3DWOX

Crystal structure of a pseudomonas aeruginosa fadl homologue
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
444
structure length
444
Chain Sequence
AGFMVPTTNTAGWGRAMAGGSLFPNDPSAAFNNPAAMAFIDKRIAQLTVNYADIDIKYNGDAYDYQGNPMTGGYQDGPGTPELGTNDGGQAGFGAWLPTGFLVVPINDRFAFGLSQVVPMGMRSTWDPNWKGRDFAVDTKIETIGLTGSLSFKVNDNFSLGAGVIIQRTSGFVSQNLDLYASAANSPGMGGIPFPASNSSALMRVKVDNTSPGFFAGAVWKPTDRDTLGFAYHAKIRNKLKGHYNLYDHDGGLTEGAIEGGTPGLAYPGLDLRMGASASARLDIPAYASLDWVHQFNDRLSLGASATWTEWSSFQDLTLKSHGNTIVSIPYTYRNTWTLAVGGDYKVTDQWTMRAGVAYDQTPTHNATRDPRIPDGDRYFASLGAGYRFQSMPELSIDAAYSRQFVKEVPLKTVNQDRLGGGRLDGRATSKGQVFSLSATYDFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable outer membrane protein
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 123
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3dwoX00
3PGUA 3BS0A 3DWOX 1T1LA 3DWNA 3BRZA 3BRYA 3PF1A 3PGSA 2R4NA 2R4OA 2R8AA 2R88A 2R4LA 1T16A 3PGRA 2R4PA 2R89A
chains in the Genus database with same CATH superfamily
4AUIA 4LSIA 2JMMA 2XTRA 4G75A 4UB8O 4AKMA 5H2FO 1ZHXA 2ERVA 4C4VB 4GCSA 4KR4A 3AA1B 3LK3A 3AAEB 3A0BO 3PGRA 4FRTA 1ZHTA 2O4VA 2KZ7A 2KDYA 1BT9A 2Y7SA 3LK2B 3SY9A 4N75A 3VY8X 4XNLA 3AA6B 3FYXA 3SZVA 1GFQA 3NJTA 4K3BA 2PRNA 3PQSA 1HXXA 5E79O 3SYBA 5D5DA 3BS0A 4AFKA 4O4XA 4PUXA 5DL7A 2ZFGA 4AZLA 2XMXA 3NSGA 1THQA 3A0HO 4U9CA 4E1TA 4F4BA 4FQEA 1T1LA 2K4TA 5G39A 2XG6A 1ORMA 2R4NA 3AAAB 1MM4A 4GCPA 3AA7B 1T16A 4BUMX 5ADXL 4RJWA 4RL9A 1G90A 1MM5A 1GFPA 2X27X 1HXTA 3DA4A 4FMSA 4FESA 3AA0A 5G3AA 3SY7A 3T0SA 3T24A 2IWVA 1Q9GA 2KC0A 2YPVA 3C5OA 2R4PA 3JCUO 2KXPB 3VE1A 3PGUA 4B61A 4GF4A 4D5UA 4Z3TA 2FGRA 3WU2O 4GHBA 4RLBA 3K19A 5B5EO 2R8AA 3DWNA 3LK41 3TZGA 1PHOA 4FUVA 3LK3B 4CTDA 4UB6O 3GP6A 4PJ0O 2J4UP 3G7GA 2WJRA 4FZNA 5DL6A 1PRNA 5GV0A 4N74A 1OSMA 1E54A 2N2LA 3A2SX 2XE1A 2XE5A 3HW9A 3PRNA 4AYDC 4O3XB 4LSFA 5AFUL 5IYUA 4AKRA 2M06A 2W81C 4KR8A 3PORA 5ADXK 4JCHA 3WI4A 3BRZA 2N2MA 2MHLA 4C69X 3PGSA 1YS5A 2JQYA 2Y0LA 4K3CA 4LSEA 3RBHA 2FGQX 3WI5A 2R89A 2Y0KA 8PRNA 2W80C 3LK42 1IZNA 1GFMA 1QJ9A 2LFUA 3JTYA 4FRXA 4RJXA 3KVDD 5FVNA 1Q9FA 2WJQA 2AXTO 3AA0B 2PORA 2ODJA 3PF1A 4FSOA 4IL6O 4AYEC 2MNHA 2KZ7B 3UAQA 