3DWOX

Crystal structure of a pseudomonas aeruginosa fadl homologue
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
444
structure length
444
Chain Sequence
b'AGFMVPTTNTAGWGRAMAGGSLFPNDPSAAFNNPAAMAFIDKRIAQLTVNYADIDIKYNGDAYDYQGNPMTGGYQDGPGTPELGTNDGGQAGFGAWLPTGFLVVPINDRFAFGLSQVVPMGMRSTWDPNWKGRDFAVDTKIETIGLTGSLSFKVNDNFSLGAGVIIQRTSGFVSQNLDLYASAANSPGMGGIPFPASNSSALMRVKVDNTSPGFFAGAVWKPTDRDTLGFAYHAKIRNKLKGHYNLYDHDGGLTEGAIEGGTPGLAYPGLDLRMGASASARLDIPAYASLDWVHQFNDRLSLGASATWTEWSSFQDLTLKSHGNTIVSIPYTYRNTWTLAVGGDYKVTDQWTMRAGVAYDQTPTHNATRDPRIPDGDRYFASLGAGYRFQSMPELSIDAAYSRQFVKEVPLKTVNQDRLGGGRLDGRATSKGQVFSLSATYDFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable outer membrane protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 123
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3dwoX00
3DWOX 3BRYA 2R4PA 2R89A 2R4NA 2R88A 3BS0A 3DWNA 3BRZA 3PGUA 3PF1A 3PGSA 2R4LA 2R8AA 1T1LA 3PGRA 2R4OA 1T16A
chains in the Genus database with same CATH superfamily
3DWOX 2ODJA 4FOZA 4LSHA 3T0SA 3HOLA 4GF4A 4QQ1A 3LK2B 1E54A 2XG6A 2ZFGA 3KVDD 4IL6O 3VZUX 1MM4A 1ZHTA 2XE1A 4FMSA 3HOEA 1MPFA 3A0HO 4N74A 3AA7B 1HXTA 4O3XB 3AAAA 4FZNA 2YPVA 4UB6O 4JFBA 3C5OA 3UPGA 1QJ8A 4PJ0O 5KAFO 2LFUA 3SZVA 3TZGA 4E1TA 3DZMA 2IWVA 4O4XA 3WI4A 4GCSA 4XNLA 2W81C 3HWBA 4KR4A 2LHFA 1ZHXA 2R4OA 4FZMA 4LSEA 1QJ9A 3LK42 3LK3B 4XNKA 2Y0KA 4O3WA 1BXWA 2XE2A 4GCPA 4AFKA 4PUXA 3AA6B 4AKRA 2N2LA 4Z3TA 2KXPB 5T5FA 2JMMA 4JCHA 4C4VB 4AYID 1S5LO 3PGUA 3PQUA 1GFOA 4FT6A 4U9CA 2WVPA 3WI5A 4LSFA 2PORA 2XTQA 4RL9A 4LSIA 5DL6A 5GTHO 3VE1A 2MHLA 2KC0A 2X9KA 4B61A 4RLCA 1BT9A 3G7GA 5G39A 3T20A 1GFQA 2WJQA 3PGRA 5ADXL 3GP6A 3SYBA 3PQSA 5H2FO 5B66O 3POXA 3V8UA 2PRNA 2Y2XA 2Y7SA 3QRCA 1GFMA 2FGQX 3DA4A 4FUVA 4N59A 3EMNX 1YS5A 4FSOA 4AUIA 8PRNA 4FESA 4F4BA 1MM5A 4O3YA 4C00A 1Q9GA 4G75A 4C69X 4AYDC 4UB8O 3UAQA 1PHOA 2FGRA 2K0LA 4KRAA 3VY9X 2YNKA 4RJWA 5E79O 4AKRB 1THQA 5FVNA 2M06A 3SY7A 5DL5A 5GTIO 2OMFA 3PF1A 5G3AA 3AAEA 1ORMA 4GHBA 4O49A 3AA0B 2J4UP 1HXUA 5AFUL 3JTYA 4AYMC 3AA1A 3K19A 2R4NA 4D5UA 2XE3A 3LK2A 5GV0A 1BH3A 2Y0HA 3WU2O 4AZLA 1H6S1 2F1TA 3AA7A 2WJRA 3AAAB 3FYXA 3NSGA 1OSMA 4AKMA 2GE4A 