3DWEX

Proteinase k by classical hanging drop method after high x-ray dose on esrf id14-2 beamline
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dweX00
2V8BA 3CO0S 3DE5X 1LW6E 2Z2YA 5FFNA 4M1ZA 2SECE 3VV3A 1PTKA 4H6XA 5ARDA 2IXTA 4WOCA 2IY9A 5AQEA 3DE3X 3I34X 3GT4A 3LXUX 1THMA 1BJRE 1SN7A 2QTWB 1SIBE 4ZOQI 1SBIA 4CFZA 3H42B 5ARCA 3PTLA 4C3VA 1GA6A 1R0RE 4GI3A 4NE9A 4LVNA 5FBZA 1BE8A 1S02A 3TI7A 2DP4E 3GCXA 3DYBA 5JXHA 1YU6A 3ZXYA 1SCNE 4K8RB 3D43A 2PWBA 1SCBA 1SELA 1V5IA 2SNIE 1OYOA 1SBTA 4H6VA 3A3PA 3F7OA 3VYVA 2Z57A 3WIUA 3I2YX 1SCJA 3WQBA 1ST2A 3DE0X 1TO1E 3GCWA 1SUEA 1P7WA 1AK9A 3OSZA 4J94A 1MEEA 3DE1X 2PRKA 4RYDA 1Y3BE 2Z2ZA 5JXGA 5JMOA 1TO2E 4BWGA 4FONA 5FAXA 4B5LA 3DVSX 3WHIA 3QFHA 3ZXXA 1C3LA 1CNMA 1YJCA 4DJ5X 1MPTA 1BFKA 5B1EA 3DE2X 1BFUA 5JXJA 1T1EA 1WMFA 2PQ2A 2ZRQA 4ZARA 3UNXA 3LPDA 1KDZA 1EA7A 4CFYA 3EE6A 1HT3A 3VV2A 3DE6X 1Y48E 2W2QA 1DBIA 4MZDA 3VHQA 1C9MA 2XRMA 1TM1E 1Y4DE 1XF1A 2W2MA 3WIVA 3F49S 1R64A 1WMDA 1T1GA 2SBTA 2ZWPA 1TM3E 1PFGA 3BPSA 4C3UA 1GNSA 2ID4A 1AQNA 2SICE 1SIOA 1YJBA 3VTAA 2W2PA 1VSBA 4H6WA 1KE2A 1YJAA 2Z56A 1AU9A 2WUVA 3DW3X 2ID8A 3QTLA 1TM5E 4DZTA 1Y34E 1GNVA 1SVNA 1A2QA 3TI9A 5JXIA 3DE4X 1C9NA 1IAVA 1GTL1 2ZWOA 1S2NA 1TECE 2DQKA 2W2OA 3DVRX 1TM4E 2PKCA 1AVTA 2P4EA 4YN3A 1SBCA 4WOBA 1GT91 2PYZA 3A3OA 1SUAA 1V6CA 1TM7E 4LVOA 4HVLA 3AJ8A 4OMDA 3AJ9A 4AKSA 1TK2A 1WSDA 1Y4AE 4CG0A 1WVMA 1NLUA 2E1PA 5AVJA 1NDUA 1GTG1 2W2NA 2X8JA 1SBNE 5B1DA 5I9SA 1SUBA 3BX1A 3SICE 2B6NA 2HPZA 4NMXB 1IC6A 1SUDA 2PWAA 2TECE 1ZVKA 1GTJ1 3EIFA 5CW1A 2Z58A 3EDYA 3F7MA 1ZVJA 1GA4A 4AKTA 4KB5A 3VSBA 1GCIA 1PJ8A 4KG7A 1EGQA 1WMEA 1JEAA 1R6VA 1KDYA 1GA1A 4KPGA 1OYVA 3CNQS 1BE6A 4OV6B 3AFGA 2HD4A 1SH7A 1SCDA 4JP8A 1Y3FE 1DUIA 1PEKE 5AVKA 3QMPA 2PMWB 2Z30A 5SICE 2WV7A 3DDZX 1UBNA 1ST3A 1KDVA 4HX2A 1C9JA 1T1IA 1Y1KE 3I30X 1TMGE 4I0WB 1Y3CE 3SQOA 3T41A 1BH6A 1AF4A 2ST1A 2Z2XA 3P5BA 4NE7A 1CSEE 5ARBA 1SUPA 4DWWA 3DE7X 1SUCA 3DVQX 3TECE 2GKOA 3D9QX 1AH2A 3DW1X 1KE1A 2WWTA 3L1KA 3I37X 5AMXA 3HJRA 1P7VA 1Y3DE 3PRKE 3LPAA 3Q5GA 4Z2AA 1Y9ZA 5K7SA 3DWEX 1Y33E 1OT5A 2G4VA 3Q40A 1Q5PA 2X8JB 4OMCA 1AV7A 1SBHA 2XTJA 2WUWE 3BGOS 1SIUA 1NDQA 3A3NA 2DUJA 1SCAA 1P8JA 3LPCA 3GT3A 1SPBS 1S01A
chains in the Genus database with same CATH superfamily
1FTQA 3JSAA 3VHRA 3DZBA 4BFWA 4TXHA 3HB9A 3BZWA 1TMOA 1N5DA 1XA0A 2H57A 1N3LA 3B8HA 1O57A 3O1JC 4MO9A 4NSNA 1IEQA 2F67A 2X9QA 3DH0A 4NV0A 4FLFA 5B3AA 5CX4A 5J47A 2W6NA 2ZM6B 3DAHA 3NORA 5ALVA 1E4OA 5ADWA 4ME6A 4TV9A 5E7QA 4F5YA 5KJ6A 4K9OA 4C0SA 4M0EA 3E5RA 621PA 4BMZA 2GPBA 4F0JA 1NI3A 1FLNA 1YRAA 3BFVA 1TJPB 4EFKA 4MUBA 4CQNA 1JAZA 2PNJA 1KDTA 3OA2A 1W34A 2VHCA 3TW8A 2PT7A 4YRFA 3M6XA 2YWJA 4AJIA 5H16A 2WOJA 1VJ1A 4GE0A 1ECPA 1ZAKA 1Z8FA 2YOFA 2QN1A 1QVZA 3HVIA 5COBA 5AKGA 4BOYA 3EQ8A 1ZK3A 4XASA 5KTKA 2W2LD 1A9SA 1RPNA 4XLTA 1C9DB 4ZA2A 4K03A 4PU0A 1MQ9A 3QHAA 5L45A 4CTJA 2JIQA 5B4UA 4MARA 3LECA 2FMIA 3PE4A 5BURA 5ENZA 4JX8A 4EM6A 4MGKR 2JIDA 2JASA 3PIDA 3R1IA 2VXOA 4OJTA 1DEHA 2D2IA 3VMFA 2ZYHA 4F3NA 3PI7A 4A6XA 2IYSA 4IFTA 5TGTA 1H1DA 3V8NA 2CXRA 2P90A 2XTMA 3H75A 4J3JA 4IQFA 1PDWA 3N2KA 4LV8B 3U3XA 3JAKA 5B3JA 2PUCA 4AUEA 4WI1A 1DHRA 2ZS8A 5HIKA 1NNI1 4BO4A 1GOTA 1W5EA 5GJWC 1PF7E 1Z5PA 1OH8A 3VJRA 1GN8A 2ZGVA 1JU4A 3VPCA 3ETLA 1XIVA 16PKA 3EVCA 4Z7QB 3BMNB 4L4ZA 1OZHA 3PFGA 4DB4A 4B3JA 5FR2A 1DC7A 5JS7A 2EX1A 2OZPA 3P8ZA 3OOJA 1T36A 3RSOA 2VI5A 2AFVA 4U6NA 1DARA 1E7WA 3AF3A 2HSEA 1LEHA 3C3YA 3QF4B 4TLEA 1CIJA 3V4FA 3G17A 4X9XA 3PDJA 4DWOA 3QBDA 5L3QB 1OYOA 3SHVA 2P35A 3PQEA 3AQ4A 2FZGA 4LUCA 5EPOA 5FNVB 4P5DA 1YR6A 1JHVA 2MJLA 2NTEA 4IGAA 5LYJB 1AQLA 2C5BA 2ZEJA 3SLKA 4YUXA 2J1LA 6AT1A 4MUJA 2WVHA 4QARA 1M6VB 3DCIA 4NENA 2G80A 1HMYA 3FLMA 2Y4OA 4XUDA 4KYVA 4RANA 5ALOA 2B1IA 1RQPA 2PU7A 5AVTA 4ZV7A 4YJHA 1EUDA 2OYSA 1WXXA 4E3ZA 5M2QA 4MLCA 4E22A 1EMDA 4RTQA 3WQQA 1B6TA 1QPBA 1JJVA 4RYDA 3O95A 1IG3A 2AWOA 4DCVA 4E88A 1T0BA 3BWYA 3RRNA 2VBGA 4H7DA 4DYDA 3A1CA 1Q12A 3CW2A 4P2GA 1XSEA 2P2LA 3H2SA 1E5DA 4CR6A 1YQUA 4W5QA 1DINA 1NRIA 1DBWA 3BK7A 5SY4A 1NIPA 2WC1A 4LZLA 5DGDA 2OHXA 1UMDB 2YHIA 1G8SA 5E1DA 2VDPB 4RAQA 5KKAA 1IUOA 1ESZA 1N9ZA 3N8IA 4A16A 4CR8A 4P7BA 3VC2A 5C81A 1EFUA 1HKUA 1JV2B 2BI4A 1E6UA 3AUYA 3ZXXA 4PG7A 4TL6A 4HWGA 2XCSB 5AUQA 2PZLA 5IJZA 3D3NA 1ABFA 1RXEA 3FIUA 1KK1A 3TTYA 2C9BA 1RLOA 4CLEA 4B3CA 2R4QA 4K28A 3QLVC 3RF7A 1SQ0A 1TYCA 1XAHA 1K3FA 2O2ZA 2RHRA 4ZIRB 5JSZA 3KAPA 1KP2A 2RHOA 4JCCA 2C3YA 3TKAA 5GTDA 5JVDA 4UEOA 1SC1A 2Q5LA 3NNSA 4DY6A 1MC8A 5BVHA 4BC0A 2QZ4A 4LWOA 3FDXA 2J9RA 4EW2A 1LLUA 2E4ZA 5HE8A 2SKDA 3H87A 5CA0A 4LF6B 1J33A 1EWYA 3UXYA 4ER5A 3T5DA 1Z62A 4XAQA 2GXQA 3L1UA 2P2CA 2VNSA 4YQZA 1A04A 2O2SA 2P6PA 4BNLA 5B1IA 1HWYA 3ER6A 3QKRA 4K7JA 5IJ9A 1SG0A 1BQ3A 2R84A 1FYWA 3FIJA 1E92A 3O73A 3PNVA 1KC1A 3IEXA 3PHBE 4BJ5A 1BD3A 1RBMA 4MUNA 2Q1YA 5E4FA 3OCZA 4JL8A 3TLGA 3QM1A 4DUGA 1I2DA 5BMVB 3WQSB 1TEXA 2ZPAA 4EHIA 3LUFA 3K70C 3O26A 4HAVA 4XA8A 3WIVA 4BE9A 1N0WA 2WWIA 1V3UA 1R64A 4QOHA 5CTJA 3Q85A 2BKUA 1OFIA 5JYEA 3EAGA 