3DWLG

Crystal structure of fission yeast arp2/3 complex lacking the arp2 subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
114
Chain Sequence
b'VQAAVSQLIPQARSAIQTGNALQGLKTLLSYVPYGNDVQEVRTQYLNAFVDVLSNIRAADIPAFVKECSTEEIDNIVNFIYRGLANNSSVLLNWHEKVVEISGIGCIVRVLNSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
pubmed doi rcsb
molecule tags Structural protein
total genus 26
structure length 114
sequence length 118
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dwlG00
3DXKG 1U2VG 2P9IG 3DWLG 1TYQG 2P9KG 4XEIG 2P9LG 3RSEG 3UKRG 2P9PG 1K8KG 4JD2G 3UKUG 3DXMG 2P9UG 2P9NG 3ULEG 2P9SG
chains in the Genus database with same CATH superfamily
4DLQA 3L16A 2VGXB 5ITZF 2WXJA 4C0MA 3LEWA 1HX8A 3HVEB 1OWNA 3ZU7B 1OCOE 1Y6IA 4HRMB 3LJNA 4J8SA 3D9LA 4UUCA 1DVPA 2WXKA 2AVPA 3D9MA 2DYRE 3ASDA 4F1PA 4GTVA 5HKPA 1INZA 1FCHA 1SZ9A 4XEIG 5CHEE 5EX3A 3SFXA 4OAUC 3V2OA 1A5EA 4LUNU 2R05A 5ENPD 5BV1A 3S7BA 4YDOA 2WQ7A 4CDMA 3ASGA 3BQOA 4AEZC 5A7DB 4I1MA 1IYGA 4AIFA 2VSXE 4NURA 4PS3A 5CCLA 3RRMB 3L22A 1YYHA 4PH4B 1WM5A 4AOFA 1NZNA 4N2SA 4MLPA 2P9LG 2P9PG 2VJ8A 4C0EA 2I6HA 3SBTB 4GZ3A 2HE0A 3BU8A 2X6FA 2P9SG 1K1AA 2JABA 4LNBA 4OAVB 3K9IA 4KXKB 3V31A 4GMLA 4G11A 3LS8A 5EYLA 1HG5A 4N5QA 4XZ4A 2WVIA 2X6HA 3APCA 2PQNA 5LFAA 4HQDA 3ZXSA 3ZIMA 2R02A 2I9CA 1EF1C 4WUYA 5CEAA 2IU1A 2DZOA 4GTPA 3RO3A 5LCWJ 2CG3A 3ZHEB 4G8LA 3RSEG 5FQ7A 2HYZA 3D9OA 3E34A 2RD0A 3HDXA 3PZ3A 3FTZA 5ANRA 1KPSB 2XCCA 2CHZA 1JPLA 5BV0A 3CHOA 2J49A 1OY3D 4HBDA 3QK0A 4DK5A 1U3DA 3PZ1A 2L0IA 1DCEA 3UUXA 5JJ6A 2QYUA 3F6QA 1BI7B 4M7CA 1N4PA 1QNFA 2IO2C 3D9KA 3BEEA 3OXFA 2WQHA 1OWPA 4LSZE 3U66A 1UG3A 3I4GA 1A17A 3BG1B 1QYMA 5T8IA 4D10C 3Q47B 4F1SA 4ILHB 3ZYQA 3CV0A 2EIJE 3RK6A 1MHQA 2WXFA 2XCBA 3FTXA 2Q7FA 1YMPA 1RW2A 4WNFA 1WAO1 4KMOA 3VTXA 1JWFA 1VDYA 4BWRA 1V55E 2GRQB 2H6IA 3LVQE 3UM2A 1W3BA 3GZSA 3TGOA 5G05J 2EIME 2Y0BG 2AJAA 3FTVA 3HHMA 2E0IA 5CRVA 3CVVA 3E4BA 2DBAA 3SD5A 4OVUA 2I1JA 4U8HA 1ZB1A 2XPIA 3UQ3A 4B89A 1U3CA 4AY6A 1BLXB 5G04C 3ONKA 3QB2A 1LTXA 1OWLA 4J6IA 3EIJA 3DPYA 3Q78A 4B8CB 3SZ7A 1EDUA 4JD2G 1SW6A 4GPKA 3JQ1A 3PVLA 4JHRA 4O6FA 4U95D 5D0OD 1D8DA 3DSTA 3DPDA 3C72A 4GTTA 1TN6A 1X81A 3L82A 3IXEA 5BUZA 3DSUA 5AQ9A 1NL4A 4J7WA 3ABME 3P1UA 3LYAA 3JXIA 2AXZA 4WWOA 5ANLA 3OXGA 1AWCB 3PZ4A 2XGSA 1S70B 3UX4A 1HZ4A 3SI5A 3UI2A 3TWRA 2QYJA 1HO8A 2MOWA 4HOUA 2KCVA 1N0QA 5ENTD 2OV8A 1O1TA 3JUIA 3ZNGA 2XGMA 2XPYA 2NC9A 1FPPA 1KT0A 4J0UA 4GMJA 3ZEFA 4DX7D 3APDA 4MS6A 4N3AA 3B13A 4KZCA 5LX8A 3B7TA 3LY9A 4OVVA 1Z3YA 3ESLA 5AENA 1MJ0A 4K5CA 1SA5A 3CHRA 4CGWA 4V3IA 3UINC 4UWGA 1XNFA 3G2SA 1MX6A 2E2EA 3FUJA 1N54A 4KVMA 2LNIA 3N71A 1IHGA 1H6KA 4N5CA 4WWPA 2FI7A 3FUFA 2XZTG 5FZRA 1MX4A 2XENA 4HNAD 2YHCA 5KJLA 1BPOA 3VTYA 2GGFA 3HXFA 4AP2A 2J09A 1YCSB 2ETCA 4APOA 1S0PA 5CERB 4J8DA 2ILRA 2DCPA 4PS8A 5JA4D 4HS2A 4U96D 4HORA 3C3RA 3AU4A 2XEHA 3HXEA 1JUQA 3CVLA 5ENQD 3AS5A 4U7EB 4MRUA 4HFGA 