3O0EA 2ZLDA 3UU2A 3VZTX 4KR8A 5IYUA 4K3CA 3DA3A 3PORA 4G76A 3A0BO 4K3BA 3SZDA 4D65A 1G90A 4FZLA 3A2SX 2AXTO 1PRNA 2R88A 2W80C 4FSPA 3VZWX 4N58A 5KAIO 3KZIO 4RJXA 2XE5A 5DL8A 1IZNA 3NJTA 3VY8X 2R8AA 3PRNA 5G38A 5AFUK 4E1SA 2R4PA 3JCUO 2F1VA 2JQYA 2KZ7A 2O4VA 3AAEB 3HW9A 3PGSA 5JDPA 5G26A 2X27X 2XTRA 4O4UA 3AA1B 4RLBA 3SY9A 2ERVA 5D5DA 1Q9FA 3RBHA 7PRNA 1P4TA 4AYEC 4BUMX 5PRNA 2F1CX 2Y0LA 3T24A 2IWWA 1HXXA 2R89A 2K4TA 4GCQA 4PR7A 4D64A 2KDYA 1ZHYA 5B5EO 2R4LA 1T1LA 2M07A 2N2MA 4FRXA 1GFPA 3POUA 1T16A 4FQEA 3VE2A 1ZHWA 3LK41 3POQA 3BS0A 1QJPA 5TISO 5EE2A 1IZNB 3LK3A 2MNHA 5DL7A 4AYNA 2QTKA 4FRTA 4N75A 1GFNA 2XMXA 1OPFA 6PRNA 2J1NA 3AA6A 2KZ7B 4CTDA 2KXPA 3QRAA 3DWNA 3BRZA 1ZHZA 4C4VA 3SYSA 5ADXK 3AA0A 3BRYA 4O3ZA
chains in the Genus database with same CATH topology
3DWOX 3BRYA 2R4PA 2R89A 2R4NA 2R88A 3BS0A 3DWNA 3BRZA 3PGUA 3PF1A 3PGSA 2R4LA 2R8AA 1T1LA 3PGRA 2R4OA 1T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWO X;  3BRY A;  2R4P A;  2R89 A;  2R4N A;  2R88 A;  3BS0 A;  3DWN A;  3BRZ A;  3PGU A;  3PF1 A;  3PGS A;  2R4L A;  2R8A A;  1T1L A;  3PGR A;  2R4O A;  1T16 A; 
#chains in the Genus database with same CATH topology
 3DWO X;  2ODJ A;  4FOZ A;  4LSH A;  3T0S A;  3HOL A;  4GF4 A;  4QQ1 A;  3LK2 B;  1E54 A;  2XG6 A;  2ZFG A;  3KVD D;  4IL6 O;  3VZU X;  1MM4 A;  1ZHT A;  2XE1 A;  4FMS A;  3HOE A;  1MPF A;  3A0H O;  4N74 A;  3AA7 B;  1HXT A;  4O3X B;  3AAA A;  4FZN A;  2YPV A;  4UB6 O;  4JFB A;  3C5O A;  3UPG A;  1QJ8 A;  4PJ0 O;  5KAF O;  2LFU A;  3SZV A;  3TZG A;  4E1T A;  3DZM A;  2IWV A;  4O4X A;  3WI4 A;  4GCS A;  4XNL A;  2W81 C;  3HWB A;  4KR4 A;  2LHF A;  1ZHX A;  2R4O A;  4FZM A;  4LSE A;  1QJ9 A;  3LK4 2;  3LK3 B;  4XNK A;  2Y0K A;  4O3W A;  1BXW A;  2XE2 A;  4GCP A;  4AFK A;  4PUX A;  3AA6 B;  4AKR A;  2N2L A;  4Z3T A;  2KXP B;  5T5F A;  2JMM A;  4JCH A;  4C4V B;  4AYI D;  1S5L O;  3PGU A;  3PQU A;  1GFO A;  4FT6 A;  4U9C A;  2WVP A;  3WI5 A;  4LSF A;  2POR A;  2XTQ A;  4RL9 A;  4LSI A;  5DL6 A;  5GTH O;  3VE1 A;  2MHL A;  2KC0 A;  2X9K A;  4B61 A;  4RLC A;  1BT9 A;  3G7G A;  5G39 A;  3T20 A;  1GFQ A;  2WJQ A;  3PGR A;  5ADX