3DWNA

Crystal structure of the long-chain fatty acid transporter fadl mutant a77e/s100r
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
421
structure length
421
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTEWVPNMHFVAPINDQFGWGASITRNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 121
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3dwnA00
3DWNA 3PGRA 2R4NA 1T1LA 3BS0A 3PGSA 2R4PA 2R89A 3BRZA 3PGUA 2R4LA 2R4OA 2R8AA 3DWOX 3BRYA 1T16A 2R88A 3PF1A
chains in the Genus database with same CATH superfamily
3DWNA 5KAFO 5ADXK 2LFUA 2Y7SA 2ZFGA 4XNLA 3UU2A 2XG6A 4FZLA 2ODJA 2F1TA 3AAAB 4FZMA 5G38A 5GTIO 3AAEA 4PUXA 5G26A 4O4UA 2Y2XA 3UAQA 3A2SX 3FYXA 3NSGA 5GTHO 2ZLDA 5JDPA 5DL5A 2XTQA 1G90A 3PRNA 1ZHZA 3PQUA 2XMXA 3DWOX 4PJ0O 5TISO 4E1SA 2O4VA 1OPFA 2OMFA 1QJ9A 1OSMA 4O4XA 2IWWA 2AXTO 3AA1A 1Q9GA 1IZNA 3T0SA 2XE5A 3POQA 1GFOA 2N2MA 4JCHA 3GP6A 3LK41 4JFBA 4LSEA 5E79O 1ZHYA 2XTRA 4AYDC 4IL6O 2R4NA 3BS0A 3DZMA 1MM5A 5T5FA 3QRAA 5DL8A 4AYID 4UB6O 1ZHTA 5B5EO 2J4UP 2R4OA 2GE4A 4KRAA 1S5LO 2W81C 4FSOA 3V8UA 3VZTX 2WJRA 4Z3TA 5GV0A 2MNHA 3C5OA 4LSIA 4C4VB 1GFQA 3LK2B 3PGSA 4LSHA 3AA1B 4AFKA 5AFUK 1GFPA 1HXXA 8PRNA 4KR8A 5IYUA 2J1NA 2KZ7B 4AKRA 4FOZA 4FMSA 2YNKA 1THQA 4AYEC 4E1TA 2KXPB 2MHLA 3PQSA 3VZWX 2PRNA 2KDYA 4GCQA 5PRNA 3AA0B 1T16A 4BUMX 2R89A 2K0LA 3DA4A 1HXUA 1BXWA 3HOEA 3JCUO 4FUVA 1YS5A 4N74A 3KVDD 1MM4A 3LK3A 4U9CA 5DL6A 3T24A 3TZGA 3POXA 4XNKA 4B61A 4LSFA 2WVPA 1MPFA 3AAEB 5FVNA 4FRTA 3VE2A 4C00A 5ADXL 5D5DA 3EMNX 2XE1A 3PF1A 4G75A 1GFMA 4FSPA 3WU2O 4RLCA 2FGRA 2W80C 3RBHA 4GHBA 2X9KA 4FQEA 3SZVA 3JTYA 3AA6A 1IZNB 1P4TA 2F1CX 3A0HO 3POUA 4K3CA 4O3XB 3VZUX 1BH3A 3DA3A 1T1LA 1GFNA 4RL9A 2QTKA 3T20A 4UB8O 2M07A 2F1VA 3UPGA 1E54A 1H6S1 4G76A 2K4TA 3VE1A 4C69X 1HXTA 3AAAA 4F4BA 5EE2A 3SYBA 3BRZA 1Q9FA 4O49A 3SY7A 3SYSA 4D65A 3BRYA 4AZLA 1ZHXA 4KR4A 6PRNA 4FESA 3WI4A 3AA7A 3SY9A 2N2LA 4AKRB 3PORA 4PR7A 3WI5A 4FZNA 3PGUA 3LK42 5AFUL 3HWBA 2ERVA 3A0BO 3G7GA 2JMMA 4CTDA 4AUIA 4AYNA 4D5UA 