5CVEA 3F7TA 3AU9A 4PO8A 1ZXXA 2AOVA 1LVHA 3Q9UA 1U28A 3D7RA 1O77A 1CTQA 4GBMA 4X7MA 2V6BA 5BN5B 2ZWPA 1AKQA 1PFGA 2Y1KA 3BCRA 3E5NA 4GLJA 1I0LA 1MX9A 2YDXA 3L1HA 2IRWA 1EPUA 4OSOA 4EVQA 1GNSA 5CB6A 2GAFA 5CLGA 1NONA 1RXCA 4BKUA 3DMYA 3AF1A 1L8AA 3KJQA 5ECDA 5KTOA 3OTQA 3PENA 5JSYA 1S9HA 3OX2A 5SV2A 4OG2A 4DSTA 3RV3A 2O2JA 1ILWA 4QXRA 3WL8A 1K0UA 4NX2A 3AV3A 2AHOA 1WU8A 3R6GA 3TVYA 3AUXA 3JR3A 1Z33A 1KE2A 5BPFA 5DU2A 3W4JA 3RAEC 4FDUA 1UH5A 3VU8A 1YUMA 2OB1A 2V0GA 2H2WA 2OCYC 1KAHA 1ODLA 2DWUA 2RHBA 3O4JA 1U4OA 1R10A 1VLVA 4JGIA 4IH9A 4JJIA 1Q3KA 4OH7A 1LRKA 3CF4G 2JEYA 2AFIB 5ALFA 3INRA 3OQPA 4XUGB 3UWPA 1U7XA 3V97A 5ISMA 3ZOKA 3PNBA 4M1YA 1G7CA 4XB1A 1XL0A 3H3XA 1SFRA 1XI2A 4XWGA 3UHPA 2X5KO 4G9BA 4JUIA 2XCUA 5CT4A 4CGYA 1SVNA 2FOIA 3C5CA 4YIKA 4AUKA 5MGBA 2DWQA 1M2KA 3B3QA 4QYIB 5TJHA 3N6VA 2XUPA 1ZUNA 3BICA 3VOTA 3T9AA 2IF2A 4TTQA 4CFSA 2AI3A 3WGGA 1MENA 2D3WA 2FW9A 1RKXA 3FUUA 3U7FB 4TZ6A 5DGHA 2Z9BA 2RH9B 2Z9DA 5BSEA 1J24A 2LIVA 4MQLA 1TNDA 3TQTA 3UJ3X 2OK7A 1NR1A 2ZYUX 3L0YA 4A03A 1VKNA 3U7QB 1LBEA 4OFBA 1JEOA 2QVYX 1YMQA 3GGCA 3MQ2A 4R1TA 4TLAA 5CGZA 5H68A 1AHHA 4ZU3A 4UTPA 3N87A 3SP1A 5JE8A 3STXA 3E3AA 4LHZA 2I8CA 4IDNA 4QO7A 3E9EA 1DEXA 3AEKA 4KAJA 5EZ6B 1NP7A 4KPUB 1ONOA 2CFOA 3HY4A 4N3CA 4DIMA 2P4EA 4EX6A 4NOJA 4LGYA 5FYQA 4RLSA 1XXLA 1L7BA 1EFKA 1GEGA 1XX6A 3EUEA 4DPKA 5C7OO 5LDDC 1GY8A 3VI4B 3ZJ5A 4C3OB 4RTRA 1E9BA 1V71A 4P34A 3C1TA 4C6RA 1BCRB 5CA1A 1TCVA 2ZG6A 3GJ8A 3KYCA 4JYCA 4X20A 3TQSA 4JWKA 1PO7A 2PZJA 1VP3A 3DULA 3ST7A 1D2MA 3EW9A 1I7LA 5FTMA 3I9LA 4L75A 5KNCD 1MC1A 5KSWB 4M0CA 3E35A 3HZZA 1H5NA 2ZE8A 3ANYB 1P18A 3QJYA 4B3BA 4D4JA 1QHSA 4LMRA 3GLGE 4CQMA 3E53A 1X1TA 2XW6A 4WOKA 4NYJQ 4GI5A 3FDJA 4IQ4A 1RTTA 2DSNA 2ECFA 1ZM4A 3IAM6 4BP3A 3HHEA 3FJ1A 5CEFA 3QE0A 1DWUA 2OBBA 2X8WA 3CEMA 3F97A 5AOAA 2IV3A 4DQUA 3K0FB 3ELDA 4XRGA 5IC4A 2OV1A 2X19A 1JR4A 4G1EB 3K09C 5JAZA 4CGZA 3PLRA 5T41A 4C0LA 2VC2B 3CKLA 1KQPA 1MOSA 3C1AA 3H3FA 3LA8A 3WG9A 1QFMA 1SUBA 1T4CA 2OZVA 2R00A 1QHIA 4HNAA 3WNBA 3WYNA 3TNLA 4BZXA 4ZJYA 2JD2A 2CB0A 3INNA 1M76A 3NBUA 3TNJA 2ZU6A 5HXAA 3A11A 4B2PA 1QV7A 3GEMA 4MR7B 4MI6A 3QXHA 3OCUA 4EYKA 5L8VA 1NIJA 3N8NA 5A1JA 1KI6A 1WL8A 3HJUA 4OB8A 2Q07A 4G4SP 4YR7A 2QM0A 2YOGA 1FMFA 2C57A 1U8AA 3AJEA 3CSUA 2GPJA 4Q4LA 3M6AA 4H27A 3BUSA 2HHAA 4L4SA 4RSMA 4BRWA 3CRQA 1CJMA 2IZ1A 1GRVA 3H0CA 4P4SA 3PT5A 3GI1A 4UNQA 4D9IA 3G02A 1MX3A 5D5QA 3X3HA 3ZE1B 1R5JA 3D8UA 2B82A 5JR3A 4Y1EA 3QPAA 3KJFA 2Q2NA 4BC1A 1H65A 1OPXA 2ACWA 3WZMA 3DC2A 3A37A 3QE4A 1RRVA 3HR8A 5AKJA 1RHMA 4EG1A 1K8XB 1LS1A 4ND7A 4KR9A 1CJCA 4RZ2A 4O3FA 4PSDA 4JEHA 4D9CA 1RZRA 1XG5A 3LQFA 3ZLUA 4ZAGA 4XH9B 2IX9A 4QUIA 5A71A 1O95A 1XWWA 1PLKA 3D3QA 3NKFA 4OHMA 4LYGA 4EUEA 5JECA 3AI2A 4FHFA 4GWKA 4KQKA 4W7HA 3ZVMA 1M54A 1PHPA 3A4TA 2WD7A 3RAGA 1MD9A 4QLOA 5TARA 3C48A 3IKTA 1QFSA 4JSYA 3RANA 1TVCA 3S7ZA 3R3WA 4H1UA 5KVAA 4MWDA 3KEOA 5A0FA 2XMDA 1BVRA 3DDOA 3DTVB 4QDJA 2O2YA 8ADHA 2P40A 2ERCA 4KRYA 4QYWA 4DBLE 4OV6B 1ZJ4A 4PCUA 2IXFA 3TTXA 3V32A 3CPEA 3BTVA 3HEMA 2G1AA 1XYYA 3NVAA 1Q19A 1XWFA 2VYCA 4B31A 1TUEA 3CLSC 4Q4JA 2XSZD 1QIHA 1WZIA 3D54D 4J0HA 4W5OA 3VR3D 4B4KA 5BOVA 4ZMBA 3AEXA 2D1FA 5ALGA 1K6JA 4U5XA 4IIYA 1DCKA 1PJ4A 1ST3A 1Z25A 4LMPA 1V37A 3B70A 4QOIA 3ZN2A 4K6GA 2JLAA 4PG4A 4QEKA 1C7ZA 4HMQA 2V03A 1WCWA 3R8FA 1NPTO 5HKOA 1IEXA 4DL9A 3WFZA 3OLYA 3RRJA 3GQVA 2YWCA 5J2TF 1SXJE 3I2GA 1QQ6A 3HN7A 3IURA 3QXSA 4GOKA 2Z2KA 4K9NA 1KU6A 1ID8A 1CR6A 3OOHA 3STVA 5K2OA 1C30B 5K3AA 4OYHA 3CW8X 5LWQA 1NXTA 2XAAA 5HS4A 3ESAA 1WZCA 2EFYA 2JFPA 4YIHA 5TPZD 2HREA 1B2RA 4A8HA 3KDPA 3QVUA 2NAPA 5CRIA 1QHNA 3FGPA 5L4NA 1MJGA 2VT7A 1AHPA 2HV8A 2HY7A 3MUFA 4ZCMA 3A25A 1JFFB 2RIPA 4YI5A 3T9CA 4Q5IA 3GPLA 1Z0KA 1E3QA 1TJ4A 1Z4OA 4IYRA 4CVNA 1PWXA 2AEMA 3OTHA 4A2WA 2P11A 1N36B 2MSLA 5ESXA 2V7UA 1BU5A 2Y2UA 3HMKA 2C2ZA 5TQ0A 3VVCA 4YRSA 1GGVA 3ZIAA 5LIRA 3GUYA 1ULTA 4W6QA 1A27A 3ZC3A 1YBMA 3C8DA 4RVFA 5T67A 4Y18A 1PQUA 3RVQA 4CKEB 1KTIA 1KQFA 2C1EA 3FWHA 3O94A 5TPWB 2YJ4A 3V8BA 1ODIA 2B8JA 2PWPA 1Q7GA 4JQSA 3LC7O 2EP7A 1NMXA 1OXBB 5E7MA 5DM1A 5IZ4A 2RD2A 4IZHA 4HDAA 4UUQA 3U26A 4JI6B 4YRBA 3ZDBA 3HDHA 5TB5A 1DJQA 4L9SA 2G7MC 2GQ0A 1XMVA 3CA8A 3Q5GA 4Q16A 4ER0A 3H8SA 3UJHA 1F6DA 3OF5A 4J49A 4YREA 3RFTA 3ZWPA 3NHWA 2WV9A 4WXRA 5DGIA 2K7FA 1W0CA 3D64A 3RYHB 3SS9X 2O8DB 3R5KA 1X8JA 2Z8YA 4QAJA 1ITZA 1M72A 1VA5A 13PKA 4FE4A 4QXAA 4TRRA 5GMOA 2QN8A 3PHLA 1YT5A 4FHEA 4KXVA 1B0ZA 3ON5A 1LC0A 3AEQA 1XZKA 1VMIA 3OP1A 1GUFA 2C20A 2FWRA 1ZIXA 2I4IA 3QH4A 1KEWA 3IPXA 4EPXA 4R7TA 1Y7PA 2D5BA 1BMQA 2E18A 2J46A 4K9QA 3I0MA 5FULA 5HCUA 4IYJA 3ZY5A 2WM8A 2GX6A 1Q2UA 2AOUB 2WLSA 4W5WA 4HDRB 1L8OA 4WAUA 5ALLA 2G83A 4RTSA 4L0DA 3NIWA 2AHRA 2VKTA 3R5XA 4HRVA 3GAAA 3SXJA 2DULA 1XD2A 3MT7A 1UQRA 3L92A 4UBKA 5EUBA 3UAWA 4O25A 3F9IA 4XFDA 1C4XA 3X2FA 1I9CA 4BKRA 1IDOA 4UPVA 2CV0A 5JANA 1E59A 4N8SA 1FSZA 4P4UA 1DOAA 3LFUA 3HKCB 4WXYB 3W8FA 4C87A 4DCCA 1Y8QB 1XXHA 3N59A 2FXIA 1RRMA 1FXWF 1ULAA 4MR8B 4MP3A 1D4ZA 1U0HC 2Q1WA 2X0FA 1ES9A 4I19A 4EKEA 