3DW8C

Structure of a protein phosphatase 2a holoenzyme with b55 subunit
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
288
structure length
288
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 106
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3dw8C00
1IT6A 3IVDA 4FBQA 3RL5A 2HYOA 4LACC 1FJMA 2HYPA 1KBPA 4ORAA 3PSNA 3GVEA 2XMOA 3AV0A 4LU9A 2WDEA 3FGAC 5B8IA 2DFJA 2CV9A 1T70A 2Z1AA 3CK2A 1JK7A 1G5BA 4I5NC 5C1VA 1XZWA 1SU1A 1HPUA 3H63A 2R17A 4FBWA 5DNYA 2QJCA 4JA7A 2WDCA 2O8GA 4OR9A 1W24A 2Z06A 1II7A 3DW8C 4MOVA 2BDXA 4DHLA 3QFKA 1UTEA 4XPNA 4J6OA 3QFNA 4HD0A 1S95A 3IB8A 4H2IA 1QHWA 3P71C 3AUZA 4Q7FA 2O8AA 3E7AA 4KBPA 2NPPC 3H68A 3C5WC 2NYLC 3DSCA 2HY1A 4V0WA 2BCDA 2KKNA 3JYFA 5JPEA 2Z72A 4MP0A 1OIDA 4UT3A 4G9JA 4ORCA 1QFCA 1XM7A 2NYMC 4ZVZA 2NXFA 3ZU0A 4KKZA 4NZVA 4JA9A 2ZBMA 4O4KA 3THNA 3HVQA 3IB7A 4O5GA 3THOB 3QG5C 3IVEA 3ICFA 3K7VC 3KBPA 5GTUA 4DSYA 4F0ZA 1TCOA 4WWLA 3EGGA 3TGHA 3E7BA 4V0VA 1AUIA 1V73A 1S3NA 1OI8A 1S8EA 3T1IA 4H1SA 1HP1A 3RL3A 1S3LA 2WDDA 4MOYA 1Z2XA 3QFOA 4UT2A 4UT3B 4V0XA 2IAEC 4FCXA 4O24A 3ZTVA 5EQVA 2IE3C 1S3MA 3V4YA 2JOGA 4TUIA 3H60A 5JJTA 3RQZA 1S70A 1NNWA 2GJUA 2WDFA 4FBKA 4O43A 1HO5A 4H2BA 4B2OA 3LL8A 3PSOA 5IOHA 3DSDA 4UWQA 4H1YP 3RL4A 2A22A 3N5UA 3H61A 4IYPC 5INBA 3C9FA 4M0VA 4LTYA 2QFPA 2Q8UA 2AHDA 4TUGA 5JPFA 1UF3A 2BQ8X 1USHA 1OIEA 3H62B 4ORBA 3H69A 4H2GA 1WAO1 1M63A 2IE4C 1T71A 3H67A 4DT2A 3EGHA 2USHA 3H64A 3QFMA 1Z2WA 1U32A 1WARA 2YVTA 2QFRA 3K7WC 5F3WA 4H2FA 4ZX2A 5HPEA 2P6BA 3H66A 4I5LC 4YKEA 5J28A 4IL1A 1MF8A
chains in the Genus database with same CATH superfamily
1IT6A 3IVDA 4FBQA 3RL5A 2HYOA 3FLOA 1FJMA 4LACC 2HYPA 1KBPA 4ORAA 3PSNA 3GVEA 2XMOA 3AV0A 4LU9A 2WDEA 3FGAC 5B8IA 2DFJA 2CV9A 1T70A 2Z1AA 3CK2A 1JK7A 1G5BA 3D03A 4I5NC 5C1VA 1XZWA 1SU1A 1HPUA 3H63A 2R17A 4FBWA 5DNYA 2QJCA 4JA7A 2WDCA 2O8GA 4OR9A 1W24A 2Z06A 1II7A 3DW8C 4MOVA 2BDXA 4DHLA 3QFKA 1UTEA 4XPNA 4J6OA 3QFNA 4HD0A 1S95A 3IB8A 2DXLA 4H2IA 1QHWA 3P71C 3AUZA 4Q7FA 2O8AA 3E7AA 4KBPA 2NPPC 3H68A 3C5WC 2NYLC 3E0JA 2ZO9B 3DSCA 2HY1A 4V0WA 2DXNA 