3DW8C

Structure of a protein phosphatase 2a holoenzyme with b55 subunit
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 106
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3dw8C00
2KKNA 4UT2A 3AUZA 2IE4C 1S3MA 4FCXA 3HVQA 4I5NC 3H69A 4JA7A 2WDCA 4H2FA 2NYMC 4HD0A 1HO5A 4MOYA 4FBWA 3RL5A 5J28A 1XZWA 3RL3A 5JJTA 3T1IA 4Q7FA 4M0VA 2YVTA 3QFKA 3C5WC 2JOGA 4H2IA 3THNA 5JPEA 5F3WA 3E7BA 2Z1AA 1AUIA 4OR9A 2A22A 3EGGA 4ZVZA 3K7WC 1NNWA 2ZBMA 2WDFA 3QFNA 1S3NA 2HYOA 2BCDA 2WDEA 2BDXA 1WARA 1T70A 1XM7A 3DW8C 3JYFA 4ORCA 5C1VA 2O8GA 2GJUA 4G9JA 4DHLA 2NYLC 1SU1A 3ICFA 3V4YA 4IL1A 3QG5C 1S3LA 1IT6A 4LTYA 1V73A 2USHA 3GVEA 1Z2XA 3FGAC 1JK7A 5GTUA 1Z2WA 2BQ8X 4V0WA 3QFOA 1W24A 5INBA 1HPUA 5EQVA 1FJMA 3DSCA 4UT3B 2Z06A 4H1YP 1HP1A 2CV9A 3IVDA 1WAO1 3H68A 4MOVA 4KBPA 1S95A 3E7AA 4I5LC 3QFMA 4B2OA 2HY1A 2P6BA 3IB8A 4O4KA 4WWLA 1OI8A 3H67A 5JPFA 4YKEA 4IYPC 3TGHA 2AHDA 3P71C 4KKZA 3C9FA 5DNYA 1G5BA 1MF8A 4ORAA 4DT2A 4F0ZA 2O8AA 5B8IA 1QFCA 4LACC 2Q8UA 1S70A 1TCOA 3PSOA 4FBKA 4V0XA 2XMOA 3RL4A 3K7VC 4UT3A 1U32A 5HPEA 2HYPA 3KBPA 2IE3C 1UF3A 2QFRA 3ZU0A 3H61A 1OIDA 1T71A 1II7A 4MP0A 5IOHA 3H66A 1UTEA 1KBPA 2DFJA 2IAEC 4H1SA 4H2GA 4UWQA 4JA9A 2Z72A 1QHWA 2R17A 3H62B 2NXFA 4DSYA 1S8EA 4FBQA 4NZVA 3ZTVA 3IB7A 4O43A 3RQZA 4ORBA 2WDDA 2QFPA 4V0VA 3N5UA 1OIEA 3AV0A 1USHA 4O5GA 4H2BA 3EGHA 3DSDA 3LL8A 3IVEA 3H63A 4O24A 4TUIA 4LU9A 4ZX2A 2QJCA 4XPNA 3THOB 3CK2A 4TUGA 3H64A 4J6OA 3PSNA 1M63A 2NPPC 3H60A
chains in the Genus database with same CATH superfamily
2KKNA 4UT2A 3AUZA 2IE4C 1S3MA 4FCXA 3HVQA 4I5NC 3H69A 4JA7A 2WDCA 4H2FA 2NYMC 4HD0A 1HO5A 4MOYA 4FBWA 3RL5A 5J28A 1XZWA 3RL3A 5JJTA 3T1IA 4Q7FA 4M0VA 2YVTA 3QFKA 3C5WC 2JOGA 4H2IA 3THNA 5JPEA 5F3WA 3E7BA 2Z1AA 1AUIA 4OR9A 2A22A 3EGGA 4ZVZA 3K7WC 1NNWA 2ZBMA 2WDFA 3QFNA 1S3NA 2HYOA 2BCDA 2WDEA 2BDXA 1WARA 1T70A 1XM7A 3DW8C 3JYFA 4ORCA 5C1VA 2O8GA 2GJUA 4G9JA 2DXNA 4DHLA 2NYLC 3FLOA 1SU1A 3ICFA 2YEQA 3V4YA 4IL1A 2DXLA 3QG5C 1S3LA 1IT6A 4LTYA 1V73A 2USHA 3GVEA 1Z2XA 3FGAC 1JK7A 5GTUA 1Z2WA 2BQ8X 4V0WA 3QFOA 