5H59A 3P4XA 1N9GB 3EWIA 1R6AA 2XMRA 5FBRB 3A1TA 5JWOA 1USIA 2VKQA 3GLKA 5CLHA 1WHTB 1XBTA 3A3KA 3EWNA 3F2VA 4K81B 3NTLA 3WV5A 5CMLA 3DOHA 3JQAA 2E89A 3PJEA 5BPHA 3I6BA 3LNCA 4MA0A 1ZVMA 4QEZA 5AQEA 4G1VA 1XKXA 1Q14A 4C76A 1QCDA 1SUWA 1Z2AA 2P2ZA 5AW7A 1FS6A 5LSAA 3ELUA 4OHPA 1M6NA 1U8YA 1VRWA 2LD4A 3K1YA 1NKVA 4J0CA 3HFSA 4F3YA 1BEZA 2FQYA 1IZ8A 3NU1A 1Q95A 1WPGA 4TKUA 2XUGA 1NATA 3AHEA 3UAOA 1SN7A 2XDAA 2W9XA 3AI7A 3HYLA 4YFYA 1X0XA 5ITVA 4GKJB 5TMBA 4YQYA 2ZIAA 1UEIA 1PEAA 3FPFA 5IK2D 1EVZA 1CUUA 1KYXA 1U9IA 2OQRA 1U4SA 2APJA 3EQ7A 4ID3A 4MS3A 1YFLA 4AZSA 1QQAA 2Z6AA 2GESA 1IBRA 5FPSA 3KZOA 8LDHA 2XMCA 1TB4A 4KJXA 1U7UA 1V1MB 4I66A 4P82A 5D8DA 2XTZA 3U4MA 2CNOA 5JZMA 5ALUA 4XGIA 4BIMA 1BNCA 1MAVA 3BWXA 3ZWWA 3OTOB 1G60A 3EXFA 4JB8A 4L72A 3CUSA 3KOWA 1A9OA 2EL9A 3GCXA 4TXLA 2VJBA 2JAUA 4ZO6A 3EMKA 1YU6A 3ANXA 4J16C 2AFHE 3SEQA 1DFHA 1P6UA 1ESDA 3GFRA 3NYIA 4PRYA 5F7ZA 1E7YA 3NFYA 2VTBA 1GR1A 1T3ZA 1LLCA 1TU4A 5EJ2A 2ATIA 2FMXA 1KFKB 2IZOA 3O0TA 4DJAA 4C6HA 2Y9MB 1KK2A 1VB3A 3BMCB 4OAOA 1BE0A 2Q7DA 2PS0A 5JD5A 5LOVA 2IJGX 4FEEA 2YJZA 4G4JA 2G9RA 3IXQA 3GLRA 3O5AA 4RIIA 4ITUA 3SHOA 1OX5A 4FOPA 1EYZA 3DHVA 4Y30A 4QL3A 5DN6A 4ER3A 1NG9A 4UJ5A 1DQZA 3ZHQA 1PZHA 2YOHA 2IEGA 4JLUA 2COEA 3LDFA 3P32A 3W79A 3KV1A 1RWPA 1WAMA 3BJZA 3ZYZA 5H7XA 3FZYA 4X8MA 3ZHUA 1BO6A 3KSAC 3G82C 1J0AA 1LS6A 1WX1A 5DHRA 2UYQA 5EIBD 1M7BA 2XY4A 1B42A 3A7EA 2AL7A 3FLAA 3GDFA 4IAOA 1EFDN 1KJQA 1YS7A 4NKRA 5DNVA 3U4GA 3ZV4A 3OD1A 2ZT6A 3C3DA 4RCYA 5LP6A 3PSAA 3QRWA 3U7IA 3VHLB 2HMWA 4LCBA 1I7PA 3DT8A 5JWHA 3MOSA 5K03A 4R1NA 4M1KA 3FM9A 1GPLA 1NFQA 1FVOA 2G3YA 3HLTA 2P91A 3QKWA 1TU3A 4NBRA 3Q88A 4KX3A 4V3BA 4ZN6A 4HEA6 3IAHA 4J07A 3DWFA 4KN9S 4N5IX 5HNKA 4GEKA 3S5UA 2DTDA 1E9RA 2AOWA 5JMOA 1A9XA 1VKZA 5KSYA 1J4AA 1KZ6A 2GEFA 1LQ2A 3M6WA 3K0EA 4MVXA 2LR0A 4FLEA 1RNLA 5KTSA 1UC9A 2LWIA 2ES4A 5B1HA 1YZQA 1CQIA 5IM4A 2CFRA 3JVVA 3TTSA 3ZNOA 4UDNA 2W71A 1Y3HA 2X9NA 4RU1A 4OJQA 4EY7A 1J0CA 5AM2A 1MPTA 2VF4X 3QE2A 4JS0A 1D2GA 2RARA 2YWEA 1I2ZA 1T8RA 3BRQA 3LUPA 2PKWA 3PNSA 3RYTC 2IA5A 4HBZA 4DMFA 5EI5A 4EOGA 1WB6A 4N6NA 1LRJA 2AEJA 5F52A 1BS1A 4ZARA 2QT9A 1XTTA 3RJMA 1WVIA 3NTOA 4KWIA 1B8VA 3B48A 4CMIA 1FFHA 2FSVC 2W4MA 2W8ZA 3PI6A 3PT9A 2EZ4A 3B3AA 3O9ZA 1QK4A 2F48A 4RELA 3AP2A 3LMKA 1RE1A 2WJWA 3O82A 4IH4A 3AWDA 3TZ6A 2COUA 2OKCA 1XTIA 2WNSA 3D6MA 3NATA 1V35A 3DSRA 4L5CA 4NMLA 3MFYA 3CT6A 3Q0IA 3LSTA 3W8EA 2MCFA 3ZR4B 1JHUA 5FUQA 2WSYB 2P8SA 1H2BA 4OM8A 3ZWMA 3DE6X 3OEHA 2WJ4A 4FYPA 4LC1A 3R7AA 3IERA 3W5IA 5CB4B 3FMIA 2KS6A 5ENVA 5EKTA 2V7VA 3BXOA 3E4DA 2RJNA 4WLFA 1FBNA 3A05A 4MPJA 1JJBA 1HSOA 1SU6A 1Y4DE 2WJHA 1AE1A 3LT0A 4L8FA 3HSKA 3OLVA 4DADA 3SPXA 2IUUA 5K8LA 5IJWA 3NXSA 3E15A 1OFTA 1GG5A 1O96B 5M5BA 1EDZA 3FMFA 5GZ6A 1DT5A 2UZ1B 2WSMA 3A2NA 5L7YA 1WMDA 1Q7BA 1PD0A 5F35A 3NM6B 1ZA2A 5EA2A 1U7HA 1YR8A 4M0LA 1C81A 2MSEB 1CV2A 1JPUA 4N5DA 4O4LA 1H2RS 2IPMA 1P4JA 4MV1A 4ZT6A 3SE0A 3R3UA 4W1SA 2C95A 3WLIA 4CMBA 4C3UA 3AB7A 1DQSA 5A4IS 3PCRB 5ECYA 1I6MA 3IL2A 4TTVA 3UUFA 3SX2A 1JQBA 1RCUA 2ZUBA 4WMLA 4D3XA 1XQXA 3GMSA 4IV5A 5ELMA 4DUPA 3UOGA 1BDHA 3MD9A 4JJAA 4IJKA 5U9CA 1Y6FA 5CT6A 4GI2A 5DGXA 3PX7A 4N76A 1K7CA 1E1NA 1ZD2P 3K53A 1Z4IA 3OU7A 4RK1A 2OQVA 4D56A 4MUKA 2ZWMA 1JAYA 1TXGA 1CJKC 2Y1FA 3EC7A 2BFBA 4OEHA 4QPDA 4PCVA 1QWOA 1WCV1 2I7VA 3NJRA 3REQA 4BV2A 5B4VA 1A96A 1IATA 2CCJA 1OBVA 3M70A 1J9GA 4TSRA 1UBKS 2G06A 4NI5A 1GZ6A 1AS0A 1PGOA 3TL3A 2WAXA 3EVAA 3RSGA 1EVYA 3IRVA 4AN1A 2VNIA 3H2KA 2JGFA 1K63A 1DADA 1Y7LA 3FBTA 4ZYTA 1XELA 3G5UA 2WQ7A 3OPYA 2GVZC 4FFBA 4D97A 2G1UA 4XB2A 4ZWNA 2WJYA 3QJ5A 3T3DA 3DONA 2ONKA 3JALA 4IIGA 4K87A 5CIQA 2HWYA 1U80A 1VOTA 3HBMA 3UMVA 7MDHA 3IP7A 3LBAA 4IWXA 2E5LB 3AY6A 1PJAA 3EIHA 3FCOA 3V6LA 5DYWA 3P4UA 2W2KB 3WLTA 4F72A 4RDXA 2FUCA 1VMKA 6PFKA 2FR1A 1RQNA 2ZWOA 1H0RA 2ZTMA 4IIFA 3TJMA 4H60A 4IJQA 4EG7A 1MR3F 1J25A 2EX0A 3DL4A 3SHFA 4B74A 2WIAA 3NEAA 1V9LA 1XNRB 2QRLA 3OICA 1KOGA 5HIAA 3H11B 2H1CA 5LLSA 4GYJA 3LFHA 2ZITA 3PXGA 3TCNA 4W6ZA 1F2DA 1I7NA 2AMYA 4KOAA 4M6WA 2A4MA 3LHIA 1N7JA 4JYMA 4WOBA 1H6BA 4O8CA 1JR3A 3KTAB 1BCSB 2HMSA 2FG5A 5C7LO 3AM1A 5DT2A 2ZI4A 1M3SA 2OKGA 2D2VA 4NH0A 1FFGA 1NSTA 2AR9A 2ZUSA 4YBRA 1F0KA 1BS9A 2WHPB 4TLBA 3SOZA 3B1XA 3U17A 1QDUA 2O5VA 1QHEA 4IHQA 5EESA 3CNNA 3V55A 1T9AA 1Z07A 3RVNA 3UJDA 5K8UA 2YXLA 2KPOA 5JNTA 4WK0B 4YRMA 3M34A 1XEFA 3N7TA 2GM3A 3FCAA 2D1RA 2R6FA 1IRIA 5I7EA 2ZJ6A 2EFDB 2AGVA 4Q0MA 4DLAA 3RUFA 2FF7A 3ETJA 3LO5A 3OF3A 2JRCA 5ALQA 3X1WA 4XQ9A 2E1PA 1V96A 1POXA 2XA9A 1KEEA 1HNZB 1MORA 3K35A 4PXSA 1J21A 3FOCA 1NDUA 3PFHA 5A05A 4EI8A 121PA 3AFHA 4R1OA 2VSXA 3RVRA 2CZGA 2J3JA 2WJZB 1SXIA 2G70A 1SBNE 1PL7A 3GFFA 1LV8A 4Q05A 2FDXA 5FLYA 3OPYB 3LSYA 2FPKA 1S4MA 4GM1A 4EMSA 3AW9A 4CIAA 1NVAA 2HQBA 3ASYA 3DEFA 4G0YA 1PZXA 4WNYA 5BSMA 3U37A 3WJ7A 1STOA 4FT2A 1L5NA 4I55B 3ZKWB 3BJMA 3U3JA 4GP6A 3G5MA 5E7IA 4P92A 5BV1A 3I2IA 1HQKA 1D2NA 3BIOA 4O2BB 5HFJA 4EPWA 4DV5B 3HKEA 2ZTSA 3PGXA 1I2CA 1TCCA 3LQ1A 2UVPB 5DXJA 1K5HA 3B89A 1NOJA 4P36A 5A04A 