4PR7A 5EE2A 4AYID 2F1CX 1HXUA 5T5FA 4O3ZA 4C4VA 3DWOX 1GFNA 2Y0HA 1S5LO 3AA1A 2X9KA 3BRYA 1P4TA 3AAEA 3HWBA 4LSHA 4XNKA 4C00A 4AYNA 1ZHZA 3LK2A 4FT6A 5DL8A 3V8UA 2GE4A 3AA6A 3HOLA 3DA3A 3POUA 3VZTX 3POQA 2M07A 3DZMA 3QRCA 4FZLA 1GFOA 4O3YA 4E1SA 3UPGA 7PRNA 2R4OA 4N59A 1H6S1 3VZUX 2WVPA 4FSPA 2R88A 5DL5A 3UU2A 2OMFA 2LHFA 1ZHYA 4FOZA 4FZMA 4O4UA 5KAIO 4AKRB 4O49A 4D64A 3O0EA 1QJ8A 2F1VA 1BXWA 2K0LA 3HOEA 2IWWA 5AFUK 5TISO 5KAFO 4O3WA 5G26A 3VZWX 4AYMC 2XE2A 2QTKA 1OPFA 2J1NA 3AAAA 4G76A 2XTQA 5GTIO 5PRNA 4GCQA 3VY9X 5GTHO 3AA7A 3QRAA 2F1TA 5G38A 3SZDA 2YNKA 1IZNB 3POXA 3SYSA 1ZHWA 3VE2A 4JFBA 4N58A 5B66O 1QJPA 4RLCA 2XE3A 2Y2XA 1MPFA 3PQUA 5JDPA 4QQ1A 3EMNX 2KXPA 3T20A 6PRNA 4KRAA 3KZIO 2ZLDA 2R4LA 4D65A 1BH3A
chains in the Genus database with same CATH topology
3PGUA 3BS0A 3DWOX 1T1LA 3DWNA 3BRZA 3BRYA 3PF1A 3PGSA 2R4NA 2R4OA 2R8AA 2R88A 2R4LA 1T16A 3PGRA 2R4PA 2R89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGU A;  3BS0 A;  3DWO X;  1T1L A;  3DWN A;  3BRZ A;  3BRY A;  3PF1 A;  3PGS A;  2R4N A;  2R4O A;  2R8A A;  2R88 A;  2R4L A;  1T16 A;  3PGR A;  2R4P A;  2R89 A; 
#chains in the Genus database with same CATH topology
 4AUI A;  4LSI A;  2JMM A;  2XTR A;  4G75 A;  4UB8 O;  4AKM A;  5H2F O;  1ZHX A;  2ERV A;  4C4V B;  4GCS A;  4KR4 A;  3AA1 B;  3LK3 A;  3AAE B;  3A0B O;  3PGR A;  4FRT A;  1ZHT A;  2O4V A;  2KZ7 A;  2KDY A;  1BT9 A;  2Y7S A;  3LK2 B;  3SY9 A;  4N75 A;  3VY8 X;  4XNL A;  3AA6 B;  3FYX A;  3SZV A;  1GFQ A;  3NJT A;  4K3B A;  2PRN A;  3PQS A;  1HXX A;  5E79 O;  3SYB A;  5D5D A;  3BS0 A;  4AFK A;  4O4X A;  4PUX A;  5DL7 A;  2ZFG A;  4AZL A;  2XMX A;  3NSG A;  1THQ A;  3A0H O;  4U9C A;  4E1T A;  4F4B A;  4FQE A;  1T1L A;  2K4T A;  5G39 A;  2XG6 A;  1ORM A;  2R4N A;  3AAA B;  1MM4 A;  4GCP A;  3AA7 B;  1T16 A;  4BUM X;  5ADX L;  4RJW A;  4RL9 A;  1G90 A;  1MM5 A;  1GFP A;  2X27 X;  1HXT A;  3DA4 A;  4FMS A;  4FES A;  3AA0 A;  5G3A A;  3SY7 A;  3T0S A;  3T24 A;  2IWV A;  1Q9G A;  2KC0 A;  2YPV A;  3C5O A;  2R4P A;  3JCU O;  2KXP B;  3VE1 A;  3PGU A;  4B61 A;  4GF4 A;  4D5U A;  4Z3T A;  2FGR A;  3WU2 O;  4GHB A;  4RLB A;  3K19 