3DWQA

Crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
b'EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilase cytotoxin, subunit B
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 116
sequence length 116
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwqA00
5I4DA 3KLSX 3BYTB 3BZDB 2XRQD 1LO5D 1EEID 1EWCA 3EA6A 1F77A 1SJHD 1EEFD 3EFXD 4RFBA 5ELDA 3URYA 1TS2A 4DXFA 1PTOD 4BWGB 4RGNA 3DWQA 5ELEA 1S5DD 1GOZA 3BVZA 3DWAA 4C56C 1AW7A 1G8ZD 1PZKD 1EFID 3R2IA 1SE3A 3CHBD 1SXTA 1HQRD 1PYWD 1SBBB 1SE4A 1PTOB 1LTTD 2XNAC 5ELCA 4L6TB 1BXTA 2AQ3B 2RDHA 1FNWA 1S5ED 2NTSA 1S5CD 1BCPD 1PRTB 1V1PA 3MFGA 1CHPD 2ICIA 1I4RA 1RD9D 4RGMA 1HXYD 1RDPD 3GP7A 1D5XC 4RHRA 1EU4A 1PTOH 1PTOC 4Z9CB 4L63B 1CHQD 1I4XA 1BCPB 1JQYD 1JWUD 3OWEB 1I4QA 4ZYSA 1RF2D 2CHBD 1MD2D 1PRTC 1FD7D 2XN9C 1UUPA 2NTTA 2Z8LA 1B44D 2AQ1B 1L0YB 1UNSA 1S5FD 3R2TA 4RGTA 1QILA 1SE2A 2AQ2B 1JR0D 1BCPC 2XRSD 1TY2A 1TY0A 4RGOS 1CT1D 1FGBD 4RH6A 1LTGD 5ELBA 1LT6D 5D3IB 3TSSA 1I4PA 2RDGA 1S5BD 5FK9C 1XXGA 2O2LD 1FNUA 2G9HD 1JWMD 3BVMA 1LTRD 5ELFA 1JCKB 1PZID 1ET6A 1RCVD 2R61A 1HA5A 1LTBD 1LT3D 1SJED 1TS3A 3O13A 2QEJC 1ET9A 1JWSD 1D5ZC 1HTLD 1M4VA 4UDUC 1STEA 3R8BA 2WV6D 4K6LA 1FNVA 1AN8A 1DYQA 2SEBD 1EU3A 1CQVA 1LTID 1LT5D 1ESFA 1PTOF 2TSSA 5FKAC 4RCOA 1B1ZA 1ENFA 1LTSD 3BVGA 1PRTF 1V1PB 4O1NA 5D3DA 1L0XB 1V1OA 4OHJA 4TSSA 3MC0B 2IPKD 3BYYB 1XTCD 1BCPF 1DJRD 1LT4D 5TSSA 1I4HA 1TS5A 3V05A 3SEBA 1LTAD 1PRTD 3DWPA 1PZJD 1TS4A 1D6EC 1KLUD 1LLRD 2QILA 3W2DA 4DXGA 4RHSA 2IJ0A 1I4GA 1SEBD 1D5MC 1KLGD 1T5XD 1CK1A 2J4XA 1KTKA
chains in the Genus database with same CATH superfamily
1KRTA 1E24A 3C1EA 1M8AA 3OMGA 1PH2A 4JI0Q 1Y1WG 3MTSA 4X64Q 2XWBB 2Z4HA 4R8NA 4IJHA 5HURA 5ELEA 3K0YA 3BVZA 1STHA 4R4IA 1EIYB 1I94Q 3CHBD 2UXBL 1JB3A 2AQ3B 4ZUJA 2EJMA 3UDGA 2O5IC 3AB9A 1HXYD 4B3RL 5T1GA 1TWFB 1FVIA 4X3KA 1EU4A 1PHJA 4CBVA 3NP8A 1C4QA 1I4XA 1WTPA 3DLLA 1CZGA 4M8AA 1SNMA 1O7YA 1IYUA 2Z9HA 3HOWH 2NZ1D 4A3IG 5LL6S 5KGUA 1WJJA 1X65A 3OYYA 3R2TA 1EY5A 1Q90A 1S40A 4DR4L 1CT1D 3KYHC 2F0VA 2PQAA 1N36Q 5EKKA 1LTGD 2N3SA 1CFMA 1FNUA 2G9HD 5KRUA 3SHLA 3E6ZX 3GTOH 2EVBA 2B3GA 4PZ6A 1YNXA 3H6MA 5IWAQ 1UWVA 3A8JE 3TZDA 2VXWA 3HZXA 1Q7YC 2VQFL 1DXMA 1SE8A 1JWSD 1BDOA 1J9OA 4JI2Q 4A3KG 1PA6A 4JV5Q 1E7ZA 4A93H 3R8BA 4DR1L 5A2QE 2JEAI 4JC0A 1XX8A 2DNEA 3GTPB 2I5MX 4BBRG 1ESFA 3KF8B 2KCNA 1H9MA 1B1ZA 3S2HB 3F2UA 2A6HC 4XTCS 1ICFB 3OWFA 4XYOA 2A68D 3PSIA 5C4XG 5E3FA 1RHPA 2CFMA 2E2HH 2DUDA 4A3EG 4PMCA 2N88A 5A35A 3NK9A 1PRTD 3W1BA 3W2DA 4ZRZA 1CKNB 2QKIC 1I4GA 5D65A 1LV9A 1EY0A 1WYDA 2F3VA 1VQLA 5A2QL 4KY6A 3MEHA 3NQTA 3L3OC 4RA8A 4AYBG 1WCMG 3RZOB 4JYAQ 5JPMC 1Q8KA 3FHWA 3NSWA 3PUWA 3J7ZC 1JB7A 3KF6B 4JI6Q 1HNWQ 1A0IA 5E4XA 1JJGA 4WJ3M 5GADC 4DR5Q 2CH4A 1IZ6A 2WKDA 3D6CA 1Y8PB 2F0TA 3R2IA 3E9HA 3F2CA 1V1PA 3OIQA 1B9NA 1B4OA 1HUNA 3NBHA 5IGGA 1GM5A 4DR6Q 4PZ7A 4MIUA 4RHRA 4KD4A 1F2ZA 1GUTA 3PGZA 1SFOB 4LF7Q 4LF4Q 3CD6A 1A62A 3S2DH 1Y1VH 3STBD 2UXDL 4Q5VA 3GQBA 4JOIA 2B8FA 1UNSA 2K7VA 4A3KB 2AQ2B 2SDFA 1JR0D 2B63G 1TWAB 1EL0A 3DMUA 1FGBD 3S1NB 2ATWA 3HOVG 3TSSA 1I4PA 2RDGA 1S5BD 4BBRB 5FK9C 1XXGA 5CV4A 3M3YH 2K01A 4BBSG 4CKBA 3L0OA 3P1HA 5CC4A 1G2SA 1T5EA 1B53A 2LY7A 4HCEA 1N32Q 3TRZA 2OCEA 1PYSB 3FVQA 5IYDG 1K83H 1SMYD 4A3EB 3J81E 1U9RA 1NE3A 2UUCQ 4YIJA 5ISRA 3K5OA 4DV5Q 2EY6A 4K6LA 2NVQB 4LUZA 3AMUA 4DAPA 5CBAE 4CJ2C 3M7GA 5IGFA 2WAQB 3Q0AA 1VF5C 4AYBB 4Y7NH 2G9DA 2IW3A 1Z6HA 3E5SA 4DFAA 5DEHA 1VMCA 1I4HA 3V05A 1QVFA 1BBXC 4X3UA 1BR9A 3WDNA 1LM0A 4ZAIA 1YZ6A 2ZXPA 4ID6A 2L0CA 4DR5L 1L1OA 1DGSA 4XDXA 2Z0SA 3HOYH 2A69D 2E8GA 3SGIA 1NNXA 4HJ8A 3M9BA 4BA2I 4ZK9B 5KEEA 1N33Q 1PXUA 4DK3C 3AFPA 1Q81C 1UE1A 1Z47A 1HZCA 4P75A 2UUBL 3K7AB 3D4WA 2Z6KC 1JICA 2M00A 4V0BA 3BJUA 4KHVA 4P72A 2EQSA 4YHHL 3HOZH 2LMCB 2B63B 3NUCA 4BY1B 4NPSA 1PH1A 1NBWA 2YU9B 4DV3Q 4XQNA 3CXCA 3D4DA 4X3TA 3A0JA 4OWWB 3TN2A 4BBSB 1PTOC 2NB0A 3J7AF 1EQRA 3RN5A 1TVXA 3T1HQ 4J1MA 2CHBD 2BE5D 1K3BC 2PI2E 1VQ4A 1VDZA 2AQ1B 2Q2IA 4A3BH 2A6ED 3T1YQ 4QUFA 3JAME 4NW2A 1A63A 5LHY1 1SR3A 2CQAA 2K4KA 2Q8RE 2R3ZA 2KHJA 2AHOB 5IODA 1Y14B 1JC7A 1ML0D 2OQ0A 4B9XA 2B2YC 4I7AA 1LT3D 2NVYH 2PMZB 4RKLA 2EYPA 2L9HA 3TP6A 4J15A 2O4XA 2EE1A 3VYUA 4X65Q 3T13A 3CCLA 4DV2L 1EYAA 1ILQA 1AN8A 1QCBD 1WFQA 2IHFA 5JVG3 1OXUA 3JAMc 2RHSB 2CW0C 3JAML 1VMPA 2H5XA 3S1QB 3S17B 4DUYQ 2AKWB 3Q22A 5EPJA 2EIFA 4QMGA 5EBCA 2JA9A 1H9SB 1O80A 4JBWA 4IPDA 2KEDA 3CCEA 5COYA 1HQMC 2PCFB 1U0LA 3KDFA 4YY3Q 4C2MH 1D5MC 1WTHA 2B2TA 2AMCB 2CWAA 4RG1A 4DNTB 4EQOA 3HOWB 1DONA 1SLJA 1VQHA 1HFGA 1IBLL 4JW0A 2VQEL 3I70A 5K36G 5EGTA 4OIKA 4B3TQ 1B2TA 4RFBA 4DF7A 5E1FA 3F1ZA 1B50A 1R4PB 3NHHA 1F9SA 1PZKD 1SYFA 3EJIA 3N6RA 1PTOB 4HCSA 4OL7A 4X66L 2QDBA 4DV0L 3MXGA 4KN4C 4CGYB 1WTOA 3MFGA 1R9TH 3ND9A 5DM63 1AZQA 2BA1A 1ASYA 4K8JA 1EQVA 4DAMA 1WTWA 5T1IA 3OW7A 1XNQL 4KJNA 4H7BA 3H94A 1TWCB 3I91A 3FKIH 1I50H 3NTHA 3VA7A 1TWGH 1CKOA 1L0YB 3K58A 3AU7A 4ZKBB 3GTQB 1SE2A 4G57A 3CC4A 4QCLA 2YYZA 4A3JG 3K7UC 5D3IB 1HJPA 2I0QA 4JBJA 1FJGQ 1HZ9A 1IBML 1ZYRC 5C0XI 4LF5L 4GN5A 3HOUH 5FO7B 1PZID 2DY7A 1LACA 4XT1B 1P8LA 1K8AC 4FXDA 2ZXOA 1SJED 2PW7A 2QGQA 4K0KQ 1STYA 1ET9A 4A3GH 4P73A 3K5MA 1HTLD 2SNSA 1RKNA 4DV7Q 2MPMA 5CYUA 5GAEC 2WV6D 5C0XG 2MJ8A 2HIXA 2JN4A 4Q0FA 4LFAQ 1HR0Q 5IGCA 2JJQA 4RCOA 3PO2G 1E2ZA 4ZQ3A 4JI8Q 1NUCA 1V1OA 4IOCA 3I4MG 4IFDH 3ND8A 3A74A 1KHIA 2WB1G 3JC66 4DAVA 1BCPF 3DUZA 2OTJA 2R7FA 2AUJD 3F8TA 3MZ5A 1TR5A 4DXGA 2LKVA 2K6AA 1BBWA 1X3EA 4X62Q 1J8IA 1W6KA 1KDAA 2RCNA 5I9PA 1NR4A 4XIGS 5C3WA 3S2DB 4CHTB 2I07B 4QF4A 3BU2A 4PG3A 2IX1A 5IP9G 1IXRA 5CV8A 3HOZG 4DV1Q 4CKEA 1GJXA 2EYMA 3KLSA 1XPOA 4FF3A 4JI7L 1HUMA 5I6WA 1PFSA 4RKBA 2BDNA 3K5LA 4HJ7A 3DWAA 3PUYA 1SSOA 1W6JA 1Z7TA 1VQNA 1LTTD 5FJ8H 4ZLTF 4A3FG 1BQQT 3CCSA 2F0IA 1WTRA 4OELB 2F0KA 4ZKCB 1VQKA 2L12A 1BCPD 1S72A 3D0FA 1SYBA 5BR8L 1NTGA 4HTHA 4Z9CB 1TWHH 1HZBA 1MBYA 3OWEB 2KCCA 2WIIB 3RLFA 4ZYSA 4GLVB 1XMOQ 1VQAA 2XN9C 1QJOA 2PMZE 2E76C 1Q86C 2Z8LA 2OTLA 2HIVA 4DUZQ 3K6OA 3M4OH 1OTCA 1VQGA 2A74C 3SK4A 1EQTA 4KHPL 4JI1L 1RTNA 1PLFA 4KKUA 1QB5D 4A3DG 3PO2B 2OEOA 1B70B 1OXVA 4MN3A 3RMHA 4NMZA 2R93G 3J80E 3FEWX 2HDMA 3I4MB 4XT3B 1TS3A 1K8MA 2WB1B 3HOYB 2GN5A 4DR7L 3I2ZA 1EOVA 3KBGA 2ENBA 4ME5A 1FNVA 1EY7A 1DYQA 2SEBD 4UP9A 5C3EH 4H0LC 2XWJB 1ONLA 4LF8L 1GXDC 1G91A 4DR3L 4F7XA 1V1PB 1VQ9A 3HOZB 3J80c 4A3LG 3SK6A 1TIID 2RA4A 3J80L 1PFMA 2MUYA 5H1SE 1NCVA 4JI4Q 1II3A 3CQZB 4JPBW 3TS2A 4EQNA 4NXMQ 5GQOA 1YNND 3H3VC 3H0GH 3I7FA 4MHEA 2RSOA 3PIP3 3TP8A 4GS3A 5JEAH 1U4RA 1ZEQX 4A3FB 4OONA 2J4XA 3E0JA 4CKCA 2CWPA 4PMBA 4A3CH 2JA8H 1IL8A 2XRQD 3QWNA 4P74A 4HIKA 4IZ8A 4IN3A 1IBKQ 4A3BB 5K5PA 5LMUL 3P75A 1IW7D 3E0EA 5IT9c 1NMFA 3S1MH 2HUGA 5JJKA 2D62A 1KAWA 5IT9L 3CF5A 1X55A 5LMNQ 1YBYA 1NAPA 2KQ3A 3PIPA 1EZ8A 3C46A 1HQRD 1SBBB 1SE4A 4KK7A 1DCZA 4L6TB 1NY4A 3CKIB 4LAAA 1TXYA 1GHKA 2Q2UA 3U4ZA 1CHPD 3X3MA 5IYBG 3MXNA 4A3DB 2VB2X 1B9MA 3CRLC 2R93B 1AE3A 3TREA 4G4KA 4IALA 1OXSC 1SNOA 1MD2D 4EVOA 2F0OA 1JMCA 4NDXA 2EYLA 5C4JB 1EOTA 2VZAA 1HA6A 3WWVA 5IGBA 4JK1C 4RGOS 4ODGA 4GNXA 3TZUA 4IUVA 1CSQA 5IYCG 3CRKC 4IFDI 2F0LA 4DGZA 2E2IH 4LF6L 2EYOA 4R4TA 1LTRD 3I73A 4C3HH 4B3MQ 2JA5H 4P2CB 5NUCA 3STBC 