1Y1RA 2CKDA 4FW9A 4DZRA 2H1LA 3T6KA 1LBTA 3LY7A 1NXWA 5DISB 1JMKC 1JPJA 2PJDA 3EDYA 1K06A 5HK8A 3UV3A 4ENTA 4LVUA 1Y82A 1V16A 4CIXA 4JLPA 2RHGB 2G4LA 3AOGA 1IQPA 1JKJB 2GEKA 1SHKA 2ZI5A 4NMMA 1KY4A 5L3VA 2DFDA 1R2QA 3H5AA 1RAHA 2UDPA 4DANA 2C94A 4CF4A 3WLOA 3GOQA 2HTEA 2YVLA 2OZKA 1VBNA 4HRYA 3IO3A 4DXDA 5JNWA 3P2IA 3ORFA 2VFAA 4O08A 4ZC8A 9MHTA 1P81A 2CLKB 5AFSA 1O08A 4EPVA 3E3LA 2XLCA 2Q0QA 2AYXA 3CMMA 2MDTA 4UMEA 1KMQA 2BHSA 1NBMA 2C07A 3GLQA 4XTRA 2DETA 3DXYA 4PINA 2JAHA 1JBQA 4X1OA 3RTEA 1K92A 1A9PA 1RQXA 2REXB 4AN4A 5KQPA 2VXBA 2NXNA 1IB0A 4NDNE 4EI2A 1ECJA 5A62A 3GJ3A 2QD1A 2BDEA 3DT9A 5SZJA 2OAEA 2W7TA 1GZ4A 3ICEA 4BEVA 2Q1TA 4Q7KA 4YDHB 2FW6A 3R0IA 2WTNA 4OI4A 3GDOA 1FP7A 5CDUA 4D8XA 2CVZA 4PFQA 1NJGA 2DBVO 5AKYA 4X7BA 3U4CA 2Q5IA 2OCDA 3MN1A 2FJ0A 1JSXA 4FEYA 3STUA 3PL1A 4I0WB 2IKSA 1UBHS 5KCMA 5EWLA 5L9AA 2ORYA 1H0HA 2JFFA 4Z51A 1E69A 1O87A 2CJWB 4HN4B 3UXHA 4MQFB 1YRYE 4MQ5A 4ZK2A 1IUKA 2Z4RA 4J9VA 2PUFA 4LKRA 4MHOA 2FKAA 5EUCA 4B40A 3AKZA 2R7NA 4NE7A 3QF4A 2QTHA 3T9EA 3D6JA 5K01A 5L3QA 1KAQA 1AUVA 4H77A 5AI0A 1Z16A 2BGLA 1EK1A 2V45A 2RGCA 4PANA 4B3FX 3LBYA 3ECCA 4MV0A 1JG6A 1VJ5A 4EFNA 1ZJWA 2IIQA 1CZLA 1N6LA 1RYZA 1YCHA 2L19A 3TK1A 1G4UR 1AKWA 1BYIA 1F2VA 1II0A 4F9TA 4QSHA 2X23A 1IQUA 2C3OA 2V54A 3KVOA 5CR9A 5C5DA 3CBGA 3SVTA 2QQ0A 3L0IB 1KY2A 1ZC4A 4M7OA 3FBWA 4PZ9A 3THOA 3P9IA 3NASA 1M6VA 4OHXA 4ML3A 2XADA 2MYUA 3ETCA 1GCGA 2J5KA 1V8BA 4OQMA 4PLYA 1DC4A 3ND7A 2XWBF 1M1YB 4NWIA 2WU3A 3IUPA 3F46A 2Z5VA 4ZRNA 3LK6A 3WS7A 2QDKA 1OVGA 4U8GA 1J2UA 5MDHA 1Y3DE 2IOFA 1XQYA 4XX0A 4S05A 3CN7A 3PRKE 1KARA 1ILEA 3N07A 1UKZA 1N2XA 1O4WA 3L6RA 3VTKA 1B1CA 5EJ7A 4RWEA 4MS4B 3ZUPA 1YE3A 1RHRA 2FWPA 3M7IA 5FLKA 3NRBA 1QG2A 4ZQCB 3A6LA 4WKCA 3FFXA 4KO3S 1ZQ9A 3H8JA 4KP7A 3W90A 1UMDA 2YNMA 1U2PA 3IVMA 2D5AA 1MQAA 2ERYA 4M53A 3PNMA 2H3HA 4LPSA 4KXUA 4AS1A 3DTNA 1PNOA 3B6KA 1QO0A 1XVLA 2ZLBA 3GCGA 4I4IA 2IUSA 4FNMA 3D4LA 4RK0A 2GK4A 4EHHA 1C4OA 3N74A 1ZM9A 3F3KA 3CUVA 3UB3A 1KQGA 1ULUA 3K0AA 4OP2A 3DBHB 4UBIA 2VDQB 4QM7A 1I4TD 1ZY2A 2EXXA 1NQXA 2LP4Y 3MRTA 4IGEA 2C99A 3TS1A 4YYZA 2UZ0A 2XHZA 4MRRA 3SXUA 4FEGA 4KR6A 1E89A 3W3AD 5BNFA 3WIOA 4YWHA 3S1LA 1HT1E 3QWHA 2OHIA 4NU8X 3G9ZA 2C2MA 3A70A 2Y0CA 3R41A 4FWTA 1BOOA 5HEKA 4RMHA 2JGMA 1J2JA 2P3QA 3ITNA 3PC8A 4B79A 4BP9A 3EARA 1V43A 2JJYA 3H97A 2C2WA 1PGNA 4JC4A 2X0DA 1FP4B 1MJHA 3GLFE 1XPOA 2TMGA 4KIFA 2XTAA 2BP7B 5DI9A 1B73A 1KKUA 2YMPA 4P4NA 3UTCA 3KP1A 1RTKA 1VYUA 4YX9A 5FR1A 5F7XA 5LQMA 3QYAA 4O2LA 3VV3A 2L17A 2VJNA 2CL0X 1Y8RB 3A9VA 3EHDA 4K88A 3M89A 4DMLA 5K8JB 2GA8A 1XTRA 3EOAI 4AJKA 2DY0A 2Q6IA 1QOQB 6LDHA 2VA9A 3T5CA 1REQB 1YC5A 1L5HA 2VAWA 4WRRA 2VWGA 1NI4B 5JV5A 3L0BA 3L43A 5MGNA 3VDQA 1MHPA 4YMGA 2C00A 3QWAA 4K0RA 4RBNA 2XUJA 5LXTB 5AOVA 2PNFA 1EE9A 5FAKA 1XL1A 1QV6A 2CHEA 4MWGA 4L78A 3WBKA 2G6TA 3IKLA 4MVJG 1NVDA 2VCYA 2GPWA 3KPWA 3N2EA 3PWZA 3AUFA 3I9JA 4MWOA 4FFPA 3B7PA 3I92A 4R2XA 2CXHA 3HB4X 3NV7A 5DT9A 3D8SA 2Y6VA 1GCUA 1NV9A 2OBNA 3D3WA 3IB6A 2PA0A 5IAGA 4QXQA 2JPDA 2NVUB 3OZIA 1WXIA 1UR5A 4R1LA 3FUXA 4A73A 4G9EA 2IHVA 2LBPA 4W9NA 2X6TA 1CJSA 3GFTA 4I7EA 4E5NA 1NW9B 1R0RE 5BRJA 2IUTA 1Z15A 2Q8NA 4NE9A 1RWWA 2GA9A 5H81A 1DAOA 5FBVB 1TZ2A 5K9ZA 1BE8A 4UNRA 3A4VA 5KNDH 1RJDA 1G8YA 1U2GC 1QHHB 4JROA 3U40A 1LJLA 2Y92A 2UAGA 2PUDA 1CUXA 3D8NA 4FFLA 4IIXA 4A82A 1MVLA 3CNLA 2FLKA 3JWPA 1CBUA 3I9V6 1YD7A 3HHPA 1G4AE 4I14A 4R16A 2I4MA 2YY7A 1VLZA 4BNVA 3GMTA 4I5DA 3IS3A 4M8NE 4G24A 3IDFA 4CV2A 2AT1A 3NRCA 1FJXA 5LQUA 2XVXA 1GRCA 3H6HA 3CHYA 2D7CA 1NW4A 1RPAA 3EOBI 2FFHA 2XGOA 2SNIE 4YJFB 3NC0C 2A9FA 4LJ5A 4AJJA 3KKQA 5DHPA 3QP9A 1OB2A 3PXBA 4PYKA 4Q6BA 4JA0A 4QUKA 5LNK6 4ZVOA 1TVKA 3U7QA 2NVUA 3PC6A 1YBFA 5K0ZA 2FZCA 2YVAA 3IQXA 4UVEA 1FSPA 4PZCA 1PUIA 1MKYA 4F7DA 3WIBA 3CSSA 3MRXA 5EE0A 1TFRA 2QVBA 3NHAA 4KPUA 2ZSBA 2WIDA 1K7FB 1EK0A 5DYYA 2EKBA 2SHKA 1ACLA 3JQFA 1R50A 1YR2A 1Z34A 2F9LA 2ZJ4A 3C6XA 4IS3A 4N7RA 1XQVA 2QTLA 4TKLA 5ENDA 4JI7B 2JHFA 1A9TA 1XPUA 5HRCA 4FS8A 3MILA 1UBMS 1BCRA 4IIHA 1VBMA 1LNSA 1COWD 2QX9A 2VT6A 4PLPA 1XMSA 4IMIB 4Q34A 5LA6A 4YQFA 5JI3E 1ABBA 2WM9B 4MMZB 5CLLA 4U6SA 4URFA 2IS4A 3EF3A 4ZOLB 2Q6OA 1B8UA 4I4LA 1SU4A 5ECWA 4AMZA 5MN4A 4MEBA 3H13A 2Y0PA 4UNNA 4IG4A 3R9KA 2Y93A 4AG3A 3OE5A 4ESOA 2GEVA 3ZBQA 3GJ6A 3JASA 3SM9A 1F12A 4FCCA 2WMNB 1ENZA 2IYEA 4RA9B 4FX5A 2ILVA 4D81A 3O8OA 1K2WA 4HPXB 4BVBA 2X5NA 2BPOA 4EHKA 3QGMA 4MW6A 4BX0A 1WZEA 1KJNA 3BDVA 1R8XA 1GL7A 1LV7A 2V7QD 3OWXA 4DF3A 4U0KA 5LQAA 1RYBA 4UEKA 4P93A 3ABZA 4FGLA 5ED0A 1U11A 2A0KA 5LB2A 4F45A 1X7XB 2YCBA 3UC5A 1GTRA 2J45A 4EG8A 5B58C 1DC5A 3DE2X 1SKQA 3ZDZB 3UMMA 2I7DA 3E2MA 4LXXA 5E2AA 2HJ9A 2ZSAA 4Q3AA 3W7BA 1R8SA 4B3MB 1SBQA 4RESA 3K0HA 2H2HA 2FG7C 1VA4A 2VLBA 1Z5NA 4L5IA 4MR7A 5REQB 4K9KA 3PHGA 2Q7OE 4BNDA 4CFYA 1P3Y1 3OOYA 3VR0A 4D4MA 1T9BA 4NESA 5A6SA 3ZH2A 3S8MA 4QWMA 3GN2A 3ZCRA 3QXGA 3LP6A 2I1VB 1ADCA 3A27A 4RVSA 3EIWA 3IO5A 2Z04A 1FDWA 1UOEA 3OJLA 4A0RA 3T3GA 3ETGA 5DTEA 3CRNA 2REOA 5E1OA 2FB9A 3E7WA 3RKRA 4ZKDA 4KWHA 1L7MA 4EJ2A 1PS9A 