1W24A 5INBA 1HPUA 5EQVA 1FJMA 3DSCA 4UT3B 2Z06A 4H1YP 1HP1A 2CV9A 3IVDA 1WAO1 3H68A 4MOVA 4KBPA 1S95A 3E7AA 4I5LC 3QFMA 4B2OA 2HY1A 2P6BA 3IB8A 4O4KA 4WWLA 1OI8A 3H67A 5JPFA 4YKEA 2ZO9B 4IYPC 3TGHA 2AHDA 3P71C 4KKZA 3C9FA 5DNYA 1G5BA 1MF8A 4ORAA 4DT2A 4F0ZA 2O8AA 5B8IA 3E0JA 1QFCA 4LACC 2ZOAA 2Q8UA 1S70A 1TCOA 3PSOA 4FBKA 4V0XA 2XMOA 3RL4A 3K7VC 4UT3A 1U32A 5HPEA 2HYPA 3KBPA 2IE3C 1UF3A 2QFRA 3ZU0A 3H61A 1OIDA 1T71A 1II7A 4MP0A 5IOHA 3H66A 1UTEA 1KBPA 2DFJA 2IAEC 4H1SA 4H2GA 4UWQA 4JA9A 2Z72A 1QHWA 2R17A 3H62B 2NXFA 4DSYA 1S8EA 4FBQA 4NZVA 3D03A 3ZTVA 3IB7A 4O43A 3RQZA 4ORBA 2WDDA 2QFPA 4V0VA 3N5UA 1OIEA 3AV0A 1USHA 4O5GA 4H2BA 3EGHA 3DSDA 3LL8A 3IVEA 3H63A 4O24A 4TUIA 4LU9A 4ZX2A 2QJCA 4XPNA 3THOB 3CK2A 4TUGA 3H64A 4J6OA 3PSNA 1M63A 2NPPC 3H60A
chains in the Genus database with same CATH topology
2KKNA 4UT2A 3AUZA 2IE4C 1S3MA 4FCXA 3HVQA 4I5NC 3H69A 4JA7A 2WDCA 4H2FA 2NYMC 4HD0A 1HO5A 4MOYA 4FBWA 3RL5A 5J28A 1XZWA 3RL3A 5JJTA 3T1IA 4Q7FA 4M0VA 2YVTA 3QFKA 3C5WC 2JOGA 4H2IA 3THNA 5JPEA 5F3WA 3E7BA 2Z1AA 1AUIA 4OR9A 2A22A 3EGGA 4ZVZA 3K7WC 1NNWA 2ZBMA 2WDFA 3QFNA 1S3NA 2HYOA 2BCDA 2WDEA 2BDXA 1WARA 1T70A 1XM7A 3DW8C 3JYFA 4ORCA 5C1VA 2O8GA 2GJUA 4G9JA 2DXNA 4DHLA 2NYLC 3FLOA 1SU1A 3ICFA 2YEQA 3V4YA 4IL1A 2DXLA 3QG5C 1S3LA 1IT6A 4LTYA 1V73A 2USHA 3GVEA 1Z2XA 3FGAC 1JK7A 5GTUA 1Z2WA 2BQ8X 4V0WA 3QFOA 1W24A 5INBA 1HPUA 5EQVA 1FJMA 3DSCA 4UT3B 2Z06A 4H1YP 1HP1A 2CV9A 3IVDA 1WAO1 3H68A 4MOVA 4KBPA 1S95A 3E7AA 4I5LC 3QFMA 4B2OA 2HY1A 2P6BA 3IB8A 4O4KA 4WWLA 1OI8A 3H67A 5JPFA 4YKEA 2ZO9B 4IYPC 3TGHA 2AHDA 3P71C 4KKZA 3C9FA 5DNYA 1G5BA 1MF8A 4ORAA 4DT2A 4F0ZA 2O8AA 5B8IA 3E0JA 1QFCA 4LACC 2ZOAA 2Q8UA 1S70A 1TCOA 3PSOA 4FBKA 4V0XA 2XMOA 3RL4A 3K7VC 4UT3A 1U32A 5HPEA 2HYPA 3KBPA 2IE3C 1UF3A 2QFRA 3ZU0A 3H61A 1OIDA 1T71A 1II7A 4MP0A 5IOHA 3H66A 1UTEA 1KBPA 2DFJA 2IAEC 4H1SA 4H2GA 4UWQA 4JA9A 2Z72A 1QHWA 2R17A 3H62B 2NXFA 4DSYA 1S8EA 4FBQA 4NZVA 3D03A 3ZTVA 3IB7A 4O43A 3RQZA 4ORBA 2WDDA 2QFPA 4V0VA 3N5UA 1OIEA 3AV0A 1USHA 4O5GA 4H2BA 3EGHA 3DSDA 3LL8A 3IVEA 