3QIAA 4KLKA 1SNDA 2B2TC 3G71A 3I90A 3QG1A 1MIUA 4KTAA 2Z1CA 3I55A 2IX3A 4IURA 2EYHA 1DD2A 3TQYA 3CCMA 5DAUA 1XYIA 4UY8C 1HR0W 1H95A 1KIXA 2WINB 1N34L 1PRTF 3K5NA 2ZTCA 1GKHA 1Q1EA 3ERQA 2Z6BA 4JVZA 4OHJA 1SMYC 2NN6H 1AP0A 3OIPA 3Q8DA 1R9TB 3RR5A 1DJRD 2F0FA 5FLMH 3GTGB 4J8QA 1B7YB 1PFBA 5M5WH 1TS4A 5AJ3Q 1LLRD 5EKIA 4ZCKA 3A55A 3S15H 3RLOA 3FKIB 3QOLA 3GTJH 4DR2L 1I50B 2ZJQA 4HEDA 4QGUA 1J6QA 4IQZA 1PH6A 4C3IH 4OX9L 5M3MH 5IY0A 1EEFD 3TDQA 3URYA 1O7IA 1STAA 1SNQA 4C3JH 3L9AX 1FYCA 1XNRQ 4GOPA 4JI0L 1I3QH 3HOUB 4X64L 5IE8A 2K5QA 1WTVA 3R3OA 2JA7H 3KJOA 2A69C 3VR3A 1JORA 1EUJA 3HGBA 1C7YA 2RDHA 2NTSA 4R1JA 4QB4A 1I94L 1E3PA 5J1ZA 2WAQG 4A3GB 2RSNA 1RIPA 2JA6H 3NWSA 4AQYQ 2YTVA 2QCPX 1N9WA 1JWUD 3K57A 4G7OC 1ENCA 4YCUA 2KJXA 3DXJC 2JE6I 2WB1E 4UP8A 2RBMA 3JAMi 3H09A 5M3FH 1EY8A 5JJIA 2FJ2A 4AIMA 2R92G 4HMJA 1RODA 2RF4A 3PUZA 3S1RH 3BVMA 1N36L 2MNAA 2BE5C 5GAHC 2ZT9C 1ET6A 2N55A 1M90C 3PO3H 1GUSA 2EOTA 1HNZQ 2A6EC 4M1UB 3V96A 2ZM6Q 5IWAL 5J22A 5M5XH 4DV6Q 3KOJA 1KDBA 1B3AA 4BY1G 3GTMB 1B3QA 2OWOA 1LT5D 4JI2L 4JV5L 1A3TA 4LF9Q 3HKZE 3FRPB 3I4NH 3Q6SA 5CV7A 1F9QA 4IUPA 5I9OA 3GTLH 3BYYB 5JJZA 3NBIA 2K32A 2UU9Q 3S16B 4LFBQ 4IUNA 5C44H 5EPKA 3HOXH 3IFTA 1PDQA 4POGA 1PZJD 4K5WA 3TP5A 1NJIC 1A2UA 1CTMA 1D1KA 1PH7A 1F2YA 2NYZD 1MSGA 1SEBD 1C48A 5DM73 4HR7B 2A73B 1YVCA 4BXXH 2K03A 5FO9B 3M4OB 2NBFA 2WP8J 4JI5Q 4HMIA 3UI2A 5IIFA 4H44C 4ALPA 1D8LA 1HFNA 5BN5A 2F0EA 3PF4A 2MHVA 3D4RA 1JJ2A 2NVXB 4JYAL 4XXEA 2FMMA 2I5LX 3J81c 3J81L 1A8VA 4JI6L 4K5VA 5LMNW 2R92B 4XQQA 3ERSX 5CORA 1HNWL 2HCCA 5C0XJ 4B3SQ 4CDDC 3BDOA 4LMQD 1FNWA 3VR6A 2KCTA 1BF4A 1QOHA 3CPWA 2BH2A 4G7ZC 1VCIA 1KRSA 1CKMA 4EQPA 3BS1A 1S4ZA 1X32A 1ASZA 2O5JC 4IPCA 3U58A 4HSVA 5C3EB 4DR6L 3J81j 3ICEA 1I6HB 1B44D 1SYGA 5EQ0A 1DM0B 1UAPA 3LGJA 1F9PA 1MHWC 1YJNA 2OXPA 4LF7L 4XQJA 3A5ZB 1IYJB 3UE1A 5I2YA 2UXCQ 4LF4L 2PZUA 2G5DA 4O2DA 1LT6D 2MQHA 2ZM6L 1Q1BA 3HOWG 1U5KA 2FFKB 1CA6A 1JOQA 2NN6I 5ELFA 2FHTA 3H0GB 3OPOA 1D2BA 4QIWB 3RZDH 3LWEA 1LTBD 4IJLA 4CDEC 1SN8A 3OOCA 1X3PA 3G7LA 3O13A 1A15A 2X6GA 2M2LA 1K73C 1N32L 2B2VA 5FO8B 4A3MH 4OO1H 1XJVA 2YTXA 3CCUA 4HAEA 2UUCL 1VQPA 3S1MB 2HT1A 4DV5L 2PI2A 2KECA 3ONAB 3WOEA 1LTSD 1BKBA 1X54A 3F2BA 3RN2A 4JBMA 4A93G 3B6YA 4R4CA 1X3QA 3ULJA 5C4HA 1EWIA 3G48A 3OTOQ 1TS5A 3PMFA 3C3LA 2R7DA 5E4WC 1XMQQ 1EYDA 1EIGA 3GTKH 2EY2A 4MZ9A 4FDBA 2MP1A 2F0SA 2K75A 4B08A 4C1NK 1LO5D 2WACA 1VF7A 3HRZC 4UAIA 2RQXA 2HQLA 3CP0A 4I7ZC 1P16A 1V9PA 1N33L 1XPUA 4GNXC 1CQFA 2E2IB 2F1MA 1AW7A 1J5EQ 4GN3B 3AFQA 3U9OA 3S14H 1STGA 4C3HB 4GZYC 2J7ZA 4KKTA 2K04A 4KV6A 1SNPA 5J39A 1A3UA 3L2PA 1KL9A 1PH3A 1LYLA 2FXQA 1AZPA 1TT2A 3KF6A 1U4PA 2R7ZH 2ZXRA 5M9OA 4DV3L 3A5UA 4JI3Q 5EPLA 3A8KE 1RF2D 4OIJA 3CMAA 3U50C 2F0NA 1JE5A 4LUOA 2NWGA 4NXNQ 1GUWA 1S3OA 1TWFH 4HN7A 2VW9A 1AFPA 4DAYA 3G4SA 2B2WA 2H4OA 2X6LA 4YCVA 3GTOB 3T1HL 1BCPC 5FLXE 1GUGA 1PH5A 3J80i 2K05A 5GROA 1Y1VG 2XSCA 2F4VQ 3HKSA 4IPHA 5M5WB 1JCKB 3T1YL 2GVAA 1WD0A 1WD1A 2A5HA 4A93B 2JP1A 1VQJA 3UDXA 5CV6A 1SYEA 4NP5A 2QEJC 3I3CA 1M4VA 1FL0A 1X9NA 4C1NI 1QUQB 3BDCA 3TMEA 4BY7H 4PMWA 2E2DC 4X65L 5IP7H 2VNUD 2E2HB 1FR3A 2ID0A 3GO5A 2OF1A 2KHSA 1Y8NB 3RD4A 1I3QB 2YTYA 4GOPC 1RTOA 2WAQE 4F88A 1HNXQ 2BDOA 2KA7A 4GKKQ 4AYBE 1JOOA 1YHAA 2PZWA 4HIOA 2EJGC 2CCZA 4DUYL 1VQ8A 1LTAD 2BOSA 3KLWA 2QILA 1Y1WH 5HY6A 4QY7A 3SK8A 2N8NA 1LABA 4F8MA 4L8JA 1WI5A 4GNXB 4DK0A 2KCMA 1YIJA 3K8AA 4YY3L 5M5YH 2CQOA 2F0MA 4L5SA 1EY4A 4DU9A 1GHJA 4JG2A 1YNNC 3HOYG 1VQ7A 4LFCQ 3BZKA 3EN2A 3VA5A 3I4OA 4LK1C 4N8X1 3RZOH 4B3TL 5HGTA 2F0PA 4IFDJ 2VS1A 1HHVA 1NSNS 3SR1A 1PH4A 1FGUA 3NXWA 4FXKC 4FNFA 4B9WA 1Y1VB 4A3IH 2EXZA 2PQAB 2B8GA 4P71A 1D5XC 1IW7C 2C9OA 2EYFA 4JOIC 3EIVA 1BCPB 3FPPA 4QIWE 1I4QA 2UUAQ 1KDCA 1SYDA 3H91A 3A54A 2DNCA 5KIXA 2LSSA 2K52A 1JJCB 4OO1I 3M3YB 1RL2A 1BBUA 2K1BA 5KNDA 1KD1C 1YEZA 2LS01 5G3LF 3QB3A 4MTNA 3MXPA 2HDLA 1UEAB 1LUZA 1K83B 3AQQA 1SROA 3MXUA 4A3KH 1TWAH 4F87A 4FO2A 4A3BG 5C5MA 4HIMA 3S1NH 1HA5A 3P20A 1FJGL 2DGYA 4BBRH 4R9WA 1AE2A 4UHVA 4IUUA 3CCVA 2HHHQ 2EJFC 2V4DA 3E3XA 4V190 4UDUC 4K0KL 4Y7NB 4KY7A 1TQOA 5C4XH 2RHQB 3PUVA 4A3EH 1LTID 3CC2A 1PFNA 5D14A 4DV7L 1LTLA 5IOCA 2RKSA 4GKJQ 4DV4Q 3I72A 5D3DA 4LFAL 1HR0L 4K2KA 2NVQH 1K9MC 5G3LD 3P7JA 4KD3A 3D8GA 1JOKA 1V43A 1L1OC 4JI8L 1IKLA 3DWPA 3BDLA 1D6EC 1Q46A 2D0PA 1CM9A 1WCMH 2Z4IA 3WOFA 3HS0C 1KNEA 3CAMA 3UE0A 4CDFC 2D9UA 1H9KA 4TVAB 5CR3A 4DNRB 4OEMB 1CSPA 2ZTDA 1R4QB 3LNNA 2SNMA 3ULPA 2QF7A 2BH8A 4X62L 3CMEA 4JBKA 1EEID 5C6AA 3EQLC 2K50A 3SVMA 3NBHB 3EFXD 2UXBQ 4BWGB 1EYCA 4RGNA 1G2TA 1HZAA 2KBNA 4DV1L 4UPAA 1NR2A 3QR8A 3I8ZA 2GVBA 1EZ6A 1SE3A 2GA4B 1SXTA 4ABNA 4B3RQ 2C35B 3K7AH 2LXKA 3OMCA 3I4LA 4FYDA 2VB3X 4R4OA 1G51A 4EX5A 1BVSA 4WFN3 1O7ZA 1RD9D 4RGMA 2MO0A 3F2DA 4PV1C 2KEEA 3PCOB 2A68C 2B63H 1VQEA 3S9WA 3IFDA 3UDFA 4HJ5A 1CHQD 2IX0A 5JEAJ 5JPNC 4JCVE 2YU9H 3HOVH 2B2VC 1PRTC 1FD7D 4DR4Q 1GD7A 2JQOA 3EROA 4BBSH 2VY3A 1G6PA 1XMOL 1E2WA 3CU7A 4A76A 5IYDH 5ELBA 5IGDA 4ILWA 2NVYB 4DUZL 3FKIG 3CCRA 2H1EA 3BZCA 2F0WA 2VQFQ 1E1TA 1PMRA 5DLQE 1K0SA 2K28A 1Q3LA 1TU2B 5E7NA 4DR1Q 2TMPA 4HJ9A 4MNOA 5CMDA 4WORA 3HOUG 2K5DA 3I56A 4L5QA 1Q8IA 4X3SA 3SDZA 3CC7A 1CQVA 2TSSA 1L1OB 1ENFA 4A3GG 1Z9FA 1L0WA 3S14B 3J81i 2PYKA 2KOLA 2K5WA 2BA0A 4TSSA 5JVH3 1VQDA 4C2MB 2QA4A 4YWMA 2K5NA 3SK5A 3S1QH 3S17H 1Q82C 3SEBA 1OXXK 4XYQA 5HGQA 2R7ZB 2IJ0A 4IFDG 1SRUA 2B39A 1TKWB 4JI4L 4L5TA 1KAAA 2QW7A 1EYGA 3KJPA 1CK1A 3NQIA 2F0HA 4NXML 1IHZA 1ILPA 2SOBA 2PW5A 3Q23A 3T16A 1D7QA 1X56A 3L7ZC 1SMXA 1EWCA 3K59A 2WFWA 3T51B 2B2WC 4BS9A 4OWTB 4HJAA 3DWQA 2F03A 4OGQC 1W2BA 1IKMA 1IBKL 3R93A 1OXTA 2E75C 1PV4A 3KFUA 2B2UA 3IKJA 2XNAC 5ELCA 1EIFA 3TBIB 3H15A 3KK7A 1PRTB 5LMNL 1I4RA 1A2TA 3A7AB 4FF1A 1MGSA 1TWGB 1CUKA 1HCZA 3VYRA 2UXDQ 1PTOH 3IAYA 2PQEA 2MGSA 5FJ8G 4BY7B 1X3FA 2NUCA 2R6GA 2Y0SG 1YI2A 1K28A 2L15A 2OT2A 3DM3A 2ICEC 3M4PA 4R4QA 1MJCA 1XTDA 1O78A 1EQQA 1TY2A 1TWCH 1EY9A 4RH6A 2KENA 2D5DA 4R8IA 2E5LQ 3GTQH 3BG3A 4K5XA 2IL8A 3MEFA 1MJEA 1Y1WB 1GUNA 2QDLA 1DOMA 3E9IA 1SYCA 1BOSA 4QL5A 1B8AA 4B3ML 2A19A 1D5ZC 1YNJD 1SDFA 1BUVT 5M5YB 1CA5A 1ICWA 3PUXA 3VYTA 2EXDA 3KDFB 1ESRA 3QO2A 4CDCC 1XPRA 1K8GA 1IL2A 4N9PA 3NENA 3C2PA 4APVA 1YJ9A 3SE0A 2KHIA 2F0UA 5ELNA 4H02A 4OWXB 1PH8A 1Q12A 4CJ1B 5C3EG 1LT4D 2LXJA 4DK1A 1YHBA 4A3IB 1SNCA 3U4VA 2EY5A 5K36H 4RHSA 3DEPA 3CW2C 2BCOA 4DAYB 5C5LA 1KLGD 1T5XD 3FMCA 1N8RC 5AJ3L 4GLXA 1VQ5A 4H13C 2UUBQ 3PQIA 3H0GG 1X6OA 3T56B 1JE4A 3ZJYC 4LNQA 3GD7A 5JEAG 4YHHQ 1ENAA 2XVSA 2KUMA 1TS2A 1D1IA 2Y0SB 4A3CG 3J7A5 2RVLA 2JA8G 3EVQA 3N52A 3UDIA 1BO0A 4FF4A 2JK8A 1TWHB 4DA2A 3A56A 1XNRL 1S5CD 1KC8C 2ICIA 5EJWA 2PNRC 2VL6A 1HPCA 5KYIA 4K14A 4A3JH 2E5LL 2DY8A 5C4XB 2IY5B 2EYJA 1K8OA 3NWTA 2NTTA 1VQFA 4GLAC 4N9TA 3CCJA 4AQYL 3NEMA 3AEVA 2VUMH 4PQXA 4RGTA 5C3XA 3A7LA 3TS0A 3W3AA 1RJTA 2AWOA 3CCQA 2WKCA 4QJFA 3ITPA 3W5OA 4X6AH 2ASBA 1WCMB 5ELOA 3EBEA 5BN4A 5C0XH 1KQSA 1RCVD 4DV2Q 3ER0A 3W1GA 2A6HD 4LWCA 4DPGA 1T9HA 4TRDA 4U673 2NZOA 3T4AC 3PO2H 4O0AA 1K3RA 1WTQA 1YITA 3I4MH 1I6VC 2JXMB 2F0DA 4C3HG 2JA5G 1STEA 1PH9A 1M1KC 1QE6A 4RWSC 3PIO3 1HNZL 2MFIA 2XTIA 3QJYA 3MHBA 4DV6L 4O1NA 4FP5D 2K14A 5DNFA 1L0XB 1NMGA 3KBXA 2OQKA 1QWYA 