5KJKA 4EPZA 2P9KG 4Q69A 2GW1A 4F6RD 3MZLB 4U04A 2WXLA 4DX2A 3B7RL 4UQZA 3ZUVB 3ASFA 4BX9A 3Q5MA 4H7XA 4AV7A 1QZ2A 1WG0A 4ABNA 2VTBB 5AARA 1N94A 1H19A 5JHAA 1O1RA 4DUIA 4ANXA 4GA0A 5CECB 3O48A 2CHXA 4BSXA 1BI8B 4LG6A 4N3CA 1TN7A 2BEDA 3IHVA 5AQ7A 2BKKB 1TR4A 2PM6A 1OCCE 4O1PA 3C3QA 1IQUA 3CK7A 3ULYA 2X3MA 2LAHA 4JHKA 3FEXA 3B95A 3QNKA 1G3NB 3EU9A 3J5PA 3TG4A 2ZU6B 4GYWA 3FUIA 2VYIA 4JXTA 2DWZA 3ASNE 3X2QE 3IV0A 2V4HC 5EX0A 1Z3XA 5FINA 4IRUA 5KJNA 3TG5A 4NIKA 4FLHA 4R7LA 2PZIA 3B7BA 2UY1A 3L08A 4BERA 4L9PA 2Y4UA 2NSZA 4BT9A 1JWGA 4K03A 3W9FA 1OCZE 3HIZA 5M72A 4G24A 3ULQA 3CKBA 3ZYLA 3QWWA 3ZFWA 4EECA 4Q96A 3FH7A 2RKKA 1HH8A 4GB9A 4WNGA 2HM8A 2WXQA 2J08A 4BTAA 3PEVB 4Y6WA 3FEYA 3D9PA 3B7SA 3ABKE 4RQIA 5AJLA 4BETA 4I1AA 4ZHBA 5T3RA 1TEZA 4H7YA 2X6KA 1PC2A 2R59A 3U4TA 2XRZA 2P9IG 3ZW3A 4GMRA 2IF4A 4A3TA 4I2WA 3UM0A 3HRAA 3TAXA 2V5QC 3TWUA 5CMWA 4UI9C 3S7FA 5E76A 3FTYA 3CVUA 1IXVA 4BY6A 1DNPA 1HU3A 2KBXA 3RAUA 3AU5A 1U2VG 3CK9A 4HRNA 3JQ0A 3IBEA 3QDNA 2KC7A 2OCCE 2J8SD 3SFYA 5FIOA 5A6CA 4HXIA 1BU9A 5EIBE 3TXNA 1LD8A 1LF8A 4DPRA 2VQ2A 4B8AA 1UJJA 3I3NA 1N4QA 2B0OE 4G8KA 1D8EA 4UWFA 3EUVA 3RRNB 2OVFA 4ACKA 2YINA 4LERA 2ONDA 3FU0A 1JCRA 3UKUG 4UQYA 3R9AB 3ZN3A 5H7PA 4L2LA 2PL2A 2P9NG 1E7UA 5KNGA 3CHMA 2WPVA 3OAWA 1O5MA 3E33A 1LD7A 1MZCA 4WWNA 3HXCA 3CVQA 5EN5D 3LVRE 4LCTA 1RZ4A 1KT1A 2WXMA 4JW1A 2UY1B 2XHEA 1MX2A 4XKCA 2XZDG 3Q73A 4HB5A 4Q94A 4HRLA 5J90A 2XEEA 3DSSA 1IQRA 2WXOA 4TV3A 2LXMA 3LCAA 3LXUX 3DEOA 1HF8A 1JCQA 3RIBA 1NFIE 1XGWA 3AS4A 2QFCA 2JLBA 2DVWA 4U07A 2VSYA 4DI4A 5EYPF 2R17C 3C98A 5AYWD 4L23A 4DX6D 4CCAA 1S64A 3FFLA 4JB8P 4Y6CA 3HG0D 2BKGA 4LNUD 2QC9A 1NA0A 5AAOA 1TNYA 3AAAC 3MYVA 3T5VA 4KT6B 2AW6A 4GTSA 2H6FA 3S7DA 2Y4TA 1EPUA 2KZTA 4FU3A 4HLLA 4A1SA 3FH5A 2IY0C 4FHJA 4I6GA 4FADA 3VLEA 4KBQA 4ANWA 3CQCB 3Q49B 3U64A 3ZRHA 4BX8A 1OXJA 3RU0A 2V0PA 3PUKA 3FU6A 5FQ6A 1H6PA 4EQFA 3UM3A 1MQSA 1H2UA 2FBNA 4FJZA 3WG7E 2GRRB 2A4ZA 4MKTA 1OCRE 1FT2A 3CIAA 3MJWA 3HYMB 5ENNA 3UPVA 3ASHA 4DRXE 1UN8A 3FU3A 4JEHA 5AN8A 4BESA 3MKRA 1NP7A 4G2VA 4LEUA 2X38A 3NF1A 1IHBA 5FZQA 4DI3A 5D2MC 3LJ3A 3UKRG 1AP7A 4CRWA 2HR2A 4FHKA 3TL5A 2NYJA 4B93B 4I1OB 3ZXPA 4LRZA 5G04J 4ATGA 3TWSA 4DX5D 2KATA 2IONA 1KZPA 1TNUA 1FVFA 4G26A 3SQVA 2LAIA 3QARA 4TXQA 1N11A 4E6HA 4N39A 4URKA 5AQAA 4RG6A 2P2CP 3ISMC 1X5BA 3ML9A 5B3SE 5KJMA 3UTMA 4GA2A 4GYOA 5BT1A 1JCSA 3DEPA 3UIOC 5FQ8A 2A5UA 5C1DA 3Q7AA 1HG2A 3E37A 4P29A 4HVBA 3ULEG 3I4RB 3WXXA 1HE8A 4WNEA 1K8KG 5E75A 1TN8A 3FP3A 4JHJA 4F7AA 3RO2A 3V79K 2XRYA 4EZLA 2DZNA 4GZDA 3CHQA 5JJTA 4Z68A 4KYOB 2HO1A 4N2QA 1H6OA 1SVXA 3ZGQA 2ZGDA 4DX1A 4B94A 3FHEA 4BFRA 5AQBA 3KEAA 3W9GA 2OOEA 2BF0X 5HQ8A 3D3MA 5BNWA 3NAWA 1ELKA 5CEDB 1SQMA 5CCMA 3IEGA 4UQXA 3NQPA 2LUHA 2B6CA 5B1BE 4CZ2D 3GW4A 2PQRA 5AJDA 3CVXA 2VGXA 2VGYA 3NBNB 3HVEA 2DYSE 2H6GA 2IQCA 2UWJG 2LO6A 5FQ4A 1N52A 2X6JA 1N95A 2R03A 4I6JA 5J08A 4EBAG 4L1BA 3UT7A 