A;  5B5E O;  2R8A A;  3DWN A;  3LK4 1;  3TZG A;  1PHO A;  4FUV A;  3LK3 B;  4CTD A;  4UB6 O;  3GP6 A;  4PJ0 O;  2J4U P;  3G7G A;  2WJR A;  4FZN A;  5DL6 A;  1PRN A;  5GV0 A;  4N74 A;  1OSM A;  1E54 A;  2N2L A;  3A2S X;  2XE1 A;  2XE5 A;  3HW9 A;  3PRN A;  4AYD C;  4O3X B;  4LSF A;  5AFU L;  5IYU A;  4AKR A;  2M06 A;  2W81 C;  4KR8 A;  3POR A;  5ADX K;  4JCH A;  3WI4 A;  3BRZ A;  2N2M A;  2MHL A;  4C69 X;  3PGS A;  1YS5 A;  2JQY A;  2Y0L A;  4K3C A;  4LSE A;  3RBH A;  2FGQ X;  3WI5 A;  2R89 A;  2Y0K A;  8PRN A;  2W80 C;  3LK4 2;  1IZN A;  1GFM A;  1QJ9 A;  2LFU A;  3JTY A;  4FRX A;  4RJX A;  3KVD D;  5FVN A;  1Q9F A;  2WJQ A;  2AXT O;  3AA0 B;  2POR A;  2ODJ A;  3PF1 A;  4FSO A;  4IL6 O;  4AYE C;  2MNH A;  2KZ7 B;  3UAQ A;  4PR7 A;  5EE2 A;  4AYI D;  2F1C X;  1HXU A;  5T5F A;  4O3Z A;  4C4V A;  3DWO X;  1GFN A;  2Y0H A;  1S5L O;  3AA1 A;  2X9K A;  3BRY A;  1P4T A;  3AAE A;  3HWB A;  4LSH A;  4XNK A;  4C00 A;  4AYN A;  1ZHZ A;  3LK2 A;  4FT6 A;  5DL8 A;  3V8U A;  2GE4 A;  3AA6 A;  3HOL A;  3DA3 A;  3POU A;  3VZT X;  3POQ A;  2M07 A;  3DZM A;  3QRC A;  4FZL A;  1GFO A;  4O3Y A;  4E1S A;  3UPG A;  7PRN A;  2R4O A;  4N59 A;  1H6S 1;  3VZU X;  2WVP A;  4FSP A;  2R88 A;  5DL5 A;  3UU2 A;  2OMF A;  2LHF A;  1ZHY A;  4FOZ A;  4FZM A;  4O4U A;  5KAI O;  4AKR B;  4O49 A;  4D64 A;  3O0E A;  1QJ8 A;  2F1V A;  1BXW A;  2K0L A;  3HOE A;  2IWW A;  5AFU K;  5TIS O;  5KAF O;  4O3W A;  5G26 A;  3VZW X;  4AYM C;  2XE2 A;  2QTK A;  1OPF A;  2J1N A;  3AAA A;  4G76 A;  2XTQ A;  5GTI O;  5PRN A;  4GCQ A;  3VY9 X;  5GTH O;  3AA7 A;  3QRA A;  2F1T A;  5G38 A;  3SZD A;  2YNK A;  1IZN B;  3POX A;  3SYS A;  1ZHW A;  3VE2 A;  4JFB A;  4N58 A;  5B66 O;  1QJP A;  4RLC A;  2XE3 A;  2Y2X A;  1MPF A;  3PQU A;  5JDP A;  4QQ1 A;  3EMN X;  2KXP A;  3T20 A;  6PRN A;  4KRA A;  3KZI O;  2ZLD A;  2R4L A;  4D65 A;  1BH3 A; 
#chains in the Genus database with same CATH homology
 3PGU A;  3BS0 A;  3DWO X;  1T1L A;  3DWN A;  3BRZ A;  3BRY A;  3PF1 A;  3PGS A;  2R4N A;  2R4O A;  2R8A A;  2R88 A;  2R4L A;  1T16 A;  3PGR A;  2R4P A;  2R89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...