1DKPA 1Z4NA 3PKZA 3RRMA 2FEPA 1ZIOA 1AQIA 3INTA 4FYKA 5BQOA 4JXXA 1JHXA 4QXPA 2DB3A 4UAUA 3L4BC 4N3NA 1ESMA 1RI3A 2QM3A 3DD5A 1OXUA 1Z0SA 3LF1A 1IYZA 1ZPDA 2PMBA 2XUZA 3I5MA 1CY8A 4F85A 1ADFA 2DEUA 4RULA 4GLBA 2Z3VA 3VPXA 2ZROA 2BI7A 1GIAA 2EKPA 1RZVA 4JFAA 5KX5A 5HKAA 3A4IA 5T4EA 3NV9A 3UMFA 4G8JA 5FPPA 2R25B 1T5SA 4LK3A 5CW2A 3PICA 2Z98A 3VAAA 1M2HA 4RTKA 3ANTA 3E3MA 2C5EA 4HDMA 5DI3B 2YYZA 3DXFA 3HCPA 2DTXA 3ZK9A 2PK3A 2RGGA 4JB0A 2P8JA 3AEZA 3ED5A 1MO3A 4LSZA 1UIRA 2SICE 3KWLA 5BNWA 3BHNA 4LXYA 4M88A 2NVBA 3CC8A 4Q3LA 2UV8A 3UHJA 2YBEA 3HA5A 2PBRA 4KGXA 4B35A 4H1VA 4JLDA 1XRJA 3RU3A 4MVJF 4R9VA 1ODFA 3KJZA 1CNEA 1ONSA 4PAWA 2V0CA 3BD6A 3K94A 4B3RB 1AU9A 1UEJA 1JTFA 1V5FA 1OGJA 2PGDA 5EE9A 3V9AA 4ER6A 2W6IA 4JI3B 3PUKA 4F92B 4B9AA 2DG2A 2HRQA 3SSNA 4JP1A 2CZQA 3JATA 3DLAA 2NVOA 3HEAA 5D3ZA 5IUNC 3W5VA 1CUIA 2ECOA 1JYSA 2QUKA 3M1AA 3F4BA 4YAUA 5IVIA 1PN3A 5FO1A 4NFSA 1KC3A 2HMUA 1KR2A 5KBYA 1CPYA 1BWPA 2VQFB 2RHWA 4I1RA 4DLKA 3OFKA 4AJLA 4C29A 1X42A 1E4YA 3L6BA 1E9FA 3TINA 3OLXA 2OCKA 4UW9A 4PONA 3ENVA 6CHYA 3SDSA 3I2FA 1N6PA 2PX4A 2JFUA 1PEYA 2BMDA 1YAJA 5ALMA 1ISFA 2W0SA 3JRWA 1A77A 1QUFA 1DJPA 3LKVA 2X7JA 2GPNA 3C6KA 3OFJA 1JFFA 4CL2A 5K6AC 2PZMA 3W7AA 1M6WA 2ZTVA 3OHPA 1KI7A 3KZ1E 5L3RA 3OZTA 1YRLA 5IULC 3VGJA 3V8EA 5IW8A 3FCSB 5K6RA 3MTEA 5KYUA 1IQ0A 1JHMA 1NBWB 2HRCA 3GQBB 4PPFA 1N8TA 4PTZA 1FSFA 1M8KA 2ZIGA 4JJKA 4EG6A 4UE6A 4WCVA 1PNQA 4NVRA 1OFHA 3BM5A 3ZJ4A 4AO7A 5JZBA 4QE3A 3TKYA 2CLFB 3B6ZA 2B1RA 1QGDA 2BGKA 3RFFA 1YVPA 4TWRA 3EPPA 3LWBA 2JBAB 2VDJA 2II6A 3IMGA 4RLHA 1UMBB 3S8EA 5HQJA 4V2IA 3AJ9A 4NNJA 5JDIC 5BQPA 3VUEA 1E8DA 1SXQA 1PBTA 1LBQA 4B6PA 1JIJA 3ER9A 5F5NA 3ROEA 3H4VA 1NLUA 3OKFA 5CITA 1ZISA 3C0KA 3GP8A 4CMKA 4DKXA 2XPCA 4MVJE 2QRQA 4P83A 5ADUS 1JA9A 5MF6A 4IIJA 1X70A 2HK6A 2CNWA 3REGA 4YFVA 4EJFA 1GTG1 4HLUC 1CJVC 4OX9Y 4BQPA 2N75A 2XV1A 2H54A 5FOSA 2C4VA 1R66A 3ELBA 3STTA 2BD0A 3RJ5A 5C0OE 3NNDA 1LZLA 5U1PA 3IUEA 3TVDA 5KSZA 1Y8AA 1SVOA 4HGOA 2ZB3A 2VP0A 3ZH9B 1SG6A 1XLWA 2JZCA 1W2WB 4OOFA 1LJUA 1RPTA 2P30A 4Z4GA 3DS8A 1N2CE 3QLTA 4JUCA 4R8VA 1S2LA 3C3JA 3DG9A 3G1TA 4Z53A 4IKOA 4GD3Q 2PAFA 4NOLA 3OWOA 4N0DA 3K3PA 4LGVA 3DV0B 4RZSA 1GPAA 3G6KA 5CJJA 5ALEA 4GL4A 4MCIA 3HKCA 1DKMA 1DTEA 1V8PA 3OE7D 3ZGZA 4R2HA 3LZCA 4IG9A 3RRZA 3SZMA 1Y8QA 5FI0B 4ERNA 1JAXA 1KI4A 4I6EA 5JI2E 4MR8A 2Q50A 1ORIA 3K9QO 3QOFA 1KDRA 4KNVA 3SEFA 4DTCA 4HZIA 1SCUA 2Z58A 1YKFA 3AKCA 1QTIA 1WHTA 3KYJB 2QT1A 2C4TA 3IOEA 9LDTA 3SKXA 2VUSA 1M6HA 2FE4A 2IS1A 5FTLA 5G4KA 3GD5A 4RFLA 5CT8A 5B2EA 4XDZA 2AKEA 2C2BA 2JKVA 4BEBA 4LF8B 1AC5A 2ZJ0A 3TMAA 1GZ5A 4IM7A 2QF7A 3IUBA 2XF8A 3PXDA 1W29A 2X2OA 5AOCA 1YL6A 3I64A 1X0VA 4BNWA 3UMCA 3FPSA 5FNVF 3GEIA 3S2IA 4RJTA 5LYJF 3EZ7A 1QGAA 3K8OE 3R7NA 3MWJA 2CLDX 1OHHA 2OAGA 2WMOB 5EJIA 1YWGO 5B3JC 4EL0A 1R4NA 5BYKA 5D3KA 1X77A 3MT9A 4Y6LA 5E3IA 5A3QA 5BW8A 5FHRA 3K70B 2E5WA 2FGKA 2KWIA 1PL8A 1Z6ZA 1LSOA 4U7PB 5JJCA 3EPLA 1U7WA 2ZP1A 4EHFA 2A5FA 2H1WA 3TCXB 2GFIA 2CDAA 2E1RA 1TIPA 2PFSA 1RACA 2JH3A 4TVOA 1W25A 2JBWA 3UHFA 1PG0A 4PSUA 3VR6D 3DOIA 1DT3A 4QBGB 3WQHA 5K8VA 3IEKA 4BBZA 1PV1A 2VNAA 3OIUA 4KAAA 4S0ZA 1RPJA 1Q7TA 4G6ZA 1FDVA 2WF6A 3EIXA 2L82A 4LHSA 5AVSA 4QAQA 4KHPB 2ZRFA 4G09A 2D06A 1PR9A 1TAHA 2G9NA 3KE9A 8OHMA 2VDUE 3EQZA 3EJ6A 2W2TA 2OUKA 4GDMA 4C4RA 2WZQA 1G3QA 4BFTA 3GXBA 4JBYA 1BFDA 2ZBEA 2VJLA 2IW3A 3R23A 4GBJA 4WKPA 4RKQA 3ZXIA 5BWNA 1Z4JA 4K9PA 2D1QA 4BLOA 3QNMA 2QP3A 2H31A 2PMKA 3SKYA 1HNXB 1D3AA 2RAFA 4MQ6A 4YNBA 3TR0A 3FPCA 1N2HA 3U0BA 4LNUB 1JEJA 3MCVA 2RGNA 2I1LA 1TM2A 2ZB4A 5BNTA 3L07A 2YRFA 1U81A 1WD7A 3T7KA 2HJVA 2KQUA 3I04M 3S99A 3QY9A 5JZSA 1BHSA 3WGZA 1KPIA 3U81A 4V38A 4C4PA 1YK0A 4NAHA 4MAFA 1TLFA 1N1MA 3L8GA 4OHFA 1NF2A 2P41A 1X87A 2LCIA 4PSAA 4UVGA 2J59A 5KNBA 4AECA 2OD9A 3ZDYB 5HTOA 3DKRA 1QZXA 2EX4A 1AGPA 4B8YA 1JSLA 1PE0A 3AVQA 4RY2A 1W36C 1E7MA 1EQAA 2QN9A 1AX9A 1PS0A 4UOQA 5DHAA 1QH9A 3KEQA 3MSXA 3OMWA 1BX1A 1MQSA 3SQDA 5BWOA 3BVPA 2GJAA 1FU7A 4IOMA 1M0TA 3EFOA 4YCJA 1RFGE 1CF4A 1W5AA 5IJXA 1T34A 5BMVF 2RCYA 1SIWA 1LPPA 3IQZA 3QI7A 2F8LA 4OU4A 3P97A 3RYFB 3ZLTA 3NBQA 2RHCA 3VKWA 3QPVA 4GPEA 2R60A 1E5LA 1OT5A 4LDQA 4UCQA 3JYPA 1YS6A 4GU5A 3AERA 1JDPA 4FI3C 4YAGA 4G1UC 3ANNA 3DXXA 4JLBA 2D7DA 2EG5A 5FWNA 3HA3A 5GZ3A 3T0FA 1GAEO 3MBOA 2NP7A 4YCNA 3FWKA 1KOFA 3EXHA 3ZTYA 3DBOB 2OGZA 1GNTA 1ZU5A 3PEYA 1KO8A 2FX5A 3DCJA 1C2YA 2P79A 1CYDA 3IT2A 1J99A 3LT2A 3PR3A 4IOLA 1Z37A 5AVUA 2MSDB 4CN9A 5L6LB 3V4RA 3FKSD 5LKAA 5LIPA 3BE6A 3I52A 5DHUA 1Y9JA 3U3MA 1U63A 4YT8A 4MSUA 3HVJA 1Q1NA 4FFMA 3ONFA 2IU0A 4UKDA 4Z9XA 4KPFC 2BHLA 3KXLA 4YECA 2H0RA 4G5QA 3QQPA 1E2NA 2GBGA 1IJEA 2O0MA 4J75A 2OFWA 1P8JA 1ZL0A 2HDNB 2D5CA 3VDXA 5J1TB 3OC0A 1T15A 1XC7A 5F64A 2W6JA 3NTVA 4JQZA 3ZE7A 5C53B 4KQ2A 3BL5A 1KO1A 4FC7A 3WGOA 4DIBA 4BZQA 4KPYA 1U7OA 1E2LA 1WQ4A 4B44A 3WL4A 1CUVA 3FY4A 2XZTA 4BXOB 1ELOA 2B35A 3GBSA 4Z86A 4ZTBA 1A8SA 3BQMB 3TPZA 2Y76A 5DWDA 2A1UB 5FFNA 1BA2A 4C22A 1XDSA 4RV5A 5E8RA 4L76A 2WZCA 4H6XA 2KSQA 2ZRPA 3SZLA 4ND8B 4WOCA 3DZGA 