2BCDA 2KKNA 3JYFA 5JPEA 2Z72A 4MP0A 1OIDA 4UT3A 4G9JA 4ORCA 1QFCA 1XM7A 2NYMC 4ZVZA 2NXFA 3ZU0A 4KKZA 4NZVA 4JA9A 2ZBMA 4O4KA 3THNA 3HVQA 3IB7A 4O5GA 3THOB 3QG5C 3IVEA 3ICFA 3K7VC 3KBPA 5GTUA 4DSYA 4F0ZA 1TCOA 4WWLA 3EGGA 3TGHA 3E7BA 4V0VA 1AUIA 1V73A 1S3NA 1OI8A 1S8EA 3T1IA 4H1SA 1HP1A 3RL3A 1S3LA 2WDDA 4MOYA 1Z2XA 3QFOA 4UT2A 4UT3B 4V0XA 2IAEC 4FCXA 4O24A 3ZTVA 5EQVA 2IE3C 1S3MA 3V4YA 2JOGA 4TUIA 3H60A 5JJTA 3RQZA 1S70A 1NNWA 2GJUA 2WDFA 4FBKA 4O43A 1HO5A 4H2BA 4B2OA 3LL8A 3PSOA 5IOHA 3DSDA 4UWQA 4H1YP 3RL4A 2A22A 3N5UA 3H61A 4IYPC 2YEQA 5INBA 3C9FA 4M0VA 4LTYA 2QFPA 2Q8UA 2AHDA 4TUGA 5JPFA 1UF3A 2BQ8X 1USHA 1OIEA 3H62B 4ORBA 3H69A 4H2GA 1WAO1 1M63A 2IE4C 1T71A 3H67A 4DT2A 3EGHA 2USHA 3H64A 3QFMA 1Z2WA 1U32A 1WARA 2YVTA 2QFRA 3K7WC 5F3WA 4H2FA 4ZX2A 5HPEA 2ZOAA 2P6BA 3H66A 4I5LC 4YKEA 5J28A 4IL1A 1MF8A
chains in the Genus database with same CATH topology
1IT6A 3IVDA 4FBQA 3RL5A 2HYOA 3FLOA 1FJMA 4LACC 2HYPA 1KBPA 4ORAA 3PSNA 3GVEA 2XMOA 3AV0A 4LU9A 2WDEA 3FGAC 5B8IA 2DFJA 2CV9A 1T70A 2Z1AA 3CK2A 1JK7A 1G5BA 3D03A 4I5NC 5C1VA 1XZWA 1SU1A 1HPUA 3H63A 2R17A 4FBWA 5DNYA 2QJCA 4JA7A 2WDCA 2O8GA 4OR9A 1W24A 2Z06A 1II7A 3DW8C 4MOVA 2BDXA 4DHLA 3QFKA 1UTEA 4XPNA 4J6OA 3QFNA 4HD0A 1S95A 3IB8A 2DXLA 4H2IA 1QHWA 3P71C 3AUZA 4Q7FA 2O8AA 3E7AA 4KBPA 2NPPC 3H68A 3C5WC 2NYLC 3E0JA 2ZO9B 3DSCA 2HY1A 4V0WA 2DXNA 2BCDA 2KKNA 3JYFA 5JPEA 2Z72A 4MP0A 1OIDA 4UT3A 4G9JA 4ORCA 1QFCA 1XM7A 2NYMC 4ZVZA 2NXFA 3ZU0A 4KKZA 4NZVA 4JA9A 2ZBMA 4O4KA 3THNA 3HVQA 3IB7A 4O5GA 3THOB 3QG5C 3IVEA 3ICFA 3K7VC 3KBPA 5GTUA 4DSYA 4F0ZA 1TCOA 4WWLA 3EGGA 3TGHA 3E7BA 4V0VA 1AUIA 1V73A 1S3NA 1OI8A 1S8EA 3T1IA 4H1SA 1HP1A 3RL3A 1S3LA 2WDDA 4MOYA 1Z2XA 3QFOA 4UT2A 4UT3B 4V0XA 2IAEC 4FCXA 4O24A 3ZTVA 5EQVA 2IE3C 1S3MA 3V4YA 2JOGA 4TUIA 3H60A 5JJTA 3RQZA 1S70A 1NNWA 2GJUA 2WDFA 4FBKA 4O43A 1HO5A 4H2BA 4B2OA 3LL8A 3PSOA 5IOHA 3DSDA 4UWQA 4H1YP 3RL4A 2A22A 3N5UA 3H61A 4IYPC 2YEQA 5INBA 3C9FA 4M0VA 4LTYA 2QFPA 2Q8UA 2AHDA 4TUGA 5JPFA 1UF3A 2BQ8X 1USHA 1OIEA 3H62B 4ORBA 3H69A 4H2GA 1WAO1 1M63A 2IE4C 1T71A 