3DWLG

Crystal structure of fission yeast arp2/3 complex lacking the arp2 subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
114
Chain Sequence
VQAAVSQLIPQARSAIQTGNALQGLKTLLSYVPYGNDVQEVRTQYLNAFVDVLSNIRAADIPAFVKECSTEEIDNIVNFIYRGLANNSSVLLNWHEKVVEISGIGCIVRVLNSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
pubmed doi rcsb
molecule tags Structural protein
total genus 26
structure length 114
sequence length 118
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dwlG00
1U2VG 4JD2G 2P9LG 3RSEG 2P9NG 2P9PG 3UKUG 2P9KG 3DXKG 2P9IG 3UKRG 2P9UG 3DXMG 3ULEG 2P9SG 1TYQG 1K8KG 4XEIG 3DWLG
chains in the Genus database with same CATH superfamily
2J4DA 2P9LG 1QBQA 3CHOA 4C48B 1N9AA 3C5RA 3V31A 3BUAA 4HOQA 3CR3A 3ESKA 1N0QA 2FF4A 2FULA 3AS8A 4G2VA 4BESA 3AG4E 5G05C 2GRPB 2ONDA 1FVHA 1JPLA 2DZOA 4LERA 4I6JA 3ZRHA 1JUQA 4N3AA 3PUKA 4MBGA 4X8QA 3HXCA 3CVLA 3DBSA 1KPSB 2V5FA 3P1UA 2ETAA 3C3QA 1TN8A 1TNYA 3KD7A 3TL5A 3P2BA 1UG3A 1OCCE 3FDHA 5ENTD 4KMOA 4HOSA 2HE0A 5KCMA 4LUNU 1ELRA 2BUGA 1BD8A 3IV0A 3S7BA 4JZYA 5A6CA 4AY5A 5EYLA 2IF4A 2IQCA 3CVPA 3O4ZA 4G24A 3AG3E 2GRMA 3CVQA 5FQ6A 2X3MA 4RLYA 3KAEA 2R5SA 1MJ0A 1ZB1A 3UINC 2R03A 4U8HA 3CHQA 3SO8A 4CCAA 5BUZA 3J5PA 4CRWA 4L7TA 2C2LA 3TWWA 1QZ2A 4HB5A 4APOA 2OEWA 3EU5A 4K5BA 4DX1A 3APCA 3E4BA 3FUNA 4BSXA 4U04A 2PQRA 2B6CA 2F37A 3AU5A 2J08A 2H6IA 3D9KA 4HS2A 1Y8MA 2KCVA 3PH0C 2ZXWE 4GTRA 3FEYA 1JCSA 3ULYA 3CHMA 5CMWA 3MV3B 4UI9K 3KS2A 4O60A 1BLXB 5EN5D 2XZTG 1E8WA 1MQSA 2V8SE 2YQ8A 4FLHA 3CKCA 3CLJA 5G2NA 2AXZA 5KJMA 3TWXA 2BF0X 3AU4A 3Q7AA 1YA0A 3Q7FA 4DX2A 3RRUA 1PY1A 3G2VA 3EHRA 4K5AB 2WPVA 4OYSA 1NA3A 3FU3A 1E8ZA 2WXNA 3KSLA 1OUVA 3UM1A 1OWLA 1MX2A 3GW4A 4P29A 3MYVA 3B7UX 2L6JA 3CQGB 4WNEA 2LSVA 5T3RA 1BU9A 3SZ7A 4N3CA 1JCQA 4L9PA 1LTXA 4JXTA 1A5EA 2ETBA 3TG5A 3J5QB 2PNNA 5B3SE 5EILA 4KVMA 3NF1A 4J0UA 4BWRA 3PE4A 5JJ6A 5LCWJ 1TNOA 3JYSA 4J8FA 3URZA 5M72A 2X6KA 3T9KA 5A7DB 3ASOE 2X6IA 5FJYA 5AARA 2XQ0A 1NI1A 3QC1A 3LEWA 2DBAA 3CVXA 3ZVVA 2XPIA 5EX0A 4URKA 2JLBA 1H6OA 5FZQA 4OAVB 3CK8A 4E85A 1S63A 4N3BA 2LXMA 3C3OA 3ENEA 4J8YA 3ONLA 4KZCA 4HFGA 4I6GA 4OAUC 3AAAC 4NRHB 3LJ3A 2IO2C 5C1DA 2XEEA 3VTXA 3S7DA 3WXXA 1Z3XA 4JW1A 4UWHA 3AJIA 1D8DA 3BG1B 4J8EA 2EIKE 1N95A 3AG2E 3LVRE 4WWPA 3FUDA 2OVFA 5CEDB 3D9PA 4PS3A 3B7SA 4GTPA 3Q9NC 1WDYA 3FTSA 3R7RA 2V5QC 1K1AA 3ZFWA 1XNFA 3CGHA 3HRAA 3UKUG 3ZW3A 3FEXA 2VJ8A 4LSZE 3GYZA 4BT9A 2P9SG 2Y4TA 3CVUA 1FPPA 4WUYA 3Q15A 4JA7A 3LVQE 3L82A 3VLDA 3TG4A 4DUIA 2VSOE 5AAOA 3B95A 5E76A 5T8IA 4IRUA 3R9AB 5CECB 3ZNGA 2ZU6B 3EIJA 4FULA 4DX5D 3V2OA 1N52A 3EHQA 1Z3YA 3L16A 5LFAA 4BFRA 2Y1LE 1UN8A 2FBNA 4OVVA 3RRMB 1WM5A 3FH5A 1OY3D 1Z5SC 1HFAA 4GA1A 1NZNA 3QOUA 3ZU7B 2BTDA 3TXMA 4Q96A 4BX9A 3QWPA 4UI9C 3NAWA 4ILHB 4U8VD 5CCMA 4JL0A 3Q4AB 3TWUA 5JJ7A 3CK9A 3UPVA 5BPPA 1BI8B 3PEVB 3Q79A 2OOEA 5EKQD 3V79K 3ZYKA 4FJZA 3VLEA 1V55E 1WAO1 3L6AA 3OXLA 4LNGA 3IEGA 3PZ2A 