3H63A 4O24A 4TUIA 4LU9A 4ZX2A 2QJCA 4XPNA 3THOB 3CK2A 4TUGA 3H64A 4J6OA 3PSNA 1M63A 2NPPC 3H60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKN A;  4UT2 A;  3AUZ A;  2IE4 C;  1S3M A;  4FCX A;  3HVQ A;  4I5N C;  3H69 A;  4JA7 A;  2WDC A;  4H2F A;  2NYM C;  4HD0 A;  1HO5 A;  4MOY A;  4FBW A;  3RL5 A;  5J28 A;  1XZW A;  3RL3 A;  5JJT A;  3T1I A;  4Q7F A;  4M0V A;  2YVT A;  3QFK A;  3C5W C;  2JOG A;  4H2I A;  3THN A;  5JPE A;  5F3W A;  3E7B A;  2Z1A A;  1AUI A;  4OR9 A;  2A22 A;  3EGG A;  4ZVZ A;  3K7W C;  1NNW A;  2ZBM A;  2WDF A;  3QFN A;  1S3N A;  2HYO A;  2BCD A;  2WDE A;  2BDX A;  1WAR A;  1T70 A;  1XM7 A;  3DW8 C;  3JYF A;  4ORC A;  5C1V A;  2O8G A;  2GJU A;  4G9J A;  4DHL A;  2NYL C;  1SU1 A;  3ICF A;  3V4Y A;  4IL1 A;  3QG5 C;  1S3L A;  1IT6 A;  4LTY A;  1V73 A;  2USH A;  3GVE A;  1Z2X A;  3FGA C;  1JK7 A;  5GTU A;  1Z2W A;  2BQ8 X;  4V0W A;  3QFO A;  1W24 A;  5INB A;  1HPU A;  5EQV A;  1FJM A;  3DSC A;  4UT3 B;  2Z06 A;  4H1Y P;  1HP1 A;  2CV9 A;  3IVD A;  1WAO 1;  3H68 A;  4MOV A;  4KBP A;  1S95 A;  3E7A A;  4I5L C;  3QFM A;  4B2O A;  2HY1 A;  2P6B A;  3IB8 A;  4O4K A;  4WWL A;  1OI8 A;  3H67 A;  5JPF A;  4YKE A;  4IYP C;  3TGH A;  2AHD A;  3P71 C;  4KKZ A;  3C9F A;  5DNY A;  1G5B A;  1MF8 A;  4ORA A;  4DT2 A;  4F0Z A;  2O8A A;  5B8I A;  1QFC A;  4LAC C;  2Q8U A;  1S70 A;  1TCO A;  3PSO A;  4FBK A;  4V0X A;  2XMO A;  3RL4 A;  3K7V C;  4UT3 A;  1U32 A;  5HPE A;  2HYP A;  3KBP A;  2IE3 C;  1UF3 A;  2QFR A;  3ZU0 A;  3H61 A;  1OID A;  1T71 A;  1II7 A;  4MP0 A;  5IOH A;  3H66 A;  1UTE A;  1KBP A;  2DFJ A;  2IAE C;  4H1S A;  4H2G A;  4UWQ A;  4JA9 A;  2Z72 A;  1QHW A;  2R17 A;  3H62 B;  2NXF A;  4DSY A;  1S8E A;  4FBQ A;  4NZV A;  3ZTV A;  3IB7 A;  4O43 A;  3RQZ A;  4ORB A;  2WDD A;  2QFP A;  4V0V A;  3N5U A;  1OIE A;  3AV0 A;  1USH A;  4O5G A;  4H2B A;  3EGH A;  3DSD A;  3LL8 A;  3IVE A;  3H63 A;  4O24 A;  4TUI A;  4LU9 A;  4ZX2 A;  2QJC A;  4XPN A;  3THO B;  3CK2 A;  4TUG A;  3H64 A;  4J6O A;  3PSN A;  1M63 A;  2NPP C;  3H60 A; 