2IPKD 3ULLA 3M85A 1V8QA 3DEOA 3VR4A 2E2JH 4LF9L 5BN3A 3VR2A 2FINB 3RNUA 3KLRA 5IP9H 2JA8B 1F9RA 1IBLQ 3M7NA 3D3RA 2UU9L 4LFBL 2VQEQ 3HOVB 4HIDA 2NN6G 4FVMA 1V1QA 3CQZH 3PIOA 5FLMG 4MTKA 5KNBA 3RLNA 1K0RA 4KKSA 4A3FH 1E1OA 1F77A 1SJHD 2JEBI 2L5TA 2NVTH 3J7AV 1ZXTA 4X66Q 4DV0Q 1CI3M 4JI5L 2JSOA 1E22A 1GOZA 3G6JB 4C56C 5C4ZA 4AH6A 4KI0A 4E6IA 4C3IG 5M3MG 4LUVA 2ALYB 3KF8A 2ZJRA 1VQBA 2CH4W 4FXGC 1XNQQ 1UE7A 5AFWA 4C3JG 2PZTA 5J3BA 3NTIA 1U4MA 4B3SL 4QUCA 2ES2A 4L63B 2JA7G 1G291 1OO9B 1Y8OB 3DHQA 4NB3A 1UUPA 3IRBA 1CKNA 1STBA 4A3DH 2E74C 3FPUB 3NE5B 2R93H 2A8VA 2JA6G 2N49A 1IBMQ 1AEXA 1YHQA 4LF5Q 2XRSD 4IUQA 2JA5B 1KXLA 2X69A 3MWYW 2I5HA 3LWUA 5C4JH 1W3SA 1DZ1A 4FF2A 2AWNA 4Y52H 3HG9A 1UEBA 1GUOA 2DJGC 2UXCL 5M3FG 3VYSA 4LW1A 2Q2TA 1O7LA 2Q8TA 1WTXA 1MI2A 2FMCA 2F0JA 5CV9A 4YWLA 3GV3A 4WRDA 4LJZC 5F2DA 1VQMA 4A3LH 1DOKA 3OHXC 5KNCA 3PO3G 2K5VA 1VQIA 1L2FA 3SXHA 5GAGC 1F2LA 1PTOF 1H9JA 1SAPA 2I46A 2ZTEA 2EPBA 1BNZA 5JAVA 4DKAC 3MC0B 4KY5A 1XTCD 3M4QA 2B2UC 5CBEE 3S15B 2V1CC 1IYVA 3GTJB 3NPPA 1QVGA 1G6ZA 1WVLA 3U9SA 2F52A 1EFWA 2Y0SE 3H3VH 3I4NG 1C9OA 3AYHB 4OXPA 3G6EA 4C3IB 5M3MB 3NELA 5FLXc 3MFYA 3OTOL 1YJWA 4U68A 3D6WA 5FLXL 3GTGH 5C44G 4C3JB 4JI7Q 1GVPA 2D2CC 3GV6A 4TKOB 3HOXG 3BZDB 1XMQL 4KHZA 1CZWA 3EA6A 1F2MA 2P5ZX 1QZHA 2JA7B 3MXNB 4K2LA 5IGEA 2ZJPA 5ELDA 3GTPH 1PTOD 1QG7A 2N78A 3DM1A 4BXXG 5IYBH 4UP7A 1S5DD 2XIWA 4L5RC 3S2HH 2D0OA 1AH9A 1G8ZD 1EFID 1MKHA 2JA6B 1PYWD 1HH2P 1PVOA 5BR8Q 2K5HA 5CV5A 1HTPA 2F3WA 2PO4A 3VDYA 1J5EL 2MO1A 1RDPD 4GN4B 4NKLA 2VUMG 3OW2A 3GP7A 5M3FB 2IT1A 1JQYD 5KYLA 5IYCH 1A3VA 1A6XA 2NZHA 4KHPQ 4JI1Q 3S1RB 2EY1A 5EBDA 4JI3L 2QEXA 4PZ8A 2HD3A 4NXNL 3PO3B 1KNAA 2L4NA 2O2LD 3NTKA 3C1FA 1JWMD 2LFNA 4DR7Q 2Q2HA 2YV5A 2CW0D 4WJWA 4POFA 4A75A 3S24A 1H9RA 5M5XB 2C5CA 2F4VL 5I6YA 3LX0A 1VQCA 3K80C 1VQOA 4LF8Q 4EQ5A 4YCWA 3I4NB 4DR3Q 4PNYA 2A1AA 2AUKA 4DNIA 1E2VA 1SFOH 2F3IA 4KN7C 3HEJA 1EU3A 5CGKA 2RCFA 3GTLB 1DOLA 1QVCA 4CJ0B 2PPBC 4KJOA 5C44B 4RCNA 3HOXB 3Q24A 3V2TA 3D31A 2L55A 2F0GA 2F4IA 3GTMH 2IWHA 4A3MG 4OO1G 1GO3E 2J0TD 5EKLA 4ZUIA 3PF5A 1Y69U 3M4YA 1U4LA 4YWKA 1HNXL 4J6HA 1KTKA 4GKKL 4HSPA 2XGTA 4GOPB 4A3JB 4O42A 4ME3A 1VS0A 4IPGA 3S16H 1I5FA 3HKZG 3MVVA 3MAQA 2IHEA 3FDTA 3ZYYX 5LMUQ 2CVRA 5I4DA 1MSHA 3KLSX 3BYTB 4DK6C 2L11A 2VUMB 3FP9A 4IO9A 1VQ6A 5JOBA 4ULLA 2CKZB 4DXFA 2HCIA 2EDGA 2B29A 3CPFA 2EZVA 4BA1I 4S3SA 1UE5A 1BXTA 4LFCL 1S5ED 2NVXH 1QZGA 4A4IA 4TQUS 3PV0A 1H9SA 2R92H 1QNKA 5FOBB 2K33A 4I65A 1ZYRD 1X3GA 1STNA 4K8IA 4K6DA 2RDFA 4RMFA 2M9VA 1EWHA 2UUAL 4LF6Q 2R7ZG 1QILA 1C0AA 2Z6KA 1TY0A 2Q8IB 5JJLA 3X3NA 3RZDB 2E2JB 1I6HH 3K81C 1KABA 1HRJA 1WOCA 3K0XA 1ZKOA 3J7YW 4IUTA 3TP7A 2R61A 1QNUA 4BY1H 5IT9E 4A3MB 3VR5A 3IL8A 3H3VI 4KMUC 4QQBX 3TEHB 4WJ4A 2DJFC 2PNHA 1C8CA 3OSOA 1PYBA 3MA2B 1N34Q 1EY6A 2NVTB 2HHHL 3HKZB 2HQEA 3HFZB 5FKAC 4N8FA 3KUPA 3BVGA 3T53B 5LL6X 2JYOA 5L37A 1XWEA 5I2XA 4EGVA 2DN8A 4BY7G 1E0BA 3GTKB 1YNJC 5EAYA 4GKJL 4IOAA 4RAUC 5IP7G 4DV4L 5TSSA 1QUQA 1UE6A 3QOJA 3GDEA 4DR2Q 1KLUD 4DN4M 2B2YA 1JT8A 4G7HC 2L1BA 1EIHA 3HP3A 3RUZA 2F0QA 3A8IE 2KVMA 4OX9Q 1S5FD
chains in the Genus database with same CATH topology
3C1EA 1M8AA 3OMGA 3MTSA 2XWBB 2Z4HA 4R8NA 5HURA 5ELEA 3K0YA 3BVZA 1STHA 3CHBD 1JB3A 2AQ3B 4ZUJA 2EJMA 2O5IC 3AB9A 1HXYD 5T1GA 1TWFB 4X3KA 1EU4A 4CBVA 3NP8A 1C4QA 1I4XA 1WTPA 1CZGA 4M8AA 1SNMA 1O7YA 1IYUA 2NZ1D 5LL6S 5KGUA 3R2TA 1EY5A 1Q90A 1CT1D 2F0VA 5EKKA 1LTGD 1CFMA 1FNUA 2G9HD 5KRUA 3SHLA 3E6ZX 2EVBA 3H6MA 3A8JE 3TZDA 2VXWA 3HZXA 1DXMA 1JWSD 1BDOA 1J9OA 3R8BA 5A2QE 2JEAI 1XX8A 2DNEA 3GTPB 1ESFA 2KCNA 1H9MA 1B1ZA 3S2HB 3F2UA 2A6HC 4XTCS 3OWFA 4XYOA 2A68D 5E3FA 1RHPA 4PMCA 2N88A 5A35A 3NK9A 1PRTD 3W2DA 4ZRZA 2QKIC 1I4GA 5D65A 1LV9A 1EY0A 2F3VA 5A2QL 4KY6A 3MEHA 3NQTA 3L3OC 4RA8A 3RZOB 5JPMC 3NSWA 3PUWA 5E4XA 2WKDA 3D6CA 1Y8PB 2F0TA 3R2IA 1V1PA 3OIQA 1B9NA 1B4OA 1HUNA 3NBHA 5IGGA 4MIUA 4RHRA 4KD4A 1F2ZA 1GUTA 1SFOB 4Q5VA 3GQBA 2B8FA 1UNSA 2K7VA 4A3KB 2AQ2B 2SDFA 1JR0D 1TWAB 1EL0A 3DMUA 1FGBD 3S1NB 3TSSA 1I4PA 2RDGA 1S5BD 4BBRB 5FK9C 1XXGA 5CV4A 2K01A 4CKBA 3P1HA 5CC4A 1G2SA 1T5EA 1B53A 2LY7A 4HCEA 3FVQA 4A3EB 1SMYD 3J81E 1U9RA 4YIJA 5ISRA 3K5OA 2EY6A 4K6LA 2NVQB 3AMUA 4DAPA 5CBAE 4CJ2C 3M7GA 5IGFA 2WAQB 3Q0AA 1VF5C 4AYBB 2G9DA 2IW3A 1Z6HA 3E5SA 4DFAA 5DEHA 1VMCA 1I4HA 3V05A 1BBXC 4X3UA 1BR9A 3WDNA 4ZAIA 2ZXPA 4ID6A 2L0CA 4XDXA 2A69D 4BA2I 4ZK9B 5KEEA 1PXUA 1Z47A 3K7AB 3D4WA 1JICA 2M00A 4V0BA 4KHVA 2LMCB 2B63B 3NUCA 4BY1B 2YU9B 4XQNA 3D4DA 4X3TA 3TN2A 4BBSB 1PTOC 2NB0A 3J7AF 1TVXA 4J1MA 2CHBD 2BE5D 1VDZA 2AQ1B 2A6ED 4QUFA 3JAME 4NW2A 5LHY1 2CQAA 2Q8RE 2R3ZA 5IODA 1JC7A 1ML0D 4B9XA 2B2YC 1LT3D 2PMZB 4RKLA 2EYPA 2L9HA 3TP6A 2O4XA 2EE1A 3VYUA 3T13A 1EYAA 1ILQA 1AN8A 1QCBD 5JVG3 1OXUA 2CW0C 3JAML 1VMPA 3S1QB 3S17B 3Q22A 5EPJA 4QMGA 5EBCA 1H9SB 1O80A 4JBWA 2KEDA 5COYA 1HQMC 2PCFB 1D5MC 2B2TA 4DNTB 4EQOA 3HOWB 1DONA 1HFGA 3I70A 5K36G 5EGTA 4OIKA 1B2TA 4RFBA 4DF7A 5E1FA 1B50A 1R4PB 3NHHA 1F9SA 1PZKD 1SYFA 3EJIA 3N6RA 1PTOB 4HCSA 4OL7A 2QDBA 3MXGA 4KN4C 4CGYB 1WTOA 3MFGA 3ND9A 5DM63 1AZQA 2BA1A 4K8JA 1EQVA 1WTWA 5T1IA 3OW7A 4KJNA 4H7BA 3H94A 1TWCB 3I91A 3NTHA 3VA7A 3K58A 1L0YB 3AU7A 4ZKBB 3GTQB 1SE2A 4G57A 4QCLA 2YYZA 5D3IB 1ZYRC 5C0XI 5FO7B 1PZID 2DY7A 1LACA 4XT1B 4FXDA 2ZXOA 1SJED 2PW7A 1STYA 1ET9A 3K5MA 1HTLD 2SNSA 1RKNA 2MPMA 5CYUA 2WV6D 5C0XG 2MJ8A 4Q0FA 5IGCA 4RCOA 1E2ZA 4ZQ3A 4IFDH 1NUCA 1V1OA 3ND8A 4DAVA 1BCPF 3DUZA 2AUJD 3MZ5A 1TR5A 4DXGA 2LKVA 2K6AA 1J8IA 1W6KA 1KDAA 5I9PA 1NR4A 5C3WA 4XIGS 3S2DB 4CHTB 2I07B 4QF4A 2IX1A 1GJXA 5CV8A 4CKEA 2EYMA 3KLSA 4FF3A 1HUMA 5I6WA 4RKBA 2BDNA 3K5LA 3DWAA 3PUYA 1SSOA 1W6JA 1Z7TA 1LTTD 4ZLTF 1BQQT 2F0IA 1WTRA 2F0KA 4ZKCB 2L12A 1BCPD 1SYBA 4HTHA 4Z9CB 1MBYA 3OWEB 2KCCA 2WIIB 3RLFA 4ZYSA 2XN9C 1QJOA 2E76C 2Z8LA 3K6OA 2A74C 3SK4A 1EQTA 1RTNA 1PLFA 4KKUA 1QB5D 3PO2B 2OEOA 1OXVA 4MN3A 3RMHA 4NMZA 3J80E 3FEWX 2HDMA 3I4MB 4XT3B 1TS3A 1K8MA 2WB1B 3HOYB 3KBGA 2ENBA 4ME5A 1FNVA 1EY7A 1DYQA 2SEBD 4H0LC 2XWJB 1ONLA 1GXDC 1G91A 4F7XA 1V1PB 3HOZB 3SK6A 1TIID 2RA4A 3J80L 1PFMA 2MUYA 1NCVA 1II3A 3CQZB 4EQNA 1YNND 3H3VC 4MHEA 2RSOA 3PIP3 3TP8A 5JEAH 1U4RA 1ZEQX 4A3FB 2J4XA 3E0JA 4CKCA 4PMBA 1IL8A 2XRQD 3QWNA 4A3BB 4IZ8A 4IN3A 5K5PA 3P75A 1IW7D 2HUGA 2D62A 5IT9L 1NAPA 2KQ3A 1EZ8A 3C46A 1HQRD 1SBBB 1SE4A 4KK7A 1DCZA 4L6TB 3CKIB 4LAAA 1GHKA 1CHPD 3X3MA 3MXNA 4A3DB 2VB2X 1B9MA 3CRLC 2R93B 4G4KA 4IALA 1OXSC 1SNOA 1MD2D 4EVOA 2F0OA 4NDXA 2EYLA 5C4JB 1EOTA 1HA6A 5IGBA 4JK1C 4RGOS 4ODGA 3TZUA 4IUVA 3CRKC 4IFDI 2F0LA 4DGZA 2EYOA 1LTRD 3I73A 4P2CB 5NUCA 3QIAA 1SNDA 2B2TC 3I90A 3QG1A 4KTAA 2Z1CA 2IX3A 4IURA 2EYHA 1DD2A 5DAUA 1XYIA 2WINB 1PRTF 3K5NA 1Q1EA 3ERQA 4OHJA 1SMYC 2NN6H 1AP0A 3OIPA 1R9TB 1DJRD 2F0FA 3GTGB 4J8QA 1PFBA 1TS4A 1LLRD 5EKIA 3A55A 3FKIB 3QOLA 1I50B 4HEDA 4IQZA 1EEFD 3TDQA 3URYA 1STAA 1SNQA 3L9AX 1FYCA 3HOUB 2K5QA 1WTVA 3R3OA 2A69C 3VR3A 1JORA 3HGBA 2RDHA 2NTSA 4QB4A 5J1ZA 4A3GB 2RSNA 3NWSA 2QCPX 1JWUD 3K57A 4G7OC 1ENCA 2KJXA 3DXJC 2JE6I 2RBMA 3H09A 1EY8A 2FJ2A 4HMJA 1RODA 3PUZA 3BVMA 2BE5C 2ZT9C 1ET6A 2N55A 1GUSA 2EOTA 2A6EC 4M1UB 3V96A 5J22A 1KDBA 1B3AA 3GTMB 1LT5D 1A3TA 3FRPB 3Q6SA 5CV7A 1F9QA 