4FULA 4J8FA 2IEJA 2WXHA 3S7JA 2RFMA 4K5AB 4WNDA 3PE4A 3SY2A 3RRUA 1L5JA 3RJVA 4I17A 3FU5A 3CGHA 3Q79A 3CK8A 4I9EA 1E8WA 5KNHD 4QQIA 4CT4A 2GRMA 2CHWA 4PS7A 3TJPA 3CEQA 3KS2A 4GTRA 2FEZA 2XQ0A 1EYHA 3V30A 3AJIA 2P58C 4K0RA 4RG9A 4LNGA 4RLYA 1HS6A 5CRUA 3MV3B 4TXPA 1KZOA 4OYSA 1OT8A 2F8XK 3Q15A 4CGVA 3P2BA 4HI9A 2ZIRA 3D9JA 4A1GA 4TRQA 3DRAA 3T9KA 3T5XA 3URZA 2LXLA 4U0SA 3AG4E 1O1SA 2CFUA 3PUJA 3CQGB 2R5SA 4I6EA 3AG2E 2EINE 4PUCA 3CKCA 4F53A 1PAQA 1PY1A 4GAAA 5LP0A 4M3OA 2L6BA 3ONLA 5ARGA 2L9BA 4ATZD 5IY5E 5FT9A 5LOZA 3G2VA 3ZHEA 4U8VD 1FVHA 3APFA 4JVSA 3TWWA 3R9MA 2L0TB 1E8XA 4NRHB 3KD7A 3B7UX 4GZ6A 2Y3AA 1NI1A 2F0YA 3MEKA 2ZXWE 1DCQA 3NB2A 3Q4AB 3VLFA 3DSWA 5KCMA 2WXRA 3OXLA 4FP7A 1BD8A 3IKOB 1HFAA 3TWXA 4XE0A 2XPZA 3FUMA 2OEVA 4CDNA 1K3ZD 2C0MA 3QOUA 2H6HA 3SFZA 1TNZA 2GRLA 3L17A 2F37A 3JXJA 1ZBPA 3CSTA 4NACA 3L6AA 4J8YA 3BUAA 1Q2ZA 5ARFA 4YNDA 3DXMG 4BT8A 4UWKA 3Q9NC 2J9QA 1E8YA 2AXUA 3FTSA 5B1AE 4ILIA 2XEVA 2OEWA 3L9TA 4I43A 3FTUA 4A55A 3PE3A 1TNBA 3JYSA 4AY5A 2Y1LE 4B0ZA 3PNTB 4J8EA 4HLEA 3V2XA 3O4ZA 4HOQA 4C48B 4JA7A 5BPPA 4U63A 4GZCA 5CMYA 4GZ5A 4ILGA 4K5BA 4FLBA 1IKND 4X8QA 5LCWC 2IOSA 2WXGA 4GCOA 2WB2A 4BEPA 1OWOA 2BTDA 3MGBA 4G25A 4PDXA 4APFA 4RSYA 4UI9J 4XI9A 4CDRA 2XGOA 3HXDA 4GTQA 4IN3B 2GRPB 3CSFA 4U0ZA 3PNLB 1UOHA 2QZAA 3Q7FA 1V54E 5D66A 3SHFA 3LY8A 2KM4A 2M63A 2RFAA 4G23A 2MRIA 3CR3A 2X6IA 1N0RA 4I9CA 2RG8A 2XS8A 2ZISA 2WXNA 2WM9A 3L54A 4O60A 1Z5SC 3FH8A 3QC1A 5FZSA 3PEUB 1UW4B 4W9RA 5DIZA 2IO3C 3QWVA 3IHYA 3NZSA 1Z6TA 1E96B 3L13A 2EIKE 4EZKA 5FTPA 3JUEA 3ZKJA 4RVBA 4IYPA 2YHEA 4YDYA 1WDYA 4F3VA 5ENRD 3ENEA 3KAEA 5EIDA 2AXVA 4JZYA 4N3BA 4FC8A 2I1KA 4AVXA 1OWMA 3PRZA 1E8ZA 5G05C 5EKQD 4JA9A 1E90A 3PS6A 4O1OA 5FWQA 4G1TA 5HRYA 2OVBA 3SO8A 2Y69E 3D9HA 4UI9K 4WAFA 2KCLA 5JHBA 1UN9A 2WQ6A 3CHSA 3GZ2A 3DBSA 2CG2A 3LDZA 3TWVA 4GTMA 4ANVA 2CFZA 4I2ZA 5G55A 2GROB 1H2TC 3QWPA 4JEUA 3FULA 2FULA 3MKQA 3EHNA 3PZ2A 4UWHA 4GTOA 2V4LA 4EBAA 3SNXA 4HOSA 3MA5A 2DIWA 4U0UA 5A23A 3S2AA 4DLOA 5CBNA 5T4YA 4BTBA 4CYMD 2MYOA 1H2VC 3OTNA 3UMVA 2YQ8A 3CLJA 3CVNA 1N4SA 3TWTA 3QAQA 2ETBA 4KZ0A 2C2LA 4AJWA 3I5PA 5JMND 3CVYA 4CT0A 2VGEA 3ZVVA 3FUKA 3LKUA 4FA6A 4GPMA 3FUDA 3E30A 1UJKA 3FUEA 4EHMA 4YVOA 3KSLA 3UT4A 1N4RA 1QQEA 3G2TA 1SA4A 2VSOE 5KWDA 5CBOA 4YDEA 5DBKA 2BUGA 1QBQA 4XIFA 4ZFHA 3NZUA 4GYYA 3C5RA 1YA0A 2L6JA 2EILE 3E32A 3FDHA 3PREA 3ZPJA 2C0LA 4TXRA 1OUVA 3MCXA 2VTBA 4ACLA 1Y8MA 2PNNA 3EIQC 2WMNA 3CVPA 4EZJA 3BG0B 2V5FA 4AM9A 4E85A 4MBGA 2VSNA 3D9IA 4A63B 2V8SE 4TUMA 2J4BA 4HOTA 2IOLA 3JCKC 1KLXA 2KZTB 2PM7A 3SGHA 3C3OA 2IJGX 3NOGD 3SBSA 1E7VA 3ASOE 2FO1E 3MKQB 3UIPC 4XX5A 1S63A 3FUNA 2NXPA 4AXHA 3D9NA 4HI8A 2MHKA 5HI7A 1NA3A 3ML8A 3QJZA 1ZU2A 4JC8A 3GZ1A 3EHRA 3FWVA 3MV2B 1DC2A 1B89A 2LSUA 3FY4A 2EQXA 1N9AA 1SZAA 3PH0C 3FTWA 2JEKA 3TWQA 1ELRA 5EILA 3VLDA 1TJFA 4JL0A 4XI0A 1TJCA 3KEZA 1WY6A 3UT8A 4C9BB 5HS0A 3ZYKA 5JJ7A 4BSZB 3R7RA 