3DWOX

Crystal structure of a pseudomonas aeruginosa fadl homologue
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
444
structure length
444
Chain Sequence
AGFMVPTTNTAGWGRAMAGGSLFPNDPSAAFNNPAAMAFIDKRIAQLTVNYADIDIKYNGDAYDYQGNPMTGGYQDGPGTPELGTNDGGQAGFGAWLPTGFLVVPINDRFAFGLSQVVPMGMRSTWDPNWKGRDFAVDTKIETIGLTGSLSFKVNDNFSLGAGVIIQRTSGFVSQNLDLYASAANSPGMGGIPFPASNSSALMRVKVDNTSPGFFAGAVWKPTDRDTLGFAYHAKIRNKLKGHYNLYDHDGGLTEGAIEGGTPGLAYPGLDLRMGASASARLDIPAYASLDWVHQFNDRLSLGASATWTEWSSFQDLTLKSHGNTIVSIPYTYRNTWTLAVGGDYKVTDQWTMRAGVAYDQTPTHNATRDPRIPDGDRYFASLGAGYRFQSMPELSIDAAYSRQFVKEVPLKTVNQDRLGGGRLDGRATSKGQVFSLSATYDFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transmembrane passage of hydrophobic compounds through a protein channel wall.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Probable outer membrane protein
total genus 123
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3dwoX00
2R88A 3PGUA 3PGSA 3DWOX 3BRYA 1T1LA 2R4PA 2R4LA 1T16A 2R4NA 3BS0A 3BRZA 2R89A 2R4OA 3PF1A 3DWNA 3PGRA 2R8AA
chains in the Genus database with same CATH superfamily
1QJPA 5T5FA 4O3ZA 2F1TA 5G3AA 5DL8A 3EMNX 6PRNA 4AKRB 4GCPA 1MPFA 2Y0HA 4G75A 4K3BA 4FT6A 3HOEA 4RLBA 2IWVA 3AAEA 2ERVA 3PQUA 4RLCA 2R4NA 5G38A 4C00A 2M06A 3AAAA 3T0SA 3WI5A 4FESA 1MM4A 3AA6A 3DA3A 3KZIO 4AKRA 5G26A 4FRXA 3PQSA 4UB6O 5DL5A 4AUIA 1QJ8A 1E54A 3GP6A 1T16A 1IZNB 2WVPA 4N59A 5EE2A 5KAFO 1GFPA 3POXA 1HXXA 3WI4A 3T24A 3DWOX 2AXTO 3POQA 1Q9GA 5E79O 5GTIO 2MHLA 3LK41 4U9CA 2R4OA 4IL6O 3SY7A 2R8AA 4N75A 5DL7A 4AYEC 2Y2XA 2XE1A 4Z3TA 5D5DA 1MM5A 3LK42 2LHFA 3A2SX 2Y7SA 4BUMX 3T20A 4FSPA 3VZWX 2N2LA 5JDPA 2QTKA 3G7GA 5G39A 4E1TA 4FUVA 3BRYA 4PR7A 2PORA 2R4LA 2XE3A 2KZ7B 1ORMA 4FOZA 4LSFA 4PUXA 4KR8A 4O3WA 4FQEA 4AKMA 5ADXK 2IWWA 5ADXL 2X27X 2J4UP 4N58A 4O3XB 3V8UA 3VE1A 4FSOA 4JCHA 5B66O 3SYSA 2KZ7A 4GF4A 5AFUK 4O49A 4G76A 4CTDA 2YPVA 2F1VA 5AFUL 2ZLDA 2WJRA 2W81C 2MNHA 2N2MA 1GFQA 3PORA 4O3YA 1HXUA 3BS0A 3AA7A 3QRCA 4K3CA 2XE2A 2JQYA 1ZHYA 3DWNA 4GCSA 4LSHA 2OMFA 3K19A 4LSEA 7PRNA 3LK2A 4GCQA 4C69X 2K0LA 2R4PA 1ZHXA 3PRNA 5PRNA 1GFMA 3AAEB 4LSIA 4QQ1A 4AZLA 4E1SA 4RL9A 3UU2A 3HOLA 2XTQA 4N74A 2XTRA 3AAAB 2Y0LA 3A0HO 4AYID 1S5LO 