3NM5A 4CG2A 5F23A 4G2TA 3JRXA 4NIMA 4R40A 1K9SA 4HEQA 4CMEA 4II3A 1BE1A 2E0IA 1LBHA 1N1EA 3R0ZA 1BAPA 5KTYA 1G2PA 5I51A 4L51A 1XMJA 2A7QA 4FMCB 2FPXA 4AWAA 4YRAA 1L4NA 2VWQA 1Q0LA 2XI4A 1WDMA 4NG5A 2F1IA 3NZEA 2CD9A 2VZ0A 5CBPB 5JISA 1QSGA 1PK9A 3L4EA 3VO9A 1Z8NA 4Q9KA 1S3FA 2JZOA 5J5VA 3LQQA 1X1BA 1OT3A 2XQGA 4R81A 1UKAA 4DARA 5EUMA 1UZLA 3H4MA 3AFIA 3RT9A 4RGYA 3FCEA 1BHO1 3EEFA 4NG4A 4INZA 1QO9A 4US2R 4L0MA 2PY6A 1PR3A 1T10A 4KMRA 1VLLA 3P71T 4G5RA 3AZOA 4Y1RB 3RK4A 4LYHA 3O0DA 4OQZA 3C24A 2HQRA 4YJ3B 4RSHA 5TRTA 2EGHA 3H5OA 2FEMA 5F21A 4CHTA 4P4GA 1FFAA 3DZJA 3OY7A 4LXTA 5DEIA 2H2GA 4GOND 2DFKB 4GPD1 3HB0A 2H5IA 3QEJA 3KKPA 4N0EA 2PWYA 2VXCA 1QJ4A 2A9JA 4WNCA 2WK1A 2WWRA 3BH7A 4OQDA 5JXHA 2AC4A 1F4VA 2JI7A 2Z9CA 3EXIA 4JI5B 4IIDA 3RV4A 1SCNE 2O2EA 3BEDA 2G17A 3NC4A 1Y0BA 3OO0A 1IJBA 1FRFS 1KH1A 1PEDA 2VNKA 4RA6B 1JNYA 4LDPA 1ZUD1 1XZJA 3HUDA 2PWBA 3KOMA 1MVOA 3KEMA 5FOVA 1D5CA 3TSCA 3TYXA 4I08A 4OA8A 4RFSA 5EC8A 1WUYA 2J3HA 4YAOA 5IARA 1UDXA 2AS0A 2CFTA 3NKLA 3VR4H 4WPGA 2CMFA 9ABPA 1TKAA 1RI1A 2CE7A 2AFIE 2NZWA 2PH5A 4QGSA 5LM3A 3MLAA 5L7TA 3IQIX 4HXGA 4Q7JB 4KBFA 3U49A 1RC1A 4P3NA 3JTMA 4U2GA 5IEJA 1C4WA 3QFTA 4O4IA 2FMKA 4G5YA 4PG5A 4XOIA 3KU1A 1SK9A 1DPGA 3TSWA 4CN8A 4F8YA 3PPYA 4TYMA 5F12A 2ZPUA 4XWWA 1GG8A 4MNTA 2OG2A 4AJOA 3RIMA 1YZLA 4HB4A 5EKUA 2G88A 2BJHA 2MMGA 2NIPA 2NUBA 1E3LA 1YOVB 3R4VA 4GVXA 5BV0A 1ZCBA 4A2CA 3DE1X 2VTDA 3A6JA 3L05A 2PA3A 2VP4A 3NTUA 4FGSA 5EJ5A 2HWWA 5H80A 2VRBA 1TCUA 2H4YA 5IH3A 4ZOAA 3IDSA 3UAZA 2DLCX 3D6FA 1Y5IA 2IYPA 1P2DA 5J5AA 3WGMA 4BO9A 1IZ9A 2JCGA 3B60A 3Q5EA 2NXCA 4BWGA 5CYFA 2PMDA 1U6JA 4DMHA 2HA0A 5LZ2A 3PTAA 1LLDA 2ZAGA 2YHBA 1XFAA 3KEFA 4JLMA 4UCFA 3GLIA 2UZIR 1D6MA 1FXUA 3WLMA 3I53A 4CT0A 3NCTA 2ZUTA 2OV4A 4AXXA 3HM2A 3EIQA 3IB3A 1RLUA 2BMWA 3MZ0A 3PNPA 1RQRA 5LQKA 3U7GA 2PD4A 3AV0B 1VCNA 3PR1A 3CUTA 4IDPA 5KMGB 2AG5A 1T9CA 3V4VB 4KFRA 1V4BA 4DM4A 1U1FA 4JI0B 1D1TA 4AROA 3EVTA 2QKYA 1GSAA 1T1EA 2XVZA 2JLYA 3I6ZA 4W63A 3VPBA 4LBVA 1USWA 5EY5B 4OXNA 3ZK7A 1GKKA 4BU0A 5JFOA 2HBYA 4GSYA 1L7OA 1NTRA 2AVDA 1EDBA 2C8VA 3CH5A 2WTAA 4ONEA 3T7SA 1HK7A 2IZ0A 1TEVA 2G0NA 4I8IA 4A3SA 5C35A 2Q45A 2QIPA 3UMRA 3DTTA 5JCPA 3KOZA 5KC8A 3U44B 5BP7A 1NBHA 1GLGA 4O2BA 2FRVA 4RD4A 1KS2A 3VPFA 4BLWA 1J6UA 1PNVA 1BW9A 1MABB 1Z8DA 2IW1A 5KYYA 4EGJA 4NCXA 1Y63A 2XEDA 2ZE7A 3IODA 3OPMA 1KYVA 1O95C 5JQWA 3NG1A 1K4MA 2AZDA 2GN6A 2UVPA 2A35A 2F43B 1PZEA 1DBIA 3AR3A 5G0VA 4YCMA 1XEAA 4C0AC 4RW0A 5A6VA 1ZGBA 2QORA 4OMFG 4ZU1X 3T35A 1CUAA 1NUSA 1PVDA 1SC6A 2DKOA 4B6RA 2D5LA 1WULS 1IVYA 4Z4QA 1W4RA 5JCJD 4YCSA 2X5OA 2QJFA 5FDFA 4P0PB 3F6PA 5FPYA 4UVIA 1JI3A 1MZPA 4JP5A 3QEKA 2Q6KA 2I5PO 4ZU6X 2ZSUA 5T57A 4LOLA 1XZMA 3K05A 4ZOCA 2F62A 3BWVA 4NJEB 2NZ2A 4QLAA 4BBPA 1IZYA 1TQDA 4ZZ1A 2AJLI 4MRSA 1EG2A 1Y7IA 3MWEA 3CLSD 3LPLA 4MYSA 3HH8A 1H2XA 2ECKA 2FUG1 3LCCA 3BPSA 5CXXA 4DVJA 3HM9A 1GADO 2DKNA 2HPHA 1DJLA 1FZTA 5DTRA 4GP7A 1S4QA 4F5WA 1OV6A 1T5HX 3AHJA 1CQJB 3L1JA 1TYEB 2ZYIA 1YJBA 2WFLB 1W8DA 1N2OA 3G2KA 4AULA 3FB1A 4BQNA 4EL5A 5ER9A 3W5UA 3O38A 5DBGA 2EKZA 1Z2OX 3U9LA 3MCZA 1RBQA 2A6PA 7AT1A 4RF4A 3LX4A 1JZQA 3X1DA 4MX8A 4PV7A 2PHZA 2DPYA 2O8DA 4Q3NA 3GNTA 1ZGGA 4X44A 4K3VA 2IV7A 4EG0A 4M1OA 2XT9A 3VJMA 2BFDB 3K9GA 5AW1A 3TE6A 1KRWA 4UQPA 4JV5B 1MHTA 3VBCA 2FWNA 1QHGA 3NHYA 1V8DA 4Q15A 3ZX5A 3CH4B 1Y42X 1H8HA 1MJ5A 4GG1A 3QU9A 4FGZA 1I5RA 1VJCA 1JDZA 1D5WA 3GAZA 3NTXA 4P3YA 3BWEA 2HXGA 4WV3A 1Y34E 1VLHA 3DBVO 3PQFA 2JC3A 3PJGA 1VBKA 1BGWA 1G8MA 2DF8A 1PSWA 4GZLA 3UMGA 2BKEA 1Q16A 2Q5EA 5LWHA 3PRHA 2AG6A 3BERA 4B4UA 1FTWA 1C3VA 3EA4A 3HBNA 3V8VA 2V7WA 3CZ9A 3MLEA 4JJ6A 1BXRA 2H29A 2OHVA 4BNMA 4EVSA 5DKFA 3ND6A 5AICA 4HWOA 4JLJA 3LG2A 1S8FA 2ZJ1A 3W8NA 4ENUA 4MVJP 1K75A 1XZCA 2JAWA 1GPUA 2QVGA 4JT8A 2PKCA 1SUIA 4FR5A 4UMVA 4BWYA 2IOQA 2P6MA 3C87A 4AURA 1DXQA 3JAWB 2R47A 4ZO4A 3WNVA 5EJ9A 4ZTUB 3LT5A 1U94A 4DEXA 3PYMA 2DR0A 2DFNA 3BHJA 2EKQA 2QT0A 1RAEA 2XLBA 3BZBA 2FWMX 4MW2A 4AZ3A 3JWEA 1W19A 4G65A 4IJVA 1EHIA 1MRSA 2OUIA 1EVJA 2YQ5A 3OIWA 2JGDA 4DS3A 1RJ9B 1T4DA 3QX9A 1TKCA 2LVBA 1ODJA 3BRWA 3L04A 4FX2A 4L1KA 4R7GA 4HYTA 3OEWA 3AJ8A 1HDIA 1HYQA 4NYMQ 4OHKA 4WJKB 4BX2A 1EZ1A 3V1KA 3BKWA 3AP3A 3U16A 2AF4C 2OBMA 4LEIA 3JQ8B 4X1IB 5EMKA 1ZWKA 3UYKA 1K5DA 1GVNB 1YB2A 4LY6A 1YFJA 4RZQA 1SOWA 2YXNA 1EUQA 3EGXA 2EIHA 5A7HA 3P94A 2OE2A 2YIMA 5AJTA 4DEVA 3Q7QA 5KYVA 5HQTA 1FMJA 4YGXB 4DIUA 5GONA 3FHJA 3IHLA 3H16A 2IHBA 1RJWA 4XJTA 4QT4A 5ADHA 3L7JA 4XGNA 2CYBA 1Q2XA 4DJDC 2PKEA 2OMEA 5BNIA 4MJXA 3DBHA 4RJKA 3QIAA 1S1MA 3FKJA 1NQAO 3BX1A 4QFMA 2P6OA 4O3MA 1GSHA 1IJFA 3MMSA 1FS5A 4IP0A 4ARZB 4Z54A 1T1SA 1JJFA 1X1EA 2RBGA 2VAXA 4TVSA 2ZBVA 4RVNA 1XTJA 3GJSA 5IUJC 4ALKA 3CVXA 3GEEA 1LD3A 1E66A 1JU3A 4B6OA 3UKDA 4JLKA 2JLQA 2O9JA 2H59A 3O8NA 4LE0A 4GMHA 5B12A 5IHPA 3DNFA 2O19A 5G3ZA 3T5TA 2GJ4A 5IEBA 2YVQA 2ZRJA 3H1AA 3WISA 4D9BA 1GV0A 2EW2A 1K6EA 2XZPA 3HDYA 4PAQA 4U02A 3HP7A 5IYZB 5KHOC 2J0SA 3PQCA 3O9MA 3QNUA 3DEHA 3OG9A 5BUQA 2QG4A 5HRAA 2Q27A 1U2SA 3NBMA 3P45A 2AEFA 1LU9A 