3H67A 4DT2A 3EGHA 2USHA 3H64A 3QFMA 1Z2WA 1U32A 1WARA 2YVTA 2QFRA 3K7WC 5F3WA 4H2FA 4ZX2A 5HPEA 2ZOAA 2P6BA 3H66A 4I5LC 4YKEA 5J28A 4IL1A 1MF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IT6 A;  3IVD A;  4FBQ A;  3RL5 A;  2HYO A;  4LAC C;  1FJM A;  2HYP A;  1KBP A;  4ORA A;  3PSN A;  3GVE A;  2XMO A;  3AV0 A;  4LU9 A;  2WDE A;  3FGA C;  5B8I A;  2DFJ A;  2CV9 A;  1T70 A;  2Z1A A;  3CK2 A;  1JK7 A;  1G5B A;  4I5N C;  5C1V A;  1XZW A;  1SU1 A;  1HPU A;  3H63 A;  2R17 A;  4FBW A;  5DNY A;  2QJC A;  4JA7 A;  2WDC A;  2O8G A;  4OR9 A;  1W24 A;  2Z06 A;  1II7 A;  3DW8 C;  4MOV A;  2BDX A;  4DHL A;  3QFK A;  1UTE A;  4XPN A;  4J6O A;  3QFN A;  4HD0 A;  1S95 A;  3IB8 A;  4H2I A;  1QHW A;  3P71 C;  3AUZ A;  4Q7F A;  2O8A A;  3E7A A;  4KBP A;  2NPP C;  3H68 A;  3C5W C;  2NYL C;  3DSC A;  2HY1 A;  4V0W A;  2BCD A;  2KKN A;  3JYF A;  5JPE A;  2Z72 A;  4MP0 A;  1OID A;  4UT3 A;  4G9J A;  4ORC A;  1QFC A;  1XM7 A;  2NYM C;  4ZVZ A;  2NXF A;  3ZU0 A;  4KKZ A;  4NZV A;  4JA9 A;  2ZBM A;  4O4K A;  3THN A;  3HVQ A;  3IB7 A;  4O5G A;  3THO B;  3QG5 C;  3IVE A;  3ICF A;  3K7V C;  3KBP A;  5GTU A;  4DSY A;  4F0Z A;  1TCO A;  4WWL A;  3EGG A;  3TGH A;  3E7B A;  4V0V A;  1AUI A;  1V73 A;  1S3N A;  1OI8 A;  1S8E A;  3T1I A;  4H1S A;  1HP1 A;  3RL3 A;  1S3L A;  2WDD A;  4MOY A;  1Z2X A;  3QFO A;  4UT2 A;  4UT3 B;  4V0X A;  2IAE C;  4FCX A;  4O24 A;  3ZTV A;  5EQV A;  2IE3 C;  1S3M A;  3V4Y A;  2JOG A;  4TUI A;  3H60 A;  5JJT A;  3RQZ A;  1S70 A;  1NNW A;  2GJU A;  2WDF A;  4FBK A;  4O43 A;  1HO5 A;  4H2B A;  4B2O A;  3LL8 A;  3PSO A;  5IOH A;  3DSD A;  4UWQ A;  4H1Y P;  3RL4 A;  2A22 A;  3N5U A;  3H61 A;  4IYP C;  5INB A;  3C9F A;  4M0V A;  4LTY A;  2QFP A;  2Q8U A;  2AHD A;  4TUG A;  5JPF A;  1UF3 A;  2BQ8 X;  1USH A;  1OIE A;  3H62 B;  4ORB A;  3H69 A;  4H2G A;  1WAO 1;  1M63 A;  2IE4 C;  1T71 A;  3H67 A;  4DT2 A;  3EGH A;  2USH A;  3H64 A;  3QFM A;  1Z2W A;  1U32 A;  1WAR A;  2YVT A;  2QFR A;  3K7W C;  5F3W A;  4H2F A;  4ZX2 A;  5HPE A;  2P6B A;  3H66 A;  4I5L C;  4YKE A;  5J28 A;  4IL1 A;  1MF8 A; 