3CVWA 2GRNB 2IFUA 4ANUA 1GW6A 3FUHA 4GCNA 5G2NA 1MYOA 3MX3A 4GA1A 2I2OA 4JPSA 3TXMA 4A3VA 2F8YA 3GYZA 2WMOA 3DSXA 2FO7A 2XS1A 3Q9UC 1FT1A 5KBAA 2FF4A 2KCKA 3LY7A 3G2UA 2J07A 3EHQA 3AS8A 3LPZA 5FJYA 4QFVA 1ELWA 4GU5A 3PDNA 3QKYA 2LSVA 1P5QA 3U9WA 3G2WA 4FJYA 3SF4A 3U3WA 3CHPA 1HXIA 2KXPC 1TYQG 3KSQA 5C2YA 3T8MA 3Q75A 1K1BA 3NOCD 4L7TA 2ZGGA 2YNQA 5BW8C 4DJAA 3RKVA 2ETAA 3J5QB 3PZDA 4U8YD 3T8KA 4NQ0A 5AIJA 3DSVA 4YVQC 1TNOA 5ENOD 4ME2A 4TUUA 3EHMA 5BXOA 3DXKG 1D9SA 3EDTB 3AG1E 4YDWA 3EJNA 1H0AA 4L2YA 3ABLE 4XKBA 3HXBA 2P9UG 3R7QA 2QY7A 3UM1A 3UXGA 2R2LA 3DWLG 2AWIA 3EU5A 4IULA 2WXIA 5EDSA 2A5EA 4CEMA 5ENSD 5BXUA 2J4DA 3ESKA 2WXPA 5D0QD 4KVOA 3AG3E 4UWLA 3ZYMA
chains in the Genus database with same CATH topology
3DXKG 1U2VG 2P9IG 3DWLG 1TYQG 2P9KG 4XEIG 2P9LG 3RSEG 3UKRG 2P9PG 1K8KG 4JD2G 3UKUG 3DXMG 2P9UG 2P9NG 3ULEG 2P9SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXK G;  1U2V G;  2P9I G;  3DWL G;  1TYQ G;  2P9K G;  4XEI G;  2P9L G;  3RSE G;  3UKR G;  2P9P G;  1K8K G;  4JD2 G;  3UKU G;  3DXM G;  2P9U G;  2P9N G;  3ULE G;  2P9S G; 
#chains in the Genus database with same CATH topology
 4DLQ A;  3L16 A;  2VGX B;  5ITZ F;  2WXJ A;  4C0M A;  3LEW A;  1HX8 A;  3HVE B;  1OWN A;  3ZU7 B;  1OCO E;  1Y6I A;  4HRM B;  3LJN A;  4J8S A;  3D9L A;  4UUC A;  1DVP A;  2WXK A;  2AVP A;  3D9M A;  2DYR E;  3ASD A;  4F1P A;  4GTV A;  5HKP A;  1INZ A;  1FCH A;  1SZ9 A;  4XEI G;  5CHE E;  5EX3 A;  3SFX A;  4OAU C;  3V2O A;  1A5E A;  4LUN U;  2R05 A;  5ENP D;  5BV1 A;  3S7B A;  4YDO A;  2WQ7 A;  4CDM A;  3ASG A;  3BQO A;  4AEZ C;  5A7D B;  4I1M A;  1IYG A;  4AIF A;  2VSX E;  4NUR A;  4PS3 A;  5CCL A;  3RRM B;  3L22 A;  1YYH A;  4PH4 B;  1WM5 A;  4AOF A;  1NZN A;  4N2S A;  4MLP A;  2P9L G;  2P9P G;  2VJ8 A;  4C0E A;  2I6H A;  3SBT B;  4GZ3 A;  2HE0 A;  3BU8 A;  2X6F A;  2P9S G;  1K1A A;  2JAB A;  4LNB A;  4OAV B;  3K9I A;  4KXK B;  3V31 A;  4GML A;  4G11 A;  3LS8 A;  5EYL A;  1HG5 A;  4N5Q A;  4XZ4 A;  2WVI A;  2X6H A;  3APC A;  2PQN A;  5LFA A;  4HQD A;  3ZXS A;  3ZIM A;  2R02 A;  2I9C A;  1EF1 C;  4WUY A;  5CEA A;  2IU1 A;  2DZO A;  4GTP A;  3RO3 A;  5LCW J;  2CG3 A;  3ZHE B;  4G8L A;  3RSE G;  5FQ7 A;  2HYZ A;  3D9O A;  3E34 A;  2RD0 A;  3HDX A;  3PZ3 A;  3FTZ A;  5ANR A;  1KPS B;  2XCC A;  2CHZ A;  1JPL A;  5BV0 A;  3CHO A;  2J49 A;  1OY3 D;  4HBD A;  3QK0 A;  4DK5 A;  1U3D A;  3PZ1 A;  2L0I A;  1DCE A;  3UUX A;  5JJ6 A;  2QYU A;  3F6Q A;  1BI7 B;  4M7C A;  1N4P A;  1QNF A;  2IO2 C;  3D9K A;  3BEE A;  3OXF A;  2WQH A;  1OWP A;  4LSZ E;  3U66 A;  1UG3 A;  3I4G A;  1A17 A;  3BG1 B;  1QYM A;  5T8I A;  4D10 C;  3Q47 B;  4F1S A;  4ILH B;  3ZYQ A;  3CV0 A;  2EIJ E;  3RK6 A;  1MHQ A;  2WXF A;  2XCB A;  3FTX A;  2Q7F A;  1YMP A;  1RW2 A;  4WNF A;  1WAO 1;  4KMO A;  3VTX A;  1JWF A;  1VDY A;  4BWR A;  1V55 E;  2GRQ B;  2H6I A;  3LVQ E;  3UM2 A;  1W3B