4IUPA 5I9OA 3BYYB 5JJZA 3NBIA 2K32A 3S16B 4IUNA 5EPKA 3IFTA 1PDQA 1PZJD 4K5WA 3TP5A 1A2UA 1CTMA 1D1KA 1F2YA 2NYZD 1MSGA 1SEBD 1C48A 5DM73 4HR7B 2A73B 2K03A 5FO9B 3M4OB 2NBFA 2WP8J 4HMIA 3UI2A 5IIFA 4H44C 1HFNA 5BN5A 2F0EA 2MHVA 3D4RA 2NVXB 4XXEA 2FMMA 3J81L 4K5VA 2R92B 4XQQA 5CORA 2HCCA 5C0XJ 3BDOA 4LMQD 1FNWA 3VR6A 1BF4A 1QOHA 4G7ZC 1VCIA 4EQPA 3BS1A 1S4ZA 1X32A 2O5JC 4HSVA 5C3EB 1I6HB 1B44D 1SYGA 5EQ0A 1DM0B 1UAPA 1F9PA 2OXPA 4XQJA 5I2YA 2PZUA 1LT6D 1Q1BA 2FFKB 1CA6A 1JOQA 2NN6I 5ELFA 2FHTA 3H0GB 3OPOA 1D2BA 4QIWB 3LWEA 1LTBD 3OOCA 1X3PA 3G7LA 3O13A 1A15A 2X6GA 2M2LA 2B2VA 5FO8B 4OO1H 4HAEA 3S1MB 2KECA 3ONAB 3WOEA 1LTSD 1X3QA 5C4HA 1TS5A 3PMFA 3C3LA 5E4WC 1EYDA 1EIGA 2EY2A 2MP1A 2F0SA 4B08A 4C1NK 1LO5D 2WACA 1VF7A 3HRZC 4UAIA 2RQXA 4I7ZC 1CQFA 2E2IB 2F1MA 1AW7A 3U9OA 1STGA 4C3HB 4GZYC 2J7ZA 4KKTA 2K04A 4KV6A 1SNPA 5J39A 1A3UA 1AZPA 1TT2A 1U4PA 2ZXRA 5M9OA 5EPLA 3A8KE 1RF2D 4OIJA 2F0NA 2NWGA 1GUWA 1AFPA 4HN7A 4DAYA 2B2WA 2H4OA 2X6LA 3GTOB 1BCPC 5FLXE 1GUGA 2K05A 2XSCA 5M5WB 1JCKB 1WD0A 1WD1A 2A5HA 4A93B 2JP1A 5CV6A 1SYEA 4NP5A 2QEJC 3I3CA 1M4VA 4C1NI 3BDCA 3TMEA 4PMWA 2E2DC 2E2HB 2VNUD 1FR3A 2ID0A 3GO5A 2OF1A 2KHSA 1Y8NB 3RD4A 1I3QB 1RTOA 4F88A 2BDOA 2KA7A 1JOOA 2PZWA 2EJGC 1LTAD 2BOSA 2QILA 3SK8A 1LABA 4F8MA 4L8JA 4DK0A 2F0MA 1EY4A 4DU9A 1GHJA 1YNNC 3VA5A 4LK1C 5HGTA 2F0PA 4IFDJ 1HHVA 1NSNS 3SR1A 3NXWA 4FXKC 4FNFA 4B9WA 1Y1VB 2EXZA 2B8GA 1D5XC 1IW7C 2C9OA 2EYFA 1BCPB 3FPPA 1I4QA 1KDCA 1SYDA 3H91A 3A54A 2DNCA 5KIXA 4OO1I 3M3YB 2K1BA 5KNDA 2LS01 5G3LF 3QB3A 3MXPA 2HDLA 1UEAB 1K83B 3MXUA 4F87A 4FO2A 5C5MA 1HA5A 3P20A 4R9WA 4IUUA 2EJFC 2V4DA 4V190 4UDUC 4Y7NB 4KY7A 1TQOA 3PUVA 1LTID 1PFNA 5D14A 5IOCA 2RKSA 3I72A 5D3DA 4K2KA 5G3LD 3P7JA 4KD3A 3D8GA 1JOKA 1V43A 1IKLA 3DWPA 3BDLA 1D6EC 1CM9A 2Z4IA 3WOFA 3HS0C 1KNEA 2D9UA 1H9KA 5CR3A 4DNRB 1R4QB 3LNNA 2SNMA 2QF7A 1EEID 5C6AA 3EQLC 3SVMA 3EFXD 4BWGB 1EYCA 4RGNA 1G2TA 1NR2A 3I8ZA 1EZ6A 1SE3A 2GA4B 1SXTA 4ABNA 3OMCA 3I4LA 4FYDA 2VB3X 4WFN3 1O7ZA 1RD9D 4RGMA 4PV1C 2KEEA 2A68C 3S9WA 3IFDA 1CHQD 2IX0A 5JEAJ 5JPNC 2B2VC 1PRTC 1FD7D 3EROA 1E2WA 3CU7A 5ELBA 5IGDA 4ILWA 2NVYB 2H1EA 2F0WA 1PMRA 2K28A 1Q3LA 1TU2B 2TMPA 5CMDA 4WORA 2K5DA 1Q8IA 4X3SA 3SDZA 1CQVA 2TSSA 1ENFA 3S14B 2PYKA 2KOLA 2K5WA 2BA0A 4TSSA 5JVH3 4C2MB 3SK5A 3SEBA 1OXXK 4XYQA 2R7ZB 2IJ0A 4IFDG 2B39A 1TKWB 1KAAA 1CK1A 3NQIA 2F0HA 1IHZA 1ILPA 2SOBA 2PW5A 3Q23A 3T16A 3L7ZC 1EWCA 3K59A 3T51B 2B2WC 4BS9A 3DWQA 2F03A 4OGQC 1IKMA 3R93A 1OXTA 2E75C 2B2UA 5ELCA 3IKJA 2XNAC 3TBIB 3KK7A 1PRTB 1I4RA 1A2TA 3A7AB 4FF1A 1MGSA 1TWGB 1HCZA 3VYRA 1PTOH 3IAYA 2PQEA 2MGSA 4BY7B 2NUCA 2R6GA 2OT2A 2ICEC 1O78A 1TY2A 4RH6A 1EY9A 2D5DA 4R8IA 3BG3A 4K5XA 2IL8A 1Y1WB 1GUNA 1DOMA 1SYCA 1BOSA 1D5ZC 1YNJD 1SDFA 1BUVT 5M5YB 1CA5A 1ICWA 3PUXA 3VYTA 1ESRA 3QO2A 4N9PA 3C2PA 3SE0A 2F0UA 1Q12A 4CJ1B 1LT4D 4DK1A 4A3IB 1SNCA 2EY5A 5K36H 4RHSA 3DEPA 2BCOA 5C5LA 1KLGD 1T5XD 3FMCA 4H13C 3T56B 1JE4A 3GD7A 5JEAG 1ENAA 2XVSA 2KUMA 1TS2A 1D1IA 2Y0SB 2RVLA 3EVQA 3N52A 1BO0A 4FF4A 1TWHB 4DA2A 3A56A 1S5CD 2ICIA 5EJWA 2PNRC 1HPCA 5KYIA 4K14A 2DY8A 5C4XB 2EYJA 1K8OA 3NWTA 2NTTA 4N9TA 4PQXA 4RGTA 5C3XA 3A7LA 3W3AA 1RJTA 2AWOA 2WKCA 3ITPA 1WCMB 5BN4A 5C0XH 1RCVD 2A6HD 4TRDA 4U673 3T4AC 1WTQA 1I6VC 2JXMB 2F0DA 4C3HG 1STEA 1QE6A 4RWSC 3PIO3 3QJYA 3MHBA 4O1NA 4FP5D 5DNFA 1L0XB 3KBXA 1QWYA 2IPKD 3M85A 1V8QA 3DEOA 3VR4A 5BN3A 3VR2A 2FINB 3KLRA 2JA8B 1F9RA 3M7NA 3D3RA 3HOVB 2NN6G 4FVMA 5KNBA 4KKSA 1F77A 1SJHD 2JEBI 2L5TA 3J7AV 1ZXTA 1CI3M 2JSOA 1GOZA 3G6JB 4C56C 5C4ZA 4KI0A 4E6IA 4C3IG 3KF8A 4FXGC 5AFWA 4C3JG 2PZTA 3NTIA 1U4MA 4QUCA 4L63B 1G291 1OO9B 1Y8OB 3DHQA 1UUPA 1STBA 2E74C 3FPUB 3NE5B 1AEXA 2XRSD 4IUQA 2JA5B 2X69A 3MWYW 3LWUA 1DZ1A 4FF2A 2AWNA 3HG9A 1GUOA 3VYSA 1O7LA 2Q8TA 1WTXA 1MI2A 2FMCA 2F0JA 5CV9A 3GV3A 4WRDA 4LJZC 5F2DA 1DOKA 3OHXC 5KNCA 3SXHA 1PTOF 1SAPA 1F2LA 1H9JA 2I46A 2EPBA 1BNZA 5JAVA 3MC0B 4KY5A 1XTCD 2B2UC 5CBEE 3S15B 1IYVA 3GTJB 3NPPA 1G6ZA 1WVLA 3U9SA 4C3IB 5M3MB 3MFYA 4U68A 3D6WA 5FLXL 4C3JB 2D2CC 3GV6A 4TKOB 3BZDB 4KHZA 1CZWA 3EA6A 1F2MA 2JA7B 5IGEA 4K2LA 5ELDA 1PTOD 1QG7A 3DM1A 1S5DD 2XIWA 1G8ZD 1EFID 2JA6B 1PYWD 5CV5A 1HTPA 2F3WA 2PO4A 1RDPD 4NKLA 3GP7A 5M3FB 2IT1A 1JQYD 5KYLA 1A3VA 1A6XA 3S1RB 2EY1A 5EBDA 1S5FD 3PO3B 1KNAA 2L4NA 2O2LD 3NTKA 3C1FA 1JWMD 2LFNA 2CW0D 4WJWA 1H9RA 5M5XB 2C5CA 5I6YA 3LX0A 3I4NB 4PNYA 2AUKA 1E2VA 4KN7C 3HEJA 1EU3A 5CGKA 3GTLB 1DOLA 4CJ0B 2PPBC 4KJOA 5C44B 4RCNA 3HOXB 3Q24A 3V2TA 3D31A 2L55A 2F0GA 2F4IA 2IWHA 4OO1G 2J0TD 5EKLA 4ZUIA 1Y69U 3M4YA 1U4LA 4J6HA 4HSPA 4A3JB 4O42A 3MAQA 3MVVA 3FDTA 3ZYYX 2CVRA 5I4DA 1MSHA 3KLSX 3BYTB 2L11A 2VUMB 5JOBA 4ULLA 4DXFA 2HCIA 2EDGA 2EZVA 4BA1I 4S3SA 1BXTA 1S5ED 4TQUS 3PV0A 1H9SA 1QNKA 5FOBB 2K33A 4I65A 1ZYRD 1STNA 4K8IA 4K6DA 2RDFA 2M9VA 1EWHA 1QILA 1TY0A 2Q8IB 3X3NA 3RZDB 2E2JB 1KABA 1HRJA 1ZKOA 3J7YW 4IUTA 3TP7A 2R61A 1QNUA 5IT9E 4A3MB 3VR5A 3IL8A 4KMUC 1C8CA 3OSOA 3MA2B 1EY6A 2NVTB 3HKZB 2HQEA 5FKAC 3KUPA 3BVGA 3T53B 5LL6X 2JYOA 1XWEA 5I2XA 4EGVA 2DN8A 1E0BA 3GTKB 1YNJC 4RAUC 5TSSA 3QOJA 1KLUD 4DN4M 2B2YA 4G7HC 2L1BA 1EIHA 3HP3A 3RUZA 2F0QA 3A8IE 2KVMA 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4D A;  3KLS X;  3BYT B;  3BZD B;  2XRQ D;  1LO5 D;  1EEI D;  1EWC A;  3EA6 A;  1F77 A;  1SJH D;  1EEF D;  3EFX D;  4RFB A;  5ELD A;  3URY A;  1TS2 A;  4DXF A;  1PTO D;  4BWG B;  4RGN A;  3DWQ A;  5ELE A;  1S5D D;  1GOZ A;  3BVZ A;  3DWA A;  4C56 C;  1AW7 A;  1G8Z D;  1PZK D;  1EFI D;  3R2I A;  1SE3 A;  3CHB D;  1SXT A;  1HQR D;  1PYW D;  1SBB B;  1SE4 A;  1PTO B;  1LTT D;  2XNA C;  5ELC A;  4L6T B;  1BXT A;  2AQ3 B;  2RDH A;  1FNW A;  1S5E D;  2NTS A;  1S5C D;  1BCP D;  1PRT B;  1V1P A;  3MFG A;  1CHP D;  2ICI A;  1I4R A;  1RD9 D;  4RGM A;  1HXY D;  1RDP D;  3GP7 A;  1D5X C;  4RHR A;  1EU4 A;  1PTO H;  1PTO C;  4Z9C B;  4L63 B;  1CHQ D;  1I4X A;  1BCP B;  1JQY D;  1JWU D;  3OWE B;  1I4Q A;  4ZYS A;  1RF2 D;  2CHB D;  1MD2 D;  1PRT C;  1FD7 D;  2XN9 C;  1UUP A;  2NTT A;  2Z8L A;  1B44 D;  2AQ1 B;  1L0Y B;  1UNS A;  1S5F D;  3R2T A;  4RGT A;  1QIL A;  1SE2 A;  2AQ2 B;  1JR0 D;  1BCP C;  2XRS D;  1TY2 A;  1TY0 A;  4RGO S;  1CT1 D;  1FGB D;  4RH6 A;  1LTG D;  5ELB A;  1LT6 D;  5D3I B;  3TSS A;  1I4P A;  2RDG A;  1S5B D;  5FK9 C;  1XXG A;  2O2L D;  1FNU A;  2G9H D;  1JWM D;  3BVM A;  1LTR D;  5ELF A;  1JCK B;  1PZI D;  1ET6 A;  1RCV D;  2R61 A;  1HA5 A;  1LTB D;  1LT3 D;  1SJE D;  1TS3 A;  3O13 A;  2QEJ C;  1ET9 A;  1JWS D;  1D5Z C;  1HTL D;  1M4V A;  4UDU C;  1STE A;  3R8B A;  2WV6 D;  4K6L A;  1FNV A;  1AN8 A;  1DYQ A;  2SEB D;  1EU3 A;  1CQV A;  1LTI D;  1LT5 D;  1ESF A;  1PTO F;  2TSS A;  5FKA C;  4RCO A;  1B1Z A;  1ENF A;  1LTS D;  3BVG A;  1PRT F;  1V1P B;  4O1N A;  5D3D A;  1L0X B;  1V1O A;  4OHJ A;  4TSS A;  3MC0 B;  2IPK D;  3BYY B;  1XTC D;  1BCP F;  1DJR D;  1LT4 D;  5TSS A;  1I4H A;  1TS5 A;  3V05 A;  3SEB A;  1LTA D;  1PRT D;  3DWP A;  1PZJ D;  1TS4 A;  1D6E C;  1KLU D;  1LLR D;  2QIL A;  3W2D A;  4DXG A;  4RHS A;  2IJ0 A;  1I4G A;  1SEB D;  1D5M C;  1KLG D;  1T5X D;  1CK1 A;  2J4X A;  1KTK A; 
#chains in the Genus database with same CATH topology