5EZYA 4XWKA 1Y8RA 3Q0TA 4W1PA 1WY5A 1PW7A 1B0UA 2E4XA 2RH5A 3PZBA 4RHFA 1JH9A 2AD1A 1I1QB 2DWOA 4J7UA 1REQA 2OENG 2VRWA 2QX7A 1OY1A 1G8JA 4ARUA 1A5TA 1UJ5A 1OAAA 2P0EA 4QUAA 3CUWA 4CM9A 2QU7A 1U9IC 4LCJA 4FBLA 2ASVA 3D3JA 4RABA 4CLDA 2NU7A 4EY3A 4N3AA 3GW8A 2I6FA 3PR2B 5I5EA 2Q99A 4YT2A 3NVDA 1JVSA 1QKKA 2FW7A 4PSVA 3HU5A 1BOFA 5F73A 1IHUA 3DBRA 4X94A 5FI3A 2HD4A 5JY6A 1M9NA 1OVMA 2VUTA 4QGFA 4LF7B 3KAQA 3MJSA 3U80A 2A0WA 1MDBA 4EB8A 2BEUA 5IDWA 2C2OA 3QMPA 3JWHA 1U1EA 2PMWB 2Y71A 4HATA 1ULBA 2HA6A 4UHJA 1RXSA 1Y89A 3VR5D 5C1OA 2GK3A 3DDZX 3EUWA 1RABA 4F2DA 2P69A 1GPBA 2G0AA 5AJZA 1U2TA 1NVEA 4WFIA 1H9AA 3M0EA 4UHBA 1CFJA 3OOEA 3F5DA 4YJGB 4DZZA 1ZIPA 1XZDA 5IN5A 3C6BA 3I6QA 4TRNA 3VX4A 5HKKA 1NURA 2O0JA 1I4EB 2YY5A 4QQRA 3TL6A 2OGTA 2GK7A 3UPTA 4R54A 3P9ZA 1QHHA 2I67A 3Q1KA 3S68A 1W85A 3DYVA 1QH1A 2ENUA 5LU8A 1T1IA 3CSDA 3FROA 3GEHA 4MV9A 3EA0A 5AOBA 4XYMA 1FP1D 5KOHB 2MSCB 2ZJBA 3AESA 3LZDA 2YYSA 2GPTA 1KVUA 3MUNA 1GTSA 4IF6A 4MJ7A 5PNTA 2HLDD 1XCPA 5CJPA 4EMUA 1RLMA 4Z0PA 3ZY2A 1R6BX 4TYYA 3QG5A 4KMOA 3VXKA 2ZB7A 5EJGA 3ZLBA 1H1TA 3SCZA 2OXFA 1J5EB 4ZEVA 3NWOA 1DWOA 4YJFA 1WCYA 3FI9A 3FNQA 3LPMA 3O21A 3ZXSA 4ZZ0A 5EWJB 2M6KA 3BJRA 2LDXA 3HUTA 4QC2A 3IV9A 1VGVA 2JIZD 3BMXA 1GPMA 3CLTD 2UZAA 2YWHA 3L7NA 4JYPA 1YS2X 5EIAA 2QV7A 5LP6C 4UFPA 3Q8MA 1U8FO 3BYZA 3TIIA 3O83A 4Z8XA 1NSFA 2EATA 3I4LA 3N6RA 4B6SA 3F5SA 1AUOA 4IRUB 4DDMA 5JJIA 4NU0A 4WY5A 1OZ0A 2BDTA 2OR3A 4V0SA 2H6EA 5M7EA 3GFQA 2RIRA 4XLLA 3UWOA 2O59A 5E1MA 5CB4F 1IK6A 5L40A 2PVPA 4MKFA 2Q4EA 4K8OA 5KTTA 1WDTA 2J6BA 2WU0A 1I3LA 4IUCS 4I1UA 5F5LA 3VUFA 1QBKC 5JPDA 4BFXA 3A1WA 2OV8A 4LXGA 3MT8A 1ZJYA 1C50A 2GYUA 3KHKA 4ZYLA 1LPSA 2EHDA 3MB5A 1Q7CA 3KZCA 1JFLA 5E3HA 5HX7A 3UK6A 1GCAA 3ZHBA 2H0AA 2J5RA 4XVHA 4ZC1A 5BV2P 1VFPA 2HFJA 2UYHA 4RA9A 5LMCA 3D4NA 1Z0ZA 4BQRA 3GXOA 2ODEA 4V03A 3ZQKA 4DJJA 3UJNA 2FETA 1ZXLA 2HRRA 3OCYA 4ZVTA 4L95C 4MQUA 1ZK0A 2V9CA 3OMXA 4KXFB 4KQXA 4TUYB 4ZI5A 5FBWB 5E6RA 4YWJA 4K0KB 3A1SA 5I9BA 2I3DA 5DLDA 3C4QA 3OQHA 1L5OA 3KLMX 4RZIA 1XMIA 2HN9A 3IP6A 3MNFA 4UU7A 3RD5A 1B76A 1I33A 4J4TA 5EIEA 1FDSA 1CUEA 5I7FA 1CLEA 4IIVA 1KI8A 1E9DA 3OPXA 1P1HA 3OZEA 2G09A 3VZRA 2ESRA 3IUMA 4BKOA 2FPSA 1JZTA 3RODA 4NL4H 9GPBA 3OQOA 4RDCA 3G2LA 4DGQA 4CMGA 3TFQA 4AQDA 1JWAB 1SPBS 4J6EA 2J5BA 1US8B 3BF8A 1EBUA 3KQTA 4LXQA 5FFMA 3HXMA 4FP9A 4JLSA 4LQLA 4XX1A 3RS8A 4DB2A 2O6HA 5CYPA 5I5GA 1GKIA 4FDTA 2Q4DA 1YULA 1Q0RA 1VJDA 3PGMA 3BB3A 1F0YA 2D4AA 3IHWA 4QDTA 5FV7A 3KTDA 4AF6A 2IHNA 1FDUA 2SECE 1K5GA 1M7GA 1SKYB 3FWNA 3LGSA 5C5CA 6YASA 1C8LA 3LW7A 2QUJA 1EUCA 3IAM1 3M4XA 3P96A 3Q9SA 4RD0A 3ROQA 3UAYA 5K2MA 4IH1A 1U0NA 2GETA 1JEYA 4Z49A 1KBZA 2J7PD 4LBYA 3AI3A 1ECBA 2PXHA 1PAUA 3PWKA 4QPNA 1DFIA 3FN4A 2XE4A 3MSCA 4GXQA 4WTOA 1K3UB 3LXUX 2VQ3A 2MR6A 4FR0A 2FHSA 1QYDA 4ROSA 2F1RA 4HAXA 2YWGA 4JI4B 1NMYA 3E9QA 3GLTA 4J1TA 3IBGA 4B6EA 1YZ3A 1DI0A 5LQDA 1TYAE 2IDMA 2JJ1D 4GOJA 4GR9A 4RC9A 3F9RA 1NJFA 2BEWA 3DA8A 2ATEA 1NJ1A 4PIVA 5DI3A 3TZKA 3UMYA 1Q20A 3EVEA 5E95A 5FBQB 4IZ6A 3CVOA 4XCQA 2RH8A 2EJCA 4JB2A 2VHVA 1CQZA 1JL3A 2XXAB 1U8EA 3G1UA 3UXMA 3ZHOA 4IHJF 3KT0A 4KO1S 4LZNA 2CLSA 2ZRNA 5DK6A 3T94A 1RKBA 3MXTA 1NW6A 3BGIA 2VHYA 3V34A 1YB4A 5DNAA 1WDKA 2HZ7A 2IHKA 4B84A 2W2LA 4M37A 4ZYYA 1F8FA 4UHKA 1XNJA 5EIFA 2IZ5A 1HNWB 1PK8A 2CJYA 2GBLA 3E4CA 4TQUS 4UAGA 3RQSA 3W2HA 4BO0A 3EMDA 3O2NA 3DQPA 4EY8A 2PEZA 5EGNA 4F21A 5C7IO 2QP4A 3I04A 4QPPA 4XZ3A 2WA2A 2Q6VA 4N0PA 2NT4A 1F2TB 3KUUA 1E1QD 2NPIA 1KHHA 2XKBA 4JOBA 3ONEA 3VZPA 1T0IA 2A0XA 2C2GA 2BCEA 1O4VA 1VDZA 2J0UB 2VEDA 3CONA 2WFMA 5KDLA 4CKYA 1NZFA 1DB3A 3ETHA 3R9IA 1CP2A 4XKJA 5I4IA 4B3XA 1YACA 1T5IA 3MK31 1B2LA 2QG6A 1RM5A 4M46A 5EL0A 3H2JA 4NBNA 3SZ3A 5A4DA 3N2NA 1IOWA 1U2RA 4I55F 2ZKIA 4DC0A 1BSVA 2PPVA 1O0CA 1EP9A 1IXZA 3ZWVA 3U56A 3OZFA 4C4YA 3TRHA 3MYYA 2A5DA 3SYLA 3VDRA 1A3CA 3DAYA 3O92A 1K89A 2PFKA 1R74A 2AN9A 1M0EA 2WBLC 1GYRA 2HU8A 3BWBA 2B3DA 2BFWA 4V1CI 1AB6A 1RLIA 3K72B 4B3TB 1QYCA 4CUKA 1JQEA 1P4SA 2D8AA 4XRRA 4ZQIA 2NU9A 3P2EA 1O6GA 3M6LA 3EZXA 4JMPA 1B3BA 1SURA 1P61B 4GR4A 4M2LA 1AD2A 5BQXA 3PJRA 2VLIA 1BDMA 3FNHA 2FW8A 1E1YA 2XUQA 2JBAA 3V8MA 2IYUA 2CLMB 1SCIA 4MS1B 2YV5A 3CY6A 2C84A 4YP5A 2BMVA 5EEHA 4D0LB 3PEUA 5DM60 1RAIA 1EXVA 3WL6A 3AR8A 3UJCA 4TLDA 2BGUA 4F2HA 1SC3A 1ANKA 1ULZA 4PNZA 2OLEA 2W48A 3GF4A 4LI3X 3E05A 3I1IA 5KWEA 3L7CA 4RS3A 4F1KA 4Z0NA 1RRGA 1KOLA 5TMPA 4KH1A 3OIFA 3H7IA 1HRDA 5DMXA 1YS9A 3UAGA 1Z5GA 4BNFA 1L5ZA 4G5FA 1PGJA 1SPXA 1I6KA 2HLPA 2DPMA 5COAA 1BTOA 2XQVA 1NLFA 4KODA 2VYNA 1IK4A 1RWNA 4TV8A 3WL3A 2CY0A 4RVHA 2VO1A 1DXYA 3FCXA 3O1HB 2YV2A 4H35A 4PYNA 5KNDA 3TL2A 3HGTA 3KFVA 3HB7A 1AK1A 2VSOA 4ZPXA 5ALXA 1VL2A 1GFWA 3R8XA 4DCGA 2P4SA 3O7WA 5LN1A 2XCRB 2G5TA 1F4PA 4TLLB 3OEED 3DV0A 4G5GA 5F2EA 2M6SA 3N5KA 4OGLA 2AN4A 2HM7A 3IPRA 4I5IA 1C1XB 1PIWA 4ZALA 1DSSG 1QQ7A 1VSTA 3OURA 3PF8A 4CM8B 4D82A 1OYWA 2J9GA 4NAUA 2HKIA 1EFVB 3LUHA 3R3HA 4YAJA 3RRFA 1T8TA 1U0LA 4ZO8A 4BAUA 4CLRB 4GOLD 3VKGA 2XRMA 1MV5A 2CNLA 5TXGA 1CEQA 1VYVA 4MW9A 5BR8B 