A;  3GZS A;  3TGO A;  5G05 J;  2EIM E;  2Y0B G;  2AJA A;  3FTV A;  3HHM A;  2E0I A;  5CRV A;  3CVV A;  3E4B A;  2DBA A;  3SD5 A;  4OVU A;  2I1J A;  4U8H A;  1ZB1 A;  2XPI A;  3UQ3 A;  4B89 A;  1U3C A;  4AY6 A;  1BLX B;  5G04 C;  3ONK A;  3QB2 A;  1LTX A;  1OWL A;  4J6I A;  3EIJ A;  3DPY A;  3Q78 A;  4B8C B;  3SZ7 A;  1EDU A;  4JD2 G;  1SW6 A;  4GPK A;  3JQ1 A;  3PVL A;  4JHR A;  4O6F A;  4U95 D;  5D0O D;  1D8D A;  3DST A;  3DPD A;  3C72 A;  4GTT A;  1TN6 A;  1X81 A;  3L82 A;  3IXE A;  5BUZ A;  3DSU A;  5AQ9 A;  1NL4 A;  4J7W A;  3ABM E;  3P1U A;  3LYA A;  3JXI A;  2AXZ A;  4WWO A;  5ANL A;  3OXG A;  1AWC B;  3PZ4 A;  2XGS A;  1S70 B;  3UX4 A;  1HZ4 A;  3SI5 A;  3UI2 A;  3TWR A;  2QYJ A;  1HO8 A;  2MOW A;  4HOU A;  2KCV A;  1N0Q A;  5ENT D;  2OV8 A;  1O1T A;  3JUI A;  3ZNG A;  2XGM A;  2XPY A;  2NC9 A;  1FPP A;  1KT0 A;  4J0U A;  4GMJ A;  3ZEF A;  4DX7 D;  3APD A;  4MS6 A;  4N3A A;  3B13 A;  4KZC A;  5LX8 A;  3B7T A;  3LY9 A;  4OVV A;  1Z3Y A;  3ESL A;  5AEN A;  1MJ0 A;  4K5C A;  1SA5 A;  3CHR A;  4CGW A;  4V3I A;  3UIN C;  4UWG A;  1XNF A;  3G2S A;  1MX6 A;  2E2E A;  3FUJ A;  1N54 A;  4KVM A;  2LNI A;  3N71 A;  1IHG A;  1H6K A;  4N5C A;  4WWP A;  2FI7 A;  3FUF A;  2XZT G;  5FZR A;  1MX4 A;  2XEN A;  4HNA D;  2YHC A;  5KJL A;  1BPO A;  3VTY A;  2GGF A;  3HXF A;  4AP2 A;  2J09 A;  1YCS B;  2ETC A;  4APO A;  1S0P A;  5CER B;  4J8D A;  2ILR A;  2DCP A;  4PS8 A;  5JA4 D;  4HS2 A;  4U96 D;  4HOR A;  3C3R A;  3AU4 A;  2XEH A;  3HXE A;  1JUQ A;  3CVL A;  5ENQ D;  3AS5 A;  4U7E B;  4MRU A;  4HFG A;  5KJK A;  4EPZ A;  2P9K G;  4Q69 A;  2GW1 A;  4F6R D;  3MZL B;  4U04 A;  2WXL A;  4DX2 A;  3B7R L;  4UQZ A;  3ZUV B;  3ASF A;  4BX9 A;  3Q5M A;  4H7X A;  4AV7 A;  1QZ2 A;  1WG0 A;  4ABN A;  2VTB B;  5AAR A;  1N94 A;  1H19 A;  5JHA A;  1O1R A;  4DUI A;  4ANX A;  4GA0 A;  5CEC B;  3O48 A;  2CHX A;  4BSX A;  1BI8 B;  4LG6 A;  4N3C A;  1TN7 A;  2BED A;  3IHV A;  5AQ7 A;  2BKK B;  1TR4 A;  2PM6 A;  1OCC E;  4O1P A;  3C3Q A;  1IQU A;  3CK7 A;  3ULY A;  2X3M A;  2LAH A;  4JHK A;  3FEX A;  3B95 A;  3QNK A;  1G3N B;  3EU9 A;  3J5P A;  3TG4 A;  2ZU6 B;  4GYW A;  3FUI A;  2VYI A;  4JXT A;  2DWZ A;  3ASN E;  3X2Q E;  3IV0 A;  2V4H C;  5EX0 A;  1Z3X A;  5FIN A;  4IRU A;  5KJN A;  3TG5 A;  4NIK A;  4FLH A;  4R7L A;  2PZI A;  3B7B A;  2UY1 A;  3L08 A;  4BER A;  4L9P A;  2Y4U A;  2NSZ A;  4BT9 A;  1JWG A;  4K03 A;  3W9F A;  1OCZ E;  3HIZ A;  5M72 A;  4G24 A;  3ULQ A;  3CKB A;  3ZYL A;  3QWW A;  3ZFW A;  4EEC A;  4Q96 A;  3FH7 A;  2RKK A;  1HH8 A;  4GB9 A;  4WNG A;  2HM8 A;  2WXQ A;  2J08 A;  4BTA A;  3PEV B;  4Y6W A;  3FEY A;  3D9P A;  3B7S A;  3ABK E;  4RQI A;  5AJL A;  4BET A;  4I1A A;  4ZHB A;  5T3R A;  1TEZ A;  4H7Y A;  2X6K A;  1PC2 A;  2R59 A;  3U4T A;  2XRZ A;  2P9I G;  3ZW3 A;  4GMR A;  2IF4 A;  4A3T A;  4I2W A;  3UM0 A;  3HRA A;  3TAX A;  2V5Q C;  