3DWQA

Crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Subtilase cytotoxin, subunit B
total genus 26
structure length 116
sequence length 116
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwqA00
1S5DD 5ELBA 4O1NA 1HTLD 3R2IA 1F77A 3R2TA 1D5ZC 1LTBD 1RCVD 1PTOB 4RGNA 2RDHA 1V1PA 2AQ1B 1TS5A 1PZKD 1UUPA 3CHBD 3DWAA 4RCOA 1G8ZD 3KLSX 1D5MC 1EU4A 1HA5A 1FNVA 1QILA 1RDPD 1PTOC 4DXGA 1PRTC 4BWGB 1CHQD 2G9HD 2NTTA 2CHBD 1EFID 1EEFD 5FKAC 1LT6D 1RD9D 1SE4A 1LT4D 1V1PB 1KLGD 1TS3A 1AN8A 1FD7D 1MD2D 2IJ0A 4C56C 4RHSA 1XXGA 1TY0A 4RHRA 1S5CD 1EEID 5D3DA 5I4DA 2XN9C 1JR0D 1PRTD 1LT3D 1PTOD 3BYYB 3R8BA 1SE3A 3W2DA 1ENFA 1LTTD 3DWQA 4RFBA 1STEA 3MFGA 3DWPA 1CHPD 5ELCA 1L0YB 1RF2D 4RGOS 1JWMD 1FGBD 1D6EC 3EFXD 4OHJA 3BVMA 2AQ3B 4DXFA 2SEBD 1BCPD 1BCPF 5FK9C 1I4HA 1JWUD 3TSSA 2ICIA 2TSSA 5ELFA 1I4RA 1S5ED 2J4XA 3BVGA 1ET9A 1PYWD 1LLRD 2XNAC 3EA6A 5D3IB 3URYA 1CT1D 1LTRD 1BXTA 1CK1A 1V1OA 1LTSD 2AQ2B 1LTAD 3GP7A 2IPKD 1I4XA 5ELEA 1SBBB 2QILA 1T5XD 1S5BD 2RDGA 3BVZA 1ESFA 2WV6D 1D5XC 1PRTF 5ELDA 1B1ZA 1I4PA 1SJHD 5TSSA 1AW7A 1EWCA 1JWSD 1I4QA 4RH6A 1PZID 3OWEB 1PRTB 1TY2A 3SEBA 1M4VA 1LT5D 4Z9CB 2R61A 1KTKA 1SEBD 2Z8LA 2XRSD 1JCKB 1LTID 1LTGD 1TS4A 4L63B 1GOZA 2O2LD 3BYTB 1B44D 1SXTA 1HXYD 3BZDB 4RGTA 1DJRD 2NTSA 1EU3A 1S5FD 1L0XB 1TS2A 1FNUA 1JQYD 4TSSA 1FNWA 1SJED 1DYQA 4K6LA 1ET6A 1PTOH 1BCPB 3MC0B 1HQRD 3V05A 2QEJC 1KLUD 1LO5D 4UDUC 4L6TB 4RGMA 1XTCD 4ZYSA 1CQVA 1PZJD 3O13A 2XRQD 1I4GA 1SE2A 1UNSA 1BCPC 1PTOF
chains in the Genus database with same CATH superfamily
3PO3G 3PF4A 1SE8A 2R7DA 1W3SA 3U58A 4X65Q 1D5ZC 5DAUA 3NHHA 3EQLC 4DR4Q 1Y8OB 5IWAQ 3TS0A 1KNAA 2PPBC 1NR4A 2DUDA 1YZ6A 5IT9c 1VF7A 1CHQD 1J9OA 1EEFD 1NBWA 3ULJA 4YY3Q 3TS2A 1XNQL 3M7NA 4C1NK 1VQPA 4K0KL 5BR8Q 3F1ZA 3KYHC 4A3BH 1WCMG 4A3MG 1ENFA 4B3SQ 4R1JA 2QA4A 2UXCL 1E2VA 5JPNC 3T51B 1HR0W 1HPCA 2ICEC 4N9TA 3GTOB 4RKLA 4DAVA 1C4QA 2BH2A 4BS9A 1FVIA 1SYDA 2K01A 3I90A 3HOYH 1Z7TA 3GTQB 3LNNA 2UUAQ 4DPGA 3BVGA 1V1QA 2EJMA 1TWGB 3EA6A 4KD4A 3URYA 5I2YA 1LTAD 2IPKD 3F2UA 4X3TA 5ELEA 1GUWA 2NVYB 3KBGA 2A69C 3J7ZC 3NP8A 3P1HA 3I4NB 1PLFA 4S3SA 4KKUA 4CKBA 2PQAA 2QW7A 2OTJA 1HZBA 2Z1CA 4IUVA 4IPDA 1KTKA 4BBSH 4X66Q 2Z8LA 5I2XA 5D14A 3VR2A 4QUFA 1PH2A 2HUGA 1TS4A 3I4MB 5M5XH 1OXSC 1HHVA 1FR3A 4B3TL 1VQDA 1S5FD 2L12A 1PH5A 1ZYRC 4QB4A 1PA6A 4AIMA 4APVA 2AUJD 2X6GA 2PNRC 2B2WC 4X3UA 4GOPB 1EIHA 3H0GG 4AYBB 4DN4M 5IGBA 2EXZA 4L6TB 3NE5B 3CCMA 1GUTA 2R3ZA 1PDQA 3MXUA 4HCEA 1E22A 4IFDJ 4K8JA 2UUCQ 1SE2A 2E76C 1SYCA 2SNSA 3NSWA 3CCQA 2JA7H 1GD7A 2UUBQ 4FF2A 2K04A 4O1NA 4EQNA 3HOYG 2R7ZG 4JI5L 4LF4L 4L5QA 4XT3B 1G6PA 1MSGA 4OWWB 2F3VA 2ZTCA 4JI3L 4NP5A 1PTOC 4KY6A 5BR8L 2NZOA 4YIJA 2CHBD 4A3GH 4GLXA 1LT4D 1V1PB 5E1FA 4A3BG 4LFAL 3QIAA 1PFBA 5C44G 3S2HH 3A0JA 4H0LC 4KV6A 3LWUA 4HSVA 2XN9C 4DA2A 1STGA 1NMFA 5LL6S 4OX9Q 5EKKA 4HTHA 4P74A 3LX0A 2M2LA 2WAQB 3MFGA 1U0LA 2YTYA 4JV5Q 2L1BA 3DWPA 4LFAQ 5G3LD 1WYDA 2JN4A 4JI1L 3OWFA 3EFXD 4OIJA 3CMEA 4OO1H 4FXGC 4DV3Q 1EQQA 2NB0A 2A8VA 1NUCA 4LF7Q 4QUCA 5CYUA 2NVXH 1SFOH 5JEAJ 2K5QA 3H3VI 4ZUJA 5FLMH 3D4RA 1GVPA 4QIWE 4QMGA 2JA6G 3A74A 5JJLA 5A2QE 1EIGA 4B3ML 1TIID 2KQ3A 3HOZB 5EPKA 2ZJQA 2C5CA 4X64L 1D7QA 2JA9A 1L1OC 4XTCS 5FLXc 2NVXB 4DR7L 1AP0A 1VQIA 4HEDA 3G7LA 4KTAA 4DR1L 1MGSA 3E6ZX 4B3TQ 1PFSA 4JYAQ 3Q8DA 1T5EA 4DR5Q 1LTID 1UE5A 2L4NA 2WB1G 3HEJA 4JOIC 3PQIA 4NPSA 4B3MQ 5C4XB 1JMCA 4LFBQ 1PH4A 3CCLA 1HZCA 1EZ8A 5DLQE 3J81L 4JI6L 3IAYA 4K6LA 3TMEA 5GROA 5M3MB 4OEMB 2VQEQ 3C3LA 1EQRA 3TZDA 2Q2IA 1O80A 1AH9A 1WTHA 4A3MB 4ABNA 2EIFA 3CQZB 2E2DC 4IUUA 2J0TD 3NELA 1UNSA 1EWHA 5IY0A 5JJKA 3CCJA 5ELBA 1UE1A 1QNUA 1F77A 2VY3A 2OF1A 1WFQA 4DV0Q 1E1TA 3MWYW 3ZJYC 4A75A 3GTPB 5I9OA 2RDHA 1CA6A 2RBMA 1K83B 3U9OA 1ICFB 4C3JB 1G8ZD 2KHSA 3HOXB 3ND9A 1STAA 5FKAC 2WAQG 1ASZA 1AN8A 1KRTA 1XXGA 3PF5A 1NY4A 1EEID 2NN6I 2G9DA 3I72A 4FYDA 1UEAB 2JA6B 2EYPA 2LXKA 4A3CH 4R8NA 1TR5A 3GDEA 2VQFL 2VB3X 1YNND 2TMPA 3WDNA 1G91A 5CBEE 2QCPX 1I50H 2C35B 2FINB 3SGIA 3CRLC 4BXXH 1F9PA 4OHJA 3NBIA 5IYCG 5E7NA 3D0FA 1PH1A 1BCPD 4DAPA 1NJIC 3QWNA 1ET9A 3J7A5 1VDZA 2D2CC 3HS0C 3SK5A 3FPUB 3CCEA 3M85A 2NVYH 1UWVA 4DV6L 1SBBB 4ID6A 1FJGL 3E0JA 4F88A 4DNIA 1D5XC 2UUCL 5DM73 1M8AA 2NBFA 1STHA 1EOTA 1SNOA 3P7JA 1EWCA 1SNMA 1EL0A 2XSCA 2R93H 2OEOA 3UDXA 4O2DA 4DV5Q 4J1MA 1M4VA 1Z47A 2CQAA 2R61A 3ITPA 5I6WA 4JBWA 4LFCL 2RSNA 4A3JG 1DONA 2ALYB 2IHEA 3R93A 2AKWB 4F87A 3T1YL 3K5MA 2WB1E 5CBAE 2UXBL 1H9SA 3I73A 5DEHA 2JA5H 4FXKC 1YNJD 4Q5VA 2EVBA 3PO2B 4AQYQ 3SK4A 2JSOA 2JA7G 1IKLA 1TXYA 3GTJH 1XTCD 1MJEA 2BA1A 2RA4A 3PGZA 2NVQH 5IGFA 3S2HB 2F0EA 5CV9A 3TP7A 1MI2A 2X6LA 4EQOA 3Q6SA 1Q12A 4DK6C 3FHWA 5EKIA 3KLWA 2Z0SA 1PVOA 3S1RB 3VYRA 3K80C 1D5MC 2IHFA 4DR6L 3I8ZA 2PYKA 1HCZA 4KI0A 3A8IE 3N52A 2IY5B 3KOJA 1Z9FA 2K52A 1I6HB 1MHWC 1CTMA 2K05A 2PMZB 1HNWQ 1Y1WH 2KEEA 1JR0D 2WAQE 1JOKA 1LT3D 4MTKA 4OWTB 5EGTA 3BYYB 1VQKA 4WJ3M 2VUMB 2EY1A 1GM5A 1EFWA 2RHQB 4QCLA 4CHTB 3MAQA 1H9JA 1BDOA 1S3OA 2DN8A 2A74C 1RODA 4FVMA 1QUQB 2KHIA 3S17B 3TP6A 1IBML 4YHHL 3GTKB 4BBRB 1NCVA 4DXFA 4ZCKA 1A3VA 2B2VC 1IL2A 3JAME 3OW7A 2EZVA 1LLRD 5J1ZA 3G71A 1T9HA 2I5LX 2QKIC 3L2PA 3TN2A 2JA8H 2KENA 5IWAL 1I4XA 4A3MH 4RCNA 2K50A 4WJWA 4X64Q 1Q1EA 1J8IA 1SDFA 2MFIA 1IL8A 1JC7A 4X62L 1PZID 1PRTB 2F0DA 5E4WC 3OMCA 1X32A 1B53A 1KAAA 2MHVA 2PI2E 4GKKQ 4A3IH 4ALPA 1IW7C 5E4XA 1S40A 1TS2A 1H9MA 5CGKA 2E2JB 2MUYA 1BQQT 1N33Q 1NMGA 2VUMG 2L9HA 1ML0D 5BN5A 1VQEA 2PNHA 4DUZQ 2B2UA 1CQVA 4QQBX 1TWAH 1CKOA 1E2WA 2ZXRA 3H09A 3HOUG 1PTOF 3NUCA 2R93B 2HHHQ 1SNQA 3KF6A 3R2TA 3SVMA 1IBLL 3I4NH 4GNXC 2JK8A 4XQNA 1B9NA 3HOVG 3MXNB 3AU7A 1X3QA 2F52A 3C1FA 2VNUD 2UXDL 4TKOB 5IT9L 2EY2A 5AFWA 1YEZA 2KA7A 3OIPA 4DR2Q 4KY5A 3R8BA 1VQLA 4FDBA 3SDZA 2A73B 3S2DB 4O42A 3OTOQ 1CHPD 4O0AA 4LAAA 3SK8A 3BVMA 4RMFA 4YY3L 1HNXL 3S24A 1I94L 5IYCH 1BUVT 3T1HL 2TSSA 2JA7B 5CV4A 1HRJA 1I4RA 2LKVA 4X66L 4ULLA 2K5NA 1K28A 5IGCA 4DV4L 4DV6Q 1BXTA 2HQEA 3BU2A 4A3EG 1EIFA 1N36Q 1F2YA 1SMYC 4HAEA 4K5VA 1QZGA 5ELDA 4OGQC 2H5XA 2LS01 4K5XA 2AWOA 3KF8B 1B2TA 1SYGA 1JE5A 1GUSA 1NTGA 2WIIB 2MNAA 3X3MA 1EY0A 1I6VC 3K5OA 3B6YA 4DV1Q 1B44D 2ZTDA 4DAMA 2FFKB 1F9RA 2IX1A 4KHZA 2D5DA 3I4MG 1VQNA 2UUBL 3S1RH 4WRDA 2K32A 2B63H 3GQBA 3T13A 3J80E 1PFNA 2UXCQ 1CZWA 2MQHA 2E75C 1ASYA 4DV3L 2Z4HA 1AZQA 1KQSA 4JK1C 4XIGS 3G48A 2K5WA 1EUJA 1V43A 2F0TA 1WTQA 1HH2P 2KCCA 2YU9H 4P75A 3E9HA 3GTQH 2YV5A 2MGSA 1HTLD 1R9TH 3J80L 5LMNQ 1XYIA 3K59A 3UDGA 4R9WA 2B63B 1Q7YC 3D8GA 2Z6KA 3NWTA 3RZOB 1GUOA 3A5ZB 3MVVA 2CWAA 1B70B 3M4OB 4JYAL 2J7ZA 4LFCQ 4KHVA 3A55A 1A15A 3D31A 4MIUA 4X3KA 3VDYA 2LFNA 2DY7A 3TEHB 2ZM6Q 1PXUA 1X3EA 1HUMA 3W2DA 4A3EH 4JVZA 2SDFA 1XTDA 2B8FA 4QIWB 3TQYA 4A3KG 3HOWG 3S1NH 4XYQA 1JWMD 2F4VQ 5LMUQ 4IUQA 2F0WA 1TWCH 2EYOA 2B2VA 1I4HA 5C0XH 1F2LA 4IPHA 5ELFA 5NUCA 1WTWA 3FRPB 5DM63 2EQSA 4TQUS 2I46A 1S4ZA 1VQMA 1YIJA 2YTXA 3H94A 1LACA 3F2BA 2JA8B 4UAIA 4FXDA 4LF4Q 1YNJC 2WV6D 1O7LA 4A76A 3T16A 2DNEA 3U9SA 3Q23A 2EJGC 5E3FA 4QJFA 2KECA 3KJOA 2QGQA 3BZCA 4JI0Q 3L0OA 4LF5L 1KDCA 4RAUC 2D0OA 4RGTA 3AFQA 4N8FA 5IYBH 1Q82C 3MXPA 3V96A 4HIMA 5EKLA 1GXDC 2SOBA 2O5JC 2B2TA 1L0XB 4C3IG 1JQYD 4NXML 1G2SA 2JYOA 3MXGA 4BA1I 1PTOH 2R7ZH 2HQLA 3QB3A 1BCPB 4DF7A 1U4PA 2A6ED 3K7AH 4UY8C 1SR3A 4DUYL 3LGJA 4CJ1B 3CPWA 4J15A 5C4ZA 4HIKA 3KUPA 4IOCA 1F9SA 1SFOB 4A93G 5K36G 2B8GA 1C48A 1VQCA 2YU9B 1I3QB 3D4DA 1IBLQ 3RLNA 1L2FA 4A3FH 3BS1A 2JE6I 4G7ZC 1MKHA 1K0SA 1LUZA 2VS1A 1YITA 3CD6A 3J81j 1Y14B 1ZYRD 1K8MA 4DK3C 1OXUA 5IOCA 3HOWH 3MHBA 3M9BA 3S1MH 3VR3A 1RHPA 3DXJC 1RTNA 3J7AF 1UE7A 4HCSA 4DAYA 2B2WA 2R6GA 4RHRA 1JOOA 3U4ZA 4A3LH 4IN3A 4HMIA 1XPRA 1DM0B 4B08A 3HZXA 4FP5D 1SE3A 4ZKBB 2OWOA 3M4OH 3X3NA 4RWSC 2CW0C 2F0FA 3FVQA 5CV7A 1VMPA 1RF2D 3RD4A 3I4OA 3HGBA 4GLAC 2F3IA 1L1OB 3W1BA 3WOFA 5M5XB 2KJXA 4L8JA 2K33A 5A35A 4TVAB 2Y0SB 3HKZG 1OTCA 3JC66 3CRKC 4I7AA 3S15H 3M4YA 3EVQA 5M3FH 2MO1A 3OHXC 3HKSA 1S5BD 5C44B 2XWBB 4JI0L 1Y1WG 3U50C 5FLXL 3SXHA 2B2YA 2DY8A 2B63G 3T56B 1VQ7A 3S2DH 5M9OA 4LK1C 2RDFA 1SLJA 1JB7A 3I4MH 1VCIA 3NBHB 2XRSD 4XQQA 4B9XA 1X9NA 3GV6A 3TDQA 2KVMA 2GVBA 5JJZA 1DZ1A 2B3GA 4LMQD 3W1GA 4GN5A 2ZXPA 1IYVA 1EWIA 5JEAH 2F0GA 4B3RL 1WJJA 1VS0A 3HOXH 3NTHA 5A2QL 4DV5L 2UU9Q 4RGMA 1HFNA 1XMOQ 4A93H 1KC8C 1BBWA 1K83H 2RCFA 1VQ4A 2KUMA 3I55A 