 1KRT A;  1E24 A;  3C1E A;  1M8A A;  3OMG A;  1PH2 A;  4JI0 Q;  1Y1W G;  3MTS A;  4X64 Q;  2XWB B;  2Z4H A;  4R8N A;  4IJH A;  5HUR A;  5ELE A;  3K0Y A;  3BVZ A;  1STH A;  4R4I A;  1EIY B;  1I94 Q;  3CHB D;  2UXB L;  1JB3 A;  2AQ3 B;  4ZUJ A;  2EJM A;  3UDG A;  2O5I C;  3AB9 A;  1HXY D;  4B3R L;  5T1G A;  1TWF B;  1FVI A;  4X3K A;  1EU4 A;  1PHJ A;  4CBV A;  3NP8 A;  1C4Q A;  1I4X A;  1WTP A;  3DLL A;  1CZG A;  4M8A A;  1SNM A;  1O7Y A;  1IYU A;  2Z9H A;  3HOW H;  2NZ1 D;  4A3I G;  5LL6 S;  5KGU A;  1WJJ A;  1X65 A;  3OYY A;  3R2T A;  1EY5 A;  1Q90 A;  1S40 A;  4DR4 L;  1CT1 D;  3KYH C;  2F0V A;  2PQA A;  1N36 Q;  5EKK A;  1LTG D;  2N3S A;  1CFM A;  1FNU A;  2G9H D;  5KRU A;  3SHL A;  3E6Z X;  3GTO H;  2EVB A;  2B3G A;  4PZ6 A;  1YNX A;  3H6M A;  5IWA Q;  1UWV A;  3A8J E;  3TZD A;  2VXW A;  3HZX A;  1Q7Y C;  2VQF L;  1DXM A;  1SE8 A;  1JWS D;  1BDO A;  1J9O A;  4JI2 Q;  4A3K G;  1PA6 A;  4JV5 Q;  1E7Z A;  4A93 H;  3R8B A;  4DR1 L;  5A2Q E;  2JEA I;  4JC0 A;  1XX8 A;  2DNE A;  3GTP B;  2I5M X;  4BBR G;  1ESF A;  3KF8 B;  2KCN A;  1H9M A;  1B1Z A;  3S2H B;  3F2U A;  2A6H C;  4XTC S;  1ICF B;  3OWF A;  4XYO A;  2A68 D;  3PSI A;  5C4X G;  5E3F A;  1RHP A;  2CFM A;  2E2H H;  2DUD A;  4A3E G;  4PMC A;  2N88 A;  5A35 A;  3NK9 A;  1PRT D;  3W1B A;  3W2D A;  4ZRZ A;  1CKN B;  2QKI C;  1I4G A;  5D65 A;  1LV9 A;  1EY0 A;  1WYD A;  2F3V A;  1VQL A;  5A2Q L;  4KY6 A;  3MEH A;  3NQT A;  3L3O C;  4RA8 A;  4AYB G;  1WCM G;  3RZO B;  4JYA Q;  5JPM C;  1Q8K A;  3FHW A;  3NSW A;  3PUW A;  3J7Z C;  1JB7 A;  3KF6 B;  4JI6 Q;  1HNW Q;  1A0I A;  5E4X A;  1JJG A;  4WJ3 M;  5GAD C;  4DR5 Q;  2CH4 A;  1IZ6 A;  2WKD A;  3D6C A;  1Y8P B;  2F0T A;  3R2I A;  3E9H A;  3F2C A;  1V1P A;  3OIQ A;  1B9N A;  1B4O A;  1HUN A;  3NBH A;  5IGG A;  1GM5 A;  4DR6 Q;  4PZ7 A;  4MIU A;  4RHR A;  4KD4 A;  1F2Z A;  1GUT A;  3PGZ A;  1SFO B;  4LF7 Q;  4LF4 Q;  3CD6 A;  1A62 A;  3S2D H;  1Y1V H;  3STB D;  2UXD L;  4Q5V A;  3GQB A;  4JOI A;  2B8F A;  1UNS A;  2K7V A;  4A3K B;  2AQ2 B;  2SDF A;  1JR0 D;  2B63 G;  1TWA B;  1EL0 A;  3DMU A;  1FGB D;  3S1N B;  2ATW A;  3HOV G;  3TSS A;  1I4P A;  2RDG A;  1S5B D;  4BBR B;  5FK9 C;  1XXG A;  5CV4 A;  3M3Y H;  2K01 A;  4BBS G;  4CKB A;  3L0O A;  3P1H A;  5CC4 A;  1G2S A;  1T5E A;  1B53 A;  2LY7 A;  4HCE A;  1N32 Q;  3TRZ A;  2OCE A;  1PYS B;  3FVQ A;  5IYD G;  1K83 H;  1SMY D;  4A3E B;  3J81 E;  1U9R A;  1NE3 A;  2UUC Q;  4YIJ A;  5ISR A;  3K5O A;  4DV5 Q;  2EY6 A;  4K6L A;  2NVQ B;  4LUZ A;  3AMU A;  4DAP A;  5CBA E;  4CJ2 C;  3M7G A;  5IGF A;  2WAQ B;  3Q0A A;  1VF5 C;  4AYB B;  4Y7N H;  2G9D A;  2IW3 A;  1Z6H A;  3E5S A;  4DFA A;  5DEH A;  1VMC A;  1I4H A;  3V05 A;  1QVF A;  1BBX C;  4X3U A;  1BR9 A;  3WDN A;  1LM0 A;  4ZAI A;  1YZ6 A;  2ZXP A;  4ID6 A;  2L0C A;  4DR5 L;  1L1O A;  1DGS A;  4XDX A;  2Z0S A;  3HOY H;  2A69 D;  2E8G A;  3SGI A;  1NNX A;  4HJ8 A;  3M9B A;  4BA2 I;  4ZK9 B;  5KEE A;  1N33 Q;  1PXU A;  4DK3 C;  3AFP A;  1Q81 C;  1UE1 A;  1Z47 A;  1HZC A;  4P75 A;  2UUB L;  3K7A B;  3D4W A;  2Z6K C;  1JIC A;  2M00 A;  4V0B A;  3BJU A;  4KHV A;  4P72 A;  2EQS A;  4YHH L;  3HOZ H;  2LMC B;  2B63 B;  3NUC A;  4BY1 B;  4NPS A;  1PH1 A;  1NBW A;  2YU9 B;  4DV3 Q;  4XQN A;  3CXC A;  3D4D A;  4X3T A;  3A0J A;  4OWW B;  3TN2 A;  4BBS B;  1PTO C;  2NB0 A;  3J7A F;  1EQR A;  3RN5 A;  1TVX A;  3T1H Q;  4J1M A;  2CHB D;  2BE5 D;  1K3B C;  2PI2 E;  1VQ4 A;  1VDZ A;  2AQ1 B;  2Q2I A;  4A3B H;  2A6E D;  3T1Y Q;  4QUF A;  3JAM E;  4NW2 A;  1A63 A;  5LHY 1;  1SR3 A;  2CQA A;  2K4K A;  2Q8R E;  2R3Z A;  2KHJ A;  2AHO B;  5IOD A;  1Y14 B;  1JC7 A;  1ML0 D;  2OQ0 A;  4B9X A;  2B2Y C;  4I7A A;  1LT3 D;  2NVY H;  2PMZ B;  4RKL A;  2EYP A;  2L9H A;  3TP6 A;  4J15 A;  2O4X A;  2EE1 A;  3VYU A;  4X65 Q;  3T13 A;  3CCL A;  4DV2 L;  1EYA A;  1ILQ A;  1AN8 A;  1QCB D;  1WFQ A;  2IHF A;  5JVG 3;  1OXU A;  3JAM c;  2RHS B;  2CW0 C;  3JAM L;  1VMP A;  2H5X A;  3S1Q B;  3S17 B;  4DUY Q;  2AKW B;  3Q22 A;  5EPJ A;  2EIF A;  4QMG A;  5EBC A;  2JA9 A;  1H9S B;  1O80 A;  4JBW A;  4IPD A;  2KED A;  3CCE A;  5COY A;  1HQM C;  2PCF B;  1U0L A;  3KDF A;  4YY3 Q;  4C2M H;  1D5M C;  1WTH A;  2B2T A;  2AMC B;  2CWA A;  4RG1 A;  4DNT B;  4EQO A;  3HOW B;  1DON A;  1SLJ A;  1VQH A;  1HFG A;  1IBL L;  4JW0 A;  2VQE L;  3I70 A;  5K36 G;  5EGT A;  4OIK A;  4B3T Q;  1B2T A;  4RFB A;  4DF7 A;  5E1F A;  3F1Z A;  1B50 A;  1R4P B;  3NHH A;  1F9S A;  1PZK D;  1SYF A;  3EJI A;  3N6R A;  1PTO B;  4HCS A;  4OL7 A;  4X66 L;  2QDB A;  4DV0 L;  3MXG A;  4KN4 C;  4CGY B;  1WTO A;  3MFG A;  1R9T H;  3ND9 A;  5DM6 3;  1AZQ A;  2BA1 A;  1ASY A;  4K8J A;  1EQV A;  4DAM A;  1WTW A;  5T1I A;  3OW7 A;  1XNQ L;  4KJN A;  4H7B A;  3H94 A;  1TWC B;  3I91 A;  3FKI H;  1I50 H;  3NTH A;  3VA7 A;  1TWG H;  1CKO A;  1L0Y B;  3K58 A;  3AU7 A;  4ZKB B;  3GTQ B;  1SE2 A;  4G57 A;  3CC4 A;  4QCL A;  2YYZ A;  4A3J G;  3K7U C;  5D3I B;  1HJP A;  2I0Q A;  4JBJ A;  1FJG Q;  1HZ9 A;  1IBM L;  1ZYR C;  5C0X I;  4LF5 L;  4GN5 A;  3HOU H;  5FO7 B;  1PZI D;  2DY7 A;  1LAC A;  4XT1 B;  1P8L A;  1K8A C;  4FXD A;  2ZXO A;  1SJE D;  2PW7 A;  2QGQ A;  4K0K Q;  1STY A;  1ET9 A;  4A3G H;  4P73 A;  3K5M A;  1HTL D;  2SNS A;  1RKN A;  4DV7 Q;  2MPM A;  5CYU A;  5GAE C;  2WV6 D;  5C0X G;  2MJ8 A;  2HIX A;  2JN4 A;  4Q0F A;  4LFA Q;  1HR0 Q;  5IGC A;  2JJQ A;  4RCO A;  3PO2 G;  1E2Z A;  4ZQ3 A;  4JI8 Q;  1NUC A;  1V1O A;  4IOC A;  3I4M G;  4IFD H;  3ND8 A;  3A74 A;  1KHI A;  2WB1 G;  3JC6 6;  4DAV A;  1BCP F;  3DUZ A;  2OTJ A;  2R7F A;  2AUJ D;  3F8T A;  3MZ5 A;  1TR5 A;  4DXG A;  2LKV A;  2K6A A;  1BBW A;  1X3E A;  4X62 Q;  1J8I A;  1W6K A;  1KDA A;  2RCN A;  5I9P A;  1NR4 A;  4XIG S;  5C3W A;  3S2D B;  4CHT B;  2I07 B;  4QF4 A;  3BU2 A;  4PG3 A;  2IX1 A;  5IP9 G;  1IXR A;  5CV8 A;  3HOZ G;  4DV1 Q;  4CKE A;  1GJX A;  2EYM A;  3KLS A;  1XPO A;  4FF3 A;  4JI7 L;  1HUM A;  5I6W A;  1PFS A;  4RKB A;  2BDN A;  3K5L A;  4HJ7 A;  3DWA A;  3PUY A;  1SSO A;  1W6J A;  1Z7T A;  1VQN A;  1LTT D;  5FJ8 H;  4ZLT F;  4A3F G;  1BQQ T;  3CCS A;  2F0I A;  1WTR A;  4OEL B;  2F0K A;  4ZKC B;  1VQK A;  2L12 A;  1BCP D;  1S72 A;  3D0F A;  1SYB A;  5BR8 L;  1NTG A;  4HTH A;  4Z9C B;  1TWH H;  1HZB A;  1MBY A;  3OWE B;  2KCC A;  2WII B;  3RLF A;  4ZYS A;  4GLV B;  1XMO Q;  1VQA A;  2XN9 C;  1QJO A;  2PMZ E;  2E76 C;  1Q86 C;  2Z8L A;  2OTL A;  2HIV A;  4DUZ Q;  3K6O A;  3M4O H;  1OTC A;  1VQG A;  2A74 C;  3SK4 A;  1EQT A;  4KHP L;  4JI1 L;  1RTN A;  1PLF A;  4KKU A;  1QB5 D;  4A3D G;  3PO2 B;  2OEO A;  1B70 B;  1OXV A;  4MN3 A;  3RMH A;  4NMZ A;  2R93 G;  3J80 E;  3FEW X;  2HDM A;  3I4M B;  4XT3 B;  1TS3 A;  1K8M A;  2WB1 B;  3HOY B;  2GN5 A;  4DR7 L;  3I2Z A;  1EOV A;  3KBG A;  2ENB A;  4ME5 A;  1FNV A;  1EY7 A;  1DYQ A;  2SEB D;  4UP9 A;  5C3E H;  4H0L C;  2XWJ B;  1ONL A;  4LF8 L;  1GXD C;  1G91 A;  4DR3 L;  4F7X A;  1V1P B;  1VQ9 A;  3HOZ B;  3J80 c;  4A3L G;  3SK6 A;  1TII D;  2RA4 A;  3J80 L;  1PFM A;  2MUY A;  5H1S E;  1NCV A;  4JI4 Q;  1II3 A;  3CQZ B;  4JPB W;  3TS2 