#chains in the Genus database with same CATH topology
 2KKN A;  4UT2 A;  3AUZ A;  2IE4 C;  1S3M A;  4FCX A;  3HVQ A;  4I5N C;  3H69 A;  4JA7 A;  2WDC A;  4H2F A;  2NYM C;  4HD0 A;  1HO5 A;  4MOY A;  4FBW A;  3RL5 A;  5J28 A;  1XZW A;  3RL3 A;  5JJT A;  3T1I A;  4Q7F A;  4M0V A;  2YVT A;  3QFK A;  3C5W C;  2JOG A;  4H2I A;  3THN A;  5JPE A;  5F3W A;  3E7B A;  2Z1A A;  1AUI A;  4OR9 A;  2A22 A;  3EGG A;  4ZVZ A;  3K7W C;  1NNW A;  2ZBM A;  2WDF A;  3QFN A;  1S3N A;  2HYO A;  2BCD A;  2WDE A;  2BDX A;  1WAR A;  1T70 A;  1XM7 A;  3DW8 C;  3JYF A;  4ORC A;  5C1V A;  2O8G A;  2GJU A;  4G9J A;  2DXN A;  4DHL A;  2NYL C;  3FLO A;  1SU1 A;  3ICF A;  2YEQ A;  3V4Y A;  4IL1 A;  2DXL A;  3QG5 C;  1S3L A;  1IT6 A;  4LTY A;  1V73 A;  2USH A;  3GVE A;  1Z2X A;  3FGA C;  1JK7 A;  5GTU A;  1Z2W A;  2BQ8 X;  4V0W A;  3QFO A;  1W24 A;  5INB A;  1HPU A;  5EQV A;  1FJM A;  3DSC A;  4UT3 B;  2Z06 A;  4H1Y P;  1HP1 A;  2CV9 A;  3IVD A;  1WAO 1;  3H68 A;  4MOV A;  4KBP A;  1S95 A;  3E7A A;  4I5L C;  3QFM A;  4B2O A;  2HY1 A;  2P6B A;  3IB8 A;  4O4K A;  4WWL A;  1OI8 A;  3H67 A;  5JPF A;  4YKE A;  2ZO9 B;  4IYP C;  3TGH A;  2AHD A;  3P71 C;  4KKZ A;  3C9F A;  5DNY A;  1G5B A;  1MF8 A;  4ORA A;  4DT2 A;  4F0Z A;  2O8A A;  5B8I A;  3E0J A;  1QFC A;  4LAC C;  2ZOA A;  2Q8U A;  1S70 A;  1TCO A;  3PSO A;  4FBK A;  4V0X A;  2XMO A;  3RL4 A;  3K7V C;  4UT3 A;  1U32 A;  5HPE A;  2HYP A;  3KBP A;  2IE3 C;  1UF3 A;  2QFR A;  3ZU0 A;  3H61 A;  1OID A;  1T71 A;  1II7 A;  4MP0 A;  5IOH A;  3H66 A;  1UTE A;  1KBP A;  2DFJ A;  2IAE C;  4H1S A;  4H2G A;  4UWQ A;  4JA9 A;  2Z72 A;  1QHW A;  2R17 A;  3H62 B;  2NXF A;  4DSY A;  1S8E A;  4FBQ A;  4NZV A;  3D03 A;  3ZTV A;  3IB7 A;  4O43 A;  3RQZ A;  4ORB A;  2WDD A;  2QFP A;  4V0V A;  3N5U A;  1OIE A;  3AV0 A;  1USH A;  4O5G A;  4H2B A;  3EGH A;  3DSD A;  3LL8 A;  3IVE A;  3H63 A;  4O24 A;  4TUI A;  4LU9 A;  4ZX2 A;  2QJC A;  4XPN A;  3THO B;  3CK2 A;  4TUG A;  3H64 A;  4J6O A;  3PSN A;  1M63 A;  2NPP C;  3H60 A; 
#chains in the Genus database with same CATH homology