1CM9A 2EYLA 4MN3A 2L0CA 3G4SA 1SN8A 2K5VA 3VR4A 1R4QB 1D1IA 2JA5B 3J80c 3OTOL 1BNZA 3BDOA 1STBA 1TS5A 1PZKD 3OIQA 4FF4A 5IYBG 4CDEC 4NDXA 4J8QA 5BN3A 1FNVA 1QILA 1RDPD 1PYBA 4DXGA 3FP9A 5KEEA 2E2JH 1HA6A 4NKLA 2G9HD 3CU7A 4R4QA 1LT6D 3NTIA 3CW2C 3VR5A 1VQ6A 4LUVA 4N9PA 1Z6HA 5DNFA 4DU9A 1PTOD 4IPCA 3DUZA 4QY7A 3M3YB 2KCTA 3A8JE 4F7XA 1G291 4LF5Q 3UE0A 2E74C 1K73C 4A3FB 4JBMA 1AE3A 3KLSA 3S9WA 1E7ZA 1SRUA 2AQ3B 4IFDH 2ENBA 2SEBD 3RZDH 1H9SB 2NVQB 1A3TA 1E0BA 2PCFB 4UP9A 1B8AA 1OXVA 4UPAA 2J4XA 5HGTA 2WFWA 1L0WA 4GKKL 3F8TA 5EPJA 4A3KH 2EYMA 2F0NA 1V1OA 3KK7A 4JI2Q 3K5NA 3GTKH 2RVLA 4PZ8A 1TKWB 3HKZE 5KYIA 1KIXA 1W6JA 4NMZA 4DK0A 3HOXG 3NQIA 1AZPA 3ERQA 3WOEA 3GTGB 2DGYA 3PO3B 1JWSD 2VL6A 1IYUA 3A5UA 1TY2A 1DXMA 3SEBA 5JPMC 4DR7Q 5F2DA 1W6KA 4LF9Q 5JJIA 4E6IA 2O2LD 2HDMA 1DJRD 5ELNA 3GTMH 3D4WA 1IBKL 4HMJA 4FF1A 3RLOA 2CQOA 2EDGA 2UU9L 4P73A 3TRZA 1ET6A 4RKBA 2DJFC 2AUKA 3FMCA 1CI3M 1YHBA 1YJWA 4C3HB 1CQFA 5M3FG 4LNQA 1UEBA 2WACA 3KBXA 1PZJD 1XMQL 2L5TA 5FO7B 4R4TA 4XXEA 2PZUA 1KABA 3R3OA 2Z6KC 1FL0A 1YBYA 5LHY1 3R2IA 2K5DA 2WINB 2PZWA 2AQ1B 4KHPQ 3AB9A 5G3LF 2CW0D 3HOZG 3UDFA 3KLSX 2D0PA 1HA5A 1K3BC 2IX0A 2ZTEA 3K58A 2KHJA 4IUTA 1SROA 4ZQ3A 1G51A 4A3DG 5M5YB 3GD7A 1MD2D 1DCZA 1SNDA 4IUPA 1GJXA 4A3LG 3M4QA 2R7FA 2BDNA 1DOMA 3CXCA 4GS3A 1X54A 3GTLH 3T53B 1N32Q 4IZ8A 1RL2A 3D6CA 3GTGH 2PW7A 1Q81C 1EYDA 1Y1VH 1ILQA 4PZ6A 1X65A 3EJIA 3MEHA 3AQQA 2K28A 2VQFQ 1WD1A 4YWMA 1BBUA 2EYHA 1WTXA 4A3KB 2H4OA 1L0YB 2ATWA 1KNEA 3PUWA 1N32L 2A19A 2Z4IA 4YWLA 3RR5A 3AMUA 4A3FG 2XGTA 3OPOA 1HFGA 1VQAA 2F3WA 1N8RC 2NUCA 1S5ED 3EN2A 5L37A 1HQMC 2WKCA 4FF3A 5FO9B 5K36H 1KRSA 4BY7B 3IFDA 3KF8A 4WFN3 2F0VA 2F0JA 2AQ2B 3GP7A 2A6EC 4CDFC 4CGYB 1WI5A 3G6EA 5LMNW 4ZRZA 4BBRG 2PW5A 5KGUA 1I50B 2ZXOA 1JORA 2JA5G 3FEWX 1I94Q 4PMBA 1I3QH 4JI4L 4LF8Q 1Q8KA 2UXDQ 1SEBD 2CH4W 1GOZA 1IXRA 2F0MA 3HOVH 5IODA 1JT8A 4CKCA 1HZ9A 3AYHB 3OW2A 1EU3A 2L15A 3IRBA 1FNWA 5LMNL 4A3BB 1EQVA 1WD0A 3RZOH 1HNWL 3EIVA 4K2KA 4GOPC 4RA8A 5LMUL 1A0IA 4IALA 4LFBL 4ZKCB 3HOUH 4JCVE 3MA2B 4ME5A 3BZKA 4ZYSA 5CR3A 2A68D 3SK6A 1A3UA 2D62A 3H0GB 3K6OA 2Q8RE 4HN7A 4UP7A 2OCEA 2RHSB 3ND8A 1KDAA 5C0XG 2HCCA 4KKTA 2PQEA 1LTBD 2F0KA 3SHLA 1LTLA 3OOCA 1J5EL 1GO3E 3FKIH 4CDCC 2Z9HA 5C6AA 2F0QA 4OX9L 3CC4A 2O4XA 1KD1C 2LMCB 4DV0L 4YWKA 1RJTA 1Y1VG 5C3EG 1QZHA 3J81i 1RD9D 4PNYA 2Y0SG 2JEBI 1JB3A 3PUYA 2AHOB 1PH8A 4MHEA 3IL8A 4C1NI 3TZUA 4CKEA 3A54A 4B3RQ 1Q86C 3I4LA 2BE5C 4A3DB 3NTKA 1STEA 1DGSA 3HOUB 1STNA 2JXMB 2X69A 3HOZH 4RGOS 2BH8A 3GTPH 2JEAI 3CAMA 2BDOA 3OYYA 1B3AA 1OO9B 2WP8J 5FK9C 5GQOA 4LWCA 2ICIA 1YHQA 4XT1B 2ASBA 2RKSA 5M3MG 2HCIA 4HIDA 2ZM6L 5KNDA 3H6MA 4OONA 4DUZL 2K7VA 3W5OA 1O7IA 3HKZB 1CT1D 1EZ6A 2SNMA 4A4IA 1CK1A 1X56A 1LTSD 4MNOA 1WTVA 1K9MC 1WCMH 2QILA 1WTRA 4JI4Q 3CMAA 4NXNQ 3K7UC 3VYTA 3ERSX 1HZAA 1GUNA 1VQHA 4ZAIA 5JOBA 1ENCA 3OWEB 1CKNA 1SNPA 4ZLTF 4LF9L 2Z6BA 4IFDI 3M7GA 1ILPA 4G4KA 4DR4L 2HT1A 2QF7A 3BYTB 1B4OA 1ZXTA 2A1AA 4CJ2C 3WWVA 4DFAA 5M3FB 2VW9A 4IO9A 1M1KC 1VQ5A 3QO2A 2V4DA 1SMYD 4C3IB 3MC0B 2QEJC 1XPUA 4KMUC 1XNQQ 4UDUC 3UI2A 4K0KQ 3PIP3 4P72A 4C3JG 1ICWA 5HY6A 2WKDA 5C4XG 4X6AH 1X6OA 2Q2TA 1EY5A 1AE2A 4X62Q 2F0SA 4G57A 4JI7Q 3K7AB 4M8AA 1EY9A 4G7HC 4L5TA 1E1OA 1NR2A 1PTOB 4RGNA 4RG1A 4OO1G 1V8QA 3N6RA 5C0XJ 3K8AA 2XVSA 2WB1B 2QDLA 4MZ9A 2RCNA 5EQ0A 3VA5A 3DLLA 2F0HA 1C0AA 4JI7L 3MFYA 1SE4A 1GKHA 1KLGD 1TS3A 3ER0A 2MPMA 1GUGA 2IJ0A 2N55A 4C56C 3PV0A 3MXNA 5IP7H 1PRTD 4FO2A 5CV5A 2XWJB 2Y0SE 4GKJQ 1RKNA 1QWYA 4LF8L 4NXMQ 3K81C 5ELCA 1CUKA 4GNXA 1H9KA 2IX3A 3MTSA 2KOLA 1JOQA 5M3MH 3H3VC 3BDLA 2VXWA 1IKMA 1JE4A 3TSSA 2VZAA 4NW2A 1JJGA 1G6ZA 1XNRL 1E2ZA 3IFTA 5IIFA 2N88A 4GZYC 1LTRD 4R4IA 4K2LA 4EQPA 3Q22A 4A3CG 3K0YA 3DEPA 4H02A 4DR1Q 4A3EB 1WOCA 2RDGA 3OSOA 1ZKOA 5COYA 1YNNC 3H0GH 2VUMH 1IW7D 5I9PA 4K14A 1SJHD 2IW3A 4IJLA 5GAEC 2LSSA 2E2HB 2FXQA 1Q46A 1TQOA 1VQFA 4JBJA 4ME3A 2N8NA 2ZJRA 4Y52H 4JI6Q 1LTGD 4A3IG 1Q8IA 4KN4C 3BZDB 4KY7A 1PH9A 2N3SA 4GN3B 4TSSA 4JI8L 1PYSB 1PMRA 4PMCA 3TP5A 2DJGC 1Q3LA 1PH6A 3STBD 1BKBA 1EY7A 4H44C 3EROA 3NPPA 1Y8NB 1GHJA 4YCVA 4IQZA 4PMWA 1I4GA 2NWGA 4JG2A 3QR8A 1I6HH 4QF4A 4NB3A 1L1OA 1VQBA 5FLXE 1YI2A 3TP8A 2EY5A 4DV2Q 1QE6A 5M5WH 4JI3Q 4LF7L 1E24A 3KJPA 4HJ9A 2L11A 3CCVA 3QG1A 5C0XI 3K57A 1VQOA 1IHZA 3PCOB 3Q0AA 2F1MA 1QVFA 5T1IA 4BBRH 4CJ0B 5IT9E 4HJ5A 4PQXA 5FJ8G 1BR9A 4K5WA 1QVGA 1LTTD 1ENAA 4JI2L 1EQTA 2PI2A 3NBHA 5H1SE 3DEOA 1A2TA 1O7ZA 3GTOH 2H1EA 3RUZA 3GO5A 4CDDC 1QG7A 2B2YC 2AMCB 1N34Q 1SNCA 5KYLA 3PO3H 2HDLA 1K8OA 1PYWD 1TWFH 4ILWA 1CKMA 4DUYQ 4M1UB 3I91A 5D3IB 3ULPA 1YJ9A 5LL6X 5C3WA 1U9RA 1PH3A 5FJ8H 3J81c 4HJAA 3PIO3 2K03A 3BVZA 3K0XA 5FO8B 1SYFA 3NEMA 4Y7NH 1YNXA 1N34L 3CCRA 1EYGA 5C44H 5CV8A 5AJ3L 1U4LA 4RH6A 4A3DH 3MEFA 4LUOA 4HJ8A 4C3HH 1H95A 3S15B 1QOHA 4A3JH 1CFMA 4BY7G 1IZ6A 3HG9A 5HGQA 4BY1G 5I6YA 4YCUA 4ODGA 3A56A 1SXTA 4JV5L 1Y69U 2R92H 4B3SL 2QDBA 3S14B 1TWHH 2R93G 1HJPA 4DV1L 2VQEL 2DNCA 2K4KA 2RF4A 4QGUA 3CC7A 4XDXA 1BF4A 5T1GA 1PH7A 2OTLA 3ONAB 4LF6L 2B39A 1E3PA 3CKIB 1MSHA 1BCPC 2KCNA 3JAML 3DHQA 4DV2L 1QCBD 4K8IA 3DM1A 4DNTB 3HP3A 1F2ZA 3STBC 3D6WA 1ONLA 1RCVD 2CWPA 4MTNA 1EY8A 2QEXA 1X3GA 1UUPA 2IT1A 1OXXK 3BG3A 2K14A 1DOLA 2OQKA 4HR7B 4EVOA 1F9QA 1AEXA 1D1KA 3I70A 2FHTA 3P20A 1P16A 2F0OA 1LABA 4BBSG 4R4CA 2CKZB 4OL7A 5K5PA 1XMOL 3I7FA 1EY6A 1A63A 4IJHA 5ELOA 1TY0A 4GNXB 5D3DA 3VA7A 1NSNS 1KAWA 4HSPA 1IYJB 1AFPA 5C5MA 4JW0A 4K6DA 1C9OA 2A69D 3DWQA 3A8KE 3QJYA 4RFBA 2MP1A 2B2UC 4DAYB 1RIPA 1C8CA 1KDBA 3PIPA 1G2TA 2EYFA 4DR2L 5C4JH 1WVLA 3S16B 4GLVB 4PV1C 4DR5L 4IFDG 1HR0L 1JWUD 2ZT9C 2Q2UA 3V2TA 1VQ9A 1RTOA 1U4RA 3PIOA 2KEDA 4DK1A 1VQGA 4LJZC 2OT2A 4JI5Q 4GN4B 4I7ZC 3ZYYX 4KJNA 3BDCA 4TRDA 4L5SA 4KHPL 1I4PA 4OWXB 5TSSA 1AW7A 2I07B 1I4QA 5C3EB 5IE8A 4Z9CB 1FGUA 1LM0A 4EQ5A 2P5ZX 4A3GB 1FYCA 1N33L 4WJ4A 1S72A 4BY1H 4HJ7A 1GHKA 3U4VA 4DGZA 5J39A 3CQZH 2PO4A 2PQAB 4IUNA 3E9IA 3F2CA 4JBKA 1FNUA 4DV7L 4Q0FA 1N9WA 2EYJA 1XJVA 3S1MB 4AYBG 5KIXA 4OELB 5ISRA 4DR3Q 3HOWB 2FMMA 2GVAA 4BA2I 3GTMB 5C4XH 2NN6G 5KRUA 3AEVA 4GOPA 3HOYB 2Q2HA 5CMDA 5JEAG 2EJFC 4DR3L 1VQ8A 1JJ2A 2F4IA 1LV9A 2NZHA 1QJOA 2A5HA 2M00A 3SR1A 1CZGA 1V1PA 2LY7A 3QOJA 2NVTB 3NQTA 1M90C 2GA4B 2R7ZB 1U4MA 3PO2G 1EFID 5C4JB 3HRZC 3KDFB 1TWAB 1XNRQ 3CCUA 1SMXA 1QUQA 1XPOA 4KJOA 5I4DA 2NVTH 3C2PA 2E5LL 4A3GG 3FPPA 1PV4A 3J80i 1EOVA 4IPGA 2F03A 2N78A 1HNXQ 1K8GA 1HR0Q 3I4NG 1CSQA 5JVG3 4A3JB 3VYSA 3E5SA 1BCPF 5J22A 3I3CA 5CORA 3UDIA 3S16H 3AFPA 1KL9A 5EJWA 4OIKA 5CV6A 2CFMA 3CP0A 3T1YQ 4HIOA 3NENA 1XMQQ 3PUVA 1CKNB 4P2CB 1TWCB 3LWEA 4PG3A 1EYCA 5IP9H 5AJ3Q 1PRTF 2JQOA 1PFMA 2EOTA 3S1QH 2E2IH 4ZUIA 2L55A 3M3YH 2A6HD 2YTVA 1XX8A 3FDTA 5C3EH 1D8LA 2IWHA 3RN5A 1F2MA 4L63B 1MJCA 1HXYD 4DKAC 2M9VA 4JPBW 2NTSA 1VQJA 5CC4A 1EY4A 4KN7C 4UHVA 1IBMQ 1ZEQX 3A7LA 3K5LA 3S1QB 1SJED 3L9AX 1KLUD 1BBXC 4OO1I 3J81E 2HD3A 4JOIA 3HOVB 4AYBE 4LF6Q 3TREA 4JI1Q 2CVRA 1C7YA 2JA8G 2A68C 1HTPA 1CA5A 3H91A 2BOSA 4XQJA 4H13C 1FJGQ 3KLRA 2OXPA 4C3IH 1R9TB 2MJ8A 1HNZQ 1X3FA 5IYDG 3T1HQ 1K8AC 1SSOA 4R4OA 1PRTC 4BWGB 1OXTA 2GN5A 4L5RC 4BY7H 4F8MA 1TWGH 3EBEA 4XYOA 2I5MX 1B50A 2FMCA 3PMFA 5IP7G 2FJ2A 1B7YB 4RHSA 3I2ZA 1S5CD 3IKJA 1O78A 2I5HA 4Y7NB 3MZ5A 3RN2A 3CC2A 1A62A 3PO2H 2PMZE 1Q90A 4AQYL 4C2MB 1W2BA 1J5EQ 1U5KA 1Y1VB 5KNBA 4X65L 3L7ZC 2Q8TA 5GADC 4KLKA 3RLFA 5BN4A 2OQ0A 2K1BA 1DD2A 2E8GA 2AWNA 1Y8PB 4X3SA 4DV4Q 4KK7A 2G5DA 2XNAC 4V190 4V0BA 3E0EA 1I5FA 2NN6H 1TWHB 4UP8A 4C3JH 4P71A 4B9WA 2BCOA 4DR6Q 4IURA 4A3IB 2UXBQ 1ESFA 3M4PA 5J3BA 1PHJA 4POGA 1QB5D 1B1ZA 2F0PA 3KF6B 1VMCA 1KHIA 5EAYA 1R4PB 2E2IB 1TU2B 1DOKA 1JCKB 4J6HA 3SE0A 3GV3A 1HUNA 2HHHL 3JAMc 4EGVA 5IYDH 3VR6A 3ULLA 3C1EA 4ZK9B 4CBVA 5HURA 1CSPA 2LXJA 3TBIB 1D2BA 3FKIB 2K5HA 1JICA 2MO0A 2CH4A 2B2TC 3S17H 3CF5A 1HQRD 1LO5D 4PZ7A 3GTLB 1K3RA 3VYUA 5IGEA 1JJCB 3PUZA 2XIWA 5M5YH 2RQXA 2XTIA 1Q1BA 2JP1A 1UAPA 1VF5C 2HIVA 2RSOA 4AH6A 1A8VA 3NK9A 1X55A 2K75A 1LYLA 3RMHA 1EIYB 1SYBA 4POFA 3JAMi 1S5DD 1HNZL 3E3XA 5C4HA 4DNRB 1ESRA 1MBYA 4H7BA 5D65A 1NE3A 2ZJPA 4LW1A 3C46A 2K6AA 3KDFA 1Y1WB 4BXXG 3ICEA 2KBNA 3CHBD 3DWAA 4OXPA 4C2MH 4RCOA 1J6QA 1EU4A 2D9UA 4FNFA 2BE5D 1KXLA 3NXWA 4KKSA 2O5IC 1SYEA 2NTTA 1UE6A 4NXNL 3I56A 2CCZA 1FD7D 1X3PA 4DV7Q 3RZDB 3W3AA 4EX5A 2YYZA 2E2HH 1BVSA 2PZTA 4YCWA 3RNUA 2A6HC 2E5LQ 5IP9G 1WTPA 5M5WB 1II3A 3UE1A 5FOBB 1N36L 2NYZD 4U673 3S1NB 3Q24A 4JI8Q 3GTJB 5EPLA 2Q8IB 4QL5A 1NNXA 3FKIG 1FGBD 2F0IA 1D6EC 3HFZB 5GAHC 2V1CC 3PUXA 4WORA 1SAPA 2EY6A 1B9MA 3J7YW 3KFUA 2EE1A 2F0UA 4I65A 2JJQA 4U68A 5EBDA 4G7OC 5IGDA 3P75A 4N8X1 2ES2A 4KD3A 1A2UA 3DM3A 1YJNA 3CCSA 3QOLA 1K0RA 1WCMB 4R8IA 2UUAL 2VB2X 1T5XD 5C3XA 4BY1B 3A7AB 1TVXA 4LUZA 4GKJL 1TT2A 1IBKQ 1BO0A 3PSIA 3L3OC 1YVCA 2NZ1D 3DMUA 4BBSB 1QNKA 1LT5D 4IOAA 3J7AV 1STYA 2R92G 1H9RA 1A6XA 1P8LA 3BJUA 2B29A 2HIXA 1B3QA 2IL8A 4JC0A 2C9OA 3OMGA 4A93B 2EXDA 5JVH3 5KNCA 4C3HG 2N49A 1NAPA 1XWEA 3G6JB 2F4VL 3F2DA 5JAVA 1DYQA 5C5LA 1YHAA 2KCMA 2ID0A 3H15A 2EPBA 1BOSA 2BA0A 2F0LA 3CPFA 5IGGA 3V05A 1O7YA 1WTOA 3D3RA 5GAGC 3NWSA 1MIUA 4YHHQ 1EYAA 1V9PA 2JA6H 3S14H 3O13A 1TWFB 3T4AC 1QVCA 2XRQD 5FLMG 3H3VH 2I0QA 5EBCA 2R92B