3TWU A;  5CMW A;  4UI9 C;  3S7F A;  5E76 A;  3FTY A;  3CVU A;  1IXV A;  4BY6 A;  1DNP A;  1HU3 A;  2KBX A;  3RAU A;  3AU5 A;  1U2V G;  3CK9 A;  4HRN A;  3JQ0 A;  3IBE A;  3QDN A;  2KC7 A;  2OCC E;  2J8S D;  3SFY A;  5FIO A;  5A6C A;  4HXI A;  1BU9 A;  5EIB E;  3TXN A;  1LD8 A;  1LF8 A;  4DPR A;  2VQ2 A;  4B8A A;  1UJJ A;  3I3N A;  1N4Q A;  2B0O E;  4G8K A;  1D8E A;  4UWF A;  3EUV A;  3RRN B;  2OVF A;  4ACK A;  2YIN A;  4LER A;  2OND A;  3FU0 A;  1JCR A;  3UKU G;  4UQY A;  3R9A B;  3ZN3 A;  5H7P A;  4L2L A;  2PL2 A;  2P9N G;  1E7U A;  5KNG A;  3CHM A;  2WPV A;  3OAW A;  1O5M A;  3E33 A;  1LD7 A;  1MZC A;  4WWN A;  3HXC A;  3CVQ A;  5EN5 D;  3LVR E;  4LCT A;  1RZ4 A;  1KT1 A;  2WXM A;  4JW1 A;  2UY1 B;  2XHE A;  1MX2 A;  4XKC A;  2XZD G;  3Q73 A;  4HB5 A;  4Q94 A;  4HRL A;  5J90 A;  2XEE A;  3DSS A;  1IQR A;  2WXO A;  4TV3 A;  2LXM A;  3LCA A;  3LXU X;  3DEO A;  1HF8 A;  1JCQ A;  3RIB A;  1NFI E;  1XGW A;  3AS4 A;  2QFC A;  2JLB A;  2DVW A;  4U07 A;  2VSY A;  4DI4 A;  5EYP F;  2R17 C;  3C98 A;  5AYW D;  4L23 A;  4DX6 D;  4CCA A;  1S64 A;  3FFL A;  4JB8 P;  4Y6C A;  3HG0 D;  2BKG A;  4LNU D;  2QC9 A;  1NA0 A;  5AAO A;  1TNY A;  3AAA C;  3MYV A;  3T5V A;  4KT6 B;  2AW6 A;  4GTS A;  2H6F A;  3S7D A;  2Y4T A;  1EPU A;  2KZT A;  4FU3 A;  4HLL A;  4A1S A;  3FH5 A;  2IY0 C;  4FHJ A;  4I6G A;  4FAD A;  3VLE A;  4KBQ A;  4ANW A;  3CQC B;  3Q49 B;  3U64 A;  3ZRH A;  4BX8 A;  1OXJ A;  3RU0 A;  2V0P A;  3PUK A;  3FU6 A;  5FQ6 A;  1H6P A;  4EQF A;  3UM3 A;  1MQS A;  1H2U A;  2FBN A;  4FJZ A;  3WG7 E;  2GRR B;  2A4Z A;  4MKT A;  1OCR E;  1FT2 A;  3CIA A;  3MJW A;  3HYM B;  5ENN A;  3UPV A;  3ASH A;  4DRX E;  1UN8 A;  3FU3 A;  4JEH A;  5AN8 A;  4BES A;  3MKR A;  1NP7 A;  4G2V A;  4LEU A;  2X38 A;  3NF1 A;  1IHB A;  5FZQ A;  4DI3 A;  5D2M C;  3LJ3 A;  3UKR G;  1AP7 A;  4CRW A;  2HR2 A;  4FHK A;  3TL5 A;  2NYJ A;  4B93 B;  4I1O B;  3ZXP A;  4LRZ A;  5G04 J;  4ATG A;  3TWS A;  4DX5 D;  2KAT A;  2ION A;  1KZP A;  1TNU A;  1FVF A;  4G26 A;  3SQV A;  2LAI A;  3QAR A;  4TXQ A;  1N11 A;  4E6H A;  4N39 A;  4URK A;  5AQA A;  4RG6 A;  2P2C P;  3ISM C;  1X5B A;  3ML9 A;  5B3S E;  5KJM A;  3UTM A;  4GA2 A;  4GYO A;  5BT1 A;  1JCS A;  3DEP A;  3UIO C;  5FQ8 A;  2A5U A;  5C1D A;  3Q7A A;  1HG2 A;  3E37 A;  4P29 A;  4HVB A;  3ULE G;  3I4R B;  3WXX A;  1HE8 A;  4WNE A;  1K8K G;  5E75 A;  1TN8 A;  3FP3 A;  4JHJ A;  4F7A A;  3RO2 A;  3V79 K;  2XRY A;  4EZL A;  2DZN A;  4GZD A;  3CHQ A;  5JJT A;  4Z68 A;  4KYO B;  2HO1 A;  4N2Q A;  1H6O A;  1SVX A;  3ZGQ A;  2ZGD A;  4DX1 A;  4B94 A;  3FHE A;  4BFR A;  5AQB A;  3KEA A;  3W9G A;  2OOE A;  2BF0 X;  5HQ8 A;  3D3M A;  5BNW A;  3NAW A;  1ELK A;  5CED B;  1SQM A;  5CCM A;  3IEG A;  4UQX A;  3NQP A;  2LUH A;  2B6C A;  5B1B E;  4CZ2 D;  3GW4 A;  2PQR A;  5AJD A;  3CVX A;  2VGX A;  2VGY A;  3NBN B;  3HVE A;  2DYS E;  2H6G