3MGBA 3FTYA 3NOCD 3FFLA 4AIFA 4HBDA 5AENA 4WNFA 4A63B 3OAWA 1EDUA 4FHJA 1WY6A 4MKTA 2VTBA 3CSFA 1EF1C 4LNBA 1O1RA 2WMOA 4H7YA 3MV2B 2YHEA 5FTPA 1SA4A 2ETCA 2VSYA 3RRNB 3JQ0A 2WXQA 3ZN3A 2MYOA 3SGHA 4I2ZA 4CYMD 3QARA 3V2XA 2HR2A 2KM4A 2VSNA 3ML8A 2OVBA 4UWGA 1K8KG 2AJAA 2JEKA 3RO2A 3DWLG 2ILRA 3SQVA 4YDEA 3UM0A 1N94A 2A5EA 3DSVA 4HNAD 4MS6A 3HXEA 5DBKA 5BV1A 1O1TA 1TR4A 3D9IA 4TXPA 4A1GA 3LDZA 5AQ9A 3NZUA 3SFYA 1RW2A 2IY0C 1H6KA 2AVPA 2KZTA 5J08A 3MX3A 4HOUA 1SZ9A 3CHPA 4U7EB 4GCOA 2ZGDA 1U3DA 4JHKA 1P5QA 4K03A 2PQNA 3U4TA 2P2CP 3TWRA 4JHJA 2H6FA 1HZ4A 5KJKA 2R59A 3ZKJA 4AY6A 1Y6IA 3UKRG 5G04C 5HQ8A 3DSWA 1D8EA 4B94A 3ABLE 4F1SA 1X81A 1MYOA 2LO6A 3V30A 3APDA 2MRIA 3AG1E 2WXMA 3UM2A 3QJZA 1N54A 4RSYA 5AN8A 4I1MA 5ENQD 4BT8A 2X6JA 2IEJA 3JXJA 2V4LA 1V54E 3CVNA 4I43A 3SD5A 2YHCA 1YYHA 1QNFA 4EHMA 2RG8A 3CV0A 3ML9A 4G1TA 3ZXSA 2EQXA 2EIME 3MKQA 2DYSE 1IQUA 3IXEA 4GYYA 2VGEA 2L9BA 2GROB 1PC2A 1AWCB 5JHAA 5ENPD 3SBTB 4GAAA 3WG7E 3RSEG 1EYHA 4PDXA 2M63A 4TUMA 4DK5A 1OWOA 2C0LA 3G2WA 3FUHA 4TUUA 2WXRA 2Y3AA 2XS1A 1JCRA 4UQZA 1HU3A 3SFZA 1LF8A 2XCCA 4C0EA 4ANVA 5BNWA 2P9PG 3B7TA 4CGWA 3JUEA 1O1SA 4G8LA 2J07A 3PS6A 1E8XA 2BEDA 4BERA 3SBSA 5FWQA 1HO8A 1D9SA 1N4SA 4TRQA 5FQ8A 3D9NA 5CRVA 2WQHA 3E34A 4FC8A 2H6GA 3E32A 4UI9J 2CG2A 2VQ2A 3LXUX 2IJGX 3EU9A 3APFA 1SVXA 4ZFHA 4N2SA 3PREA 3ZGQA 4OVUA 4RG9A 1QQEA 1S0PA 3FULA 4U8YD 4Q69A 2IU1A 3PZDA 2WXGA 1E7VA 5B1BE 1W3BA 4DLQA 1OWNA 1N0RA 3W9FA 4HOTA 4CGVA 4GZCA 1S64A 2A4ZA 1Z6TA 2WXLA 2UY1B 4JD2G 1KLXA 2J9QA 4GZ6A 1NFIE 5JHBA 4G11A 5EYPF 5ARFA 3I4RB 2XZDG 4XZ4A 2WB2A 4AV7A 1YCSB 3QDNA 4G23A 2XCBA 2VTBB 4JHRA 4L23A 1TN6A 1E8YA 5D0OD 2A5UA 4J8DA 2WQ6A 5AQ7A 2EINE 3ZHEA 2X38A 5FZRA 5KBAA 4AVXA 3DPYA 4L2LA 3RIBA 2XEVA 5EIDA 3KEAA 3JUIA 4I17A 4U96D 4A3TA 1SW6A 2KXPC 1U3CA 3RKVA 2WM9A 3MEKA 4RQIA 3ZPJA 5JA4D 3LJNA 4FADA 3L13A 4H7XA 3NBNB 4XI9A 4LRZA 4U0ZA 1OT8A 2R2LA 3ULQA 2HM8A 5AQAA 4UQXA 3ZYMA 1HE8A 5ITZF 3PUJA 1UN9A 3GZ2A 4O1OA 3KEZA 4AP2A 2LAHA 4YVQC 3R9MA 3L22A 3HYMB 3MJWA 3ULEG 2KZTB 2KATA 4HXIA 2OV8A 4JPSA 2XGMA 5KJLA 4GPMA 4HRMB 3UI2A 1OCRE 3U3WA 4JC8A 4I6EA 2LXLA 4D10C 5AJLA 4HQDA 1TEZA 4J8SA 4JA9A 2F8YA 3U9WA 5HKPA 5FQ4A 3LY8A 3TAXA 2YNQA 2WXKA 3R7QA 4GMRA 3Q75A 5BXOA 2RFAA 4AXHA 2AXVA 4B8AA 3LY9A 5G05J 4FHKA 4GMJA 3C3RA 3DPDA 2GRNB 4YNDA 4AEZC 3RAUA 2J8SD 4R7LA 5JJTA 3FH7A 3ISMC 3HDXA 2XHEA 2ZISA 4GTOA 2V4HC 2KC7A 4HORA 3FP3A 4HI8A 1SZAA 4XE0A 4NURA 3UM3A 4ATZD 2NSZA 4LNUD 1DC2A 3EHMA 1IQRA 1FVFA 4UWKA 2GRLA 3GZ1A 3MKQB 3T5VA 1LD8A 3SNXA 3D9LA 1ZU2A 4U63A 1K3ZD 3JXIA 3EUVA 3UMVA 4AJWA 1IHBA 4CDNA 4DX6D 3EIQC 3FTUA 1SQMA 3FHEA 2PM6A 4E6HA 3LPZA 4ILIA 5LP0A 1JWGA 3F6QA 4EZJA 4B89A 2NYJA 3PEUB 2IONA 2HYZA 3UUXA 2J4BA 4L2YA 2E2EA 3NZSA 1B89A 5D2MC 3E30A 3I4GA 1NP7A 3ZIMA 3FUJA 2P9KG 1BPOA 3PE3A 3SF4A 4G8KA 2UY1A 1E96B 3EHNA 5A23A 5J90A 3SY2A 2I6HA 3TJPA 3D9JA 5G55A 2QYJA 4BTBA 3RJVA 3ABME 2Y69E 