chains in the Genus database with same CATH topology
1D5ZC 5DAUA 3NHHA 3EQLC 1Y8OB 1KNAA 2PPBC 1NR4A 1VF7A 1CHQD 1J9OA 1EEFD 3M7NA 4C1NK 1ENFA 1E2VA 5JPNC 3T51B 1HPCA 2ICEC 4N9TA 3GTOB 4RKLA 4DAVA 1C4QA 4BS9A 1SYDA 2K01A 3I90A 1Z7TA 3GTQB 3LNNA 3BVGA 2EJMA 1TWGB 3EA6A 4KD4A 3URYA 5I2YA 1LTAD 2IPKD 3F2UA 4X3TA 5ELEA 1GUWA 2NVYB 3KBGA 2A69C 3NP8A 3P1HA 3I4NB 1PLFA 4S3SA 4KKUA 4CKBA 2Z1CA 4IUVA 1KTKA 2Z8LA 5I2XA 5D14A 3VR2A 4QUFA 2HUGA 1TS4A 3I4MB 1OXSC 1HHVA 1FR3A 1S5FD 2L12A 1ZYRC 4QB4A 2AUJD 2X6GA 2PNRC 2B2WC 4X3UA 1EIHA 4AYBB 4DN4M 5IGBA 2EXZA 4L6TB 3NE5B 1GUTA 2R3ZA 1PDQA 3MXUA 4HCEA 4IFDJ 4K8JA 1SE2A 2E76C 1SYCA 2SNSA 3NSWA 4FF2A 2K04A 4O1NA 4EQNA 4XT3B 1MSGA 2F3VA 4NP5A 1PTOC 4KY6A 4YIJA 2CHBD 1LT4D 1V1PB 5E1FA 3QIAA 1PFBA 4H0LC 4KV6A 3LWUA 4HSVA 2XN9C 4DA2A 1STGA 5LL6S 5EKKA 4HTHA 3LX0A 2M2LA 2WAQB 3MFGA 2L1BA 3DWPA 5G3LD 3OWFA 3EFXD 4OIJA 4OO1H 4FXGC 2NB0A 1NUCA 4QUCA 5CYUA 5JEAJ 2K5QA 4ZUJA 3D4RA 4QMGA 5A2QE 1EIGA 1TIID 2KQ3A 3HOZB 5EPKA 2C5CA 4XTCS 2NVXB 1AP0A 4HEDA 3G7LA 4KTAA 1MGSA 3E6ZX 1T5EA 1LTID 2L4NA 3HEJA 5C4XB 1EZ8A 3J81L 3IAYA 4K6LA 3TMEA 5M3MB 3C3LA 3TZDA 1O80A 4A3MB 4ABNA 3CQZB 2E2DC 4IUUA 2J0TD 1UNSA 1EWHA 5ELBA 1QNUA 1F77A 2OF1A 3MWYW 3GTPB 5I9OA 2RDHA 1CA6A 2RBMA 1K83B 3U9OA 4C3JB 1G8ZD 2KHSA 3HOXB 3ND9A 1STAA 5FKAC 1AN8A 1XXGA 1EEID 2NN6I 2G9DA 3I72A 4FYDA 1UEAB 2JA6B 2EYPA 4R8NA 1TR5A 2VB3X 1YNND 2TMPA 3WDNA 1G91A 5CBEE 2QCPX 2FINB 3CRLC 1F9PA 4OHJA 3NBIA 1BCPD 4DAPA 3QWNA 1ET9A 1VDZA 2D2CC 3HS0C 3SK5A 3FPUB 3M85A 1SBBB 4ID6A 3E0JA 4F88A 1D5XC 5DM73 1M8AA 2NBFA 1STHA 1EOTA 1SNOA 3P7JA 1EWCA 1SNMA 1EL0A 2XSCA 2OEOA 4J1MA 1M4VA 1Z47A 2CQAA 2R61A 3ITPA 5I6WA 4JBWA 2RSNA 1DONA 3R93A 4F87A 3K5MA 5CBAE 1H9SA 3I73A 5DEHA 4FXKC 1YNJD 4Q5VA 2EVBA 3PO2B 3SK4A 2JSOA 1IKLA 1XTCD 2BA1A 2RA4A 5IGFA 3S2HB 2F0EA 5CV9A 3TP7A 1MI2A 2X6LA 4EQOA 3Q6SA 1Q12A 5EKIA 3S1RB 3VYRA 1D5MC 3I8ZA 2PYKA 1HCZA 4KI0A 3A8IE 3N52A 1I6HB 1CTMA 2K05A 2PMZB 2KEEA 1JR0D 1JOKA 1LT3D 5EGTA 3BYYB 2VUMB 2EY1A 4QCLA 4CHTB 3MAQA 1H9JA 1BDOA 2DN8A 2A74C 1RODA 4FVMA 3S17B 3TP6A 3GTKB 4BBRB 1NCVA 4DXFA 1A3VA 2B2VC 3JAME 3OW7A 2EZVA 1LLRD 5J1ZA 2QKIC 3TN2A 1I4XA 4RCNA 4WJWA 1Q1EA 1J8IA 1SDFA 1IL8A 1JC7A 1PZID 1PRTB 2F0DA 5E4WC 3OMCA 1X32A 1B53A 1KAAA 2MHVA 1IW7C 5E4XA 1TS2A 1H9MA 5CGKA 2E2JB 2MUYA 1BQQT 2L9HA 1ML0D 5BN5A 2B2UA 1CQVA 1E2WA 2ZXRA 3H09A 1PTOF 3NUCA 2R93B 1SNQA 3R2TA 3SVMA 4XQNA 1B9NA 3AU7A 1X3QA 3C1FA 2VNUD 4TKOB 5IT9L 2EY2A 5AFWA 2KA7A 3OIPA 4KY5A 3R8BA 3SDZA 2A73B 3S2DB 4O42A 1CHPD 4LAAA 3SK8A 3BVMA 1BUVT 2TSSA 2JA7B 5CV4A 1HRJA 1I4RA 2LKVA 4ULLA 5IGCA 1BXTA 2HQEA 1F2YA 1SMYC 4HAEA 4K5VA 5ELDA 4OGQC 2LS01 4K5XA 2AWOA 1B2TA 1SYGA 1GUSA 2WIIB 3X3MA 1EY0A 1I6VC 3K5OA 1B44D 2FFKB 1F9RA 2IX1A 4KHZA 2D5DA 4WRDA 2K32A 3GQBA 3T13A 3J80E 1PFNA 1CZWA 2E75C 2Z4HA 1AZQA 4JK1C 4XIGS 2K5WA 1V43A 2F0TA 1WTQA 2KCCA 2MGSA 1HTLD 3J80L 1XYIA 3K59A 4R9WA 2B63B 3D8GA 3NWTA 3RZOB 1GUOA 3MVVA 3M4OB 2J7ZA 4KHVA 3A55A 1A15A 3D31A 4MIUA 4X3KA 2LFNA 2DY7A 1PXUA 1HUMA 3W2DA 2SDFA 2B8FA 4QIWB 4XYQA 1JWMD 4IUQA 2F0WA 2EYOA 2B2VA 1I4HA 5C0XH 1F2LA 5ELFA 5NUCA 1WTWA 3FRPB 5DM63 4TQUS 2I46A 1S4ZA 3H94A 1LACA 2JA8B 4UAIA 4FXDA 1YNJC 2WV6D 1O7LA 3T16A 2DNEA 3U9SA 3Q23A 2EJGC 5E3FA 2KECA 1KDCA 4RAUC 4RGTA 3MXPA 3V96A 5EKLA 1GXDC 2SOBA 2O5JC 2B2TA 1L0XB 4C3IG 1JQYD 1G2SA 2JYOA 3MXGA 4BA1I 1PTOH 3QB3A 1BCPB 4DF7A 1U4PA 2A6ED 4CJ1B 5C4ZA 3KUPA 1SFOB 1F9SA 5K36G 2B8GA 1C48A 2YU9B 1I3QB 3D4DA 3BS1A 2JE6I 4G7ZC 1ZYRD 1K8MA 1OXUA 5IOCA 3MHBA 3VR3A 1RHPA 3DXJC 1RTNA 3J7AF 4HCSA 4DAYA 2B2WA 2R6GA 4RHRA 1JOOA 4IN3A 4HMIA 1DM0B 4B08A 3HZXA 4FP5D 1SE3A 4ZKBB 3X3NA 4RWSC 2CW0C 2F0FA 3FVQA 5CV7A 1VMPA 1RF2D 3RD4A 3HGBA 3WOFA 5M5XB 2KJXA 4L8JA 2K33A 5A35A 2Y0SB 3CRKC 3M4YA 3EVQA 3OHXC 1S5BD 5C44B 2XWBB 5FLXL 3SXHA 2B2YA 2DY8A 3T56B 5M9OA 2RDFA 4LK1C 1VCIA 2XRSD 4XQQA 4B9XA 3GV6A 3TDQA 2KVMA 5JJZA 1DZ1A 4LMQD 2ZXPA 1IYVA 5JEAH 2F0GA 1HFNA 3NTHA 5A2QL 4RGMA 2KUMA 1CM9A 2EYLA 4MN3A 2L0CA 3VR4A 1R4QB 1D1IA 2JA5B 1BNZA 3BDOA 1STBA 1TS5A 1PZKD 3OIQA 4FF4A 4NDXA 4J8QA 5BN3A 1FNVA 1QILA 1RDPD 4DXGA 5KEEA 1HA6A 4NKLA 2G9HD 3CU7A 1LT6D 3NTIA 3VR5A 4N9PA 1Z6HA 5DNFA 4DU9A 1PTOD 3DUZA 3M3YB 3A8JE 4F7XA 1G291 2E74C 4A3FB 3KLSA 3S9WA 2AQ3B 4IFDH 2ENBA 2SEBD 1H9SB 2NVQB 1A3TA 1E0BA 2PCFB 1OXVA 2J4XA 5HGTA 5EPJA 2EYMA 2F0NA 1V1OA 3KK7A 3K5NA 2RVLA 1TKWB 5KYIA 1W6JA 4NMZA 4DK0A 3NQIA 1AZPA 3ERQA 3WOEA 3GTGB 3PO3B 1JWSD 1IYUA 1TY2A 1DXMA 3SEBA 5JPMC 5F2DA 1W6KA 4E6IA 2O2LD 2HDMA 1DJRD 3D4WA 4HMJA 4FF1A 2EDGA 1ET6A 4RKBA 2AUKA 3FMCA 1CI3M 4C3HB 1CQFA 2WACA 3KBXA 1PZJD 2L5TA 5FO7B 4XXEA 2PZUA 1KABA 3R3OA 5LHY1 3R2IA 2K5DA 2WINB 2PZWA 2AQ1B 3AB9A 5G3LF 2CW0D 3KLSX 1HA5A 2IX0A 3K58A 4IUTA 4ZQ3A 5M5YB 3GD7A 1MD2D 1DCZA 1SNDA 4IUPA 1GJXA 2BDNA 1DOMA 3T53B 4IZ8A 3D6CA 2PW7A 1EYDA 1ILQA 3EJIA 3MEHA 2K28A 1WD1A 2EYHA 1WTXA 4A3KB 2H4OA 1L0YB 1KNEA 3PUWA 2Z4IA 3AMUA 3OPOA 1HFGA 2F3WA 2NUCA 1S5ED 1HQMC 2WKCA 4FF3A 5FO9B 5K36H 4BY7B 3IFDA 3KF8A 4WFN3 2F0VA 2F0JA 2AQ2B 3GP7A 2A6EC 4CGYB 4ZRZA 2PW5A 5KGUA 1I50B 2ZXOA 1JORA 3FEWX 4PMBA 1SEBD 1GOZA 2F0MA 5IODA 4CKCA 1EU3A 1FNWA 4A3BB 1EQVA 1WD0A 4K2KA 4RA8A 4IALA 4ZKCB 3MA2B 4ME5A 4ZYSA 5CR3A 2A68D 3SK6A 1A3UA 2D62A 3H0GB 3K6OA 2Q8RE 4HN7A 3ND8A 1KDAA 5C0XG 2HCCA 4KKTA 2PQEA 1LTBD 2F0KA 3SHLA 3OOCA 5C6AA 2F0QA 2O4XA 2LMCB 1RJTA 1RD9D 4PNYA 2JEBI 1JB3A 3PUYA 4MHEA 3IL8A 4C1NI 3TZUA 4CKEA 3A54A 3I4LA 2BE5C 4A3DB 3NTKA 1STEA 3HOUB 1STNA 2JXMB 2X69A 4RGOS 2JEAI 2BDOA 1B3AA 1OO9B 2WP8J 5FK9C 2ICIA 4XT1B 2RKSA 2HCIA 5KNDA 3H6MA 2K7VA 3HKZB 1CT1D 1EZ6A 2SNMA 1CK1A 1LTSD 1WTVA 1WTRA 2QILA 3VYTA 1GUNA 4ZAIA 5JOBA 1ENCA 3OWEB 1SNPA 4ZLTF 4IFDI 3M7GA 1ILPA 4G4KA 2QF7A 3BYTB 1B4OA 1ZXTA 4CJ2C 4DFAA 5M3FB 3QO2A 2V4DA 1SMYD 4C3IB 3MC0B 2QEJC 4KMUC 4UDUC 3UI2A 3PIP3 4C3JG 1ICWA 2WKDA 1EY5A 2F0SA 4G57A 3K7AB 4M8AA 1EY9A 4G7HC 1NR2A 1PTOB 4RGNA 4OO1G 1V8QA 3N6RA 5C0XJ 2XVSA 2WB1B 5EQ0A 3VA5A 2F0HA 3MFYA 1SE4A 1KLGD 1TS3A 2MPMA 1GUGA 2IJ0A 2N55A 4C56C 3PV0A 3MXNA 1PRTD 4FO2A 5CV5A 2XWJB 1RKNA 1QWYA 5ELCA 1H9KA 2IX3A 3MTSA 2KOLA 1JOQA 3H3VC 3BDLA 2VXWA 1IKMA 1JE4A 3TSSA 4NW2A 1G6ZA 1E2ZA 3IFTA 5IIFA 2N88A 4GZYC 1LTRD 4K2LA 4EQPA 3Q22A 3K0YA 3DEPA 4A3EB 2RDGA 3OSOA 1ZKOA 5COYA 1YNNC 5I9PA 1IW7D 4K14A 1SJHD 2IW3A 2E2HB 1TQOA 1LTGD 1Q8IA 4KN4C 3BZDB 4KY7A 4TSSA 1PMRA 4PMCA 3TP5A 1Q3LA 1EY7A 4H44C 3EROA 3NPPA 1Y8NB 1GHJA 4IQZA 4PMWA 1I4GA 2NWGA 4QF4A 5FLXE 3TP8A 2EY5A 1QE6A 2L11A 3QG1A 5C0XI 3K57A 1IHZA 3Q0AA 2F1MA 5T1IA 4CJ0B 5IT9E 4PQXA 1BR9A 4K5WA 1LTTD 1ENAA 1EQTA 3NBHA 3DEOA 1A2TA 1O7ZA 2H1EA 3RUZA 3GO5A 1QG7A 2B2YC 1SNCA 5KYLA 2HDLA 1K8OA 1PYWD 4ILWA 4M1UB 3I91A 5D3IB 5LL6X 5C3WA 1U9RA 3PIO3 2K03A 3BVZA 5FO8B 1SYFA 5CV8A 1U4LA 4RH6A 3S15B 1QOHA 1CFMA 3HG9A 5I6YA 4ODGA 3A56A 1SXTA 1Y69U 2QDBA 3S14B 2DNCA 4XDXA 1BF4A 5T1GA 3ONAB 2B39A 3CKIB 1MSHA 1BCPC 2KCNA 3JAML 3DHQA 1QCBD 4K8IA 3DM1A 4DNTB 3HP3A 1F2ZA 3D6WA 1ONLA 1RCVD 1EY8A 1UUPA 2IT1A 1OXXK 3BG3A 1DOLA 4HR7B 4EVOA 1F9QA 1AEXA 1D1KA 3I70A 2FHTA 3P20A 2F0OA 1LABA 4OL7A 5K5PA 1EY6A 1TY0A 5D3DA 3VA7A 1NSNS 4HSPA 1AFPA 5C5MA 4K6DA 2A69D 3DWQA 3A8KE 3QJYA 4RFBA 2MP1A 2B2UC 1C8CA 1KDBA 1G2TA 2EYFA 1WVLA 3S16B 4PV1C 4IFDG 1JWUD 2ZT9C 3V2TA 1RTOA 1U4RA 2KEDA 4DK1A 4LJZC 2OT2A 4I7ZC 3ZYYX 4KJNA 3BDCA 4TRDA 1I4PA 5TSSA 1AW7A 2I07B 1I4QA 5C3EB 4Z9CB 4A3GB 1FYCA 1GHKA 5J39A 4DGZA 2PO4A 4IUNA 1FNUA 4Q0FA 2EYJA 3S1MB 5KIXA 5ISRA 3HOWB 2FMMA 