4QQ1A 2Y0KA 4K3BA 2R4PA 3NJTA 4O3ZA 4N75A 3O0EA 4RLBA 2X27X 4RJXA 1ORMA 7PRNA 4GF4A 3HOLA 3KZIO 2XE3A 3LK3B 3PGRA 5G3AA 3VY9X 2PORA 2WJQA 3AA7B 4N58A 2JQYA 2R4LA 2R8AA 1QJPA 1ZHWA 4C4VA 4D64A 2LHFA 3LK2A 4FRXA 2R88A 2Y0HA 5B66O 4O3YA 2IWVA 2FGQX 4AKMA 2KZ7A 1QJ8A 5DL7A 2KXPA 2XE2A 3K19A 2KC0A 5G39A 1BT9A 1PHOA 3AA6B 1PRNA 4FT6A 2Y0LA 3AA0A 4GCPA 4AYMC 2M06A 5KAIO 4GCSA 3HW9A 4O3WA 2YPVA 3VY8X 4RJWA 4N59A 5H2FO 3SZDA 3QRCA
chains in the Genus database with same CATH topology
3DWNA 3PGRA 2R4NA 1T1LA 3BS0A 3PGSA 2R4PA 2R89A 3BRZA 3PGUA 2R4LA 2R4OA 2R8AA 3DWOX 3BRYA 1T16A 2R88A 3PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWN A;  3PGR A;  2R4N A;  1T1L A;  3BS0 A;  3PGS A;  2R4P A;  2R89 A;  3BRZ A;  3PGU A;  2R4L A;  2R4O A;  2R8A A;  3DWO X;  3BRY A;  1T16 A;  2R88 A;  3PF1 A; 
#chains in the Genus database with same CATH topology
 3DWN A;  5KAF O;  5ADX K;  2LFU A;  2Y7S A;  2ZFG A;  4XNL A;  3UU2 A;  2XG6 A;  4FZL A;  2ODJ A;  2F1T A;  3AAA B;  4FZM A;  5G38 A;  5GTI O;  3AAE A;  4PUX A;  5G26 A;  4O4U A;  2Y2X A;  3UAQ A;  3A2S X;  3FYX A;  3NSG A;  5GTH O;  2ZLD A;  5JDP A;  5DL5 A;  2XTQ A;  1G90 A;  3PRN A;  1ZHZ A;  3PQU A;  2XMX A;  3DWO X;  4PJ0 O;  5TIS O;  4E1S A;  2O4V A;  1OPF A;  2OMF A;  1QJ9 A;  1OSM A;  4O4X A;  2IWW A;  2AXT O;  3AA1 A;  1Q9G A;  1IZN A;  3T0S A;  2XE5 A;  3POQ A;  1GFO A;  2N2M A;  4JCH A;  3GP6 A;  3LK4 1;  4JFB A;  4LSE A;  5E79 O;  1ZHY A;  2XTR A;  4AYD C;  4IL6 O;  2R4N A;  3BS0 A;  3DZM A;  1MM5 A;  5T5F A;  3QRA A;  5DL8 A;  4AYI D;  4UB6 O;  1ZHT A;  5B5E O;  2J4U P;  2R4O A;  2GE4 A;  4KRA A;  1S5L O;  2W81 C;  4FSO A;  3V8U A;  3VZT X;  2WJR A;  4Z3T A;  5GV0 A;  2MNH A;  3C5O A;  4LSI A;  4C4V B;  1GFQ A;  3LK2 B;  3PGS A;  4LSH A;  3AA1 B;  4AFK A;  5AFU K;  1GFP A;  1HXX A;  8PRN A;  4KR8 A;  5IYU A;  2J1N A;  2KZ7 B;  4AKR A;  4FOZ A;  4FMS A;  2YNK A;  1THQ A;  4AYE C;  4E1T A;  2KXP B;  2MHL A;  3PQS A;  3VZW X;  2PRN A;  2KDY A;  4GCQ A;  