ A;  1AAZ A;  1AQV A;  4MPG A;  2REM A;  1ABA A;  3TKS E;  2FWH A;  3TCO A;  5HR0 A;  3MDK A;  1EV4 A;  4POK A;  4ECJ A;  2R0G A;  1XW9 A;  1PKW A;  5GAP D;  2VL2 C;  4LL1 B;  9GSS A;  4ZBB A;  1GTU A;  1HNA A;  3ZFL A;  5J4U A;  4N0Z A;  2GZP A;  2F8F A;  4DSS B;  3S9F A;  1PRX A;  4I6X A;  1FOV A;  5J9B A;  1FO5 A;  4IVF A;  2ES7 A;  3EIN A;  4ZB6 A;  4X1U A;  1DE2 A;  4I5Q A;  4K0G A;  1G7O A;  3F4T A;  2B7K A;  2HSM A;  4F2I A;  1OKT A;  2AHE A;  4HQS A;  2C3Q A;  1O85 A;  1OKD A;  3TJG A;  2IME A;  4ZB8 A;  2JZR A;  1BJX A;  1U88 A;  2F8A A;  1ZYP A;  3APQ A;  3WYW A;  4O5U A;  5D9X A;  4ZL7 A;  3EMX A;  3MAK A;  2LTK A;  1AQX A;  2H0H A;  3LOR A;  3QPM A;  2RUF A;  2R0P A;  4MJB A;  1K3O A;  1MDK A;  4ISD A;  3L9S A;  5F05 A;  4IQA A;  5KOX A;  3HVS A;  1M0U A;  4J2F A;  3ERW A;  5JCU A;  5J5N A;  5INY A;  2X8G A;  2CA8 A;  4HZ4 A;  5IMA A;  1JZW A;  3TUE A;  4ZBD A;  1J9B A;  5ENU A;  1SKR B;  2GSS A;  3TB2 A;  5DAK B;  2KLX A;  1SYR A;  1VRS D;  3IE3 A;  1GLQ A;  4MF5 A;  1YEX A;  1MD3 A;  3KP8 A;  4TR1 A;  1LU4 A;  2I81 A;  3IAM 2;  3PGT A;  1SK1 A;  2PMT A;  2PVO C;  5FHI A;  4TR4 A;  1NW2 A;  2H8L A;  1Z9H A;  4XS4 B;  3FZ4 A;  1T4Z A;  4L5L A;  3TGZ A;  1TXX A;  2EIQ A;  2JSY A;  2RII A;  2L4Q A;  1TK5 B;  1KNG A;  1V40 A;  2C3T A;  2IMD A;  2CAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...