4BA2I 3GTMB 2NN6G 5KRUA 3HOYB 5CMDA 5JEAG 2EJFC 2F4IA 1LV9A 1QJOA 2A5HA 2M00A 3SR1A 1CZGA 1V1PA 2LY7A 3QOJA 2NVTB 3NQTA 2GA4B 2R7ZB 1U4MA 1EFID 5C4JB 3HRZC 1TWAB 4KJOA 5I4DA 3C2PA 3FPPA 2F03A 5JVG3 4A3JB 3VYSA 3E5SA 1BCPF 5J22A 3I3CA 5CORA 5EJWA 4OIKA 5CV6A 3PUVA 4P2CB 1TWCB 3LWEA 1EYCA 1PRTF 1PFMA 2EOTA 4ZUIA 2L55A 2A6HD 1XX8A 3FDTA 2IWHA 1F2MA 4L63B 1HXYD 2M9VA 2NTSA 5CC4A 1EY4A 4KN7C 1ZEQX 3A7LA 3K5LA 3S1QB 1SJED 3L9AX 1KLUD 1BBXC 4OO1I 3J81E 3HOVB 2CVRA 2A68C 1HTPA 1CA5A 3H91A 2BOSA 4XQJA 4H13C 3KLRA 2OXPA 1R9TB 2MJ8A 1SSOA 1PRTC 4BWGB 1OXTA 4F8MA 4XYOA 1B50A 2FMCA 3PMFA 2FJ2A 4RHSA 1S5CD 3IKJA 1O78A 4Y7NB 3MZ5A 1Q90A 4C2MB 1Y1VB 5KNBA 3L7ZC 2Q8TA 3RLFA 5BN4A 2K1BA 1DD2A 2AWNA 1Y8PB 4X3SA 4KK7A 2XNAC 4V190 4V0BA 2NN6H 1TWHB 4B9WA 2BCOA 4IURA 4A3IB 1ESFA 1QB5D 1B1ZA 2F0PA 1VMCA 1R4PB 2E2IB 1TU2B 1DOKA 1JCKB 4J6HA 3SE0A 3GV3A 1HUNA 4EGVA 3VR6A 3C1EA 4ZK9B 4CBVA 5HURA 3TBIB 1D2BA 3FKIB 1JICA 2B2TC 1HQRD 1LO5D 3GTLB 3VYUA 5IGEA 2XIWA 3PUZA 2RQXA 1Q1BA 2JP1A 1UAPA 1VF5C 2RSOA 3NK9A 3RMHA 1SYBA 1S5DD 5C4HA 4DNRB 1ESRA 1MBYA 4H7BA 5D65A 3C46A 2K6AA 1Y1WB 3CHBD 3DWAA 4RCOA 1EU4A 2D9UA 4FNFA 2BE5D 3NXWA 4KKSA 2O5IC 1SYEA 2NTTA 1FD7D 1X3PA 3RZDB 3W3AA 2YYZA 2PZTA 2A6HC 1WTPA 5M5WB 1II3A 5FOBB 2NYZD 4U673 3S1NB 3Q24A 3GTJB 5EPLA 2Q8IB 1FGBD 2F0IA 1D6EC 3PUXA 4WORA 1SAPA 2EY6A 1B9MA 3J7YW 2EE1A 2F0UA 4I65A 4U68A 5EBDA 4G7OC 5IGDA 3P75A 4KD3A 1A2UA 3QOLA 1WCMB 4R8IA 2VB2X 1T5XD 5C3XA 4BY1B 3A7AB 1TVXA 1TT2A 1BO0A 3L3OC 2NZ1D 3DMUA 4BBSB 1QNKA 1LT5D 3J7AV 1STYA 1H9RA 1A6XA 2IL8A 4A93B 2C9OA 3OMGA 5JVH3 5KNCA 4C3HG 3G6JB 1NAPA 1XWEA 5JAVA 1DYQA 5C5LA 2ID0A 2EPBA 1BOSA 2BA0A 2F0LA 5IGGA 3V05A 1O7YA 1WTOA 3D3RA 3NWSA 1EYAA 3O13A 1TWFB 3T4AC 2XRQD 5EBCA 2R92B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5D D;  5ELB A;  4O1N A;  1HTL D;  3R2I A;  1F77 A;  3R2T A;  1D5Z C;  1LTB D;  1RCV D;  1PTO B;  4RGN A;  2RDH A;  1V1P A;  2AQ1 B;  1TS5 A;  1PZK D;  1UUP A;  3CHB D;  3DWA A;  4RCO A;  1G8Z D;  3KLS X;  1D5M C;  1EU4 A;  1HA5 A;  1FNV A;  1QIL A;  1RDP D;  1PTO C;  4DXG A;  1PRT C;  4BWG B;  1CHQ D;  2G9H D;  2NTT A;  2CHB D;  1EFI D;  1EEF D;  5FKA C;  1LT6 D;  1RD9 D;  1SE4 A;  1LT4 D;  1V1P B;  1KLG D;  1TS3 A;  1AN8 A;  1FD7 D;  1MD2 D;  2IJ0 A;  4C56 C;  4RHS A;  1XXG A;  1TY0 A;  4RHR A;  1S5C D;  1EEI D;  5D3D A;  5I4D A;  2XN9 C;  1JR0 D;  1PRT D;  1LT3 D;  1PTO D;  3BYY B;  3R8B A;  1SE3 A;  3W2D A;  1ENF A;  1LTT D;  3DWQ A;  4RFB A;  1STE A;  3MFG A;  3DWP A;  1CHP D;  5ELC A;  1L0Y B;  1RF2 D;  4RGO S;  1JWM D;  1FGB D;  1D6E C;  3EFX D;  4OHJ A;  3BVM A;  2AQ3 B;  4DXF A;  2SEB D;  1BCP D;  1BCP F;  5FK9 C;  1I4H A;  1JWU D;  3TSS A;  2ICI A;  2TSS A;  5ELF A;  1I4R A;  1S5E D;  2J4X A;  3BVG A;  1ET9 A;  1PYW D;  1LLR D;  2XNA C;  3EA6 A;  5D3I B;  3URY A;  1CT1 D;  1LTR D;  1BXT A;  1CK1 A;  1V1O A;  1LTS D;  2AQ2 B;  1LTA D;  3GP7 A;  2IPK D;  1I4X A;  5ELE A;  1SBB B;  2QIL A;  1T5X D;  1S5B D;  2RDG A;  3BVZ A;  1ESF A;  2WV6 D;  1D5X C;  1PRT F;  5ELD A;  1B1Z A;  1I4P A;  1SJH D;  5TSS A;  1AW7 A;  1EWC A;  1JWS D;  1I4Q A;  4RH6 A;  1PZI D;  3OWE B;  1PRT B;  1TY2 A;  3SEB A;  1M4V A;  1LT5 D;  4Z9C B;  2R61 A;  1KTK A;  1SEB D;  2Z8L A;  2XRS D;  1JCK B;  1LTI D;  1LTG D;  1TS4 A;  4L63 B;  1GOZ A;  2O2L D;  3BYT B;  1B44 D;  1SXT A;  1HXY D;  3BZD B;  4RGT A;  1DJR D;  2NTS A;  1EU3 A;  1S5F D;  1L0X B;  1TS2 A;  1FNU A;  1JQY D;  4TSS A;  1FNW A;  1SJE D;  1DYQ A;  4K6L A;  1ET6 A;  1PTO H;  1BCP B;  3MC0 B;  1HQR D;  3V05 A;  2QEJ C;  1KLU D;  1LO5 D;  4UDU C;  4L6T B;  4RGM A;  1XTC D;  4ZYS A;  1CQV A;  1PZJ D;  3O13 A;  2XRQ D;  1I4G A;  1SE2 A;  1UNS A;  1BCP C;  1PTO F; 
#chains in the Genus database with same CATH topology
 3PO3 G;  3PF4 A;  1SE8 A;  2R7D A;  1W3S A;  3U58 A;  4X65 Q;  1D5Z C;  5DAU A;  3NHH A;  3EQL C;  4DR4 Q;  1Y8O B;  5IWA Q;  3TS0 A;  1KNA A;  2PPB C;  1NR4 A;  2DUD A;  1YZ6 A;  5IT9 c;  1VF7 A;  1CHQ D;  1J9O A;  1EEF D;  1NBW A;  3ULJ A;  4YY3 Q;  3TS2 A;  1XNQ L;  3M7N A;  4C1N K;  1VQP A;  4K0K L;  5BR8 Q;  3F1Z A;  3KYH C;  4A3B H;  1WCM G;  4A3M G;  1ENF A;  4B3S Q;  4R1J A;  2QA4 A;  2UXC L;  1E2V A;  5JPN C;  3T51 B;  1HR0 W;  1HPC A;  2ICE C;  4N9T A;  3GTO B;  4RKL A;  4DAV A;  1C4Q A;  2BH2 A;  4BS9 A;  1FVI A;  1SYD A;  2K01 A;  3I90 A;  3HOY H;  1Z7T A;  3GTQ B;  3LNN A;  2UUA Q;  4DPG A;  3BVG A;  1V1Q A;  2EJM A;  1TWG B;  3EA6 A;  4KD4 A;  3URY A;  5I2Y A;  1LTA D;  2IPK D;  3F2U A;  4X3T A;  5ELE A;  1GUW A;  2NVY B;  3KBG A;  2A69 C;  3J7Z C;  3NP8 A;  3P1H A;  3I4N B;  1PLF A;  4S3S A;  4KKU A;  4CKB A;  2PQA A;  2QW7 A;  2OTJ A;  1HZB A;  2Z1C A;  4IUV A;  4IPD A;  1KTK A;  4BBS H;  4X66 Q;  2Z8L A;  5I2X A;  5D14 A;  3VR2 A;  4QUF A;  1PH2 A;  2HUG A;  1TS4 A;  3I4M B;  5M5X H;  1OXS C;  1HHV A;  1FR3 A;  4B3T L;  1VQD A;  1S5F D;  2L12 A;  1PH5 A;  1ZYR C;  4QB4 A;  1PA6 A;  4AIM A;  4APV A;  2AUJ D;  2X6G A;  2PNR C;  2B2W C;  4X3U A;  4GOP B;  1EIH A;  3H0G G;  4AYB B;  4DN4 M;  5IGB A;  2EXZ A;  4L6T B;  3NE5 B;  3CCM A;  1GUT A;  2R3Z A;  1PDQ A;  3MXU A;  4HCE A;  1E22 A;  4IFD J;  4K8J A;  2UUC Q;  1SE2 A;  2E76 C;  1SYC A;  2SNS A;  3NSW A;  3CCQ A;  2JA7 H;  1GD7 A;  2UUB Q;  4FF2 A;  2K04 A;  4O1N A;  4EQN A;  3HOY G;  2R7Z G;  4JI5 L;  4LF4 L;  4L5Q A;  4XT3 B;  1G6P A;  1MSG A;  4OWW B;  2F3V A;  2ZTC A;  4JI3 L;  4NP5 A;  1PTO C;  4KY6 A;  5BR8 L;  2NZO A;  4YIJ A;  2CHB D;  4A3G H;  4GLX A;  1LT4 D;  1V1P B;  5E1F A;  4A3B G;  4LFA L;  3QIA A;  1PFB A;  5C44 G;  3S2H H;  3A0J A;  4H0L C;  4KV6 A;  3LWU A;  4HSV A;  2XN9 C;  4DA2 A;  1STG A;  1NMF A;  5LL6 S;  4OX9 Q;  5EKK A;  4HTH A;  4P74 A;  3LX0 A;  2M2L A;  2WAQ B;  3MFG A;  1U0L A;  2YTY A;  4JV5 Q;  2L1B A;  3DWP A;  4LFA Q;  5G3L D;  1WYD A;  2JN4 A;  4JI1 L;  3OWF A;  3EFX D;  4OIJ A;  3CME A;  4OO1 H;  4FXG C;  4DV3 Q;  1EQQ A;  2NB0 A;  2A8V A;  1NUC A;  4LF7 Q;  4QUC A;  5CYU A;  2NVX H;  1SFO H;  5JEA J;  2K5Q A;  3H3V I;  4ZUJ A;  5FLM H;  3D4R A;  1GVP A;  4QIW E;  4QMG A;  2JA6 G;  3A74 A;  5JJL A;  5A2Q E;  1EIG A;  4B3M L;  1TII D;  2KQ3 A;  3HOZ B;  5EPK A;  2ZJQ A;  2C5C A;  4X64 L;  1D7Q A;  2JA9 A;  1L1O C;  4XTC S;  5FLX c;  2NVX B;  4DR7 L;  1AP0 A;  1VQI A;  4HED A;  3G7L A;  4KTA A;  4DR1 L;  1MGS A;  3E6Z X;  4B3T Q;  1PFS A;  4JYA Q;  3Q8D A;  1T5E A;  4DR5 Q;  1LTI D;  1UE5 A;  2L4N A;  2WB1 G;  3HEJ A;  4JOI C;  3PQI A;  4NPS A;  4B3M Q;  5C4X B;  1JMC A;  4LFB Q;  1PH4 A;  3CCL A;  1HZC A;  1EZ8 A;  5DLQ E;  3J81 L;  4JI6 L;  3IAY A;  4K6L A;  3TME A;  5GRO A;  5M3M B;  4OEM B;  2VQE Q;  3C3L A;  1EQR A;  3TZD A;  2Q2I A;  1O80 A;  1AH9 A;  1WTH A;  4A3M B;  4ABN A;  2EIF A;  3CQZ B;  2E2D C;  4IUU A;  2J0T D;  3NEL A;  1UNS A;  1EWH A;  5IY0 A;  5JJK A;  3CCJ A;  5ELB A;  1UE1 A;  1QNU A;  1F77 A;  2VY3 A;  2OF1 A;  1WFQ A;  4DV0 Q;  1E1T A;  3MWY W;  3ZJY C;  4A75 A;  3GTP B;  5I9O A;  2RDH A;  1CA6 A;  2RBM A;  1K83 B;  3U9O A;  1ICF B;  4C3J B;  1G8Z D;  2KHS A;  3HOX B;  3ND9 A;  1STA A;  5FKA C;  2WAQ G;  1ASZ A;  1AN8 A;  1KRT A;  1XXG A;  3PF5 A;  1NY4 A;  1EEI D;  2NN6 I;  2G9D A;  3I72 A;  4FYD A;  1UEA B;  2JA6 B;  2EYP A;  2LXK A;  4A3C H;  4R8N A;  1TR5 A;  3GDE A;  2VQF L;  2VB3 X;  1YNN D;  2TMP A;  3WDN A;  1G91 A;  5CBE E;  2QCP X;  1I50 H;  2C35 B;  2FIN B;  3SGI A;  3CRL C;  4BXX H;  1F9P A;  4OHJ A;  3NBI A;  5IYC G;  5E7N A;  3D0F A;  1PH1 A;  1BCP D;  4DAP A;  1NJI C;  3QWN A;  1ET9 A;  3J7A 5;  1VDZ A;  2D2C C;  3HS0 C;  3SK5 A;  3FPU B;  3CCE A;  3M85 A;  2NVY H;  1UWV A;  4DV6 L;  1SBB B;  4ID6 A;  1FJG L;  3E0J A;  4F88 A;  4DNI A;  1D5X C;  2UUC L;  5DM7 3;  1M8A A;  2NBF A;  1STH A;  1EOT A;  1SNO A;  3P7J A;  1EWC A;  1SNM A;  1EL0 A;  2XSC A;  2R93 H;  2OEO A;  3UDX A;  4O2D A;  4DV5 Q;  4J1M A;  1M4V A;  1Z47 A;  2CQA A;  2R61 A;  3ITP A;  5I6W A;  4JBW A;  4LFC L;  2RSN A;  4A3J G;  1DON A;  2ALY B;  2IHE A;  3R93 A;  2AKW B;  4F87 A;  3T1Y L;  3K5M A;  2WB1 E;  5CBA E;  2UXB L;  1H9S A;  3I73 A;  5DEH A;  2JA5 H;  4FXK C;  1YNJ D;  4Q5V A;  2EVB A;  3PO2 B;  4AQY Q;  3SK4 A;  2JSO A;  2JA7 G;  1IKL A;  1TXY