#chains in the Genus database with same CATH topology
 1IT6 A;  3IVD A;  4FBQ A;  3RL5 A;  2HYO A;  3FLO A;  1FJM A;  4LAC C;  2HYP A;  1KBP A;  4ORA A;  3PSN A;  3GVE A;  2XMO A;  3AV0 A;  4LU9 A;  2WDE A;  3FGA C;  5B8I A;  2DFJ A;  2CV9 A;  1T70 A;  2Z1A A;  3CK2 A;  1JK7 A;  1G5B A;  3D03 A;  4I5N C;  5C1V A;  1XZW A;  1SU1 A;  1HPU A;  3H63 A;  2R17 A;  4FBW A;  5DNY A;  2QJC A;  4JA7 A;  2WDC A;  2O8G A;  4OR9 A;  1W24 A;  2Z06 A;  1II7 A;  3DW8 C;  4MOV A;  2BDX A;  4DHL A;  3QFK A;  1UTE A;  4XPN A;  4J6O A;  3QFN A;  4HD0 A;  1S95 A;  3IB8 A;  2DXL A;  4H2I A;  1QHW A;  3P71 C;  3AUZ A;  4Q7F A;  2O8A A;  3E7A A;  4KBP A;  2NPP C;  3H68 A;  3C5W C;  2NYL C;  3E0J A;  2ZO9 B;  3DSC A;  2HY1 A;  4V0W A;  2DXN A;  2BCD A;  2KKN A;  3JYF A;  5JPE A;  2Z72 A;  4MP0 A;  1OID A;  4UT3 A;  4G9J A;  4ORC A;  1QFC A;  1XM7 A;  2NYM C;  4ZVZ A;  2NXF A;  3ZU0 A;  4KKZ A;  4NZV A;  4JA9 A;  2ZBM A;  4O4K A;  3THN A;  3HVQ A;  3IB7 A;  4O5G A;  3THO B;  3QG5 C;  3IVE A;  3ICF A;  3K7V C;  3KBP A;  5GTU A;  4DSY A;  4F0Z A;  1TCO A;  4WWL A;  3EGG A;  3TGH A;  3E7B A;  4V0V A;  1AUI A;  1V73 A;  1S3N A;  1OI8 A;  1S8E A;  3T1I A;  4H1S A;  1HP1 A;  3RL3 A;  1S3L A;  2WDD A;  4MOY A;  1Z2X A;  3QFO A;  4UT2 A;  4UT3 B;  4V0X A;  2IAE C;  4FCX A;  4O24 A;  3ZTV A;  5EQV A;  2IE3 C;  1S3M A;  3V4Y A;  2JOG A;  4TUI A;  3H60 A;  5JJT A;  3RQZ A;  1S70 A;  1NNW A;  2GJU A;  2WDF A;  4FBK A;  4O43 A;  1HO5 A;  4H2B A;  4B2O A;  3LL8 A;  3PSO A;  5IOH A;  3DSD A;  4UWQ A;  4H1Y P;  3RL4 A;  2A22 A;  3N5U A;  3H61 A;  4IYP C;  2YEQ A;  5INB A;  3C9F A;  4M0V A;  4LTY A;  2QFP A;  2Q8U A;  2AHD A;  4TUG A;  5JPF A;  1UF3 A;  2BQ8 X;  1USH A;  1OIE A;  3H62 B;  4ORB A;  3H69 A;  4H2G A;  1WAO 1;  1M63 A;  2IE4 C;  1T71 A;  3H67 A;  4DT2 A;  3EGH A;  2USH A;  3H64 A;  3QFM A;  1Z2W A;  1U32 A;  1WAR A;  2YVT A;  2QFR A;  3K7W C;  5F3W A;  4H2F A;  4ZX2 A;  5HPE A;  2ZOA A;  2P6B A;  3H66 A;  4I5L C;  4YKE A;  5J28 A;  4IL1 A;  1MF8 A; 