3PNTB 1E7UA 2NC9A 2I1JA 2VYIA 4N5QA 3FUKA 2CHXA 5FINA 2VSXE 3DSXA 1G3NB 2JABA 4ACKA 2XGSA 2I9CA 2LSUA 3FUFA 4ATGA 5CBNA 3NB2A 2PL2A 2WMNA 4B0ZA 4PUCA 2EILE 3D3MA 4CZ2D 4HVBA 3RO3A 4PS8A 2I2OA 3CVVA 2YINA 3MCXA 4U0UA 5ENOD 3C72A 3CSTA 1UJJA 5BW8C 1MZCA 2Y0BG 4GA2A 2R17C 4GU5A 3ASFA 3LYAA 1H2UA 4MRUA 2VGXA 4BY6A 2KBXA 4M7CA 1TNUA 3HVEA 1E90A 4DI4A 3IBEA 3ZHEB 5HRYA 4ILGA 4EECA 4LCTA 5LCWC 5ENNA 4B93B 4AM9A 4GB9A 2P58C 2XRYA 4LG6A 5KNGA 3D9MA 2GGFA 1H6PA 1NL4A 3I5PA 3FU6A 1ZBPA 3Q73A 5FT9A 4W9RA 4GYWA 3EDTB 3DXKG 3PRZA 3UIOC 2IOSA 5CEAA 4YDYA 4DLOA 2XS8A 4F53A 3OXGA 3HXBA 3S2AA 5DIZA 1O5MA 2R02A 5AJDA 2AXUA 4ANWA 4A3VA 3NQPA 1HX8A 3E37A 2DWZA 2XEHA 1DVPA 3ZXPA 5CRUA 4GMLA 3D9HA 3UIPC 2L0IA 1IHGA 3B7BA 4WNGA 4DI3A 1UJKA 5E75A 2L6BA 3C98A 4EQFA 4I1OB 1GW6A 4F7AA 5T4YA 2XRZA 1N4PA 5HI7A 2B0OE 2OCCE 2MOWA 4J7WA 1TNZA 4EZLA 1MX4A 5ENRD 1RZ4A 3NOGD 5ENSD 2CFZA 5AQBA 1OXJA 1KZPA 5FQ7A 3DSTA 2GRQB 2E0IA 4ACLA 1JWFA 2R05A 5BXUA 4O1PA 3W9GA 5ANLA 4F3VA 2GW1A 4ABNA 3PDNA 4CDRA 3SHFA 1TN7A 5D66A 2FI7A 3DSUA 3DEOA 4U07A 3FU0A 3TXNA 2QY7A 3MZLB 4BEPA 2KCLA 4NACA 4EPZA 1HF8A 4BX8A 3D9OA 4PS7A 3ZUVB 3VTYA 4JVSA 4CDMA 2LAIA 1N4QA 2WXHA 4GZ3A 4G26A 3DEPA 2WXIA 4I9CA 4DX7D 3LY7A 4GTVA 2DZNA 4FP7A 1ELWA 3FUIA 1SA5A 4CT4A 2Y4UA 2IO3C 4Z68A 3U66A 4EBAA 5H7PA 3PNLB 4IYPA 1KZOA 2X6HA 3B13A 4ANXA 3FH8A 3PZ4A 4RG6A 2F8XK 3CQCB 4NIKA 3CHSA 5FIOA 2KCKA 4HLEA 3FUMA 2IFUA 3LS8A 4J6IA 3MKRA 4XKCA 1NA0A 2AW6A 5HS0A 3QB2A 1MX6A 2EIJE 2XENA 2XGOA 5AYWD 3JCKC 3CEQA 3HXDA 1H19A 3ZYQA 1OWPA 3AS4A 5AIJA 3ABKE 4DPRA 2FO7A 3X2QE 3ONKA 3BG0B 4FU3A 2XPZA 4IULA 2P9IG 3UT4A 3L54A 3DXMG 1HH8A 3QNKA 1S70B 2BKGA 4DJAA 4L1BA 4XI0A 2DIWA 2DCPA 5LX8A 2Q7FA 4MLPA 4BTAA 4GYOA 3GZSA 1OCOE 4GZ5A 1IXVA 5D0QD 4FLBA 3HIZA 4FJYA 4C0MA 3CIAA 2WXJA 4TV3A 1VDYA 2CHWA 4WNDA 3Q47B 4U0SA 3L9TA 1QYMA 4O6FA 3T8MA 2F0YA 2VGXB 3EJNA 4G25A 4F1PA 1IKND 3HVEB 5KWDA 4AOFA 1HG5A 4ME2A 4N2QA 3SFXA 1HS6A 1H2VC 3DRAA 3RU0A 4TXRA 4IN3B 4KBQA 4GTTA 1DCEA 3O48A 1OWMA 4B8CB 5EX3A 4PH4B 1FCHA 3QWVA 3UT8A 2RKKA 5JMND 4A55A 4I1AA 1PAQA 2HO1A 5CBOA 4KXKB 4ANUA 3QAQA 3K9IA 3ASHA 3UTMA 4GTQA 4Y6CA 2C0MA 1K1BA 4NQ0A 4HI9A 3ZYLA 4M3OA 5FZSA 4GTMA 5G04J 3N71A 2H6HA 3B7RL 3OTNA 3Q5MA 3FUEA 1YMPA 5CCLA 4V3IA 3LCAA 3BQOA 4EBAG 3FTVA 4WWOA 1N4RA 2FEZA 3UQ3A 4A1SA 4RVBA 4GA0A 2OEVA 4K5CA 3CKBA 3T8KA 3TWSA 3UXGA 3IHVA 3TWVA 2WQ7A 1H2TC 5CHEE 2LNIA 3PZ1A 3Q9UC 2DYRE 3UX4A 4QFVA 2P9UG 3T5XA 1MHQA 4CEMA 2DVWA 3FY4A 2WXOA 4HRNA 2CFUA 2NXPA 4N39A 3HG0D 2ZGGA 4HRLA 4Y6WA 4CT0A 3QKYA 5KNHD 2PM7A 1WG0A 5CERB 1KT0A 3S7JA 3ASGA 4F6RD 1XGWA 2QC9A 4N5CA 4GZDA 3UT7A 3TGOA 1DNPA 3JQ1A 4EZKA 3ESLA 3VLFA 4YDWA 1INZA 3SI5A 2J49A 3E33A 2QYUA 3QK0A 1TJFA 3FTZA 2QZAA 4YVOA 4I9EA 5BT1A 4XEIG 4KYOB 3DSSA 4XKBA 3G2TA 2MHKA 4WAFA 3G2UA 3KSQA 3CVWA 3U64A 4Q94A 3HXFA 3Q78A 3L17A 4LEUA 4GTSA 2FO1E 3PZ3A 4BSZB 1DCQA 1N11A 5IY5E 2X6FA 3G2SA 5LOZA 4GCNA 