3DWHA

Structural and functional analysis of sra domain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
205
structure length
193
Chain Sequence
b'GSHMPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structure and Hemimethylated CpG Binding of the SRA Domain from Human UHRF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 54
structure length 193
sequence length 205
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 3dwhA01
4PW6A 3OLNA 2PB7A 2ZKFA 2ZO1B 3DWHA 3F8JB 2ZKDA 2ZKEA 2ZO0B 3F8IA 4PW7A 3BI7A 3FDEA 2ZKGA 3CLZA 2ZO2B 4PW5A 4NJ5A
chains in the Genus database with same CATH superfamily
4PW6A 3Q0CA 4R28A 4RZLA 3OLNA 3Q0BX 2PB7A 2ZKFA 2ZO1B 3DWHA 3Q0DA 4F0QA 3F8JB 2ZKDA 3Q0FA 2ZKEA 2ZO0B 3F8IA 4PW7A 4F0PA 3BI7A 3FDEA 2ZKGA 3CLZA 4YGIA 2ZO2B 4PW5A 4NJ5A 4OC8A
chains in the Genus database with same CATH topology
4PW6A 3OLNA 2PB7A 2ZKFA 2ZO1B 3DWHA 3F8JB 2ZKDA 2ZKEA 2ZO0B 3F8IA 4PW7A 3BI7A 3FDEA 2ZKGA 3CLZA 2ZO2B 4PW5A 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PW6 A;  3OLN A;  2PB7 A;  2ZKF A;  2ZO1 B;  3DWH A;  3F8J B;  2ZKD A;  2ZKE A;  2ZO0 B;  3F8I A;  4PW7 A;  3BI7 A;  3FDE A;  2ZKG A;  3CLZ A;  2ZO2 B;  4PW5 A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 4PW6 A;  3Q0C A;  4R28 A;  4RZL A;  3OLN A;  3Q0B X;  2PB7 A;  2ZKF A;  2ZO1 B;  3DWH A;  3Q0D A;  4F0Q A;  3F8J B;  2ZKD A;  3Q0F A;  2ZKE A;  2ZO0 B;  3F8I A;  4PW7 A;  4F0P A;  3BI7 A;  3FDE A;  2ZKG A;  3CLZ A;  4YGI A;  2ZO2 B;  4PW5 A;  4NJ5 A;  4OC8 A; 
#chains in the Genus database with same CATH homology
 4PW6 A;  3OLN A;  2PB7 A;  2ZKF A;  2ZO1 B;  3DWH A;  3F8J B;  2ZKD A;  2ZKE A;  2ZO0 B;  3F8I A;  4PW7 A;  3BI7 A;  3FDE A;  2ZKG A;  3CLZ A;  2ZO2 B;  4PW5 A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...