A;  4EQN A;  4NXM Q;  5GQO A;  1YNN D;  3H3V C;  3H0G H;  3I7F A;  4MHE A;  2RSO A;  3PIP 3;  3TP8 A;  4GS3 A;  5JEA H;  1U4R A;  1ZEQ X;  4A3F B;  4OON A;  2J4X A;  3E0J A;  4CKC A;  2CWP A;  4PMB A;  4A3C H;  2JA8 H;  1IL8 A;  2XRQ D;  3QWN A;  4P74 A;  4HIK A;  4IZ8 A;  4IN3 A;  1IBK Q;  4A3B B;  5K5P A;  5LMU L;  3P75 A;  1IW7 D;  3E0E A;  5IT9 c;  1NMF A;  3S1M H;  2HUG A;  5JJK A;  2D62 A;  1KAW A;  5IT9 L;  3CF5 A;  1X55 A;  5LMN Q;  1YBY A;  1NAP A;  2KQ3 A;  3PIP A;  1EZ8 A;  3C46 A;  1HQR D;  1SBB B;  1SE4 A;  4KK7 A;  1DCZ A;  4L6T B;  1NY4 A;  3CKI B;  4LAA A;  1TXY A;  1GHK A;  2Q2U A;  3U4Z A;  1CHP D;  3X3M A;  5IYB G;  3MXN A;  4A3D B;  2VB2 X;  1B9M A;  3CRL C;  2R93 B;  1AE3 A;  3TRE A;  4G4K A;  4IAL A;  1OXS C;  1SNO A;  1MD2 D;  4EVO A;  2F0O A;  1JMC A;  4NDX A;  2EYL A;  5C4J B;  1EOT A;  2VZA A;  1HA6 A;  3WWV A;  5IGB A;  4JK1 C;  4RGO S;  4ODG A;  4GNX A;  3TZU A;  4IUV A;  1CSQ A;  5IYC G;  3CRK C;  4IFD I;  2F0L A;  4DGZ A;  2E2I H;  4LF6 L;  2EYO A;  4R4T A;  1LTR D;  3I73 A;  4C3H H;  4B3M Q;  2JA5 H;  4P2C B;  5NUC A;  3STB C;  3QIA A;  4KLK A;  1SND A;  2B2T C;  3G71 A;  3I90 A;  3QG1 A;  1MIU A;  4KTA A;  2Z1C A;  3I55 A;  2IX3 A;  4IUR A;  2EYH A;  1DD2 A;  3TQY A;  3CCM A;  5DAU A;  1XYI A;  4UY8 C;  1HR0 W;  1H95 A;  1KIX A;  2WIN B;  1N34 L;  1PRT F;  3K5N A;  2ZTC A;  1GKH A;  1Q1E A;  3ERQ A;  2Z6B A;  4JVZ A;  4OHJ A;  1SMY C;  2NN6 H;  1AP0 A;  3OIP A;  3Q8D A;  1R9T B;  3RR5 A;  1DJR D;  2F0F A;  5FLM H;  3GTG B;  4J8Q A;  1B7Y B;  1PFB A;  5M5W H;  1TS4 A;  5AJ3 Q;  1LLR D;  5EKI A;  4ZCK A;  3A55 A;  3S15 H;  3RLO A;  3FKI B;  3QOL A;  3GTJ H;  4DR2 L;  1I50 B;  2ZJQ A;  4HED A;  4QGU A;  1J6Q A;  4IQZ A;  1PH6 A;  4C3I H;  4OX9 L;  5M3M H;  5IY0 A;  1EEF D;  3TDQ A;  3URY A;  1O7I A;  1STA A;  1SNQ A;  4C3J H;  3L9A X;  1FYC A;  1XNR Q;  4GOP A;  4JI0 L;  1I3Q H;  3HOU B;  4X64 L;  5IE8 A;  2K5Q A;  1WTV A;  3R3O A;  2JA7 H;  3KJO A;  2A69 C;  3VR3 A;  1JOR A;  1EUJ A;  3HGB A;  1C7Y A;  2RDH A;  2NTS A;  4R1J A;  4QB4 A;  1I94 L;  1E3P A;  5J1Z A;  2WAQ G;  4A3G B;  2RSN A;  1RIP A;  2JA6 H;  3NWS A;  4AQY Q;  2YTV A;  2QCP X;  1N9W A;  1JWU D;  3K57 A;  4G7O C;  1ENC A;  4YCU A;  2KJX A;  3DXJ C;  2JE6 I;  2WB1 E;  4UP8 A;  2RBM A;  3JAM i;  3H09 A;  5M3F H;  1EY8 A;  5JJI A;  2FJ2 A;  4AIM A;  2R92 G;  4HMJ A;  1ROD A;  2RF4 A;  3PUZ A;  3S1R H;  3BVM A;  1N36 L;  2MNA A;  2BE5 C;  5GAH C;  2ZT9 C;  1ET6 A;  2N55 A;  1M90 C;  3PO3 H;  1GUS A;  2EOT A;  1HNZ Q;  2A6E C;  4M1U B;  3V96 A;  2ZM6 Q;  5IWA L;  5J22 A;  5M5X H;  4DV6 Q;  3KOJ A;  1KDB A;  1B3A A;  4BY1 G;  3GTM B;  1B3Q A;  2OWO A;  1LT5 D;  4JI2 L;  4JV5 L;  1A3T A;  4LF9 Q;  3HKZ E;  3FRP B;  3I4N H;  3Q6S A;  5CV7 A;  1F9Q A;  4IUP A;  5I9O A;  3GTL H;  3BYY B;  5JJZ A;  3NBI A;  2K32 A;  2UU9 Q;  3S16 B;  4LFB Q;  4IUN A;  5C44 H;  5EPK A;  3HOX H;  3IFT A;  1PDQ A;  4POG A;  1PZJ D;  4K5W A;  3TP5 A;  1NJI C;  1A2U A;  1CTM A;  1D1K A;  1PH7 A;  1F2Y A;  2NYZ D;  1MSG A;  1SEB D;  1C48 A;  5DM7 3;  4HR7 B;  2A73 B;  1YVC A;  4BXX H;  2K03 A;  5FO9 B;  3M4O B;  2NBF A;  2WP8 J;  4JI5 Q;  4HMI A;  3UI2 A;  5IIF A;  4H44 C;  4ALP A;  1D8L A;  1HFN A;  5BN5 A;  2F0E A;  3PF4 A;  2MHV A;  3D4R A;  1JJ2 A;  2NVX B;  4JYA L;  4XXE A;  2FMM A;  2I5L X;  3J81 c;  3J81 L;  1A8V A;  4JI6 L;  4K5V A;  5LMN W;  2R92 B;  4XQQ A;  3ERS X;  5COR A;  1HNW L;  2HCC A;  5C0X J;  4B3S Q;  4CDD C;  3BDO A;  4LMQ D;  1FNW A;  3VR6 A;  2KCT A;  1BF4 A;  1QOH A;  3CPW A;  2BH2 A;  4G7Z C;  1VCI A;  1KRS A;  1CKM A;  4EQP A;  3BS1 A;  1S4Z A;  1X32 A;  1ASZ A;  2O5J C;  4IPC A;  3U58 A;  4HSV A;  5C3E B;  4DR6 L;  3J81 j;  3ICE A;  1I6H B;  1B44 D;  1SYG A;  5EQ0 A;  1DM0 B;  1UAP A;  3LGJ A;  1F9P A;  1MHW C;  1YJN A;  2OXP A;  4LF7 L;  4XQJ A;  3A5Z B;  1IYJ B;  3UE1 A;  5I2Y A;  2UXC Q;  4LF4 L;  2PZU A;  2G5D A;  4O2D A;  1LT6 D;  2MQH A;  2ZM6 L;  1Q1B A;  3HOW G;  1U5K A;  2FFK B;  1CA6 A;  1JOQ A;  2NN6 I;  5ELF A;  2FHT A;  3H0G B;  3OPO A;  1D2B A;  4QIW B;  3RZD H;  3LWE A;  1LTB D;  4IJL A;  4CDE C;  1SN8 A;  3OOC A;  1X3P A;  3G7L A;  3O13 A;  1A15 A;  2X6G A;  2M2L A;  1K73 C;  1N32 L;  2B2V A;  5FO8 B;  4A3M H;  4OO1 H;  1XJV A;  2YTX A;  3CCU A;  4HAE A;  2UUC L;  1VQP A;  3S1M B;  2HT1 A;  4DV5 L;  2PI2 A;  2KEC A;  3ONA B;  3WOE A;  1LTS D;  1BKB A;  1X54 A;  3F2B A;  3RN2 A;  4JBM A;  4A93 G;  3B6Y A;  4R4C A;  1X3Q A;  3ULJ A;  5C4H A;  1EWI A;  3G48 A;  3OTO Q;  1TS5 A;  3PMF A;  3C3L A;  2R7D A;  5E4W C;  1XMQ Q;  1EYD A;  1EIG A;  3GTK H;  2EY2 A;  4MZ9 A;  4FDB A;  2MP1 A;  2F0S A;  2K75 A;  4B08 A;  4C1N K;  1LO5 D;  2WAC A;  1VF7 A;  3HRZ C;  4UAI A;  2RQX A;  2HQL A;  3CP0 A;  4I7Z C;  1P16 A;  1V9P A;  1N33 L;  1XPU A;  4GNX C;  1CQF A;  2E2I B;  2F1M A;  1AW7 A;  1J5E Q;  4GN3 B;  3AFQ A;  3U9O A;  3S14 H;  1STG A;  4C3H B;  4GZY C;  2J7Z A;  4KKT A;  2K04 A;  4KV6 A;  1SNP A;  5J39 A;  1A3U A;  3L2P A;  1KL9 A;  1PH3 A;  1LYL A;  2FXQ A;  1AZP A;  1TT2 A;  3KF6 A;  1U4P A;  2R7Z H;  2ZXR A;  5M9O A;  4DV3 L;  3A5U A;  4JI3 Q;  5EPL A;  3A8K E;  1RF2 D;  4OIJ A;  3CMA A;  3U50 C;  2F0N A;  1JE5 A;  4LUO A;  2NWG A;  4NXN Q;  1GUW A;  1S3O A;  1TWF H;  4HN7 A;  2VW9 A;  1AFP A;  4DAY A;  3G4S A;  2B2W A;  2H4O A;  2X6L A;  4YCV A;  3GTO B;  3T1H L;  1BCP C;  5FLX E;  1GUG A;  1PH5 A;  3J80 i;  2K05 A;  5GRO A;  1Y1V G;  2XSC A;  2F4V Q;  3HKS A;  4IPH A;  5M5W B;  1JCK B;  3T1Y L;  2GVA A;  1WD0 A;  1WD1 A;  2A5H A;  4A93 B;  2JP1 A;  1VQJ A;  3UDX A;  5CV6 A;  1SYE A;  4NP5 A;  2QEJ C;  3I3C A;  1M4V A;  1FL0 A;  1X9N A;  4C1N I;  1QUQ B;  3BDC A;  3TME A;  4BY7 H;  4PMW A;  2E2D C;  4X65 L;  5IP7 H;  2VNU D;  2E2H B;  1FR3 A;  2ID0 A;  3GO5 A;  2OF1 A;  2KHS A;  1Y8N B;  3RD4 A;  1I3Q B;  2YTY A;  4GOP C;  1RTO A;  2WAQ E;  4F88 A;  1HNX Q;  2BDO A;  2KA7 A;  4GKK Q;  4AYB E;  1JOO A;  1YHA A;  2PZW A;  4HIO A;  2EJG C;  2CCZ A;  4DUY L;  1VQ8 A;  1LTA D;  2BOS A;  3KLW A;  2QIL A;  1Y1W H;  5HY6 A;  4QY7 A;  3SK8 A;  2N8N A;  1LAB A;  4F8M A;  4L8J A;  1WI5 A;  4GNX B;  4DK0 A;  2KCM A;  1YIJ A;  3K8A A;  4YY3 L;  5M5Y H;  2CQO A;  2F0M A;  4L5S A;  1EY4 A;  4DU9 A;  1GHJ A;  4JG2 A;  1YNN C;  3HOY G;  1VQ7 A;  4LFC Q;  3BZK A;  3EN2 A;  3VA5 A;  3I4O A;  4LK1 C;  4N8X 1;  3RZO H;  4B3T L;  5HGT A;  2F0P A;  4IFD J;  2VS1 A;  1HHV A;  1NSN S;  3SR1 A;  1PH4 A;  1FGU A;  3NXW A;  4FXK C;  4FNF A;  4B9W A;  1Y1V B;  4A3I H;  2EXZ A;  2PQA B;  2B8G A;  4P71 A;  1D5X C;  1IW7 C;  2C9O A;  2EYF A;  4JOI C;  3EIV A;  1BCP B;  3FPP A;  4QIW E;  1I4Q A;  2UUA Q;  1KDC A;  1SYD A;  3H91 A;  3A54 A;  2DNC A;  5KIX A;  2LSS A;  2K52 A;  1JJC B;  4OO1 I;  3M3Y B;  1RL2 A;  1BBU A;  2K1B A;  5KND A;  1KD1 C;  1YEZ A;  2LS0 1;  5G3L F;  3QB3 A;  4MTN A;  3MXP A;  2HDL A;  1UEA B;  1LUZ A;  1K83 B;  3AQQ A;  1SRO A;  3MXU A;  4A3K H;  1TWA H;  4F87 A;  4FO2 A;  4A3B G;  5C5M A;  4HIM A;  3S1N H;  1HA5 A;  3P20 A;  1FJG L;  2DGY A;  4BBR H;  4R9W A;  1AE2 A;  4UHV A;  4IUU A;  