3IHYA 4JEUA 1X5BA 1U2VG 4KT6B 2L0TB 2BKKB 2WXPA 3MA5A 3L08A 3FU5A 2PZIA 4UQYA 3ASNE 2GRRB 4YDOA 2RFMA 4KVOA 3BEEA 2WVIA 1TJCA 2UWJG 4I2WA 1HG2A 5C2YA 1KT1A 4WWNA 4QQIA 4C9BB 5KJNA 5CMYA 5BV0A 4FA6A 1A17A 1UW4B 3TWTA 1FT1A 4APFA 1H0AA 2IOLA 4XIFA 3BU8A 2I1KA 1TNBA 3Q49B 1EPUA 2LUHA 1LD7A 1BI7B 2XPYA 3LKUA 5ANRA 3ASDA 1ELKA 4KZ0A 4DRXE 1AP7A 5EDSA 3CHRA 4XX5A 4ZHBA 1HXIA 3FTXA 3TWQA 5EIBE 2WXFA 3OXFA 2ZIRA 4U95D 4UWLA 3PVLA 5B1AE 4JB8P 2J09A 4BETA 1IYGA 5ARGA 3QWWA 1TYQG 2VGYA 4TXQA 1Q2ZA 3HHMA 4UWFA 3IKOB 3I3NA 4K0RA 3AS5A 2CHZA 2QFCA 1L5JA 2P9NG 3RK6A 1OCZE 1UOHA 3ZEFA 2V0PA 4GPKA 4UUCA 2AWIA 1FT2A 3CK7A 4JEHA 2CG3A 3FWVA 2RD0A 4HLLA 3CVYA 3FTWA 3S7FA
chains in the Genus database with same CATH topology
1U2VG 4JD2G 2P9LG 3RSEG 2P9NG 2P9PG 3UKUG 2P9KG 3DXKG 2P9IG 3UKRG 2P9UG 3DXMG 3ULEG 2P9SG 1TYQG 1K8KG 4XEIG 3DWLG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V G;  4JD2 G;  2P9L G;  3RSE G;  2P9N G;  2P9P G;  3UKU G;  2P9K G;  3DXK G;  2P9I G;  3UKR G;  2P9U G;  3DXM G;  3ULE G;  2P9S G;  1TYQ G;  1K8K G;  4XEI G;  3DWL G; 
#chains in the Genus database with same CATH topology
 2J4D A;  2P9L G;  1QBQ A;  3CHO A;  4C48 B;  1N9A A;  3C5R A;  3V31 A;  3BUA A;  4HOQ A;  3CR3 A;  3ESK A;  1N0Q A;  2FF4 A;  2FUL A;  3AS8 A;  4G2V A;  4BES A;  3AG4 E;  5G05 C;  2GRP B;  2OND A;  1FVH A;  1JPL A;  2DZO A;  4LER A;  4I6J A;  3ZRH A;  1JUQ A;  4N3A A;  3PUK A;  4MBG A;  4X8Q A;  3HXC A;  3CVL A;  3DBS A;  1KPS B;  2V5F A;  3P1U A;  2ETA A;  3C3Q A;  1TN8 A;  1TNY A;  3KD7 A;  3TL5 A;  3P2B A;  1UG3 A;  1OCC E;  3FDH A;  5ENT D;  4KMO A;  4HOS A;  2HE0 A;  5KCM A;  4LUN U;  1ELR A;  2BUG A;  1BD8 A;  3IV0 A;  3S7B A;  4JZY A;  5A6C A;  4AY5 A;  5EYL A;  2IF4 A;  2IQC A;  3CVP A;  3O4Z A;  4G24 A;  3AG3 E;  2GRM A;  3CVQ A;  5FQ6 A;  2X3M A;  4RLY A;  3KAE A;  2R5S A;  1MJ0 A;  1ZB1 A;  3UIN C;  2R03 A;  4U8H A;  3CHQ A;  3SO8 A;  4CCA A;  5BUZ A;  3J5P A;  4CRW A;  4L7T A;  2C2L A;  3TWW A;  1QZ2 A;  4HB5 A;  4APO A;  2OEW A;  3EU5 A;  4K5B A;  4DX1 A;  3APC A;  3E4B A;  3FUN A;  4BSX A;  4U04 A;  2PQR A;  2B6C A;  2F37 A;  3AU5 A;  2J08 A;  2H6I A;  3D9K A;  4HS2 A;  1Y8M A;  2KCV A;  3PH0 C;  2ZXW E;  4GTR A;  3FEY A;  1JCS A;  3ULY A;  3CHM A;  5CMW A;  3MV3 B;  4UI9 K;  3KS2 A;  4O60 A;  1BLX B;  5EN5 D;  2XZT G;  1E8W A;  1MQS A;  2V8S E;  2YQ8 A;  4FLH A;  3CKC A;  3CLJ A;  5G2N A;  2AXZ A;  5KJM A;  3TWX A;  2BF0 X;  3AU4 A;  3Q7A A;  1YA0 A;  3Q7F A;  4DX2 A;  3RRU A;  1PY1 A;  3G2V A;  3EHR A;  4K5A B;  2WPV A;  4OYS A;  1NA3 A;  3FU3 A;  1E8Z A;  2WXN A;  3KSL A;  1OUV A;  3UM1 A;  1OWL A;  1MX2 A;  3GW4 A;  4P29 A;  3MYV A;  3B7U X;  2L6J A;  3CQG B;  4WNE A;  2LSV A;  5T3R A;  1BU9 A;  3SZ7 A;  4N3C A;  1JCQ A;  4L9P A;  1LTX A;  4JXT A;  1A5E A;  2ETB A;  3TG5 A;  3J5Q B;  2PNN A;  5B3S E;  5EIL A;  4KVM A;  3NF1 A;  4J0U