A;  3GTJ H;  1XTC D;  1MJE A;  2BA1 A;  2RA4 A;  3PGZ A;  2NVQ H;  5IGF A;  3S2H B;  2F0E A;  5CV9 A;  3TP7 A;  1MI2 A;  2X6L A;  4EQO A;  3Q6S A;  1Q12 A;  4DK6 C;  3FHW A;  5EKI A;  3KLW A;  2Z0S A;  1PVO A;  3S1R B;  3VYR A;  3K80 C;  1D5M C;  2IHF A;  4DR6 L;  3I8Z A;  2PYK A;  1HCZ A;  4KI0 A;  3A8I E;  3N52 A;  2IY5 B;  3KOJ A;  1Z9F A;  2K52 A;  1I6H B;  1MHW C;  1CTM A;  2K05 A;  2PMZ B;  1HNW Q;  1Y1W H;  2KEE A;  1JR0 D;  2WAQ E;  1JOK A;  1LT3 D;  4MTK A;  4OWT B;  5EGT A;  3BYY B;  1VQK A;  4WJ3 M;  2VUM B;  2EY1 A;  1GM5 A;  1EFW A;  2RHQ B;  4QCL A;  4CHT B;  3MAQ A;  1H9J A;  1BDO A;  1S3O A;  2DN8 A;  2A74 C;  1ROD A;  4FVM A;  1QUQ B;  2KHI A;  3S17 B;  3TP6 A;  1IBM L;  4YHH L;  3GTK B;  4BBR B;  1NCV A;  4DXF A;  4ZCK A;  1A3V A;  2B2V C;  1IL2 A;  3JAM E;  3OW7 A;  2EZV A;  1LLR D;  5J1Z A;  3G71 A;  1T9H A;  2I5L X;  2QKI C;  3L2P A;  3TN2 A;  2JA8 H;  2KEN A;  5IWA L;  1I4X A;  4A3M H;  4RCN A;  2K50 A;  4WJW A;  4X64 Q;  1Q1E A;  1J8I A;  1SDF A;  2MFI A;  1IL8 A;  1JC7 A;  4X62 L;  1PZI D;  1PRT B;  2F0D A;  5E4W C;  3OMC A;  1X32 A;  1B53 A;  1KAA A;  2MHV A;  2PI2 E;  4GKK Q;  4A3I H;  4ALP A;  1IW7 C;  5E4X A;  1S40 A;  1TS2 A;  1H9M A;  5CGK A;  2E2J B;  2MUY A;  1BQQ T;  1N33 Q;  1NMG A;  2VUM G;  2L9H A;  1ML0 D;  5BN5 A;  1VQE A;  2PNH A;  4DUZ Q;  2B2U A;  1CQV A;  4QQB X;  1TWA H;  1CKO A;  1E2W A;  2ZXR A;  3H09 A;  3HOU G;  1PTO F;  3NUC A;  2R93 B;  2HHH Q;  1SNQ A;  3KF6 A;  3R2T A;  3SVM A;  1IBL L;  3I4N H;  4GNX C;  2JK8 A;  4XQN A;  1B9N A;  3HOV G;  3MXN B;  3AU7 A;  1X3Q A;  2F52 A;  3C1F A;  2VNU D;  2UXD L;  4TKO B;  5IT9 L;  2EY2 A;  5AFW A;  1YEZ A;  2KA7 A;  3OIP A;  4DR2 Q;  4KY5 A;  3R8B A;  1VQL A;  4FDB A;  3SDZ A;  2A73 B;  3S2D B;  4O42 A;  3OTO Q;  1CHP D;  4O0A A;  4LAA A;  3SK8 A;  3BVM A;  4RMF A;  4YY3 L;  1HNX L;  3S24 A;  1I94 L;  5IYC H;  1BUV T;  3T1H L;  2TSS A;  2JA7 B;  5CV4 A;  1HRJ A;  1I4R A;  2LKV A;  4X66 L;  4ULL A;  2K5N A;  1K28 A;  5IGC A;  4DV4 L;  4DV6 Q;  1BXT A;  2HQE A;  3BU2 A;  4A3E G;  1EIF A;  1N36 Q;  1F2Y A;  1SMY C;  4HAE A;  4K5V A;  1QZG A;  5ELD A;  4OGQ C;  2H5X A;  2LS0 1;  4K5X A;  2AWO A;  3KF8 B;  1B2T A;  1SYG A;  1JE5 A;  1GUS A;  1NTG A;  2WII B;  2MNA A;  3X3M A;  1EY0 A;  1I6V C;  3K5O A;  3B6Y A;  4DV1 Q;  1B44 D;  2ZTD A;  4DAM A;  2FFK B;  1F9R A;  2IX1 A;  4KHZ A;  2D5D A;  3I4M G;  1VQN A;  2UUB L;  3S1R H;  4WRD A;  2K32 A;  2B63 H;  3GQB A;  3T13 A;  3J80 E;  1PFN A;  2UXC Q;  1CZW A;  2MQH A;  2E75 C;  1ASY A;  4DV3 L;  2Z4H A;  1AZQ A;  1KQS A;  4JK1 C;  4XIG S;  3G48 A;  2K5W A;  1EUJ A;  1V43 A;  2F0T A;  1WTQ A;  1HH2 P;  2KCC A;  2YU9 H;  4P75 A;  3E9H A;  3GTQ H;  2YV5 A;  2MGS A;  1HTL D;  1R9T H;  3J80 L;  5LMN Q;  1XYI A;  3K59 A;  3UDG A;  4R9W A;  2B63 B;  1Q7Y C;  3D8G A;  2Z6K A;  3NWT A;  3RZO B;  1GUO A;  3A5Z B;  3MVV A;  2CWA A;  1B70 B;  3M4O B;  4JYA L;  2J7Z A;  4LFC Q;  4KHV A;  3A55 A;  1A15 A;  3D31 A;  4MIU A;  4X3K A;  3VDY A;  2LFN A;  2DY7 A;  3TEH B;  2ZM6 Q;  1PXU A;  1X3E A;  1HUM A;  3W2D A;  4A3E H;  4JVZ A;  2SDF A;  1XTD A;  2B8F A;  4QIW B;  3TQY A;  4A3K G;  3HOW G;  3S1N H;  4XYQ A;  1JWM D;  2F4V Q;  5LMU Q;  4IUQ A;  2F0W A;  1TWC H;  2EYO A;  2B2V A;  1I4H A;  5C0X H;  1F2L A;  4IPH A;  5ELF A;  5NUC A;  1WTW A;  3FRP B;  5DM6 3;  2EQS A;  4TQU S;  2I46 A;  1S4Z A;  1VQM A;  1YIJ A;  2YTX A;  3H94 A;  1LAC A;  3F2B A;  2JA8 B;  4UAI A;  4FXD A;  4LF4 Q;  1YNJ C;  2WV6 D;  1O7L A;  4A76 A;  3T16 A;  2DNE A;  3U9S A;  3Q23 A;  2EJG C;  5E3F A;  4QJF A;  2KEC A;  3KJO A;  2QGQ A;  3BZC A;  4JI0 Q;  3L0O A;  4LF5 L;  1KDC A;  4RAU C;  2D0O A;  4RGT A;  3AFQ A;  4N8F A;  5IYB H;  1Q82 C;  3MXP A;  3V96 A;  4HIM A;  5EKL A;  1GXD C;  2SOB A;  2O5J C;  2B2T A;  1L0X B;  4C3I G;  1JQY D;  4NXM L;  1G2S A;  2JYO A;  3MXG A;  4BA1 I;  1PTO H;  2R7Z H;  2HQL A;  3QB3 A;  1BCP B;  4DF7 A;  1U4P A;  2A6E D;  3K7A H;  4UY8 C;  1SR3 A;  4DUY L;  3LGJ A;  4CJ1 B;  3CPW A;  4J15 A;  5C4Z A;  4HIK A;  3KUP A;  4IOC A;  1F9S A;  1SFO B;  4A93 G;  5K36 G;  2B8G A;  1C48 A;  1VQC A;  2YU9 B;  1I3Q B;  3D4D A;  1IBL Q;  3RLN A;  1L2F A;  4A3F H;  3BS1 A;  2JE6 I;  4G7Z C;  1MKH A;  1K0S A;  1LUZ A;  2VS1 A;  1YIT A;  3CD6 A;  3J81 j;  1Y14 B;  1ZYR D;  1K8M A;  4DK3 C;  1OXU A;  5IOC A;  3HOW H;  3MHB A;  3M9B A;  3S1M H;  3VR3 A;  1RHP A;  3DXJ C;  1RTN A;  3J7A F;  1UE7 A;  4HCS A;  4DAY A;  2B2W A;  2R6G A;  4RHR A;  1JOO A;  3U4Z A;  4A3L H;  4IN3 A;  4HMI A;  1XPR A;  1DM0 B;  4B08 A;  3HZX A;  4FP5 D;  1SE3 A;  4ZKB B;  2OWO A;  3M4O H;  3X3N A;  4RWS C;  2CW0 C;  2F0F A;  3FVQ A;  5CV7 A;  1VMP A;  1RF2 D;  3RD4 A;  3I4O A;  3HGB A;  4GLA C;  2F3I A;  1L1O B;  3W1B A;  3WOF A;  5M5X B;  2KJX A;  4L8J A;  2K33 A;  5A35 A;  4TVA B;  2Y0S B;  3HKZ G;  1OTC A;  3JC6 6;  3CRK C;  4I7A A;  3S15 H;  3M4Y A;  3EVQ A;  5M3F H;  2MO1 A;  3OHX C;  3HKS A;  1S5B D;  5C44 B;  2XWB B;  4JI0 L;  1Y1W G;  3U50 C;  5FLX L;  3SXH A;  2B2Y A;  2DY8 A;  2B63 G;  3T56 B;  1VQ7 A;  3S2D H;  5M9O A;  4LK1 C;  2RDF A;  1SLJ A;  1JB7 A;  3I4M H;  1VCI A;  3NBH B;  2XRS D;  4XQQ A;  4B9X A;  1X9N A;  3GV6 A;  3TDQ A;  2KVM A;  2GVB A;  5JJZ A;  1DZ1 A;  2B3G A;  4LMQ D;  3W1G A;  4GN5 A;  2ZXP A;  1IYV A;  1EWI A;  5JEA H;  2F0G A;  4B3R L;  1WJJ A;  1VS0 A;  3HOX H;  3NTH A;  5A2Q L;  4DV5 L;  2UU9 Q;  4RGM A;  1HFN A;  1XMO Q;  4A93 H;  1KC8 C;  1BBW A;  1K83 H;  2RCF A;  1VQ4 A;  2KUM A;  3I55 A;  1CM9 A;  2EYL A;  4MN3 A;  2L0C A;  3G4S A;  1SN8 A;  2K5V A;  3VR4 A;  1R4Q B;  1D1I A;  2JA5 B;  3J80 c;  3OTO L;  1BNZ A;  3BDO A;  1STB A;  1TS5 A;  1PZK D;  3OIQ A;  4FF4 A;  5IYB G;  4CDE C;  4NDX A;  4J8Q A;  5BN3 A;  1FNV A;  1QIL A;  1RDP D;  1PYB A;  4DXG A;  3FP9 A;  5KEE A;  2E2J H;  1HA6 A;  4NKL A;  2G9H D;  3CU7 A;  4R4Q A;  1LT6 D;  3NTI A;  3CW2 C;  3VR5 A;  1VQ6 A;  4LUV A;  4N9P A;  1Z6H A;  5DNF A;  4DU9 A;  1PTO D;  4IPC A;  3DUZ A;  4QY7 A;  3M3Y B;  2KCT A;  3A8J E;  4F7X A;  1G29 1;  4LF5 Q;  3UE0 A;  2E74 C;  1K73 C;  4A3F B;  4JBM A;  1AE3 A;  3KLS A;  3S9W A;  1E7Z A;  1SRU A;  2AQ3 B;  4IFD H;  2ENB A;  2SEB D;  3RZD H;  1H9S B;  2NVQ B;  1A3T A;  1E0B A;  2PCF B;  4UP9 A;  1B8A A;  1OXV A;  4UPA A;  2J4X A;  5HGT A;  2WFW A;  1L0W A;  4GKK L;  3F8T A;  5EPJ A;  4A3K H;  2EYM A;  2F0N A;  1V1O A;  3KK7 A;  4JI2 Q;  3K5N A;  3GTK H;  2RVL A;  4PZ8 A;  1TKW B;  3HKZ E;  5KYI A;  1KIX A;  1W6J A;  4NMZ A;  4DK0 A;  3HOX G;  3NQI A;  1AZP A;  3ERQ A;  3WOE A;  3GTG B;  2DGY A;  3PO3 B;  1JWS D;  2VL6 A;  1IYU A;  3A5U A;  1TY2 A;  1DXM A;  3SEB A;  5JPM C;  4DR7 Q;  5F2D A;  1W6K A;  4LF9 Q;  5JJI A;  4E6I A;  2O2L D;  2HDM A;  1DJR D;  5ELN A;  3GTM H;  3D4W A;  1IBK L;  4HMJ A;  4FF1 A;  3RLO A;  2CQO A;  2EDG A;  2UU9 L;  4P73 A;  3TRZ A;  1ET6 A;  4RKB A;  2DJF C;  2AUK A;  3FMC A;  1CI3 M;  1YHB A;  1YJW A;  4C3H B;  1CQF A;  5M3F G;  4LNQ A;  1UEB A;  2WAC A;  3KBX A;  1PZJ D;  1XMQ L;  2L5T A;  5FO7 B;  4R4T A;  4XXE A;  2PZU A;  1KAB A;  3R3O A;  2Z6K C;  1FL0 A;  1YBY A;  5LHY 1;  3R2I A;  2K5D A;  2WIN B;  2PZW A;  2AQ1 B;  4KHP Q;  3AB9 A;  5G3L F;  2CW0 D;  3HOZ G;  3UDF A;  3KLS X;  2D0P A;  1HA5 A;  1K3B C;  2IX0 A;  2ZTE A;  3K58 A;  2KHJ A;  4IUT A;  1SRO A;  4ZQ3 A;  1G51 A;  4A3D G;  5M5Y B;  3GD7 A;  1MD2 D;  1DCZ A;  1SND A;  4IUP A;  1GJX A;  4A3L G;  3M4Q A;  2R7F A;  2BDN A;  1DOM A;  3CXC A;  4GS3 A;  1X54 A;  3GTL H;  3T53 B;  1N32 Q;  4IZ8 A;  1RL2 A;  3D6C A;  3GTG H;  2PW7 A;  1Q81 C;  1EYD A;  1Y1V H;  1ILQ A;  4PZ6 A;  1X65 A;  3EJI A;  3MEH A;  3AQQ A;  2K28 A;  2VQF Q;  1WD1 A;  4YWM A;  1BBU A;  2EYH A;  1WTX A;  4A3K B;  2H4O A;  1L0Y B;  2ATW A;  1KNE A;  3PUW A;  1N32 L;  2A19 A;  2Z4I A;  4YWL A;  3RR5 A;  3AMU A;  4A3F G;  2XGT A;  3OPO A;  1HFG A;  1VQA A;  2F3W A;  1N8R C;  2NUC A;  1S5E D;  3EN2 A;  5L37 A;  1HQM C;  2WKC A;  4FF3 A;  5FO9 B;  5K36 H;  1KRS A;  4BY7 B;  3IFD A;  3KF8 A;  4WFN 3;  2F0V A;  2F0J A;  2AQ2 B;  3GP7 A;  2A6E C;  4CDF C;  4CGY B;  1WI5 A;  3G6E A;  5LMN W;  4ZRZ A;  4BBR G;  2PW5 A;  5KGU A;  1I50 B;  2ZXO