A;  2IQC A;  2UWJ G;  2LO6 A;  5FQ4 A;  1N52 A;  2X6J A;  1N95 A;  2R03 A;  4I6J A;  5J08 A;  4EBA G;  4L1B A;  3UT7 A;  4FUL A;  4J8F A;  2IEJ A;  2WXH A;  3S7J A;  2RFM A;  4K5A B;  4WND A;  3PE4 A;  3SY2 A;  3RRU A;  1L5J A;  3RJV A;  4I17 A;  3FU5 A;  3CGH A;  3Q79 A;  3CK8 A;  4I9E A;  1E8W A;  5KNH D;  4QQI A;  4CT4 A;  2GRM A;  2CHW A;  4PS7 A;  3TJP A;  3CEQ A;  3KS2 A;  4GTR A;  2FEZ A;  2XQ0 A;  1EYH A;  3V30 A;  3AJI A;  2P58 C;  4K0R A;  4RG9 A;  4LNG A;  4RLY A;  1HS6 A;  5CRU A;  3MV3 B;  4TXP A;  1KZO A;  4OYS A;  1OT8 A;  2F8X K;  3Q15 A;  4CGV A;  3P2B A;  4HI9 A;  2ZIR A;  3D9J A;  4A1G A;  4TRQ A;  3DRA A;  3T9K A;  3T5X A;  3URZ A;  2LXL A;  4U0S A;  3AG4 E;  1O1S A;  2CFU A;  3PUJ A;  3CQG B;  2R5S A;  4I6E A;  3AG2 E;  2EIN E;  4PUC A;  3CKC A;  4F53 A;  1PAQ A;  1PY1 A;  4GAA A;  5LP0 A;  4M3O A;  2L6B A;  3ONL A;  5ARG A;  2L9B A;  4ATZ D;  5IY5 E;  5FT9 A;  5LOZ A;  3G2V A;  3ZHE A;  4U8V D;  1FVH A;  3APF A;  4JVS A;  3TWW A;  3R9M A;  2L0T B;  1E8X A;  4NRH B;  3KD7 A;  3B7U X;  4GZ6 A;  2Y3A A;  1NI1 A;  2F0Y A;  3MEK A;  2ZXW E;  1DCQ A;  3NB2 A;  3Q4A B;  3VLF A;  3DSW A;  5KCM A;  2WXR A;  3OXL A;  4FP7 A;  1BD8 A;  3IKO B;  1HFA A;  3TWX A;  4XE0 A;  2XPZ A;  3FUM A;  2OEV A;  4CDN A;  1K3Z D;  2C0M A;  3QOU A;  2H6H A;  3SFZ A;  1TNZ A;  2GRL A;  3L17 A;  2F37 A;  3JXJ A;  1ZBP A;  3CST A;  4NAC A;  3L6A A;  4J8Y A;  3BUA A;  1Q2Z A;  5ARF A;  4YND A;  3DXM G;  4BT8 A;  4UWK A;  3Q9N C;  2J9Q A;  1E8Y A;  2AXU A;  3FTS A;  5B1A E;  4ILI A;  2XEV A;  2OEW A;  3L9T A;  4I43 A;  3FTU A;  4A55 A;  3PE3 A;  1TNB A;  3JYS A;  4AY5 A;  2Y1L E;  4B0Z A;  3PNT B;  4J8E A;  4HLE A;  3V2X A;  3O4Z A;  4HOQ A;  4C48 B;  4JA7 A;  5BPP A;  4U63 A;  4GZC A;  5CMY A;  4GZ5 A;  4ILG A;  4K5B A;  4FLB A;  1IKN D;  4X8Q A;  5LCW C;  2IOS A;  2WXG A;  4GCO A;  2WB2 A;  4BEP A;  1OWO A;  2BTD A;  3MGB A;  4G25 A;  4PDX A;  4APF A;  4RSY A;  4UI9 J;  4XI9 A;  4CDR A;  2XGO A;  3HXD A;  4GTQ A;  4IN3 B;  2GRP B;  3CSF A;  4U0Z A;  3PNL B;  1UOH A;  2QZA A;  3Q7F A;  1V54 E;  5D66 A;  3SHF A;  3LY8 A;  2KM4 A;  2M63 A;  2RFA A;  4G23 A;  2MRI A;  3CR3 A;  2X6I A;  1N0R A;  4I9C A;  2RG8 A;  2XS8 A;  2ZIS A;  2WXN A;  2WM9 A;  3L54 A;  4O60 A;  1Z5S C;  3FH8 A;  3QC1 A;  5FZS A;  3PEU B;  1UW4 B;  4W9R A;  5DIZ A;  2IO3 C;  3QWV A;  3IHY A;  3NZS A;  1Z6T A;  1E96 B;  3L13 A;  2EIK E;  4EZK A;  5FTP A;  3JUE A;  3ZKJ A;  4RVB A;  4IYP A;  2YHE A;  4YDY A;  1WDY A;  4F3V A;  5ENR D;  3ENE A;  3KAE A;  5EID A;  2AXV A;  4JZY A;  4N3B A;  4FC8 A;  2I1K A;  4AVX A;  1OWM A;  3PRZ A;  1E8Z A;  5G05 C;  5EKQ D;  4JA9 A;  1E90 A;  3PS6 A;  4O1O A;  5FWQ A;  4G1T A;  5HRY A;  2OVB A;  3SO8 A;  2Y69 E;  3D9H A;  4UI9 K;  4WAF A;  2KCL A;  5JHB A;  1UN9 A;  2WQ6 A;  3CHS A;  3GZ2 A;  3DBS A;  2CG2 A;  3LDZ A;  3TWV A;  4GTM A;  