3UPGA 1BXWA 4FMSA 1PRNA 3DZMA 2Y0KA 3FYXA 4D5UA 3PGUA 3DA4A 2X9KA 3C5OA 4AYNA 4D64A 2M07A 3HWBA 5H2FO 4C4VA 5GTHO 3AA6B 4PJ0O 4F4BA 1Q9FA 1BT9A 3NSGA 2ODJA 3POUA 4AYDC 2F1CX 2R88A 1IZNA 2KDYA 2XMXA 2JMMA 4GHBA 3SYBA 1G90A 1T1LA 4XNKA 5IYUA 4RJWA 8PRNA 2ZFGA 3SY9A 1P4TA 1YS5A 2R89A 2LFUA 4KR4A 5GV0A 3PGRA 4FZLA 1OSMA 3VZTX 4C4VB 4AYMC 3AA1A 3PGSA 3VE2A 1BH3A 3RBHA 3VZUX 2PRNA 1ZHZA 3JCUO 4UB8O 2O4VA 2W80C 3SZVA 4JFBA 2WJQA 3A0BO 3SZDA 3LK3A 4RJXA 3KVDD 5KAIO 1QJ9A 3AA1B 5TISO 3PF1A 3HW9A 3TZGA 4D65A 3VY9X 4O4UA 1GFOA 2KXPB 3JTYA 4AFKA 1ZHTA 3WU2O 3AA0B 2YNKA 4O4XA 1OPFA 1GFNA 3LK3B 1HXTA 1THQA 3BRZA 3QRAA 4FZMA 4B61A 1H6S1 4FRTA 5B5EO 2XE5A 3AA7B 4KRAA 2GE4A 3VY8X 2XG6A 3NJTA 3O0EA 1ZHWA 4XNLA 2FGRA 2FGQX 2K4TA 2J1NA 2KXPA 3LK2B 1PHOA 2KC0A 4FZNA 5DL6A 3AA0A 3UAQA 5FVNA
chains in the Genus database with same CATH topology
2R88A 3PGUA 3PGSA 3DWOX 3BRYA 1T1LA 2R4PA 2R4LA 1T16A 2R4NA 3BS0A 3BRZA 2R89A 2R4OA 3PF1A 3DWNA 3PGRA 2R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R88 A;  3PGU A;  3PGS A;  3DWO X;  3BRY A;  1T1L A;  2R4P A;  2R4L A;  1T16 A;  2R4N A;  3BS0 A;  3BRZ A;  2R89 A;  2R4O A;  3PF1 A;  3DWN A;  3PGR A;  2R8A A; 
#chains in the Genus database with same CATH topology
 1QJP A;  5T5F A;  4O3Z A;  2F1T A;  5G3A A;  5DL8 A;  3EMN X;  6PRN A;  4AKR B;  4GCP A;  1MPF A;  2Y0H A;  4G75 A;  4K3B A;  4FT6 A;  3HOE A;  4RLB A;  2IWV A;  3AAE A;  2ERV A;  3PQU A;  4RLC A;  2R4N A;  5G38 A;  4C00 A;  2M06 A;  3AAA A;  3T0S A;  3WI5 A;  4FES A;  1MM4 A;  3AA6 A;  3DA3 A;  3KZI O;  4AKR A;  5G26 A;  4FRX A;  3PQS A;  4UB6 O;  5DL5 A;  4AUI A;  1QJ8 A;  1E54 A;  3GP6 A;  1T16 A;  1IZN B;  2WVP A;  4N59 A;  5EE2 A;  5KAF O;  1GFP A;  3POX A;  1HXX A;  3WI4 A;  3T24 A;  3DWO X;  2AXT O;  3POQ A;  1Q9G A;  5E79 O;  5GTI O;  2MHL A;  3LK4 1;  4U9C A;  2R4O A;  4IL6 O;  3SY7 A;  2R8A A;  4N75 A;  5DL7 A;  4AYE C;  2Y2X A;  2XE1 A;  4Z3T A;  5D5D A;  1MM5 A;  3LK4 2;  2LHF A;  3A2S X;  2Y7S A;  4BUM X;  3T20 A;  4FSP A;  3VZW X;  2N2L A;  5JDP A;  2QTK A;  3G7G A;  5G39 A;  4E1T A;  4FUV A;  3BRY A;  4PR7 A;  2POR A;  2R4L A;  2XE3 A;  2KZ7 B;  1ORM A;  4FOZ A;  4LSF A;  