A;  4BWR A;  3PE4 A;  5JJ6 A;  5LCW J;  1TNO A;  3JYS A;  4J8F A;  3URZ A;  5M72 A;  2X6K A;  3T9K A;  5A7D B;  3ASO E;  2X6I A;  5FJY A;  5AAR A;  2XQ0 A;  1NI1 A;  3QC1 A;  3LEW A;  2DBA A;  3CVX A;  3ZVV A;  2XPI A;  5EX0 A;  4URK A;  2JLB A;  1H6O A;  5FZQ A;  4OAV B;  3CK8 A;  4E85 A;  1S63 A;  4N3B A;  2LXM A;  3C3O A;  3ENE A;  4J8Y A;  3ONL A;  4KZC A;  4HFG A;  4I6G A;  4OAU C;  3AAA C;  4NRH B;  3LJ3 A;  2IO2 C;  5C1D A;  2XEE A;  3VTX A;  3S7D A;  3WXX A;  1Z3X A;  4JW1 A;  4UWH A;  3AJI A;  1D8D A;  3BG1 B;  4J8E A;  2EIK E;  1N95 A;  3AG2 E;  3LVR E;  4WWP A;  3FUD A;  2OVF A;  5CED B;  3D9P A;  4PS3 A;  3B7S A;  4GTP A;  3Q9N C;  1WDY A;  3FTS A;  3R7R A;  2V5Q C;  1K1A A;  3ZFW A;  1XNF A;  3CGH A;  3HRA A;  3UKU G;  3ZW3 A;  3FEX A;  2VJ8 A;  4LSZ E;  3GYZ A;  4BT9 A;  2P9S G;  2Y4T A;  3CVU A;  1FPP A;  4WUY A;  3Q15 A;  4JA7 A;  3LVQ E;  3L82 A;  3VLD A;  3TG4 A;  4DUI A;  2VSO E;  5AAO A;  3B95 A;  5E76 A;  5T8I A;  4IRU A;  3R9A B;  5CEC B;  3ZNG A;  2ZU6 B;  3EIJ A;  4FUL A;  4DX5 D;  3V2O A;  1N52 A;  3EHQ A;  1Z3Y A;  3L16 A;  5LFA A;  4BFR A;  2Y1L E;  1UN8 A;  2FBN A;  4OVV A;  3RRM B;  1WM5 A;  3FH5 A;  1OY3 D;  1Z5S C;  1HFA A;  4GA1 A;  1NZN A;  3QOU A;  3ZU7 B;  2BTD A;  3TXM A;  4Q96 A;  4BX9 A;  3QWP A;  4UI9 C;  3NAW A;  4ILH B;  4U8V D;  5CCM A;  4JL0 A;  3Q4A B;  3TWU A;  5JJ7 A;  3CK9 A;  3UPV A;  5BPP A;  1BI8 B;  3PEV B;  3Q79 A;  2OOE A;  5EKQ D;  3V79 K;  3ZYK A;  4FJZ A;  3VLE A;  1V55 E;  1WAO 1;  3L6A A;  3OXL A;  4LNG A;  3IEG A;  3PZ2 A;  3MGB A;  3FTY A;  3NOC D;  3FFL A;  4AIF A;  4HBD A;  5AEN A;  4WNF A;  4A63 B;  3OAW A;  1EDU A;  4FHJ A;  1WY6 A;  4MKT A;  2VTB A;  3CSF A;  1EF1 C;  4LNB A;  1O1R A;  2WMO A;  4H7Y A;  3MV2 B;  2YHE A;  5FTP A;  1SA4 A;  2ETC A;  2VSY A;  3RRN B;  3JQ0 A;  2WXQ A;  3ZN3 A;  2MYO A;  3SGH A;  4I2Z A;  4CYM D;  3QAR A;  3V2X A;  2HR2 A;  2KM4 A;  2VSN A;  3ML8 A;  2OVB A;  4UWG A;  1K8K G;  2AJA A;  2JEK A;  3RO2 A;  3DWL G;  2ILR A;  3SQV A;  4YDE A;  3UM0 A;  1N94 A;  2A5E A;  3DSV A;  4HNA D;  4MS6 A;  3HXE A;  5DBK A;  5BV1 A;  1O1T A;  1TR4 A;  3D9I A;  4TXP A;  4A1G A;  3LDZ A;  5AQ9 A;  3NZU A;  3SFY A;  1RW2 A;  2IY0 C;  1H6K A;  2AVP A;  2KZT A;  5J08 A;  3MX3 A;  4HOU A;  1SZ9 A;  3CHP A;  4U7E B;  4GCO A;  2ZGD A;  1U3D A;  4JHK A;  1P5Q A;  4K03 A;  2PQN A;  3U4T A;  2P2C P;  3TWR A;  4JHJ A;  2H6F A;  1HZ4 A;  5KJK A;  2R59 A;  3ZKJ A;  4AY6 A;  1Y6I A;  3UKR G;  5G04 C;  5HQ8 A;  3DSW A;  1D8E A;  4B94 A;  3ABL E;  4F1S A;  1X81 A;  1MYO A;  2LO6 A;  3V30 A;  3APD A;  2MRI A;  3AG1 E;  2WXM A;  3UM2 A;  3QJZ A;  1N54 A;  4RSY A;  5AN8 A;  4I1M A;  5ENQ D;  4BT8 A;  2X6J A;  2IEJ A;  3JXJ A;  2V4L A;  1V54 E;  3CVN A;  4I43 A;  3SD5 A;  2YHC A;  1YYH A;  1QNF A;  4EHM A;  2RG8 A;  3CV0 A;  3ML9 A;  4G1T A;  3ZXS A;  2EQX A;  2EIM E;  