3DWNA

Crystal structure of the long-chain fatty acid transporter fadl mutant a77e/s100r
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
421
structure length
421
Chain Sequence
b'AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTEWVPNMHFVAPINDQFGWGASITRNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 121
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3dwnA00
1T1LA 2R4OA 1T16A 3BS0A 2R4NA 3PGSA 3DWNA 2R8AA 2R4PA 3BRZA 3PGUA 3PGRA 3BRYA 2R89A 2R88A 3PF1A 2R4LA 3DWOX
chains in the Genus database with same CATH superfamily
4GF4A 2FGRA 6PRNA 2XG6A 1ZHYA 4AZLA 3T24A 3AA0B 2R89A 3AA7B 3A0HO 4FSPA 5PRNA 5E79O 2PORA 4AFKA 7PRNA 3AAEB 2XMXA 1MM4A 3QRAA 2J1NA 2F1TA 3QRCA 2XE1A 4N74A 2MHLA 4AYDC 3V8UA 2WJRA 3SYSA 3SZDA 5AFUL 3LK3A 4GHBA 5FVNA 3C5OA 4O49A 2M06A 3LK2B 4O3ZA 4BUMX 3VZTX 3GP6A 1MPFA 4FZLA 1BXWA 1PHOA 2KDYA 2X9KA 3KVDD 4LSIA 1HXUA 1ZHTA 5DL5A 3TZGA 4F4BA 3UAQA 1QJ8A 4G75A 3LK3B 4FQEA 1H6S1 2Y0LA 3PRNA 4D64A 4KR4A 3LK41 3SYBA 3K19A 4N58A 5B66O 4FT6A 2X27X 4LSHA 5D5DA 2WVPA 4KR8A 2IWVA 4FSOA 4UB8O 3AAAA 1ZHWA 2KZ7A 3EMNX 4E1TA 4O3XB 4O3YA 1GFQA 1T1LA 2ODJA 3WI5A 1THQA 5ADXK 5KAFO 2F1CX 3PQSA 1ZHZA 4RLCA 4AYNA 4D65A 3PF1A 2R4LA 4PR7A 3NJTA 3DWOX 1BH3A 4FMSA 2N2MA 2ZLDA 4FOZA 4G76A 4N59A 4N75A 5G39A 5G3AA 4O4XA 3AAAB 4AKRB 3VY8X 8PRNA 3BRZA 4JCHA 2AXTO 2WJQA 2ZFGA 1QJPA 4LSEA 2J4UP 4C4VA 3FYXA 2K4TA 5G38A 1IZNA 3BS0A 3PGSA 2W80C 2GE4A 4K3BA 3BRYA 4K3CA 2K0LA 2Y7SA 3POQA 3A0BO 2O4VA 4FUVA 4FZMA 3VZUX 4AYMC 3G7GA 3RBHA 3AA1A 3O0EA 1Q9GA 4RL9A 2XTQA 4PUXA 2LHFA 2Y0HA 4AKRA 2KXPA 5EE2A 1IZNB 3AA6A 2QTKA 3POXA 1OSMA 3SY7A 2XE2A 5AFUK 1PRNA 4RJXA 4QQ1A 2M07A 4GCQA 5G26A 5IYUA 5DL6A 1S5LO 5T5FA 3PORA 4LSFA 3VE2A 2XTRA 3AA1B 3HOLA 3HW9A 1GFOA 4GCSA 3WI4A 4C00A 1E54A 3KZIO 4XNLA 3A2SX 3NSGA 3PGRA 2ERVA 4FZNA 1ZHXA 2KXPB 2KZ7B 3VE1A 2R88A 3AA6B 5GTIO 4CTDA 5KAIO 2W81C 3SZVA 4B61A 4AYEC 4GCPA 4AUIA 4D5UA 1HXXA 2PRNA 3LK42 3SY9A 3VY9X 1OPFA 5TISO 2JQYA 3DZMA 2YPVA 3UPGA 1QJ9A 4IL6O 4XNKA 4KRAA 3POUA 