3CCV A;  2HHH Q;  2EJF C;  2V4D A;  3E3X A;  4V19 0;  4UDU C;  4K0K L;  4Y7N B;  4KY7 A;  1TQO A;  5C4X H;  2RHQ B;  3PUV A;  4A3E H;  1LTI D;  3CC2 A;  1PFN A;  5D14 A;  4DV7 L;  1LTL A;  5IOC A;  2RKS A;  4GKJ Q;  4DV4 Q;  3I72 A;  5D3D A;  4LFA L;  1HR0 L;  4K2K A;  2NVQ H;  1K9M C;  5G3L D;  3P7J A;  4KD3 A;  3D8G A;  1JOK A;  1V43 A;  1L1O C;  4JI8 L;  1IKL A;  3DWP A;  3BDL A;  1D6E C;  1Q46 A;  2D0P A;  1CM9 A;  1WCM H;  2Z4I A;  3WOF A;  3HS0 C;  1KNE A;  3CAM A;  3UE0 A;  4CDF C;  2D9U A;  1H9K A;  4TVA B;  5CR3 A;  4DNR B;  4OEM B;  1CSP A;  2ZTD A;  1R4Q B;  3LNN A;  2SNM A;  3ULP A;  2QF7 A;  2BH8 A;  4X62 L;  3CME A;  4JBK A;  1EEI D;  5C6A A;  3EQL C;  2K50 A;  3SVM A;  3NBH B;  3EFX D;  2UXB Q;  4BWG B;  1EYC A;  4RGN A;  1G2T A;  1HZA A;  2KBN A;  4DV1 L;  4UPA A;  1NR2 A;  3QR8 A;  3I8Z A;  2GVB A;  1EZ6 A;  1SE3 A;  2GA4 B;  1SXT A;  4ABN A;  4B3R Q;  2C35 B;  3K7A H;  2LXK A;  3OMC A;  3I4L A;  4FYD A;  2VB3 X;  4R4O A;  1G51 A;  4EX5 A;  1BVS A;  4WFN 3;  1O7Z A;  1RD9 D;  4RGM A;  2MO0 A;  3F2D A;  4PV1 C;  2KEE A;  3PCO B;  2A68 C;  2B63 H;  1VQE A;  3S9W A;  3IFD A;  3UDF A;  4HJ5 A;  1CHQ D;  2IX0 A;  5JEA J;  5JPN C;  4JCV E;  2YU9 H;  3HOV H;  2B2V C;  1PRT C;  1FD7 D;  4DR4 Q;  1GD7 A;  2JQO A;  3ERO A;  4BBS H;  2VY3 A;  1G6P A;  1XMO L;  1E2W A;  3CU7 A;  4A76 A;  5IYD H;  5ELB A;  5IGD A;  4ILW A;  2NVY B;  4DUZ L;  3FKI G;  3CCR A;  2H1E A;  3BZC A;  2F0W A;  2VQF Q;  1E1T A;  1PMR A;  5DLQ E;  1K0S A;  2K28 A;  1Q3L A;  1TU2 B;  5E7N A;  4DR1 Q;  2TMP A;  4HJ9 A;  4MNO A;  5CMD A;  4WOR A;  3HOU G;  2K5D A;  3I56 A;  4L5Q A;  1Q8I A;  4X3S A;  3SDZ A;  3CC7 A;  1CQV A;  2TSS A;  1L1O B;  1ENF A;  4A3G G;  1Z9F A;  1L0W A;  3S14 B;  3J81 i;  2PYK A;  2KOL A;  2K5W A;  2BA0 A;  4TSS A;  5JVH 3;  1VQD A;  4C2M B;  2QA4 A;  4YWM A;  2K5N A;  3SK5 A;  3S1Q H;  3S17 H;  1Q82 C;  3SEB A;  1OXX K;  4XYQ A;  5HGQ A;  2R7Z B;  2IJ0 A;  4IFD G;  1SRU A;  2B39 A;  1TKW B;  4JI4 L;  4L5T A;  1KAA A;  2QW7 A;  1EYG A;  3KJP A;  1CK1 A;  3NQI A;  2F0H A;  4NXM L;  1IHZ A;  1ILP A;  2SOB A;  2PW5 A;  3Q23 A;  3T16 A;  1D7Q A;  1X56 A;  3L7Z C;  1SMX A;  1EWC A;  3K59 A;  2WFW A;  3T51 B;  2B2W C;  4BS9 A;  4OWT B;  4HJA A;  3DWQ A;  2F03 A;  4OGQ C;  1W2B A;  1IKM A;  1IBK L;  3R93 A;  1OXT A;  2E75 C;  1PV4 A;  3KFU A;  2B2U A;  3IKJ A;  2XNA C;  5ELC A;  1EIF A;  3TBI B;  3H15 A;  3KK7 A;  1PRT B;  5LMN L;  1I4R A;  1A2T A;  3A7A B;  4FF1 A;  1MGS A;  1TWG B;  1CUK A;  1HCZ A;  3VYR A;  2UXD Q;  1PTO H;  3IAY A;  2PQE A;  2MGS A;  5FJ8 G;  4BY7 B;  1X3F A;  2NUC A;  2R6G A;  2Y0S G;  1YI2 A;  1K28 A;  2L15 A;  2OT2 A;  3DM3 A;  2ICE C;  3M4P A;  4R4Q A;  1MJC A;  1XTD A;  1O78 A;  1EQQ A;  1TY2 A;  1TWC H;  1EY9 A;  4RH6 A;  2KEN A;  2D5D A;  4R8I A;  2E5L Q;  3GTQ H;  3BG3 A;  4K5X A;  2IL8 A;  3MEF A;  1MJE A;  1Y1W B;  1GUN A;  2QDL A;  1DOM A;  3E9I A;  1SYC A;  1BOS A;  4QL5 A;  1B8A A;  4B3M L;  2A19 A;  1D5Z C;  1YNJ D;  1SDF A;  1BUV T;  5M5Y B;  1CA5 A;  1ICW A;  3PUX A;  3VYT A;  2EXD A;  3KDF B;  1ESR A;  3QO2 A;  4CDC C;  1XPR A;  1K8G A;  1IL2 A;  4N9P A;  3NEN A;  3C2P A;  4APV A;  1YJ9 A;  3SE0 A;  2KHI A;  2F0U A;  5ELN A;  4H02 A;  4OWX B;  1PH8 A;  1Q12 A;  4CJ1 B;  5C3E G;  1LT4 D;  2LXJ A;  4DK1 A;  1YHB A;  4A3I B;  1SNC A;  3U4V A;  2EY5 A;  5K36 H;  4RHS A;  3DEP A;  3CW2 C;  2BCO A;  4DAY B;  5C5L A;  1KLG D;  1T5X D;  3FMC A;  1N8R C;  5AJ3 L;  4GLX A;  1VQ5 A;  4H13 C;  2UUB Q;  3PQI A;  3H0G G;  1X6O A;  3T56 B;  1JE4 A;  3ZJY C;  4LNQ A;  3GD7 A;  5JEA G;  4YHH Q;  1ENA A;  2XVS A;  2KUM A;  1TS2 A;  1D1I A;  2Y0S B;  4A3C G;  3J7A 5;  2RVL A;  2JA8 G;  3EVQ A;  3N52 A;  3UDI A;  1BO0 A;  4FF4 A;  2JK8 A;  1TWH B;  4DA2 A;  3A56 A;  1XNR L;  1S5C D;  1KC8 C;  2ICI A;  5EJW A;  2PNR C;  2VL6 A;  1HPC A;  5KYI A;  4K14 A;  4A3J H;  2E5L L;  2DY8 A;  5C4X B;  2IY5 B;  2EYJ A;  1K8O A;  3NWT A;  2NTT A;  1VQF A;  4GLA C;  4N9T A;  3CCJ A;  4AQY L;  3NEM A;  3AEV A;  2VUM H;  4PQX A;  4RGT A;  5C3X A;  3A7L A;  3TS0 A;  3W3A A;  1RJT A;  2AWO A;  3CCQ A;  2WKC A;  4QJF A;  3ITP A;  3W5O A;  4X6A H;  2ASB A;  1WCM B;  5ELO A;  3EBE A;  5BN4 A;  5C0X H;  1KQS A;  1RCV D;  4DV2 Q;  3ER0 A;  3W1G A;  2A6H D;  4LWC A;  4DPG A;  1T9H A;  4TRD A;  4U67 3;  2NZO A;  3T4A C;  3PO2 H;  4O0A A;  1K3R A;  1WTQ A;  1YIT A;  3I4M H;  1I6V C;  2JXM B;  2F0D A;  4C3H G;  2JA5 G;  1STE A;  1PH9 A;  1M1K C;  1QE6 A;  4RWS C;  3PIO 3;  1HNZ L;  2MFI A;  2XTI A;  3QJY A;  3MHB A;  4DV6 L;  4O1N A;  4FP5 D;  2K14 A;  5DNF A;  1L0X B;  1NMG A;  3KBX A;  2OQK A;  1QWY A;  2IPK D;  3ULL A;  3M85 A;  1V8Q A;  3DEO A;  3VR4 A;  2E2J H;  4LF9 L;  5BN3 A;  3VR2 A;  2FIN B;  3RNU A;  3KLR A;  5IP9 H;  2JA8 B;  1F9R A;  1IBL Q;  3M7N A;  3D3R A;  2UU9 L;  4LFB L;  2VQE Q;  3HOV B;  4HID A;  2NN6 G;  4FVM A;  1V1Q A;  3CQZ H;  3PIO A;  5FLM G;  4MTK A;  5KNB A;  3RLN A;  1K0R A;  4KKS A;  4A3F H;  1E1O A;  1F77 A;  1SJH D;  2JEB I;  2L5T A;  2NVT H;  3J7A V;  1ZXT A;  4X66 Q;  4DV0 Q;  1CI3 M;  4JI5 L;  2JSO A;  1E22 A;  1GOZ A;  3G6J B;  4C56 C;  5C4Z A;  4AH6 A;  4KI0 A;  4E6I A;  4C3I G;  5M3M G;  4LUV A;  2ALY B;  3KF8 A;  2ZJR A;  1VQB A;  2CH4 W;  4FXG C;  1XNQ Q;  1UE7 A;  5AFW A;  4C3J G;  2PZT A;  5J3B A;  3NTI A;  1U4M A;  4B3S L;  4QUC A;  2ES2 A;  4L63 B;  2JA7 G;  1G29 1;  1OO9 B;  1Y8O B;  3DHQ A;  4NB3 A;  1UUP A;  3IRB A;  1CKN A;  1STB A;  4A3D H;  2E74 C;  3FPU B;  3NE5 B;  2R93 H;  2A8V A;  2JA6 G;  2N49 A;  1IBM Q;  1AEX A;  1YHQ A;  4LF5 Q;  2XRS D;  4IUQ A;  2JA5 B;  1KXL A;  2X69 A;  3MWY W;  2I5H A;  3LWU A;  5C4J H;  1W3S A;  1DZ1 A;  4FF2 A;  2AWN A;  4Y52 H;  3HG9 A;  1UEB A;  1GUO A;  2DJG C;  2UXC L;  5M3F G;  3VYS A;  4LW1 A;  2Q2T A;  1O7L A;  2Q8T A;  1WTX A;  1MI2 A;  2FMC A;  2F0J A;  5CV9 A;  4YWL A;  3GV3 A;  4WRD A;  4LJZ C;  5F2D A;  1VQM A;  4A3L H;  1DOK A;  3OHX C;  5KNC A;  3PO3 G;  2K5V A;  1VQI A;  1L2F A;  3SXH A;  5GAG C;  1F2L A;  1PTO F;  1H9J A;  1SAP A;  2I46 A;  2ZTE A;  2EPB A;  1BNZ A;  5JAV A;  4DKA C;  3MC0 B;  4KY5 A;  1XTC D;  3M4Q A;  2B2U C;  5CBE E;  3S15 B;  2V1C C;  1IYV A;  3GTJ B;  3NPP A;  1QVG A;  1G6Z A;  1WVL A;  3U9S A;  2F52 A;  1EFW A;  2Y0S E;  3H3V H;  3I4N G;  1C9O A;  3AYH B;  4OXP A;  3G6E A;  4C3I B;  5M3M B;  3NEL A;  5FLX c;  3MFY A;  3OTO L;  1YJW A;  4U68 A;  3D6W A;  5FLX L;  3GTG H;  5C44 G;  4C3J B;  4JI7 Q;  1GVP A;  2D2C C;  3GV6 A;  4TKO B;  3HOX G;  3BZD B;  1XMQ L;  4KHZ A;  1CZW A;  3EA6 A;  1F2M A;  2P5Z X;  1QZH A;  2JA7 B;  3MXN B;  4K2L A;  5IGE A;  2ZJP A;  5ELD A;  3GTP H;  1PTO D;  1QG7 A;  2N78 A;  3DM1 A;  4BXX G;  5IYB H;  4UP7 A;  1S5D D;  2XIW A;  4L5R C;  3S2H H;  2D0O A;  1AH9 A;  1G8Z D;  1EFI D;  1MKH A;  2JA6 B;  1PYW D;  1HH2 P;  1PVO A;  5BR8 Q;  2K5H A;  5CV5 A;  1HTP A;  2F3W A;  2PO4 A;  3VDY A;  1J5E L;  2MO1 A;  1RDP D;  4GN4 B;  4NKL A;  2VUM G;  3OW2 A;  3GP7 A;  5M3F B;  2IT1 A;  1JQY D;  5KYL A;  5IYC H;  1A3V A;  1A6X A;  2NZH A;  4KHP Q;  4JI1 Q;  