3MKQ A;  2DYS E;  1IQU A;  3IXE A;  4GYY A;  2VGE A;  2L9B A;  2GRO B;  1PC2 A;  1AWC B;  5JHA A;  5ENP D;  3SBT B;  4GAA A;  3WG7 E;  3RSE G;  1EYH A;  4PDX A;  2M63 A;  4TUM A;  4DK5 A;  1OWO A;  2C0L A;  3G2W A;  3FUH A;  4TUU A;  2WXR A;  2Y3A A;  2XS1 A;  1JCR A;  4UQZ A;  1HU3 A;  3SFZ A;  1LF8 A;  2XCC A;  4C0E A;  4ANV A;  5BNW A;  2P9P G;  3B7T A;  4CGW A;  3JUE A;  1O1S A;  4G8L A;  2J07 A;  3PS6 A;  1E8X A;  2BED A;  4BER A;  3SBS A;  5FWQ A;  1HO8 A;  1D9S A;  1N4S A;  4TRQ A;  5FQ8 A;  3D9N A;  5CRV A;  2WQH A;  3E34 A;  4FC8 A;  2H6G A;  3E32 A;  4UI9 J;  2CG2 A;  2VQ2 A;  3LXU X;  2IJG X;  3EU9 A;  3APF A;  1SVX A;  4ZFH A;  4N2S A;  3PRE A;  3ZGQ A;  4OVU A;  4RG9 A;  1QQE A;  1S0P A;  3FUL A;  4U8Y D;  4Q69 A;  2IU1 A;  3PZD A;  2WXG A;  1E7V A;  5B1B E;  1W3B A;  4DLQ A;  1OWN A;  1N0R A;  3W9F A;  4HOT A;  4CGV A;  4GZC A;  1S64 A;  2A4Z A;  1Z6T A;  2WXL A;  2UY1 B;  4JD2 G;  1KLX A;  2J9Q A;  4GZ6 A;  1NFI E;  5JHB A;  4G11 A;  5EYP F;  5ARF A;  3I4R B;  2XZD G;  4XZ4 A;  2WB2 A;  4AV7 A;  1YCS B;  3QDN A;  4G23 A;  2XCB A;  2VTB B;  4JHR A;  4L23 A;  1TN6 A;  1E8Y A;  5D0O D;  2A5U A;  4J8D A;  2WQ6 A;  5AQ7 A;  2EIN E;  3ZHE A;  2X38 A;  5FZR A;  5KBA A;  4AVX A;  3DPY A;  4L2L A;  3RIB A;  2XEV A;  5EID A;  3KEA A;  3JUI A;  4I17 A;  4U96 D;  4A3T A;  1SW6 A;  2KXP C;  1U3C A;  3RKV A;  2WM9 A;  3MEK A;  4RQI A;  3ZPJ A;  5JA4 D;  3LJN A;  4FAD A;  3L13 A;  4H7X A;  3NBN B;  4XI9 A;  4LRZ A;  4U0Z A;  1OT8 A;  2R2L A;  3ULQ A;  2HM8 A;  5AQA A;  4UQX A;  3ZYM A;  1HE8 A;  5ITZ F;  3PUJ A;  1UN9 A;  3GZ2 A;  4O1O A;  3KEZ A;  4AP2 A;  2LAH A;  4YVQ C;  3R9M A;  3L22 A;  3HYM B;  3MJW A;  3ULE G;  2KZT B;  2KAT A;  4HXI A;  2OV8 A;  4JPS A;  2XGM A;  5KJL A;  4GPM A;  4HRM B;  3UI2 A;  1OCR E;  3U3W A;  4JC8 A;  4I6E A;  2LXL A;  4D10 C;  5AJL A;  4HQD A;  1TEZ A;  4J8S A;  4JA9 A;  2F8Y A;  3U9W A;  5HKP A;  5FQ4 A;  3LY8 A;  3TAX A;  2YNQ A;  2WXK A;  3R7Q A;  4GMR A;  3Q75 A;  5BXO A;  2RFA A;  4AXH A;  2AXV A;  4B8A A;  3LY9 A;  5G05 J;  4FHK A;  4GMJ A;  3C3R A;  3DPD A;  2GRN B;  4YND A;  4AEZ C;  3RAU A;  2J8S D;  4R7L A;  5JJT A;  3FH7 A;  3ISM C;  3HDX A;  2XHE A;  2ZIS A;  4GTO A;  2V4H C;  2KC7 A;  4HOR A;  3FP3 A;  4HI8 A;  1SZA A;  4XE0 A;  4NUR A;  3UM3 A;  4ATZ D;  2NSZ A;  4LNU D;  1DC2 A;  3EHM A;  1IQR A;  1FVF A;  4UWK A;  2GRL A;  3GZ1 A;  3MKQ B;  3T5V A;  1LD8 A;  3SNX A;  3D9L A;  1ZU2 A;  4U63 A;  1K3Z D;  3JXI A;  3EUV A;  3UMV A;  4AJW A;  1IHB A;  4CDN A;  4DX6 D;  3EIQ C;  3FTU A;  1SQM A;  3FHE A;  2PM6 A;  4E6H A;  3LPZ A;  4ILI A;  5LP0 A;  1JWG A;  3F6Q A;  4EZJ A;  4B89 A;  2NYJ A;  3PEU B;  2ION A;  2HYZ A;  3UUX A;  2J4B A;  4L2Y A;  2E2E A;  3NZS A;  1B89 A;  5D2M C;  3E30 A;  3I4G A;  1NP7 A;  3ZIM A;  3FUJ A;  2P9K G;  1BPO A;  3PE3 A;  3SF4 A;  4G8K A;  2UY1 A;  1E96 