A;  1JOR A;  2JA5 G;  3FEW X;  1I94 Q;  4PMB A;  1I3Q H;  4JI4 L;  4LF8 Q;  1Q8K A;  2UXD Q;  1SEB D;  2CH4 W;  1GOZ A;  1IXR A;  2F0M A;  3HOV H;  5IOD A;  1JT8 A;  4CKC A;  1HZ9 A;  3AYH B;  3OW2 A;  1EU3 A;  2L15 A;  3IRB A;  1FNW A;  5LMN L;  4A3B B;  1EQV A;  1WD0 A;  3RZO H;  1HNW L;  3EIV A;  4K2K A;  4GOP C;  4RA8 A;  5LMU L;  1A0I A;  4IAL A;  4LFB L;  4ZKC B;  3HOU H;  4JCV E;  3MA2 B;  4ME5 A;  3BZK A;  4ZYS A;  5CR3 A;  2A68 D;  3SK6 A;  1A3U A;  2D62 A;  3H0G B;  3K6O A;  2Q8R E;  4HN7 A;  4UP7 A;  2OCE A;  2RHS B;  3ND8 A;  1KDA A;  5C0X G;  2HCC A;  4KKT A;  2PQE A;  1LTB D;  2F0K A;  3SHL A;  1LTL A;  3OOC A;  1J5E L;  1GO3 E;  3FKI H;  4CDC C;  2Z9H A;  5C6A A;  2F0Q A;  4OX9 L;  3CC4 A;  2O4X A;  1KD1 C;  2LMC B;  4DV0 L;  4YWK A;  1RJT A;  1Y1V G;  5C3E G;  1QZH A;  3J81 i;  1RD9 D;  4PNY A;  2Y0S G;  2JEB I;  1JB3 A;  3PUY A;  2AHO B;  1PH8 A;  4MHE A;  3IL8 A;  4C1N I;  3TZU A;  4CKE A;  3A54 A;  4B3R Q;  1Q86 C;  3I4L A;  2BE5 C;  4A3D B;  3NTK A;  1STE A;  1DGS A;  3HOU B;  1STN A;  2JXM B;  2X69 A;  3HOZ H;  4RGO S;  2BH8 A;  3GTP H;  2JEA I;  3CAM A;  2BDO A;  3OYY A;  1B3A A;  1OO9 B;  2WP8 J;  5FK9 C;  5GQO A;  4LWC A;  2ICI A;  1YHQ A;  4XT1 B;  2ASB A;  2RKS A;  5M3M G;  2HCI A;  4HID A;  2ZM6 L;  5KND A;  3H6M A;  4OON A;  4DUZ L;  2K7V A;  3W5O A;  1O7I A;  3HKZ B;  1CT1 D;  1EZ6 A;  2SNM A;  4A4I A;  1CK1 A;  1X56 A;  1LTS D;  4MNO A;  1WTV A;  1K9M C;  1WCM H;  2QIL A;  1WTR A;  4JI4 Q;  3CMA A;  4NXN Q;  3K7U C;  3VYT A;  3ERS X;  1HZA A;  1GUN A;  1VQH A;  4ZAI A;  5JOB A;  1ENC A;  3OWE B;  1CKN A;  1SNP A;  4ZLT F;  4LF9 L;  2Z6B A;  4IFD I;  3M7G A;  1ILP A;  4G4K A;  4DR4 L;  2HT1 A;  2QF7 A;  3BYT B;  1B4O A;  1ZXT A;  2A1A A;  4CJ2 C;  3WWV A;  4DFA A;  5M3F B;  2VW9 A;  4IO9 A;  1M1K C;  1VQ5 A;  3QO2 A;  2V4D A;  1SMY D;  4C3I B;  3MC0 B;  2QEJ C;  1XPU A;  4KMU C;  1XNQ Q;  4UDU C;  3UI2 A;  4K0K Q;  3PIP 3;  4P72 A;  4C3J G;  1ICW A;  5HY6 A;  2WKD A;  5C4X G;  4X6A H;  1X6O A;  2Q2T A;  1EY5 A;  1AE2 A;  4X62 Q;  2F0S A;  4G57 A;  4JI7 Q;  3K7A B;  4M8A A;  1EY9 A;  4G7H C;  4L5T A;  1E1O A;  1NR2 A;  1PTO B;  4RGN A;  4RG1 A;  4OO1 G;  1V8Q A;  3N6R A;  5C0X J;  3K8A A;  2XVS A;  2WB1 B;  2QDL A;  4MZ9 A;  2RCN A;  5EQ0 A;  3VA5 A;  3DLL A;  2F0H A;  1C0A A;  4JI7 L;  3MFY A;  1SE4 A;  1GKH A;  1KLG D;  1TS3 A;  3ER0 A;  2MPM A;  1GUG A;  2IJ0 A;  2N55 A;  4C56 C;  3PV0 A;  3MXN A;  5IP7 H;  1PRT D;  4FO2 A;  5CV5 A;  2XWJ B;  2Y0S E;  4GKJ Q;  1RKN A;  1QWY A;  4LF8 L;  4NXM Q;  3K81 C;  5ELC A;  1CUK A;  4GNX A;  1H9K A;  2IX3 A;  3MTS A;  2KOL A;  1JOQ A;  5M3M H;  3H3V C;  3BDL A;  2VXW A;  1IKM A;  1JE4 A;  3TSS A;  2VZA A;  4NW2 A;  1JJG A;  1G6Z A;  1XNR L;  1E2Z A;  3IFT A;  5IIF A;  2N88 A;  4GZY C;  1LTR D;  4R4I A;  4K2L A;  4EQP A;  3Q22 A;  4A3C G;  3K0Y A;  3DEP A;  4H02 A;  4DR1 Q;  4A3E B;  1WOC A;  2RDG A;  3OSO A;  1ZKO A;  5COY A;  1YNN C;  3H0G H;  2VUM H;  1IW7 D;  5I9P A;  4K14 A;  1SJH D;  2IW3 A;  4IJL A;  5GAE C;  2LSS A;  2E2H B;  2FXQ A;  1Q46 A;  1TQO A;  1VQF A;  4JBJ A;  4ME3 A;  2N8N A;  2ZJR A;  4Y52 H;  4JI6 Q;  1LTG D;  4A3I G;  1Q8I A;  4KN4 C;  3BZD B;  4KY7 A;  1PH9 A;  2N3S A;  4GN3 B;  4TSS A;  4JI8 L;  1PYS B;  1PMR A;  4PMC A;  3TP5 A;  2DJG C;  1Q3L A;  1PH6 A;  3STB D;  1BKB A;  1EY7 A;  4H44 C;  3ERO A;  3NPP A;  1Y8N B;  1GHJ A;  4YCV A;  4IQZ A;  4PMW A;  1I4G A;  2NWG A;  4JG2 A;  3QR8 A;  1I6H H;  4QF4 A;  4NB3 A;  1L1O A;  1VQB A;  5FLX E;  1YI2 A;  3TP8 A;  2EY5 A;  4DV2 Q;  1QE6 A;  5M5W H;  4JI3 Q;  4LF7 L;  1E24 A;  3KJP A;  4HJ9 A;  2L11 A;  3CCV A;  3QG1 A;  5C0X I;  3K57 A;  1VQO A;  1IHZ A;  3PCO B;  3Q0A A;  2F1M A;  1QVF A;  5T1I A;  4BBR H;  4CJ0 B;  5IT9 E;  4HJ5 A;  4PQX A;  5FJ8 G;  1BR9 A;  4K5W A;  1QVG A;  1LTT D;  1ENA A;  4JI2 L;  1EQT A;  2PI2 A;  3NBH A;  5H1S E;  3DEO A;  1A2T A;  1O7Z A;  3GTO H;  2H1E A;  3RUZ A;  3GO5 A;  4CDD C;  1QG7 A;  2B2Y C;  2AMC B;  1N34 Q;  1SNC A;  5KYL A;  3PO3 H;  2HDL A;  1K8O A;  1PYW D;  1TWF H;  4ILW A;  1CKM A;  4DUY Q;  4M1U B;  3I91 A;  5D3I B;  3ULP A;  1YJ9 A;  5LL6 X;  5C3W A;  1U9R A;  1PH3 A;  5FJ8 H;  3J81 c;  4HJA A;  3PIO 3;  2K03 A;  3BVZ A;  3K0X A;  5FO8 B;  1SYF A;  3NEM A;  4Y7N H;  1YNX A;  1N34 L;  3CCR A;  1EYG A;  5C44 H;  5CV8 A;  5AJ3 L;  1U4L A;  4RH6 A;  4A3D H;  3MEF A;  4LUO A;  4HJ8 A;  4C3H H;  1H95 A;  3S15 B;  1QOH A;  4A3J H;  1CFM A;  4BY7 G;  1IZ6 A;  3HG9 A;  5HGQ A;  4BY1 G;  5I6Y A;  4YCU A;  4ODG A;  3A56 A;  1SXT A;  4JV5 L;  1Y69 U;  2R92 H;  4B3S L;  2QDB A;  3S14 B;  1TWH H;  2R93 G;  1HJP A;  4DV1 L;  2VQE L;  2DNC A;  2K4K A;  2RF4 A;  4QGU A;  3CC7 A;  4XDX A;  1BF4 A;  5T1G A;  1PH7 A;  2OTL A;  3ONA B;  4LF6 L;  2B39 A;  1E3P A;  3CKI B;  1MSH A;  1BCP C;  2KCN A;  3JAM L;  3DHQ A;  4DV2 L;  1QCB D;  4K8I A;  3DM1 A;  4DNT B;  3HP3 A;  1F2Z A;  3STB C;  3D6W A;  1ONL A;  1RCV D;  2CWP A;  4MTN A;  1EY8 A;  2QEX A;  1X3G A;  1UUP A;  2IT1 A;  1OXX K;  3BG3 A;  2K14 A;  1DOL A;  2OQK A;  4HR7 B;  4EVO A;  1F9Q A;  1AEX A;  1D1K A;  3I70 A;  2FHT A;  3P20 A;  1P16 A;  2F0O A;  1LAB A;  4BBS G;  4R4C A;  2CKZ B;  4OL7 A;  5K5P A;  1XMO L;  3I7F A;  1EY6 A;  1A63 A;  4IJH A;  5ELO A;  1TY0 A;  4GNX B;  5D3D A;  3VA7 A;  1NSN S;  1KAW A;  4HSP A;  1IYJ B;  1AFP A;  5C5M A;  4JW0 A;  4K6D A;  1C9O A;  2A69 D;  3DWQ A;  3A8K E;  3QJY A;  4RFB A;  2MP1 A;  2B2U C;  4DAY B;  1RIP A;  1C8C A;  1KDB A;  3PIP A;  1G2T A;  2EYF A;  4DR2 L;  5C4J H;  1WVL A;  3S16 B;  4GLV B;  4PV1 C;  4DR5 L;  4IFD G;  1HR0 L;  1JWU D;  2ZT9 C;  2Q2U A;  3V2T A;  1VQ9 A;  1RTO A;  1U4R A;  3PIO A;  2KED A;  4DK1 A;  1VQG A;  4LJZ C;  2OT2 A;  4JI5 Q;  4GN4 B;  4I7Z C;  3ZYY X;  4KJN A;  3BDC A;  4TRD A;  4L5S A;  4KHP L;  1I4P A;  4OWX B;  5TSS A;  1AW7 A;  2I07 B;  1I4Q A;  5C3E B;  5IE8 A;  4Z9C B;  1FGU A;  1LM0 A;  4EQ5 A;  2P5Z X;  4A3G B;  1FYC A;  1N33 L;  4WJ4 A;  1S72 A;  4BY1 H;  4HJ7 A;  1GHK A;  3U4V A;  4DGZ A;  5J39 A;  3CQZ H;  2PO4 A;  2PQA B;  4IUN A;  3E9I A;  3F2C A;  4JBK A;  1FNU A;  4DV7 L;  4Q0F A;  1N9W A;  2EYJ A;  1XJV A;  3S1M B;  4AYB G;  5KIX A;  4OEL B;  5ISR A;  4DR3 Q;  3HOW B;  2FMM A;  2GVA A;  4BA2 I;  3GTM B;  5C4X H;  2NN6 G;  5KRU A;  3AEV A;  4GOP A;  3HOY B;  2Q2H A;  5CMD A;  5JEA G;  2EJF C;  4DR3 L;  1VQ8 A;  1JJ2 A;  2F4I A;  1LV9 A;  2NZH A;  1QJO A;  2A5H A;  2M00 A;  3SR1 A;  1CZG A;  1V1P A;  2LY7 A;  3QOJ A;  2NVT B;  3NQT A;  1M90 C;  2GA4 B;  2R7Z B;  1U4M A;  3PO2 G;  1EFI D;  5C4J B;  3HRZ C;  3KDF B;  1TWA B;  1XNR Q;  3CCU A;  1SMX A;  1QUQ A;  1XPO A;  4KJO A;  5I4D A;  2NVT H;  3C2P A;  2E5L L;  4A3G G;  3FPP A;  1PV4 A;  3J80 i;  1EOV A;  4IPG A;  2F03 A;  2N78 A;  1HNX Q;  1K8G A;  1HR0 Q;  3I4N G;  1CSQ A;  5JVG 3;  4A3J B;  3VYS A;  3E5S A;  1BCP F;  5J22 A;  3I3C A;  5COR A;  3UDI A;  3S16 H;  3AFP A;  1KL9 A;  5EJW A;  4OIK A;  5CV6 A;  2CFM A;  3CP0 A;  3T1Y Q;  4HIO A;  3NEN A;  1XMQ Q;  3PUV A;  1CKN B;  4P2C B;  1TWC B;  3LWE A;  4PG3 A;  1EYC A;  5IP9 H;  5AJ3 Q;  1PRT F;  2JQO A;  1PFM A;  2EOT A;  3S1Q H;  2E2I H;  4ZUI A;  2L55 A;  3M3Y H;  2A6H D;  2YTV A;  1XX8 A;  3FDT A;  5C3E H;  1D8L A;  2IWH A;  3RN5 A;  1F2M A;  4L63 B;  1MJC A;  1HXY D;  4DKA C;  2M9V A;  4JPB W;  2NTS A;  1VQJ A;  5CC4 A;  1EY4 A;  4KN7 C;  4UHV A;  1IBM Q;  1ZEQ X;  3A7L A;  3K5L A;  3S1Q B;  1SJE D;  3L9A X;  1KLU D;  1BBX C;  4OO1 I;  3J81 E;  2HD3 A;  4JOI A;  3HOV B;  4AYB E;  4LF6 Q;  3TRE A;  4JI1 Q;  2CVR A;  1C7Y A;  2JA8 G;  2A68 C;  1HTP A;  1CA5 A;  3H91 A;  2BOS A;  4XQJ A;  4H13 C;  1FJG Q;  3KLR A;  2OXP A;  4C3I H;  1R9T B;  2MJ8 A;  1HNZ Q;  1X3F A;  5IYD G;  3T1H Q;  1K8A C;  1SSO A;  4R4O A;  1PRT C;  4BWG B;  1OXT A;  2GN5 A;  4L5R C;  4BY7 H;  4F8M A;  1TWG H;  3EBE A;  4XYO A;  2I5M X;  1B50 A;  2FMC A;  3PMF A;  5IP7 G;  2FJ2 A;  1B7Y B;  4RHS A;  3I2Z A;  1S5C D;  3IKJ A;  1O78 A;  2I5H A;  4Y7N B;  3MZ5 A;  3RN2 A;  3CC2 A;  1A62 A;  3PO2 H;  2PMZ E;  1Q90 A;  4AQY L;  4C2M B;  1W2B A;  1J5E Q;  1U5K A;  1Y1V B;  5KNB A;  4X65 L;  3L7Z C;  2Q8T A;  5GAD C;  4KLK