5PRN A;  3AA0 B;  1T16 A;  4BUM X;  2R89 A;  2K0L A;  3DA4 A;  1HXU A;  1BXW A;  3HOE A;  3JCU O;  4FUV A;  1YS5 A;  4N74 A;  3KVD D;  1MM4 A;  3LK3 A;  4U9C A;  5DL6 A;  3T24 A;  3TZG A;  3POX A;  4XNK A;  4B61 A;  4LSF A;  2WVP A;  1MPF A;  3AAE B;  5FVN A;  4FRT A;  3VE2 A;  4C00 A;  5ADX L;  5D5D A;  3EMN X;  2XE1 A;  3PF1 A;  4G75 A;  1GFM A;  4FSP A;  3WU2 O;  4RLC A;  2FGR A;  2W80 C;  3RBH A;  4GHB A;  2X9K A;  4FQE A;  3SZV A;  3JTY A;  3AA6 A;  1IZN B;  1P4T A;  2F1C X;  3A0H O;  3POU A;  4K3C A;  4O3X B;  3VZU X;  1BH3 A;  3DA3 A;  1T1L A;  1GFN A;  4RL9 A;  2QTK A;  3T20 A;  4UB8 O;  2M07 A;  2F1V A;  3UPG A;  1E54 A;  1H6S 1;  4G76 A;  2K4T A;  3VE1 A;  4C69 X;  1HXT A;  3AAA A;  4F4B A;  5EE2 A;  3SYB A;  3BRZ A;  1Q9F A;  4O49 A;  3SY7 A;  3SYS A;  4D65 A;  3BRY A;  4AZL A;  1ZHX A;  4KR4 A;  6PRN A;  4FES A;  3WI4 A;  3AA7 A;  3SY9 A;  2N2L A;  4AKR B;  3POR A;  4PR7 A;  3WI5 A;  4FZN A;  3PGU A;  3LK4 2;  5AFU L;  3HWB A;  2ERV A;  3A0B O;  3G7G A;  2JMM A;  4CTD A;  4AUI A;  4AYN A;  4D5U A;  4QQ1 A;  2Y0K A;  4K3B A;  2R4P A;  3NJT A;  4O3Z A;  4N75 A;  3O0E A;  4RLB A;  2X27 X;  4RJX A;  1ORM A;  7PRN A;  4GF4 A;  3HOL A;  3KZI O;  2XE3 A;  3LK3 B;  3PGR A;  5G3A A;  3VY9 X;  2POR A;  2WJQ A;  3AA7 B;  4N58 A;  2JQY A;  2R4L A;  2R8A A;  1QJP A;  1ZHW A;  4C4V A;  4D64 A;  2LHF A;  3LK2 A;  4FRX A;  2R88 A;  2Y0H A;  5B66 O;  4O3Y A;  2IWV A;  2FGQ X;  4AKM A;  2KZ7 A;  1QJ8 A;  5DL7 A;  2KXP A;  2XE2 A;  3K19 A;  2KC0 A;  5G39 A;  1BT9 A;  1PHO A;  3AA6 B;  1PRN A;  4FT6 A;  2Y0L A;  3AA0 A;  4GCP A;  4AYM C;  2M06 A;  5KAI O;  4GCS A;  3HW9 A;  4O3W A;  2YPV A;  3VY8 X;  4RJW A;  4N59 A;  5H2F O;  3SZD A;  3QRC A; 
#chains in the Genus database with same CATH homology
 3DWN A;  3PGR A;  2R4N A;  1T1L A;  3BS0 A;  3PGS A;  2R4P A;  2R89 A;  3BRZ A;  3PGU A;  2R4L A;  2R4O A;  2R8A A;  3DWO X;  3BRY A;  1T16 A;  2R88 A;  3PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...