B;  3EHN A;  5A23 A;  5J90 A;  3SY2 A;  2I6H A;  3TJP A;  3D9J A;  5G55 A;  2QYJ A;  4BTB A;  3RJV A;  3ABM E;  2Y69 E;  3PNT B;  1E7U A;  2NC9 A;  2I1J A;  2VYI A;  4N5Q A;  3FUK A;  2CHX A;  5FIN A;  2VSX E;  3DSX A;  1G3N B;  2JAB A;  4ACK A;  2XGS A;  2I9C A;  2LSU A;  3FUF A;  4ATG A;  5CBN A;  3NB2 A;  2PL2 A;  2WMN A;  4B0Z A;  4PUC A;  2EIL E;  3D3M A;  4CZ2 D;  4HVB A;  3RO3 A;  4PS8 A;  2I2O A;  3CVV A;  2YIN A;  3MCX A;  4U0U A;  5ENO D;  3C72 A;  3CST A;  1UJJ A;  5BW8 C;  1MZC A;  2Y0B G;  4GA2 A;  2R17 C;  4GU5 A;  3ASF A;  3LYA A;  1H2U A;  4MRU A;  2VGX A;  4BY6 A;  2KBX A;  4M7C A;  1TNU A;  3HVE A;  1E90 A;  4DI4 A;  3IBE A;  3ZHE B;  5HRY A;  4ILG A;  4EEC A;  4LCT A;  5LCW C;  5ENN A;  4B93 B;  4AM9 A;  4GB9 A;  2P58 C;  2XRY A;  4LG6 A;  5KNG A;  3D9M A;  2GGF A;  1H6P A;  1NL4 A;  3I5P A;  3FU6 A;  1ZBP A;  3Q73 A;  5FT9 A;  4W9R A;  4GYW A;  3EDT B;  3DXK G;  3PRZ A;  3UIO C;  2IOS A;  5CEA A;  4YDY A;  4DLO A;  2XS8 A;  4F53 A;  3OXG A;  3HXB A;  3S2A A;  5DIZ A;  1O5M A;  2R02 A;  5AJD A;  2AXU A;  4ANW A;  4A3V A;  3NQP A;  1HX8 A;  3E37 A;  2DWZ A;  2XEH A;  1DVP A;  3ZXP A;  5CRU A;  4GML A;  3D9H A;  3UIP C;  2L0I A;  1IHG A;  3B7B A;  4WNG A;  4DI3 A;  1UJK A;  5E75 A;  2L6B A;  3C98 A;  4EQF A;  4I1O B;  1GW6 A;  4F7A A;  5T4Y A;  2XRZ A;  1N4P A;  5HI7 A;  2B0O E;  2OCC E;  2MOW A;  4J7W A;  1TNZ A;  4EZL A;  1MX4 A;  5ENR D;  1RZ4 A;  3NOG D;  5ENS D;  2CFZ A;  5AQB A;  1OXJ A;  1KZP A;  5FQ7 A;  3DST A;  2GRQ B;  2E0I A;  4ACL A;  1JWF A;  2R05 A;  5BXU A;  4O1P A;  3W9G A;  5ANL A;  4F3V A;  2GW1 A;  4ABN A;  3PDN A;  4CDR A;  3SHF A;  1TN7 A;  5D66 A;  2FI7 A;  3DSU A;  3DEO A;  4U07 A;  3FU0 A;  3TXN A;  2QY7 A;  3MZL B;  4BEP A;  2KCL A;  4NAC A;  4EPZ A;  1HF8 A;  4BX8 A;  3D9O A;  4PS7 A;  3ZUV B;  3VTY A;  4JVS A;  4CDM A;  2LAI A;  1N4Q A;  2WXH A;  4GZ3 A;  4G26 A;  3DEP A;  2WXI A;  4I9C A;  4DX7 D;  3LY7 A;  4GTV A;  2DZN A;  4FP7 A;  1ELW A;  3FUI A;  1SA5 A;  4CT4 A;  2Y4U A;  2IO3 C;  4Z68 A;  3U66 A;  4EBA A;  5H7P A;  3PNL B;  4IYP A;  1KZO A;  2X6H A;  3B13 A;  4ANX A;  3FH8 A;  3PZ4 A;  4RG6 A;  2F8X K;  3CQC B;  4NIK A;  3CHS A;  5FIO A;  2KCK A;  4HLE A;  3FUM A;  2IFU A;  3LS8 A;  4J6I A;  3MKR A;  4XKC A;  1NA0 A;  2AW6 A;  5HS0 A;  3QB2 A;  1MX6 A;  2EIJ E;  2XEN A;  2XGO A;  5AYW D;  3JCK C;  3CEQ A;  3HXD A;  1H19 A;  3ZYQ A;  1OWP A;  3AS4 A;  5AIJ A;  3ABK E;  4DPR A;  2FO7 A;  3X2Q E;  3ONK A;  3BG0 B;  4FU3 A;  2XPZ A;  4IUL A;  2P9I G;  3UT4 A;  3L54 A;  3DXM G;  1HH8 A;  3QNK A;  1S70 B;  2BKG A;  4DJA A;  4L1B A;  4XI0 A;  2DIW A;  2DCP A;  5LX8 A;  2Q7F A;  4MLP A;  4BTA A;  4GYO A;  3GZS A;  1OCO E;  4GZ5 A;  1IXV A;  5D0Q D;  4FLB A;  3HIZ A;  4FJY A;  4C0M A;  3CIA A;  2WXJ A;  4TV3 A;  1VDY A;  2CHW A;  4WND A;  3Q47 B;  4U0S A;  3L9T A;  1QYM A;  4O6F A;  3T8M