A;  3RLF A;  5BN4 A;  2OQ0 A;  2K1B A;  1DD2 A;  2E8G A;  2AWN A;  1Y8P B;  4X3S A;  4DV4 Q;  4KK7 A;  2G5D A;  2XNA C;  4V19 0;  4V0B A;  3E0E A;  1I5F A;  2NN6 H;  1TWH B;  4UP8 A;  4C3J H;  4P71 A;  4B9W A;  2BCO A;  4DR6 Q;  4IUR A;  4A3I B;  2UXB Q;  1ESF A;  3M4P A;  5J3B A;  1PHJ A;  4POG A;  1QB5 D;  1B1Z A;  2F0P A;  3KF6 B;  1VMC A;  1KHI A;  5EAY A;  1R4P B;  2E2I B;  1TU2 B;  1DOK A;  1JCK B;  4J6H A;  3SE0 A;  3GV3 A;  1HUN A;  2HHH L;  3JAM c;  4EGV A;  5IYD H;  3VR6 A;  3ULL A;  3C1E A;  4ZK9 B;  4CBV A;  5HUR A;  1CSP A;  2LXJ A;  3TBI B;  1D2B A;  3FKI B;  2K5H A;  1JIC A;  2MO0 A;  2CH4 A;  2B2T C;  3S17 H;  3CF5 A;  1HQR D;  1LO5 D;  4PZ7 A;  3GTL B;  1K3R A;  3VYU A;  5IGE A;  1JJC B;  3PUZ A;  2XIW A;  5M5Y H;  2RQX A;  2XTI A;  1Q1B A;  2JP1 A;  1UAP A;  1VF5 C;  2HIV A;  2RSO A;  4AH6 A;  1A8V A;  3NK9 A;  1X55 A;  2K75 A;  1LYL A;  3RMH A;  1EIY B;  1SYB A;  4POF A;  3JAM i;  1S5D D;  1HNZ L;  3E3X A;  5C4H A;  4DNR B;  1ESR A;  1MBY A;  4H7B A;  5D65 A;  1NE3 A;  2ZJP A;  4LW1 A;  3C46 A;  2K6A A;  3KDF A;  1Y1W B;  4BXX G;  3ICE A;  2KBN A;  3CHB D;  3DWA A;  4OXP A;  4C2M H;  4RCO A;  1J6Q A;  1EU4 A;  2D9U A;  4FNF A;  2BE5 D;  1KXL A;  3NXW A;  4KKS A;  2O5I C;  1SYE A;  2NTT A;  1UE6 A;  4NXN L;  3I56 A;  2CCZ A;  1FD7 D;  1X3P A;  4DV7 Q;  3RZD B;  3W3A A;  4EX5 A;  2YYZ A;  2E2H H;  1BVS A;  2PZT A;  4YCW A;  3RNU A;  2A6H C;  2E5L Q;  5IP9 G;  1WTP A;  5M5W B;  1II3 A;  3UE1 A;  5FOB B;  1N36 L;  2NYZ D;  4U67 3;  3S1N B;  3Q24 A;  4JI8 Q;  3GTJ B;  5EPL A;  2Q8I B;  4QL5 A;  1NNX A;  3FKI G;  1FGB D;  2F0I A;  1D6E C;  3HFZ B;  5GAH C;  2V1C C;  3PUX A;  4WOR A;  1SAP A;  2EY6 A;  1B9M A;  3J7Y W;  3KFU A;  2EE1 A;  2F0U A;  4I65 A;  2JJQ A;  4U68 A;  5EBD A;  4G7O C;  5IGD A;  3P75 A;  4N8X 1;  2ES2 A;  4KD3 A;  1A2U A;  3DM3 A;  1YJN A;  3CCS A;  3QOL A;  1K0R A;  1WCM B;  4R8I A;  2UUA L;  2VB2 X;  1T5X D;  5C3X A;  4BY1 B;  3A7A B;  1TVX A;  4LUZ A;  4GKJ L;  1TT2 A;  1IBK Q;  1BO0 A;  3PSI A;  3L3O C;  1YVC A;  2NZ1 D;  3DMU A;  4BBS B;  1QNK A;  1LT5 D;  4IOA A;  3J7A V;  1STY A;  2R92 G;  1H9R A;  1A6X A;  1P8L A;  3BJU A;  2B29 A;  2HIX A;  1B3Q A;  2IL8 A;  4JC0 A;  2C9O A;  3OMG A;  4A93 B;  2EXD A;  5JVH 3;  5KNC A;  4C3H G;  2N49 A;  1NAP A;  1XWE A;  3G6J B;  2F4V L;  3F2D A;  5JAV A;  1DYQ A;  5C5L A;  1YHA A;  2KCM A;  2ID0 A;  3H15 A;  2EPB A;  1BOS A;  2BA0 A;  2F0L A;  3CPF A;  5IGG A;  3V05 A;  1O7Y A;  1WTO A;  3D3R A;  5GAG C;  3NWS A;  1MIU A;  4YHH Q;  1EYA A;  1V9P A;  2JA6 H;  3S14 H;  3O13 A;  1TWF B;  3T4A C;  1QVC A;  2XRQ D;  5FLM G;  3H3V H;  2I0Q A;  5EBC A;  2R92 B; 
#chains in the Genus database with same CATH homology
 1D5Z C;  5DAU A;  3NHH A;  3EQL C;  1Y8O B;  1KNA A;  2PPB C;  1NR4 A;  1VF7 A;  1CHQ D;  1J9O A;  1EEF D;  3M7N A;  4C1N K;  1ENF A;  1E2V A;  5JPN C;  3T51 B;  1HPC A;  2ICE C;  4N9T A;  3GTO B;  4RKL A;  4DAV A;  1C4Q A;  4BS9 A;  1SYD A;  2K01 A;  3I90 A;  1Z7T A;  3GTQ B;  3LNN A;  3BVG A;  2EJM A;  1TWG B;  3EA6 A;  4KD4 A;  3URY A;  5I2Y A;  1LTA D;  2IPK D;  3F2U A;  4X3T A;  5ELE A;  1GUW A;  2NVY B;  3KBG A;  2A69 C;  3NP8 A;  3P1H A;  3I4N B;  1PLF A;  4S3S A;  4KKU A;  4CKB A;  2Z1C A;  4IUV A;  1KTK A;  2Z8L A;  5I2X A;  5D14 A;  3VR2 A;  4QUF A;  2HUG A;  1TS4 A;  3I4M B;  1OXS C;  1HHV A;  1FR3 A;  1S5F D;  2L12 A;  1ZYR C;  4QB4 A;  2AUJ D;  2X6G A;  2PNR C;  2B2W C;  4X3U A;  1EIH A;  4AYB B;  4DN4 M;  5IGB A;  2EXZ A;  4L6T B;  3NE5 B;  1GUT A;  2R3Z A;  1PDQ A;  3MXU A;  4HCE A;  4IFD J;  4K8J A;  1SE2 A;  2E76 C;  1SYC A;  2SNS A;  3NSW A;  4FF2 A;  2K04 A;  4O1N A;  4EQN A;  4XT3 B;  1MSG A;  2F3V A;  4NP5 A;  1PTO C;  4KY6 A;  4YIJ A;  2CHB D;  1LT4 D;  1V1P B;  5E1F A;  3QIA A;  1PFB A;  4H0L C;  4KV6 A;  3LWU A;  4HSV A;  2XN9 C;  4DA2 A;  1STG A;  5LL6 S;  5EKK A;  4HTH A;  3LX0 A;  2M2L A;  2WAQ B;  3MFG A;  2L1B A;  3DWP A;  5G3L D;  3OWF A;  3EFX D;  4OIJ A;  4OO1 H;  4FXG C;  2NB0 A;  1NUC A;  4QUC A;  5CYU A;  5JEA J;  2K5Q A;  4ZUJ A;  3D4R A;  4QMG A;  5A2Q E;  1EIG A;  1TII D;  2KQ3 A;  3HOZ B;  5EPK A;  2C5C A;  4XTC S;  2NVX B;  1AP0 A;  4HED A;  3G7L A;  4KTA A;  1MGS A;  3E6Z X;  1T5E A;  1LTI D;  2L4N A;  3HEJ A;  5C4X B;  1EZ8 A;  3J81 L;  3IAY A;  4K6L A;  3TME A;  5M3M B;  3C3L A;  3TZD A;  1O80 A;  4A3M B;  4ABN A;  3CQZ B;  2E2D C;  4IUU A;  2J0T D;  1UNS A;  1EWH A;  5ELB A;  1QNU A;  1F77 A;  2OF1 A;  3MWY W;  3GTP B;  5I9O A;  2RDH A;  1CA6 A;  2RBM A;  1K83 B;  3U9O A;  4C3J B;  1G8Z D;  2KHS A;  3HOX B;  3ND9 A;  1STA A;  5FKA C;  1AN8 A;  1XXG A;  1EEI D;  2NN6 I;  2G9D A;  3I72 A;  4FYD A;  1UEA B;  2JA6 B;  2EYP A;  4R8N A;  1TR5 A;  2VB3 X;  1YNN D;  2TMP A;  3WDN A;  1G91 A;  5CBE E;  2QCP X;  2FIN B;  3CRL C;  1F9P A;  4OHJ A;  3NBI A;  1BCP D;  4DAP A;  3QWN A;  1ET9 A;  1VDZ A;  2D2C C;  3HS0 C;  3SK5 A;  3FPU B;  3M85 A;  1SBB B;  4ID6 A;  3E0J A;  4F88 A;  1D5X C;  5DM7 3;  1M8A A;  2NBF A;  1STH A;  1EOT A;  1SNO A;  3P7J A;  1EWC A;  1SNM A;  1EL0 A;  2XSC A;  2OEO A;  4J1M A;  1M4V A;  1Z47 A;  2CQA A;  2R61 A;  3ITP A;  5I6W A;  4JBW A;  2RSN A;  1DON A;  3R93 A;  4F87 A;  3K5M A;  5CBA E;  1H9S A;  3I73 A;  5DEH A;  4FXK C;  1YNJ D;  4Q5V A;  2EVB A;  3PO2 B;  3SK4 A;  2JSO A;  1IKL A;  1XTC D;  2BA1 A;  2RA4 A;  5IGF A;  3S2H B;  2F0E A;  5CV9 A;  3TP7 A;  1MI2 A;  2X6L A;  4EQO A;  3Q6S A;  1Q12 A;  5EKI A;  3S1R B;  3VYR A;  1D5M C;  3I8Z A;  2PYK A;  1HCZ A;  4KI0 A;  3A8I E;  3N52 A;  1I6H B;  1CTM A;  2K05 A;  2PMZ B;  2KEE A;  1JR0 D;  1JOK A;  1LT3 D;  5EGT A;  3BYY B;  2VUM B;  2EY1 A;  4QCL A;  4CHT B;  3MAQ A;  1H9J A;  1BDO A;  2DN8 A;  2A74 C;  1ROD A;  4FVM A;  3S17 B;  3TP6 A;  3GTK B;  4BBR B;  1NCV A;  4DXF A;  1A3V A;  2B2V C;  3JAM E;  3OW7 A;  2EZV A;  1LLR D;  5J1Z A;  2QKI C;  3TN2 A;  1I4X A;  4RCN A;  4WJW A;  1Q1E A;  1J8I A;  1SDF A;  1IL8 A;  1JC7 A;  1PZI D;  1PRT B;  2F0D A;  5E4W C;  3OMC A;  1X32 A;  1B53 A;  1KAA A;  2MHV A;  1IW7 C;  5E4X A;  1TS2 A;  1H9M A;  5CGK A;  2E2J B;  2MUY A;  1BQQ T;  2L9H A;  1ML0 D;  5BN5 A;  2B2U A;  1CQV A;  1E2W A;  2ZXR A;  3H09 A;  1PTO F;  3NUC A;  2R93 B;  1SNQ A;  3R2T A;  3SVM A;  4XQN A;  1B9N A;  3AU7 A;  1X3Q A;  3C1F A;  2VNU D;  4TKO B;  5IT9 L;  2EY2 A;  5AFW A;  2KA7 A;  3OIP A;  4KY5 A;  3R8B A;  3SDZ A;  2A73 B;  3S2D B;  4O42 A;  1CHP D;  4LAA A;  3SK8 A;  3BVM A;  1BUV T;  2TSS A;  2JA7 B;  5CV4 A;  1HRJ A;  1I4R A;  2LKV A;  4ULL A;  5IGC A;  1BXT A;  2HQE A;  1F2Y A;  1SMY C;  4HAE A;  4K5V A;  5ELD A;  4OGQ C;  2LS0 1;  4K5X A;  2AWO A;  1B2T A;  1SYG A;  1GUS A;  2WII B;  3X3M A;  1EY0 A;  1I6V C;  3K5O A;  1B44 D;  2FFK B;  1F9R A;  2IX1 A;  4KHZ A;  2D5D A;  4WRD A;  2K32 A;  3GQB A;  3T13 A;  3J80 E;  1PFN A;  1CZW A;  2E75 C;  2Z4H A;  1AZQ A;  4JK1 C;  4XIG S;  2K5W A;  1V43 A;  2F0T A;  1WTQ A;  2KCC A;  2MGS A;  1HTL D;  3J80 L;  1XYI A;  3K59 A;  4R9W A;  2B63 B;  3D8G A;  3NWT A;  3RZO B;  1GUO A;  3MVV A;  3M4O B;  2J7Z A;  4KHV A;  3A55 A;  1A15 A;  3D31 A;  4MIU A;  4X3K A;  2LFN A;  2DY7 A;  1PXU A;  1HUM A;  3W2D A;  2SDF A;  2B8F A;  4QIW B;  4XYQ A;  1JWM D;  4IUQ A;  2F0W A;  2EYO A;  2B2V A;  1I4H A;  5C0X H;  1F2L A;  5ELF A;  5NUC A;  1WTW A;  3FRP B;  5DM6 3;  4TQU S;  2I46 A;  1S4Z A;  3H94 A;  1LAC A;  2JA8 B;  4UAI A;  4FXD A;  1YNJ C;  2WV6 D;  1O7L A;  3T16 A;  2DNE A;  3U9S A;  3Q23 A;  2EJG C;  5E3F A;  2KEC A;  1KDC A;  4RAU C;  4RGT A;  3MXP A;  3V96 A;  5EKL A;  1GXD C;  2SOB A;  2O5J C;  2B2T A;  1L0X B;  4C3I G;  1JQY D;  1G2S A;  2JYO A;  3MXG A;  4BA1 I;  1PTO H;  3QB3 A;  1BCP B;  4DF7 A;  1U4P A;  2A6E D;  4CJ1 B;  5C4Z A;  3KUP A;  1SFO B;  1F9S A;  5K36 G;  2B8G A;  1C48 A;  2YU9 B;  1I3Q B;  3D4D A;  3BS1 A;  2JE6 I;  4G7Z C;  1ZYR D;  1K8M A;  1OXU A;  5IOC A;  3MHB A;  3VR3 A;  1RHP A;  3DXJ C;  1RTN A;  3J7A F;  4HCS A;  4DAY A;  2B2W A;  2R6G A;  4RHR A;  1JOO A;  4IN3 A;  4HMI A;  1DM0 B;  4B08 A;  3HZX A;  4FP5 D;  1SE3 A;  4ZKB B;  3X3N A;  4RWS C;  2CW0 C;  2F0F A;  3FVQ A;  5CV7 A;  1VMP A;  1RF2 D;  3RD4 A;  3HGB A;  3WOF