 2KKN A;  4UT2 A;  3AUZ A;  2IE4 C;  1S3M A;  4FCX A;  3HVQ A;  4I5N C;  3H69 A;  4JA7 A;  2WDC A;  4H2F A;  2NYM C;  4HD0 A;  1HO5 A;  4MOY A;  4FBW A;  3RL5 A;  5J28 A;  1XZW A;  3RL3 A;  5JJT A;  3T1I A;  4Q7F A;  4M0V A;  2YVT A;  3QFK A;  3C5W C;  2JOG A;  4H2I A;  3THN A;  5JPE A;  5F3W A;  3E7B A;  2Z1A A;  1AUI A;  4OR9 A;  2A22 A;  3EGG A;  4ZVZ A;  3K7W C;  1NNW A;  2ZBM A;  2WDF A;  3QFN A;  1S3N A;  2HYO A;  2BCD A;  2WDE A;  2BDX A;  1WAR A;  1T70 A;  1XM7 A;  3DW8 C;  3JYF A;  4ORC A;  5C1V A;  2O8G A;  2GJU A;  4G9J A;  2DXN A;  4DHL A;  2NYL C;  3FLO A;  1SU1 A;  3ICF A;  2YEQ A;  3V4Y A;  4IL1 A;  2DXL A;  3QG5 C;  1S3L A;  1IT6 A;  4LTY A;  1V73 A;  2USH A;  3GVE A;  1Z2X A;  3FGA C;  1JK7 A;  5GTU A;  1Z2W A;  2BQ8 X;  4V0W A;  3QFO A;  1W24 A;  5INB A;  1HPU A;  5EQV A;  1FJM A;  3DSC A;  4UT3 B;  2Z06 A;  4H1Y P;  1HP1 A;  2CV9 A;  3IVD A;  1WAO 1;  3H68 A;  4MOV A;  4KBP A;  1S95 A;  3E7A A;  4I5L C;  3QFM A;  4B2O A;  2HY1 A;  2P6B A;  3IB8 A;  4O4K A;  4WWL A;  1OI8 A;  3H67 A;  5JPF A;  4YKE A;  2ZO9 B;  4IYP C;  3TGH A;  2AHD A;  3P71 C;  4KKZ A;  3C9F A;  5DNY A;  1G5B A;  1MF8 A;  4ORA A;  4DT2 A;  4F0Z A;  2O8A A;  5B8I A;  3E0J A;  1QFC A;  4LAC C;  2ZOA A;  2Q8U A;  1S70 A;  1TCO A;  3PSO A;  4FBK A;  4V0X A;  2XMO A;  3RL4 A;  3K7V C;  4UT3 A;  1U32 A;  5HPE A;  2HYP A;  3KBP A;  2IE3 C;  1UF3 A;  2QFR A;  3ZU0 A;  3H61 A;  1OID A;  1T71 A;  1II7 A;  4MP0 A;  5IOH A;  3H66 A;  1UTE A;  1KBP A;  2DFJ A;  2IAE C;  4H1S A;  4H2G A;  4UWQ A;  4JA9 A;  2Z72 A;  1QHW A;  2R17 A;  3H62 B;  2NXF A;  4DSY A;  1S8E A;  4FBQ A;  4NZV A;  3D03 A;  3ZTV A;  3IB7 A;  4O43 A;  3RQZ A;  4ORB A;  2WDD A;  2QFP A;  4V0V A;  3N5U A;  1OIE A;  3AV0 A;  1USH A;  4O5G A;  4H2B A;  3EGH A;  3DSD A;  3LL8 A;  3IVE A;  3H63 A;  4O24 A;  4TUI A;  4LU9 A;  4ZX2 A;  2QJC A;  4XPN A;  3THO B;  3CK2 A;  4TUG A;  3H64 A;  4J6O A;  3PSN A;  1M63 A;  2NPP C;  3H60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...