A;  2F0Y A;  2VGX B;  3EJN A;  4G25 A;  4F1P A;  1IKN D;  3HVE B;  5KWD A;  4AOF A;  1HG5 A;  4ME2 A;  4N2Q A;  3SFX A;  1HS6 A;  1H2V C;  3DRA A;  3RU0 A;  4TXR A;  4IN3 B;  4KBQ A;  4GTT A;  1DCE A;  3O48 A;  1OWM A;  4B8C B;  5EX3 A;  4PH4 B;  1FCH A;  3QWV A;  3UT8 A;  2RKK A;  5JMN D;  4A55 A;  4I1A A;  1PAQ A;  2HO1 A;  5CBO A;  4KXK B;  4ANU A;  3QAQ A;  3K9I A;  3ASH A;  3UTM A;  4GTQ A;  4Y6C A;  2C0M A;  1K1B A;  4NQ0 A;  4HI9 A;  3ZYL A;  4M3O A;  5FZS A;  4GTM A;  5G04 J;  3N71 A;  2H6H A;  3B7R L;  3OTN A;  3Q5M A;  3FUE A;  1YMP A;  5CCL A;  4V3I A;  3LCA A;  3BQO A;  4EBA G;  3FTV A;  4WWO A;  1N4R A;  2FEZ A;  3UQ3 A;  4A1S A;  4RVB A;  4GA0 A;  2OEV A;  4K5C A;  3CKB A;  3T8K A;  3TWS A;  3UXG A;  3IHV A;  3TWV A;  2WQ7 A;  1H2T C;  5CHE E;  2LNI A;  3PZ1 A;  3Q9U C;  2DYR E;  3UX4 A;  4QFV A;  2P9U G;  3T5X A;  1MHQ A;  4CEM A;  2DVW A;  3FY4 A;  2WXO A;  4HRN A;  2CFU A;  2NXP A;  4N39 A;  3HG0 D;  2ZGG A;  4HRL A;  4Y6W A;  4CT0 A;  3QKY A;  5KNH D;  2PM7 A;  1WG0 A;  5CER B;  1KT0 A;  3S7J A;  3ASG A;  4F6R D;  1XGW A;  2QC9 A;  4N5C A;  4GZD A;  3UT7 A;  3TGO A;  1DNP A;  3JQ1 A;  4EZK A;  3ESL A;  3VLF A;  4YDW A;  1INZ A;  3SI5 A;  2J49 A;  3E33 A;  2QYU A;  3QK0 A;  1TJF A;  3FTZ A;  2QZA A;  4YVO A;  4I9E A;  5BT1 A;  4XEI G;  4KYO B;  3DSS A;  4XKB A;  3G2T A;  2MHK A;  4WAF A;  3G2U A;  3KSQ A;  3CVW A;  3U64 A;  4Q94 A;  3HXF A;  3Q78 A;  3L17 A;  4LEU A;  4GTS A;  2FO1 E;  3PZ3 A;  4BSZ B;  1DCQ A;  1N11 A;  5IY5 E;  2X6F A;  3G2S A;  5LOZ A;  4GCN A;  3IHY A;  4JEU A;  1X5B A;  1U2V G;  4KT6 B;  2L0T B;  2BKK B;  2WXP A;  3MA5 A;  3L08 A;  3FU5 A;  2PZI A;  4UQY A;  3ASN E;  2GRR B;  4YDO A;  2RFM A;  4KVO A;  3BEE A;  2WVI A;  1TJC A;  2UWJ G;  4I2W A;  1HG2 A;  5C2Y A;  1KT1 A;  4WWN A;  4QQI A;  4C9B B;  5KJN A;  5CMY A;  5BV0 A;  4FA6 A;  1A17 A;  1UW4 B;  3TWT A;  1FT1 A;  4APF A;  1H0A A;  2IOL A;  4XIF A;  3BU8 A;  2I1K A;  1TNB A;  3Q49 B;  1EPU A;  2LUH A;  1LD7 A;  1BI7 B;  2XPY A;  3LKU A;  5ANR A;  3ASD A;  1ELK A;  4KZ0 A;  4DRX E;  1AP7 A;  5EDS A;  3CHR A;  4XX5 A;  4ZHB A;  1HXI A;  3FTX A;  3TWQ A;  5EIB E;  2WXF A;  3OXF A;  2ZIR A;  4U95 D;  4UWL A;  3PVL A;  5B1A E;  4JB8 P;  2J09 A;  4BET A;  1IYG A;  5ARG A;  3QWW A;  1TYQ G;  2VGY A;  4TXQ A;  1Q2Z A;  3HHM A;  4UWF A;  3IKO B;  3I3N A;  4K0R A;  3AS5 A;  2CHZ A;  2QFC A;  1L5J A;  2P9N G;  3RK6 A;  1OCZ E;  1UOH A;  3ZEF A;  2V0P A;  4GPK A;  4UUC A;  2AWI A;  1FT2 A;  3CK7 A;  4JEH A;  2CG3 A;  3FWV A;  2RD0 A;  4HLL A;  3CVY A;  3FTW A;  3S7F A; 
#chains in the Genus database with same CATH homology
 1U2V G;  4JD2 G;  2P9L G;  3RSE G;  2P9N G;  2P9P G;  3UKU G;  2P9K G;  3DXK G;  2P9I G;  3UKR G;  2P9U G;  3DXM G;  3ULE G;  2P9S G;  1TYQ G;  1K8K G;  4XEI G;  3DWL G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...