A;  5M5X B;  2KJX A;  4L8J A;  2K33 A;  5A35 A;  2Y0S B;  3CRK C;  3M4Y A;  3EVQ A;  3OHX C;  1S5B D;  5C44 B;  2XWB B;  5FLX L;  3SXH A;  2B2Y A;  2DY8 A;  3T56 B;  5M9O A;  2RDF A;  4LK1 C;  1VCI A;  2XRS D;  4XQQ A;  4B9X A;  3GV6 A;  3TDQ A;  2KVM A;  5JJZ A;  1DZ1 A;  4LMQ D;  2ZXP A;  1IYV A;  5JEA H;  2F0G A;  1HFN A;  3NTH A;  5A2Q L;  4RGM A;  2KUM A;  1CM9 A;  2EYL A;  4MN3 A;  2L0C A;  3VR4 A;  1R4Q B;  1D1I A;  2JA5 B;  1BNZ A;  3BDO A;  1STB A;  1TS5 A;  1PZK D;  3OIQ A;  4FF4 A;  4NDX A;  4J8Q A;  5BN3 A;  1FNV A;  1QIL A;  1RDP D;  4DXG A;  5KEE A;  1HA6 A;  4NKL A;  2G9H D;  3CU7 A;  1LT6 D;  3NTI A;  3VR5 A;  4N9P A;  1Z6H A;  5DNF A;  4DU9 A;  1PTO D;  3DUZ A;  3M3Y B;  3A8J E;  4F7X A;  1G29 1;  2E74 C;  4A3F B;  3KLS A;  3S9W A;  2AQ3 B;  4IFD H;  2ENB A;  2SEB D;  1H9S B;  2NVQ B;  1A3T A;  1E0B A;  2PCF B;  1OXV A;  2J4X A;  5HGT A;  5EPJ A;  2EYM A;  2F0N A;  1V1O A;  3KK7 A;  3K5N A;  2RVL A;  1TKW B;  5KYI A;  1W6J A;  4NMZ A;  4DK0 A;  3NQI A;  1AZP A;  3ERQ A;  3WOE A;  3GTG B;  3PO3 B;  1JWS D;  1IYU A;  1TY2 A;  1DXM A;  3SEB A;  5JPM C;  5F2D A;  1W6K A;  4E6I A;  2O2L D;  2HDM A;  1DJR D;  3D4W A;  4HMJ A;  4FF1 A;  2EDG A;  1ET6 A;  4RKB A;  2AUK A;  3FMC A;  1CI3 M;  4C3H B;  1CQF A;  2WAC A;  3KBX A;  1PZJ D;  2L5T A;  5FO7 B;  4XXE A;  2PZU A;  1KAB A;  3R3O A;  5LHY 1;  3R2I A;  2K5D A;  2WIN B;  2PZW A;  2AQ1 B;  3AB9 A;  5G3L F;  2CW0 D;  3KLS X;  1HA5 A;  2IX0 A;  3K58 A;  4IUT A;  4ZQ3 A;  5M5Y B;  3GD7 A;  1MD2 D;  1DCZ A;  1SND A;  4IUP A;  1GJX A;  2BDN A;  1DOM A;  3T53 B;  4IZ8 A;  3D6C A;  2PW7 A;  1EYD A;  1ILQ A;  3EJI A;  3MEH A;  2K28 A;  1WD1 A;  2EYH A;  1WTX A;  4A3K B;  2H4O A;  1L0Y B;  1KNE A;  3PUW A;  2Z4I A;  3AMU A;  3OPO A;  1HFG A;  2F3W A;  2NUC A;  1S5E D;  1HQM C;  2WKC A;  4FF3 A;  5FO9 B;  5K36 H;  4BY7 B;  3IFD A;  3KF8 A;  4WFN 3;  2F0V A;  2F0J A;  2AQ2 B;  3GP7 A;  2A6E C;  4CGY B;  4ZRZ A;  2PW5 A;  5KGU A;  1I50 B;  2ZXO A;  1JOR A;  3FEW X;  4PMB A;  1SEB D;  1GOZ A;  2F0M A;  5IOD A;  4CKC A;  1EU3 A;  1FNW A;  4A3B B;  1EQV A;  1WD0 A;  4K2K A;  4RA8 A;  4IAL A;  4ZKC B;  3MA2 B;  4ME5 A;  4ZYS A;  5CR3 A;  2A68 D;  3SK6 A;  1A3U A;  2D62 A;  3H0G B;  3K6O A;  2Q8R E;  4HN7 A;  3ND8 A;  1KDA A;  5C0X G;  2HCC A;  4KKT A;  2PQE A;  1LTB D;  2F0K A;  3SHL A;  3OOC A;  5C6A A;  2F0Q A;  2O4X A;  2LMC B;  1RJT A;  1RD9 D;  4PNY A;  2JEB I;  1JB3 A;  3PUY A;  4MHE A;  3IL8 A;  4C1N I;  3TZU A;  4CKE A;  3A54 A;  3I4L A;  2BE5 C;  4A3D B;  3NTK A;  1STE A;  3HOU B;  1STN A;  2JXM B;  2X69 A;  4RGO S;  2JEA I;  2BDO A;  1B3A A;  1OO9 B;  2WP8 J;  5FK9 C;  2ICI A;  4XT1 B;  2RKS A;  2HCI A;  5KND A;  3H6M A;  2K7V A;  3HKZ B;  1CT1 D;  1EZ6 A;  2SNM A;  1CK1 A;  1LTS D;  1WTV A;  1WTR A;  2QIL A;  3VYT A;  1GUN A;  4ZAI A;  5JOB A;  1ENC A;  3OWE B;  1SNP A;  4ZLT F;  4IFD I;  3M7G A;  1ILP A;  4G4K A;  2QF7 A;  3BYT B;  1B4O A;  1ZXT A;  4CJ2 C;  4DFA A;  5M3F B;  3QO2 A;  2V4D A;  1SMY D;  4C3I B;  3MC0 B;  2QEJ C;  4KMU C;  4UDU C;  3UI2 A;  3PIP 3;  4C3J G;  1ICW A;  2WKD A;  1EY5 A;  2F0S A;  4G57 A;  3K7A B;  4M8A A;  1EY9 A;  4G7H C;  1NR2 A;  1PTO B;  4RGN A;  4OO1 G;  1V8Q A;  3N6R A;  5C0X J;  2XVS A;  2WB1 B;  5EQ0 A;  3VA5 A;  2F0H A;  3MFY A;  1SE4 A;  1KLG D;  1TS3 A;  2MPM A;  1GUG A;  2IJ0 A;  2N55 A;  4C56 C;  3PV0 A;  3MXN A;  1PRT D;  4FO2 A;  5CV5 A;  2XWJ B;  1RKN A;  1QWY A;  5ELC A;  1H9K A;  2IX3 A;  3MTS A;  2KOL A;  1JOQ A;  3H3V C;  3BDL A;  2VXW A;  1IKM A;  1JE4 A;  3TSS A;  4NW2 A;  1G6Z A;  1E2Z A;  3IFT A;  5IIF A;  2N88 A;  4GZY C;  1LTR D;  4K2L A;  4EQP A;  3Q22 A;  3K0Y A;  3DEP A;  4A3E B;  2RDG A;  3OSO A;  1ZKO A;  5COY A;  1YNN C;  5I9P A;  1IW7 D;  4K14 A;  1SJH D;  2IW3 A;  2E2H B;  1TQO A;  1LTG D;  1Q8I A;  4KN4 C;  3BZD B;  4KY7 A;  4TSS A;  1PMR A;  4PMC A;  3TP5 A;  1Q3L A;  1EY7 A;  4H44 C;  3ERO A;  3NPP A;  1Y8N B;  1GHJ A;  4IQZ A;  4PMW A;  1I4G A;  2NWG A;  4QF4 A;  5FLX E;  3TP8 A;  2EY5 A;  1QE6 A;  2L11 A;  3QG1 A;  5C0X I;  3K57 A;  1IHZ A;  3Q0A A;  2F1M A;  5T1I A;  4CJ0 B;  5IT9 E;  4PQX A;  1BR9 A;  4K5W A;  1LTT D;  1ENA A;  1EQT A;  3NBH A;  3DEO A;  1A2T A;  1O7Z A;  2H1E A;  3RUZ A;  3GO5 A;  1QG7 A;  2B2Y C;  1SNC A;  5KYL A;  2HDL A;  1K8O A;  1PYW D;  4ILW A;  4M1U B;  3I91 A;  5D3I B;  5LL6 X;  5C3W A;  1U9R A;  3PIO 3;  2K03 A;  3BVZ A;  5FO8 B;  1SYF A;  5CV8 A;  1U4L A;  4RH6 A;  3S15 B;  1QOH A;  1CFM A;  3HG9 A;  5I6Y A;  4ODG A;  3A56 A;  1SXT A;  1Y69 U;  2QDB A;  3S14 B;  2DNC A;  4XDX A;  1BF4 A;  5T1G A;  3ONA B;  2B39 A;  3CKI B;  1MSH A;  1BCP C;  2KCN A;  3JAM L;  3DHQ A;  1QCB D;  4K8I A;  3DM1 A;  4DNT B;  3HP3 A;  1F2Z A;  3D6W A;  1ONL A;  1RCV D;  1EY8 A;  1UUP A;  2IT1 A;  1OXX K;  3BG3 A;  1DOL A;  4HR7 B;  4EVO A;  1F9Q A;  1AEX A;  1D1K A;  3I70 A;  2FHT A;  3P20 A;  2F0O A;  1LAB A;  4OL7 A;  5K5P A;  1EY6 A;  1TY0 A;  5D3D A;  3VA7 A;  1NSN S;  4HSP A;  1AFP A;  5C5M A;  4K6D A;  2A69 D;  3DWQ A;  3A8K E;  3QJY A;  4RFB A;  2MP1 A;  2B2U C;  1C8C A;  1KDB A;  1G2T A;  2EYF A;  1WVL A;  3S16 B;  4PV1 C;  4IFD G;  1JWU D;  2ZT9 C;  3V2T A;  1RTO A;  1U4R A;  2KED A;  4DK1 A;  4LJZ C;  2OT2 A;  4I7Z C;  3ZYY X;  4KJN A;  3BDC A;  4TRD A;  1I4P A;  5TSS A;  1AW7 A;  2I07 B;  1I4Q A;  5C3E B;  4Z9C B;  4A3G B;  1FYC A;  1GHK A;  5J39 A;  4DGZ A;  2PO4 A;  4IUN A;  1FNU A;  4Q0F A;  2EYJ A;  3S1M B;  5KIX A;  5ISR A;  3HOW B;  2FMM A;  4BA2 I;  3GTM B;  2NN6 G;  5KRU A;  3HOY B;  5CMD A;  5JEA G;  2EJF C;  2F4I A;  1LV9 A;  1QJO A;  2A5H A;  2M00 A;  3SR1 A;  1CZG A;  1V1P A;  2LY7 A;  3QOJ A;  2NVT B;  3NQT A;  2GA4 B;  2R7Z B;  1U4M A;  1EFI D;  5C4J B;  3HRZ C;  1TWA B;  4KJO A;  5I4D A;  3C2P A;  3FPP A;  2F03 A;  5JVG 3;  4A3J B;  3VYS A;  3E5S A;  1BCP F;  5J22 A;  3I3C A;  5COR A;  5EJW A;  4OIK A;  5CV6 A;  3PUV A;  4P2C B;  1TWC B;  3LWE A;  1EYC A;  1PRT F;  1PFM A;  2EOT A;  4ZUI A;  2L55 A;  2A6H D;  1XX8 A;  3FDT A;  2IWH A;  1F2M A;  4L63 B;  1HXY D;  2M9V A;  2NTS A;  5CC4 A;  1EY4 A;  4KN7 C;  1ZEQ X;  3A7L A;  3K5L A;  3S1Q B;  1SJE D;  3L9A X;  1KLU D;  1BBX C;  4OO1 I;  3J81 E;  3HOV B;  2CVR A;  2A68 C;  1HTP A;  1CA5 A;  3H91 A;  2BOS A;  4XQJ A;  4H13 C;  3KLR A;  2OXP A;  1R9T B;  2MJ8 A;  1SSO A;  1PRT C;  4BWG B;  1OXT A;  4F8M A;  4XYO A;  1B50 A;  2FMC A;  3PMF A;  2FJ2 A;  4RHS A;  1S5C D;  3IKJ A;  1O78 A;  4Y7N B;  3MZ5 A;  1Q90 A;  4C2M B;  1Y1V B;  5KNB A;  3L7Z C;  2Q8T A;  3RLF A;  5BN4 A;  2K1B A;  1DD2 A;  2AWN A;  1Y8P B;  4X3S A;  4KK7 A;  2XNA C;  4V19 0;  4V0B A;  2NN6 H;  1TWH B;  4B9W A;  2BCO A;  4IUR A;  4A3I B;  1ESF A;  1QB5 D;  1B1Z A;  2F0P A;  1VMC A;  1R4P B;  2E2I B;  1TU2 B;  1DOK A;  1JCK B;  4J6H A;  3SE0 A;  3GV3 A;  1HUN A;  4EGV A;  3VR6 A;  3C1E A;  4ZK9 B;  4CBV A;  5HUR A;  3TBI B;  1D2B A;  3FKI B;  1JIC A;  2B2T C;  1HQR D;  1LO5 D;  3GTL B;  3VYU A;  5IGE A;  2XIW A;  3PUZ A;  2RQX A;  1Q1B A;  2JP1 A;  1UAP A;  1VF5 C;  2RSO A;  3NK9 A;  3RMH A;  1SYB A;  1S5D D;  5C4H A;  4DNR B;  1ESR A;  1MBY A;  4H7B A;  5D65 A;  3C46 A;  2K6A A;  1Y1W B;  3CHB D;  3DWA A;  4RCO A;  1EU4 A;  2D9U A;  4FNF A;  2BE5 D;  3NXW A;  4KKS A;  2O5I C;  1SYE A;  2NTT A;  1FD7 D;  1X3P A;  3RZD B;  3W3A A;  2YYZ A;  2PZT A;  2A6H C;  1WTP A;  5M5W B;  1II3 A;  5FOB B;  2NYZ D;  4U67 3;  3S1N B;  3Q24 A;  3GTJ B;  5EPL A;  2Q8I B;  1FGB D;  2F0I A;  1D6E C;  3PUX A;  4WOR A;  1SAP A;  2EY6 A;  1B9M A;  3J7Y W;  2EE1 A;  2F0U A;  4I65 A;  4U68 A;  5EBD A;  4G7O C;  5IGD A;  3P75 A;  4KD3 A;  1A2U A;  3QOL A;  1WCM B;  4R8I A;  2VB2 X;  1T5X D;  5C3X A;  4BY1 B;  3A7A B;  1TVX A;  1TT2 A;  1BO0 A;  3L3O C;  2NZ1 D;  3DMU A;  4BBS B;  1QNK A;  1LT5 D;  3J7A V;  1STY A;  1H9R A;  1A6X A;  2IL8 A;  4A93 B;  2C9O A;  3OMG A;  5JVH 3;  5KNC A;  4C3H G;  3G6J B;  1NAP A;  1XWE A;  5JAV A;  1DYQ A;  5C5L A;  2ID0 A;  2EPB A;  1BOS A;  2BA0 A;  2F0L A;  5IGG A;  3V05 A;  1O7Y A;  1WTO A;  3D3R A;  3NWS A;  1EYA A;  3O13 A;  1TWF B;  3T4A C;  2XRQ D;  5EBC A;  2R92 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...