4PUX A;  4KR8 A;  4O3W A;  4FQE A;  4AKM A;  5ADX K;  2IWW A;  5ADX L;  2X27 X;  2J4U P;  4N58 A;  4O3X B;  3V8U A;  3VE1 A;  4FSO A;  4JCH A;  5B66 O;  3SYS A;  2KZ7 A;  4GF4 A;  5AFU K;  4O49 A;  4G76 A;  4CTD A;  2YPV A;  2F1V A;  5AFU L;  2ZLD A;  2WJR A;  2W81 C;  2MNH A;  2N2M A;  1GFQ A;  3POR A;  4O3Y A;  1HXU A;  3BS0 A;  3AA7 A;  3QRC A;  4K3C A;  2XE2 A;  2JQY A;  1ZHY A;  3DWN A;  4GCS A;  4LSH A;  2OMF A;  3K19 A;  4LSE A;  7PRN A;  3LK2 A;  4GCQ A;  4C69 X;  2K0L A;  2R4P A;  1ZHX A;  3PRN A;  5PRN A;  1GFM A;  3AAE B;  4LSI A;  4QQ1 A;  4AZL A;  4E1S A;  4RL9 A;  3UU2 A;  3HOL A;  2XTQ A;  4N74 A;  2XTR A;  3AAA B;  2Y0L A;  3A0H O;  4AYI D;  1S5L O;  3UPG A;  1BXW A;  4FMS A;  1PRN A;  3DZM A;  2Y0K A;  3FYX A;  4D5U A;  3PGU A;  3DA4 A;  2X9K A;  3C5O A;  4AYN A;  4D64 A;  2M07 A;  3HWB A;  5H2F O;  4C4V A;  5GTH O;  3AA6 B;  4PJ0 O;  4F4B A;  1Q9F A;  1BT9 A;  3NSG A;  2ODJ A;  3POU A;  4AYD C;  2F1C X;  2R88 A;  1IZN A;  2KDY A;  2XMX A;  2JMM A;  4GHB A;  3SYB A;  1G90 A;  1T1L A;  4XNK A;  5IYU A;  4RJW A;  8PRN A;  2ZFG A;  3SY9 A;  1P4T A;  1YS5 A;  2R89 A;  2LFU A;  4KR4 A;  5GV0 A;  3PGR A;  4FZL A;  1OSM A;  3VZT X;  4C4V B;  4AYM C;  3AA1 A;  3PGS A;  3VE2 A;  1BH3 A;  3RBH A;  3VZU X;  2PRN A;  1ZHZ A;  3JCU O;  4UB8 O;  2O4V A;  2W80 C;  3SZV A;  4JFB A;  2WJQ A;  3A0B O;  3SZD A;  3LK3 A;  4RJX A;  3KVD D;  5KAI O;  1QJ9 A;  3AA1 B;  5TIS O;  3PF1 A;  3HW9 A;  3TZG A;  4D65 A;  3VY9 X;  4O4U A;  1GFO A;  2KXP B;  3JTY A;  4AFK A;  1ZHT A;  3WU2 O;  3AA0 B;  2YNK A;  4O4X A;  1OPF A;  1GFN A;  3LK3 B;  1HXT A;  1THQ A;  3BRZ A;  3QRA A;  4FZM A;  4B61 A;  1H6S 1;  4FRT A;  5B5E O;  2XE5 A;  3AA7 B;  4KRA A;  2GE4 A;  3VY8 X;  2XG6 A;  3NJT A;  3O0E A;  1ZHW A;  4XNL A;  2FGR A;  2FGQ X;  2K4T A;  2J1N A;  2KXP A;  3LK2 B;  1PHO A;  2KC0 A;  4FZN A;  5DL6 A;  3AA0 A;  3UAQ A;  5FVN A; 
#chains in the Genus database with same CATH homology
 2R88 A;  3PGU A;  3PGS A;  3DWO X;  3BRY A;  1T1L A;  2R4P A;  2R4L A;  1T16 A;  2R4N A;  3BS0 A;  3BRZ A;  2R89 A;  2R4O A;  3PF1 A;  3DWN A;  3PGR A;  2R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...