4ANV A;  2CFZ A;  4I2Z A;  5G55 A;  2GRO B;  1H2T C;  3QWP A;  4JEU A;  3FUL A;  2FUL A;  3MKQ A;  3EHN A;  3PZ2 A;  4UWH A;  4GTO A;  2V4L A;  4EBA A;  3SNX A;  4HOS A;  3MA5 A;  2DIW A;  4U0U A;  5A23 A;  3S2A A;  4DLO A;  5CBN A;  5T4Y A;  4BTB A;  4CYM D;  2MYO A;  1H2V C;  3OTN A;  3UMV A;  2YQ8 A;  3CLJ A;  3CVN A;  1N4S A;  3TWT A;  3QAQ A;  2ETB A;  4KZ0 A;  2C2L A;  4AJW A;  3I5P A;  5JMN D;  3CVY A;  4CT0 A;  2VGE A;  3ZVV A;  3FUK A;  3LKU A;  4FA6 A;  4GPM A;  3FUD A;  3E30 A;  1UJK A;  3FUE A;  4EHM A;  4YVO A;  3KSL A;  3UT4 A;  1N4R A;  1QQE A;  3G2T A;  1SA4 A;  2VSO E;  5KWD A;  5CBO A;  4YDE A;  5DBK A;  2BUG A;  1QBQ A;  4XIF A;  4ZFH A;  3NZU A;  4GYY A;  3C5R A;  1YA0 A;  2L6J A;  2EIL E;  3E32 A;  3FDH A;  3PRE A;  3ZPJ A;  2C0L A;  4TXR A;  1OUV A;  3MCX A;  2VTB A;  4ACL A;  1Y8M A;  2PNN A;  3EIQ C;  2WMN A;  3CVP A;  4EZJ A;  3BG0 B;  2V5F A;  4AM9 A;  4E85 A;  4MBG A;  2VSN A;  3D9I A;  4A63 B;  2V8S E;  4TUM A;  2J4B A;  4HOT A;  2IOL A;  3JCK C;  1KLX A;  2KZT B;  2PM7 A;  3SGH A;  3C3O A;  2IJG X;  3NOG D;  3SBS A;  1E7V A;  3ASO E;  2FO1 E;  3MKQ B;  3UIP C;  4XX5 A;  1S63 A;  3FUN A;  2NXP A;  4AXH A;  3D9N A;  4HI8 A;  2MHK A;  5HI7 A;  1NA3 A;  3ML8 A;  3QJZ A;  1ZU2 A;  4JC8 A;  3GZ1 A;  3EHR A;  3FWV A;  3MV2 B;  1DC2 A;  1B89 A;  2LSU A;  3FY4 A;  2EQX A;  1N9A A;  1SZA A;  3PH0 C;  3FTW A;  2JEK A;  3TWQ A;  1ELR A;  5EIL A;  3VLD A;  1TJF A;  4JL0 A;  4XI0 A;  1TJC A;  3KEZ A;  1WY6 A;  3UT8 A;  4C9B B;  5HS0 A;  3ZYK A;  5JJ7 A;  4BSZ B;  3R7R A;  3CVW A;  2GRN B;  2IFU A;  4ANU A;  1GW6 A;  3FUH A;  4GCN A;  5G2N A;  1MYO A;  3MX3 A;  4GA1 A;  2I2O A;  4JPS A;  3TXM A;  4A3V A;  2F8Y A;  3GYZ A;  2WMO A;  3DSX A;  2FO7 A;  2XS1 A;  3Q9U C;  1FT1 A;  5KBA A;  2FF4 A;  2KCK A;  3LY7 A;  3G2U A;  2J07 A;  3EHQ A;  3AS8 A;  3LPZ A;  5FJY A;  4QFV A;  1ELW A;  4GU5 A;  3PDN A;  3QKY A;  2LSV A;  1P5Q A;  3U9W A;  3G2W A;  4FJY A;  3SF4 A;  3U3W A;  3CHP A;  1HXI A;  2KXP C;  1TYQ G;  3KSQ A;  5C2Y A;  3T8M A;  3Q75 A;  1K1B A;  3NOC D;  4L7T A;  2ZGG A;  2YNQ A;  5BW8 C;  4DJA A;  3RKV A;  2ETA A;  3J5Q B;  3PZD A;  4U8Y D;  3T8K A;  4NQ0 A;  5AIJ A;  3DSV A;  4YVQ C;  1TNO A;  5ENO D;  4ME2 A;  4TUU A;  3EHM A;  5BXO A;  3DXK G;  1D9S A;  3EDT B;  3AG1 E;  4YDW A;  3EJN A;  1H0A A;  4L2Y A;  3ABL E;  4XKB A;  3HXB A;  2P9U G;  3R7Q A;  2QY7 A;  3UM1 A;  3UXG A;  2R2L A;  3DWL G;  2AWI A;  3EU5 A;  4IUL A;  2WXI A;  5EDS A;  2A5E A;  4CEM A;  5ENS D;  5BXU A;  2J4D A;  3ESK A;  2WXP A;  5D0Q D;  4KVO A;  3AG3 E;  4UWL A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 3DXK G;  1U2V G;  2P9I G;  3DWL G;  1TYQ G;  2P9K G;  4XEI G;  2P9L G;  3RSE G;  3UKR G;  2P9P G;  1K8K G;  4JD2 G;  3UKU G;  3DXM G;  2P9U G;  2P9N G;  3ULE G;  2P9S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...