#chains in the Genus database with same CATH homology
 1IT6 A;  3IVD A;  4FBQ A;  3RL5 A;  2HYO A;  3FLO A;  1FJM A;  4LAC C;  2HYP A;  1KBP A;  4ORA A;  3PSN A;  3GVE A;  2XMO A;  3AV0 A;  4LU9 A;  2WDE A;  3FGA C;  5B8I A;  2DFJ A;  2CV9 A;  1T70 A;  2Z1A A;  3CK2 A;  1JK7 A;  1G5B A;  3D03 A;  4I5N C;  5C1V A;  1XZW A;  1SU1 A;  1HPU A;  3H63 A;  2R17 A;  4FBW A;  5DNY A;  2QJC A;  4JA7 A;  2WDC A;  2O8G A;  4OR9 A;  1W24 A;  2Z06 A;  1II7 A;  3DW8 C;  4MOV A;  2BDX A;  4DHL A;  3QFK A;  1UTE A;  4XPN A;  4J6O A;  3QFN A;  4HD0 A;  1S95 A;  3IB8 A;  2DXL A;  4H2I A;  1QHW A;  3P71 C;  3AUZ A;  4Q7F A;  2O8A A;  3E7A A;  4KBP A;  2NPP C;  3H68 A;  3C5W C;  2NYL C;  3E0J A;  2ZO9 B;  3DSC A;  2HY1 A;  4V0W A;  2DXN A;  2BCD A;  2KKN A;  3JYF A;  5JPE A;  2Z72 A;  4MP0 A;  1OID A;  4UT3 A;  4G9J A;  4ORC A;  1QFC A;  1XM7 A;  2NYM C;  4ZVZ A;  2NXF A;  3ZU0 A;  4KKZ A;  4NZV A;  4JA9 A;  2ZBM A;  4O4K A;  3THN A;  3HVQ A;  3IB7 A;  4O5G A;  3THO B;  3QG5 C;  3IVE A;  3ICF A;  3K7V C;  3KBP A;  5GTU A;  4DSY A;  4F0Z A;  1TCO A;  4WWL A;  3EGG A;  3TGH A;  3E7B A;  4V0V A;  1AUI A;  1V73 A;  1S3N A;  1OI8 A;  1S8E A;  3T1I A;  4H1S A;  1HP1 A;  3RL3 A;  1S3L A;  2WDD A;  4MOY A;  1Z2X A;  3QFO A;  4UT2 A;  4UT3 B;  4V0X A;  2IAE C;  4FCX A;  4O24 A;  3ZTV A;  5EQV A;  2IE3 C;  1S3M A;  3V4Y A;  2JOG A;  4TUI A;  3H60 A;  5JJT A;  3RQZ A;  1S70 A;  1NNW A;  2GJU A;  2WDF A;  4FBK A;  4O43 A;  1HO5 A;  4H2B A;  4B2O A;  3LL8 A;  3PSO A;  5IOH A;  3DSD A;  4UWQ A;  4H1Y P;  3RL4 A;  2A22 A;  3N5U A;  3H61 A;  4IYP C;  2YEQ A;  5INB A;  3C9F A;  4M0V A;  4LTY A;  2QFP A;  2Q8U A;  2AHD A;  4TUG A;  5JPF A;  1UF3 A;  2BQ8 X;  1USH A;  1OIE A;  3H62 B;  4ORB A;  3H69 A;  4H2G A;  1WAO 1;  1M63 A;  2IE4 C;  1T71 A;  3H67 A;  4DT2 A;  3EGH A;  2USH A;  3H64 A;  3QFM A;  1Z2W A;  1U32 A;  1WAR A;  2YVT A;  2QFR A;  3K7W C;  5F3W A;  4H2F A;  4ZX2 A;  5HPE A;  2ZOA A;  2P6B A;  3H66 A;  4I5L C;  4YKE A;  5J28 A;  4IL1 A;  1MF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...