5DL7A 4FRTA 5B5EO 5GV0A 4PJ0O 4O4UA 3UU2A 1YS5A 1ORMA 4C4VB 4U9CA 5JDPA 2KC0A 5ADXL 2IWWA 3HOEA 4FRXA 2R4NA 4Z3TA 4C69X 2JMMA 4O3WA 1P4TA 2R4PA 5GTHO 2N2LA 5DL8A 4AKMA 3JCUO 3T20A 4RLBA 2YNKA 4RJWA 1G90A 2R4OA 4FESA 1Q9FA 3WU2O 4AYID 1T16A 2MNHA 1MM5A 2Y2XA 2OMFA 1GFMA 3AA0A 3HWBA 3T0SA 1HXTA 3AA7A 3VZWX 1GFPA 2XE3A 2LFUA 3JTYA 3PQUA 1BT9A 4JFBA 3AAEA 5H2FO 4UB6O 3DWNA 2F1VA 2R8AA 2XE5A 3DA3A 3DA4A 3PGUA 4E1SA 2Y0KA 2FGQX 1GFNA 3LK2A
chains in the Genus database with same CATH topology
1T1LA 2R4OA 1T16A 3BS0A 2R4NA 3PGSA 3DWNA 2R8AA 2R4PA 3BRZA 3PGUA 3PGRA 3BRYA 2R89A 2R88A 3PF1A 2R4LA 3DWOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1L A;  2R4O A;  1T16 A;  3BS0 A;  2R4N A;  3PGS A;  3DWN A;  2R8A A;  2R4P A;  3BRZ A;  3PGU A;  3PGR A;  3BRY A;  2R89 A;  2R88 A;  3PF1 A;  2R4L A;  3DWO X; 
#chains in the Genus database with same CATH topology
 4GF4 A;  2FGR A;  6PRN A;  2XG6 A;  1ZHY A;  4AZL A;  3T24 A;  3AA0 B;  2R89 A;  3AA7 B;  3A0H O;  4FSP A;  5PRN A;  5E79 O;  2POR A;  4AFK A;  7PRN A;  3AAE B;  2XMX A;  1MM4 A;  3QRA A;  2J1N A;  2F1T A;  3QRC A;  2XE1 A;  4N74 A;  2MHL A;  4AYD C;  3V8U A;  2WJR A;  3SYS A;  3SZD A;  5AFU L;  3LK3 A;  4GHB A;  5FVN A;  3C5O A;  4O49 A;  2M06 A;  3LK2 B;  4O3Z A;  4BUM X;  3VZT X;  3GP6 A;  1MPF A;  4FZL A;  1BXW A;  1PHO A;  2KDY A;  2X9K A;  3KVD D;  4LSI A;  1HXU A;  1ZHT A;  5DL5 A;  3TZG A;  4F4B A;  3UAQ A;  1QJ8 A;  4G75 A;  3LK3 B;  4FQE A;  1H6S 1;  2Y0L A;  3PRN A;  4D64 A;  4KR4 A;  3LK4 1;  3SYB A;  3K19 A;  4N58 A;  5B66 O;  4FT6 A;  2X27 X;  4LSH A;  5D5D A;  2WVP A;  4KR8 A;  2IWV A;  4FSO A;  4UB8 O;  3AAA A;  1ZHW A;  2KZ7 A;  3EMN X;  4E1T A;  4O3X B;  4O3Y A;  1GFQ A;  1T1L A;  2ODJ A;  3WI5 A;  1THQ A;  5ADX K;  5KAF O;  2F1C X;  3PQS A;  1ZHZ A;  4RLC A;  4AYN A;  4D65 A;  3PF1 A;  2R4L A;  4PR7 A;  3NJT A;  3DWO X;  1BH3 A;  4FMS A;  2N2M A;  2ZLD A;  4FOZ A;  4G76 A;  4N59 A;  4N75 A;  5G39 A;  5G3A A;  4O4X A;  3AAA B;  4AKR B;  3VY8 