3AUUA 1FNNA 4YRDA 4HWPA 5JNLA 1VYHA 4F3KA 5EIXA 3KKZA 4AP6A 3E0QA 3R5FA 1RRPA 3AINA 5T5QA 4ALLA 4EX7A 1V6AA 2M1ZA 1I4DD 3KZXA 4X60A 4BMOB 3N86A 1DBQA 1KSJA 1OFGA 4D9JA 4CE6A 3UFXB 2W4QA 3DUFA 4DLXA 4KXWA 3ZHYA 2WINI 1T4BA 4OFWA 3T4PA 3MUOA 4TMTA 1Z3IX 3CG0A 4H0FA 4J6FA 4Y2RA 3RC9A 4JP3A 4B2YA 4EY4A 4DV3B 4ARIA 1ORTA 4TRJA 1QQTA 2HNBA 1AS2A 4G81A 3A2LA 5EP4A 1KQNA 4FE3A 3N3BC 2CSXA 4GYYA 4Z1MA 1SQ6A 5AJVB 2H65A 4DQXA 1KL7A 1R0CA 1MF7A 1ZD9A 4PLWA 3K9BA 5C18A 4YLYA 1FJGB 4KOEC 3IUSA 4MEJA 4DIEA 3GP3A 1UOOA 1VLMA 2C2YA 4CTMA 1I4LD 1M34B 4XEHA 4GHWA 1SZJG 4PSCA 2GAIA 3GV0A 2UUAB 1NHWA 3OJFA 4DV0B 3LKZA 2RCNA 5BUCA 4QVIA 3RFCA 1P9OA 2GJSA 2CT8A 4KWEA 3R3VA 3TR5A 2GTHA 1PQWA 1RBYA 4LOKA 3WAGA 1IM8A 3RE1A 1OC2A 1ZSYA 3IGFA 2BT4A 2ZFUA 3BL6A 3RKSA 2PSFA 3HBJA 5K4GA 1NXVA 4FDVA 4GDFA 4BB9A 1Z83A 1DLJA 4REMA 1HZJA 4NQZA 5D85A 5K4AA 1RIFA 2B2XA 2O7SA 2ZJYA 4L73A 3TZQA 3QNWA 1YONA 4RWZA 3F9CA 3ORRA 4S04A 4RD6A 1DC6A 2BM8A 3E9NA 1SQFA 4EF4A 2XMQA 5F2OA 4LHEA 3WAJA 5TDHA 1EG7A 2RK4A 4MICA 4F3TA 1DO0A 1EWQA 1QO7A 1YRBA 1U5CA 2R8YA 5J23A 4Y1GA 3EEQA 1T8SA 3I42A 5K3FB 2ACKA 1DAKA 2QUZA 3ICOA 1I7QB 1V0JA 5IAAA 1G8KA 4BAZA 5DGCA 3VSAA 3MVEA 4YPOA 3L7OA 2P6RA 2XYPA 3HZHA 3OLCX 2RHMA 4H4CA 2XX3A 3W5AA 4PWZA 3SN6A 4OFZA 3OFND 2Y68A 3AF2A 2BELA 3A3OA 4K86A 1ZOSA 4Y9TA 1HFEL 1WUJS 4G4SO 2YNMC 1NJ5A 4KZPA 4XPZA 4UM5A 1E2HA 3BB1A 4TS9A 2OK8A 1DKNA 2PKRA 2VTEA 4PAGA 4CNQA 2F2TA 1P7YA 1N5MA 5K3CA 1WXFA 3WWPA 5BUZA 1LPNA 3CWQA 1N92A 3IH5A 3RYFA 3MS4A 4E33A 4BHTA 1U02A 4P38A 2J0EA 5CNKA 5FLEX 3TN7A 2CW5A 2DCMA 3S7TA 1W88A 2FPGB 2Z2IA 5LXTF 2BKLA 4F3RA 3LIPA 3WGQA 1I36A 1YDWA 1VCHA 4F11A 3B36A 1QOZA 1M1YE 3LRTA 3QW4B 2HC9A 2FUNB 3T52A 4EGAA 1RU3A 4H3HB 1GPYA 3HI4A 4HAWA 2HSGA 4X90A 4CKCB 4PGMA 2EEPA 3OM1A 4AYXA 5IJ0B 1ZMXA 1D2EA 4JXKA 4X66B 2AMFA 5AIAA 1DQYA 5KNCA 3PC8C 1CEXA 4ZI7A 2ZYDA 4I1YA 1YDEA 3HVRA 1OILA 2OOSA 3KETA 4AS2A 2NX2A 3AI1A 1KFJB 1XF9A 4RVOA 1C9KA 5EXTA 3ZWYA 3OM0A 4BB5A 2I6UA 2ISQA 4FXOA 4P1ZA 3WLRA 1G17A 1IBMB 2RFLA 2HPZA 4YACA 4Z4EA 2DBRA 1J8FA 2PGIA 7REQA 1NJ2A 5HK9A 5FI5A 1VMDA 5JATA 3ZQJA 3UOWA 3ENWA 3PGA1 1SUDA 2RHHA 4D0NA 4QTYA 2QOEA 3PDHA 4OHWA 1KZGB 5JAHA 4MW5A 5AI5A 4UNPA 3NNNA 2GWRA 4G41A 5JQGA 3LY8A 4L8VA 2NO5A 3DHWC 3STYA 3MIZA 2AJ8A 4HMOA 4BXOA 2NO1A 3DGFC 3CR8A 2PTGA 2Y2VA 3GPBA 4QUBA 2Q9AA 5FUWA 3LD9A 1CJBA 5LZ4A 4QGGA 1GGEA 4ND8A 3T95A 1ZUIA 4NYIQ 3D4BA 4NMHA 5DEOA 3DF7A 4H9GA 4L7QA 4LK2A 1MB4A 4MWEA 4UDXX 5DTQA 4ZAYA 1TL7C 2IYXA 3RIEA 4DE5A 2A9PA 3VNUA 2EV9A 2XGMA 1OI4A 1Z4QA 2BCJQ 1PX2A 2CMGA 2XNJA 2OP1A 1TD1A 1WW8A 2XNDD 1BWRA 3FDZB 3KJEA 4PLFA 2BBWA 1TA0A 5T8KA 5KJFA 2E48A 1RJFA 5CBPA 4KNWA 5CDTA 3A6PC 5AK0A 1VSVA 5KOIA 4IFBA 2JLBA 4I1IA 5MHTA 1WSBA 1G8GA 2LCQA 4W9NC 4C43A 4KR3A 3AU8A 1DIAA 2VZ9A 4UEQA 4QG7A 1DOHA 4OUDA 3BN3A 4INOA 1E3WA 3FXAA 5FA8A 2G08A 1R0LA 1GJRA 3JARB 1U9ZA 3QA3E 3JD3A 2Q28A 1T1JA 4UUNA 1U3GA 5TIIA 4NARA 4GL2A 5DBEX 3R40A 4AKIA 2EBHX 1UXKA 5AXDA 5HJEA 5JALA 3TZLA 1E1CB 3RGGA 2Y0BA 2BZ1A 3DB2A 1HDEA 4Y1RA 1UAGA 2BCGY 3HRKA 1QMPA 4OLJA 1OJ7A 2YV1A 4YJ3A 2D59A 1F5NA 4LC0A 4ZCSA 3R6WA 3NEPX 3VI3B 4OMUA 4LISA 4ZOLF 2R97A 3WKEA 3GFSA 3LL7A 5JMTA 4P5EA 3GWZA 4NATA 1VIAA 5IN4A 3NB0A 5BV7A 5JHHB 2VQDA 2Y66A 1KTVA 2JARA 1XNQB 2VSQA 2PD6A 4D3YA 3ED1A 3DJFA 1AY0A 4LRYA 4EYOA 1UBTS 1YNOA 5FLXA 4B47A 1GSOA 2XSZA 4RA6A 3GU3A 1B41A 1BH6A 1TF7A 1YZGA 2WIFA 3KXDA 5IUKC 5JRJA 3K5WA 4DDUA 2JVJA 5C3UA 4YUWA 1KWGA 2ISSD 4TKZA 4C1BA 2YJTD 1P6QA 1QZZA 3GGGA 4LWQA 4C0JA 1K98A 1C7RA 2TYSB 1LNZA 1PWYE 2LNDA 3KO8A 5HDQA 2DXIA 3X2EA 4PPGA 2QB5A 4HT3B 1JSZA 3JQFC 3NYWA 3PDIB 2ZRKA 4FYVA 1Z68A 5K0NA 2VVTA 4ZYVA 3ZJVA 1YL7A 2P1DA 4XWTA 2BFAA 1FB5A 1R7RA 2ORWA 1Q57A 4DQVA 4H1WA 3ISVA 2GHQA 1C8VB 1Y3AA 3HDTA 4G4GA 3EPJA 3G8AA 4JQCA 4NABA 4CM7A 4DLRA 4BO8A 3TWOA 1BZYA 4OQLA 3V33A 2JCXA 1F60A 1AQJA 5EIWA 1P33A 2OESA 3O2SB 2ZRDA 4M8KA 4M3NA 5C37A 1YOVA 1EB9A 2FPIB 3QVMA 5KQLA 1UFQA 2GCGA 3SVZA 1EM8B 4C89A 4XCVA 5DNDA 3GZTB 4I50A 4YP7A 1L4FA 3SQWA 1KI3A 4X1KA 1UFRA 3KKMA 5M29A 3ABSB 1OIVA 3RVDA 3GZJA 1VL5A 3PUVA 4LQ4A 4XB6B 1OTYA 4IIBA 5DSTA 4BV9A 2IYQA 4L3OA 1UANA 4R8SA 5KHLB 3FTCA 2EF1A 5H4HA 4G0XA 3FFAA 3EGCA 7GPBA 3ZU6A 5FIUA 1VE9A 1ZNQO 4IHAA 4O2AA 2FLVA 4ZAXA 2IPXA 3KHSA 4QJBA 2WP0A 2OLKA 4LRXA 4XUEA 2NQ8A 2GRUA 3RHTA 3RLIA 1ZG3A 4RTJA 1GZVA 5D6NA 5CNJA 3MS7A 2VJPA 1R0WA 2WYHA 4GE3A 3VO1A 5KWIA 5DX0A 4P9NA 4PHHA 1CULC 5EIOA 3GWGA 1ZIYA 1NFRA 2FN7A 4BO6A 4DMCA 2BZSA 2BFEA 3BRSA 3CNEA 4O4JA 2JGKA 4AY4A 4DTIA 1CUSA 2LW7A 3O75A 4R8MA 3O8RA 3UVEA 3CQ9A 1YKGA 2Q0XA 4PZYA 2I76A 2WDZA 1BKYA 3CIFA 3QKUA 4UCXA 5BYAA 1ZHOA 4D26A 1HZZA 1X7YA 1E9EA 2WJAA 3GT3A 4KMSA 4RGVA 3U62A 2OWEA 4D9EA 3PPXA 5ALPA 3NPMA 1UK6A 4XJXA 2CNKA 2O50A 3CX6A 4G1BA 4S2EA 4YDSA 2QE7D 4MYTA 2OZEA 4HO1X 3C39A 4I9NA 5J2UA 1X7DA 3WIDA 3WYBA 2QXUA 1I3OA 1P5HA 2H48A 4IXMA 4J1QA 1SXJD 1KAGA 3WLFA 5L51A 1WLYA 3CKKA 3E5HA 3PXAA 5CURA 2D0DA 1HE1C 3PC3A 4OJKA 4P22A 3S1AA 1YCGA 3ZCVA 1WJGA 1Q6YA 1QS0A 1FDTA 2CXQA 2RJ3A 2XOEA 3FW1A 1LPMA