L;  3GP6 A;  3SYB A;  3PQS A;  5H2F O;  5B66 O;  3POX A;  3V8U A;  2PRN A;  2Y2X A;  2Y7S A;  3QRC A;  1GFM A;  2FGQ X;  3DA4 A;  4FUV A;  4N59 A;  3EMN X;  1YS5 A;  4FSO A;  4AUI A;  8PRN A;  4FES A;  4F4B A;  1MM5 A;  4O3Y A;  4C00 A;  1Q9G A;  4G75 A;  4C69 X;  4AYD C;  4UB8 O;  3UAQ A;  1PHO A;  2FGR A;  2K0L A;  4KRA A;  3VY9 X;  2YNK A;  4RJW A;  5E79 O;  4AKR B;  1THQ A;  5FVN A;  2M06 A;  3SY7 A;  5DL5 A;  5GTI O;  2OMF A;  3PF1 A;  5G3A A;  3AAE A;  1ORM A;  4GHB A;  4O49 A;  3AA0 B;  2J4U P;  1HXU A;  5AFU L;  3JTY A;  4AYM C;  3AA1 A;  3K19 A;  2R4N A;  4D5U A;  2XE3 A;  3LK2 A;  5GV0 A;  1BH3 A;  2Y0H A;  3WU2 O;  4AZL A;  1H6S 1;  2F1T A;  3AA7 A;  2WJR A;  3AAA B;  3FYX A;  3NSG A;  1OSM A;  4AKM A;  2GE4 A;  3O0E A;  2ZLD A;  3UU2 A;  3VZT X;  4KR8 A;  5IYU A;  4K3C A;  3DA3 A;  3POR A;  4G76 A;  3A0B O;  4K3B A;  3SZD A;  4D65 A;  1G90 A;  4FZL A;  3A2S X;  2AXT O;  1PRN A;  2R88 A;  2W80 C;  4FSP A;  3VZW X;  4N58 A;  5KAI O;  3KZI O;  4RJX A;  2XE5 A;  5DL8 A;  1IZN A;  3NJT A;  3VY8 X;  2R8A A;  3PRN A;  5G38 A;  5AFU K;  4E1S A;  2R4P A;  3JCU O;  2F1V A;  2JQY A;  2KZ7 A;  2O4V A;  3AAE B;  3HW9 A;  3PGS A;  5JDP A;  5G26 A;  2X27 X;  2XTR A;  4O4U A;  3AA1 B;  4RLB A;  3SY9 A;  2ERV A;  5D5D A;  1Q9F A;  3RBH A;  7PRN A;  1P4T A;  4AYE C;  4BUM X;  5PRN A;  2F1C X;  2Y0L A;  3T24 A;  2IWW A;  1HXX A;  2R89 A;  2K4T A;  4GCQ A;  4PR7 A;  4D64 A;  2KDY A;  1ZHY A;  5B5E O;  2R4L A;  1T1L A;  2M07 A;  2N2M A;  4FRX A;  1GFP A;  3POU A;  1T16 A;  4FQE A;  3VE2 A;  1ZHW A;  3LK4 1;  3POQ A;  3BS0 A;  1QJP A;  5TIS O;  5EE2 A;  1IZN B;  3LK3 A;  2MNH A;  5DL7 A;  4AYN A;  2QTK A;  4FRT A;  4N75 A;  1GFN A;  2XMX A;  1OPF A;  6PRN A;  2J1N A;  3AA6 A;  2KZ7 B;  4CTD A;  2KXP A;  3QRA A;  3DWN A;  3BRZ A;  1ZHZ A;  4C4V A;  3SYS A;  5ADX K;  3AA0 A;  3BRY A;  4O3Z A; 
#chains in the Genus database with same CATH homology
 3DWO X;  3BRY A;  2R4P A;  2R89 A;  2R4N A;  2R88 A;  3BS0 A;  3DWN A;  3BRZ A;  3PGU A;  3PF1 A;  3PGS A;  2R4L A;  2R8A A;  1T1L A;  3PGR A;  2R4O A;  1T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...