X;  8PRN A;  3BRZ A;  4JCH A;  2AXT O;  2WJQ A;  2ZFG A;  1QJP A;  4LSE A;  2J4U P;  4C4V A;  3FYX A;  2K4T A;  5G38 A;  1IZN A;  3BS0 A;  3PGS A;  2W80 C;  2GE4 A;  4K3B A;  3BRY A;  4K3C A;  2K0L A;  2Y7S A;  3POQ A;  3A0B O;  2O4V A;  4FUV A;  4FZM A;  3VZU X;  4AYM C;  3G7G A;  3RBH A;  3AA1 A;  3O0E A;  1Q9G A;  4RL9 A;  2XTQ A;  4PUX A;  2LHF A;  2Y0H A;  4AKR A;  2KXP A;  5EE2 A;  1IZN B;  3AA6 A;  2QTK A;  3POX A;  1OSM A;  3SY7 A;  2XE2 A;  5AFU K;  1PRN A;  4RJX A;  4QQ1 A;  2M07 A;  4GCQ A;  5G26 A;  5IYU A;  5DL6 A;  1S5L O;  5T5F A;  3POR A;  4LSF A;  3VE2 A;  2XTR A;  3AA1 B;  3HOL A;  3HW9 A;  1GFO A;  4GCS A;  3WI4 A;  4C00 A;  1E54 A;  3KZI O;  4XNL A;  3A2S X;  3NSG A;  3PGR A;  2ERV A;  4FZN A;  1ZHX A;  2KXP B;  2KZ7 B;  3VE1 A;  2R88 A;  3AA6 B;  5GTI O;  4CTD A;  5KAI O;  2W81 C;  3SZV A;  4B61 A;  4AYE C;  4GCP A;  4AUI A;  4D5U A;  1HXX A;  2PRN A;  3LK4 2;  3SY9 A;  3VY9 X;  1OPF A;  5TIS O;  2JQY A;  3DZM A;  2YPV A;  3UPG A;  1QJ9 A;  4IL6 O;  4XNK A;  4KRA A;  3POU A;  5DL7 A;  4FRT A;  5B5E O;  5GV0 A;  4PJ0 O;  4O4U A;  3UU2 A;  1YS5 A;  1ORM A;  4C4V B;  4U9C A;  5JDP A;  2KC0 A;  5ADX L;  2IWW A;  3HOE A;  4FRX A;  2R4N A;  4Z3T A;  4C69 X;  2JMM A;  4O3W A;  1P4T A;  2R4P A;  5GTH O;  2N2L A;  5DL8 A;  4AKM A;  3JCU O;  3T20 A;  4RLB A;  2YNK A;  4RJW A;  1G90 A;  2R4O A;  4FES A;  1Q9F A;  3WU2 O;  4AYI D;  1T16 A;  2MNH A;  1MM5 A;  2Y2X A;  2OMF A;  1GFM A;  3AA0 A;  3HWB A;  3T0S A;  1HXT A;  3AA7 A;  3VZW X;  1GFP A;  2XE3 A;  2LFU A;  3JTY A;  3PQU A;  1BT9 A;  4JFB A;  3AAE A;  5H2F O;  4UB6 O;  3DWN A;  2F1V A;  2R8A A;  2XE5 A;  3DA3 A;  3DA4 A;  3PGU A;  4E1S A;  2Y0K A;  2FGQ X;  1GFN A;  3LK2 A; 
#chains in the Genus database with same CATH homology
 1T1L A;  2R4O A;  1T16 A;  3BS0 A;  2R4N A;  3PGS A;  3DWN A;  2R8A A;  2R4P A;  3BRZ A;  3PGU A;  3PGR A;  3BRY A;  2R89 A;  2R88 A;  3PF1 A;  2R4L A;  3DWO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...