3S1R B;  2EY1 A;  5EBD A;  4JI3 L;  2QEX A;  4PZ8 A;  2HD3 A;  4NXN L;  3PO3 B;  1KNA A;  2L4N A;  2O2L D;  3NTK A;  3C1F A;  1JWM D;  2LFN A;  4DR7 Q;  2Q2H A;  2YV5 A;  2CW0 D;  4WJW A;  4POF A;  4A75 A;  3S24 A;  1H9R A;  5M5X B;  2C5C A;  2F4V L;  5I6Y A;  3LX0 A;  1VQC A;  3K80 C;  1VQO A;  4LF8 Q;  4EQ5 A;  4YCW A;  3I4N B;  4DR3 Q;  4PNY A;  2A1A A;  2AUK A;  4DNI A;  1E2V A;  1SFO H;  2F3I A;  4KN7 C;  3HEJ A;  1EU3 A;  5CGK A;  2RCF A;  3GTL B;  1DOL A;  1QVC A;  4CJ0 B;  2PPB C;  4KJO A;  5C44 B;  4RCN A;  3HOX B;  3Q24 A;  3V2T A;  3D31 A;  2L55 A;  2F0G A;  2F4I A;  3GTM H;  2IWH A;  4A3M G;  4OO1 G;  1GO3 E;  2J0T D;  5EKL A;  4ZUI A;  3PF5 A;  1Y69 U;  3M4Y A;  1U4L A;  4YWK A;  1HNX L;  4J6H A;  1KTK A;  4GKK L;  4HSP A;  2XGT A;  4GOP B;  4A3J B;  4O42 A;  4ME3 A;  1VS0 A;  4IPG A;  3S16 H;  1I5F A;  3HKZ G;  3MVV A;  3MAQ A;  2IHE A;  3FDT A;  3ZYY X;  5LMU Q;  2CVR A;  5I4D A;  1MSH A;  3KLS X;  3BYT B;  4DK6 C;  2L11 A;  2VUM B;  3FP9 A;  4IO9 A;  1VQ6 A;  5JOB A;  4ULL A;  2CKZ B;  4DXF A;  2HCI A;  2EDG A;  2B29 A;  3CPF A;  2EZV A;  4BA1 I;  4S3S A;  1UE5 A;  1BXT A;  4LFC L;  1S5E D;  2NVX H;  1QZG A;  4A4I A;  4TQU S;  3PV0 A;  1H9S A;  2R92 H;  1QNK A;  5FOB B;  2K33 A;  4I65 A;  1ZYR D;  1X3G A;  1STN A;  4K8I A;  4K6D A;  2RDF A;  4RMF A;  2M9V A;  1EWH A;  2UUA L;  4LF6 Q;  2R7Z G;  1QIL A;  1C0A A;  2Z6K A;  1TY0 A;  2Q8I B;  5JJL A;  3X3N A;  3RZD B;  2E2J B;  1I6H H;  3K81 C;  1KAB A;  1HRJ A;  1WOC A;  3K0X A;  1ZKO A;  3J7Y W;  4IUT A;  3TP7 A;  2R61 A;  1QNU A;  4BY1 H;  5IT9 E;  4A3M B;  3VR5 A;  3IL8 A;  3H3V I;  4KMU C;  4QQB X;  3TEH B;  4WJ4 A;  2DJF C;  2PNH A;  1C8C A;  3OSO A;  1PYB A;  3MA2 B;  1N34 Q;  1EY6 A;  2NVT B;  2HHH L;  3HKZ B;  2HQE A;  3HFZ B;  5FKA C;  4N8F A;  3KUP A;  3BVG A;  3T53 B;  5LL6 X;  2JYO A;  5L37 A;  1XWE A;  5I2X A;  4EGV A;  2DN8 A;  4BY7 G;  1E0B A;  3GTK B;  1YNJ C;  5EAY A;  4GKJ L;  4IOA A;  4RAU C;  5IP7 G;  4DV4 L;  5TSS A;  1QUQ A;  1UE6 A;  3QOJ A;  3GDE A;  4DR2 Q;  1KLU D;  4DN4 M;  2B2Y A;  1JT8 A;  4G7H C;  2L1B A;  1EIH A;  3HP3 A;  3RUZ A;  2F0Q A;  3A8I E;  2KVM A;  4OX9 Q;  1S5F D; 
#chains in the Genus database with same CATH homology
 3C1E A;  1M8A A;  3OMG A;  3MTS A;  2XWB B;  2Z4H A;  4R8N A;  5HUR A;  5ELE A;  3K0Y A;  3BVZ A;  1STH A;  3CHB D;  1JB3 A;  2AQ3 B;  4ZUJ A;  2EJM A;  2O5I C;  3AB9 A;  1HXY D;  5T1G A;  1TWF B;  4X3K A;  1EU4 A;  4CBV A;  3NP8 A;  1C4Q A;  1I4X A;  1WTP A;  1CZG A;  4M8A A;  1SNM A;  1O7Y A;  1IYU A;  2NZ1 D;  5LL6 S;  5KGU A;  3R2T A;  1EY5 A;  1Q90 A;  1CT1 D;  2F0V A;  5EKK A;  1LTG D;  1CFM A;  1FNU A;  2G9H D;  5KRU A;  3SHL A;  3E6Z X;  2EVB A;  3H6M A;  3A8J E;  3TZD A;  2VXW A;  3HZX A;  1DXM A;  1JWS D;  1BDO A;  1J9O A;  3R8B A;  5A2Q E;  2JEA I;  1XX8 A;  2DNE A;  3GTP B;  1ESF A;  2KCN A;  1H9M A;  1B1Z A;  3S2H B;  3F2U A;  2A6H C;  4XTC S;  3OWF A;  4XYO A;  2A68 D;  5E3F A;  1RHP A;  4PMC A;  2N88 A;  5A35 A;  3NK9 A;  1PRT D;  3W2D A;  4ZRZ A;  2QKI C;  1I4G A;  5D65 A;  1LV9 A;  1EY0 A;  2F3V A;  5A2Q L;  4KY6 A;  3MEH A;  3NQT A;  3L3O C;  4RA8 A;  3RZO B;  5JPM C;  3NSW A;  3PUW A;  5E4X A;  2WKD A;  3D6C A;  1Y8P B;  2F0T A;  3R2I A;  1V1P A;  3OIQ A;  1B9N A;  1B4O A;  1HUN A;  3NBH A;  5IGG A;  4MIU A;  4RHR A;  4KD4 A;  1F2Z A;  1GUT A;  1SFO B;  4Q5V A;  3GQB A;  2B8F A;  1UNS A;  2K7V A;  4A3K B;  2AQ2 B;  2SDF A;  1JR0 D;  1TWA B;  1EL0 A;  3DMU A;  1FGB D;  3S1N B;  3TSS A;  1I4P A;  2RDG A;  1S5B D;  4BBR B;  5FK9 C;  1XXG A;  5CV4 A;  2K01 A;  4CKB A;  3P1H A;  5CC4 A;  1G2S A;  1T5E A;  1B53 A;  2LY7 A;  4HCE A;  3FVQ A;  4A3E B;  1SMY D;  3J81 E;  1U9R A;  4YIJ A;  5ISR A;  3K5O A;  2EY6 A;  4K6L A;  2NVQ B;  3AMU A;  4DAP A;  5CBA E;  4CJ2 C;  3M7G A;  5IGF A;  2WAQ B;  3Q0A A;  1VF5 C;  4AYB B;  2G9D A;  2IW3 A;  1Z6H A;  3E5S A;  4DFA A;  5DEH A;  1VMC A;  1I4H A;  3V05 A;  1BBX C;  4X3U A;  1BR9 A;  3WDN A;  4ZAI A;  2ZXP A;  4ID6 A;  2L0C A;  4XDX A;  2A69 D;  4BA2 I;  4ZK9 B;  5KEE A;  1PXU A;  1Z47 A;  3K7A B;  3D4W A;  1JIC A;  2M00 A;  4V0B A;  4KHV A;  2LMC B;  2B63 B;  3NUC A;  4BY1 B;  2YU9 B;  4XQN A;  3D4D A;  4X3T A;  3TN2 A;  4BBS B;  1PTO C;  2NB0 A;  3J7A F;  1TVX A;  4J1M A;  2CHB D;  2BE5 D;  1VDZ A;  2AQ1 B;  2A6E D;  4QUF A;  3JAM E;  4NW2 A;  5LHY 1;  2CQA A;  2Q8R E;  2R3Z A;  5IOD A;  1JC7 A;  1ML0 D;  4B9X A;  2B2Y C;  1LT3 D;  2PMZ B;  4RKL A;  2EYP A;  2L9H A;  3TP6 A;  2O4X A;  2EE1 A;  3VYU A;  3T13 A;  1EYA A;  1ILQ A;  1AN8 A;  1QCB D;  5JVG 3;  1OXU A;  2CW0 C;  3JAM L;  1VMP A;  3S1Q B;  3S17 B;  3Q22 A;  5EPJ A;  4QMG A;  5EBC A;  1H9S B;  1O80 A;  4JBW A;  2KED A;  5COY A;  1HQM C;  2PCF B;  1D5M C;  2B2T A;  4DNT B;  4EQO A;  3HOW B;  1DON A;  1HFG A;  3I70 A;  5K36 G;  5EGT A;  4OIK A;  1B2T A;  4RFB A;  4DF7 A;  5E1F A;  1B50 A;  1R4P B;  3NHH A;  1F9S A;  1PZK D;  1SYF A;  3EJI A;  3N6R A;  1PTO B;  4HCS A;  4OL7 A;  2QDB A;  3MXG A;  4KN4 C;  4CGY B;  1WTO A;  3MFG A;  3ND9 A;  5DM6 3;  1AZQ A;  2BA1 A;  4K8J A;  1EQV A;  1WTW A;  5T1I A;  3OW7 A;  4KJN A;  4H7B A;  3H94 A;  1TWC B;  3I91 A;  3NTH A;  3VA7 A;  3K58 A;  1L0Y B;  3AU7 A;  4ZKB B;  3GTQ B;  1SE2 A;  4G57 A;  4QCL A;  2YYZ A;  5D3I B;  1ZYR C;  5C0X I;  5FO7 B;  1PZI D;  2DY7 A;  1LAC A;  4XT1 B;  4FXD A;  2ZXO A;  1SJE D;  2PW7 A;  1STY A;  1ET9 A;  3K5M A;  1HTL D;  2SNS A;  1RKN A;  2MPM A;  5CYU A;  2WV6 D;  5C0X G;  2MJ8 A;  4Q0F A;  5IGC A;  4RCO A;  1E2Z A;  4ZQ3 A;  4IFD H;  1NUC A;  1V1O A;  3ND8 A;  4DAV A;  1BCP F;  3DUZ A;  2AUJ D;  3MZ5 A;  1TR5 A;  4DXG A;  2LKV A;  2K6A A;  1J8I A;  1W6K A;  1KDA A;  5I9P A;  1NR4 A;  5C3W A;  4XIG S;  3S2D B;  4CHT B;  2I07 B;  4QF4 A;  2IX1 A;  1GJX A;  5CV8 A;  4CKE A;  2EYM A;  3KLS A;  4FF3 A;  1HUM A;  5I6W A;  4RKB A;  2BDN A;  3K5L A;  3DWA A;  3PUY A;  1SSO A;  1W6J A;  1Z7T A;  1LTT D;  4ZLT F;  1BQQ T;  2F0I A;  1WTR A;  2F0K A;  4ZKC B;  2L12 A;  1BCP D;  1SYB A;  4HTH A;  4Z9C B;  1MBY A;  3OWE B;  2KCC A;  2WII B;  3RLF A;  4ZYS A;  2XN9 C;  1QJO A;  2E76 C;  2Z8L A;  3K6O A;  2A74 C;  3SK4 A;  1EQT A;  1RTN A;  1PLF A;  4KKU A;  1QB5 D;  3PO2 B;  2OEO A;  1OXV A;  4MN3 A;  3RMH A;  4NMZ A;  3J80 E;  3FEW X;  2HDM A;  3I4M B;  4XT3 B;  1TS3 A;  1K8M A;  2WB1 B;  3HOY B;  3KBG A;  2ENB A;  4ME5 A;  1FNV A;  1EY7 A;  1DYQ A;  2SEB D;  4H0L C;  2XWJ B;  1ONL A;  1GXD C;  1G91 A;  4F7X A;  1V1P B;  3HOZ B;  3SK6 A;  1TII D;  2RA4 A;  3J80 L;  1PFM A;  2MUY A;  1NCV A;  1II3 A;  3CQZ B;  4EQN A;  1YNN D;  3H3V C;  4MHE A;  2RSO A;  3PIP 3;  3TP8 A;  5JEA H;  1U4R A;  1ZEQ X;  4A3F B;  2J4X A;  3E0J A;  4CKC A;  4PMB A;  1IL8 A;  2XRQ D;  3QWN A;  4A3B B;  4IZ8 A;  4IN3 A;  5K5P A;  3P75 A;  1IW7 D;  2HUG A;  2D62 A;  5IT9 L;  1NAP A;  2KQ3 A;  1EZ8 A;  3C46 A;  1HQR D;  1SBB B;  1SE4 A;  4KK7 A;  1DCZ A;  4L6T B;  3CKI B;  4LAA A;  1GHK A;  1CHP D;  3X3M A;  3MXN A;  4A3D B;  2VB2 X;  1B9M A;  3CRL C;  2R93 B;  4G4K A;  4IAL A;  1OXS C;  1SNO A;  1MD2 D;  4EVO A;  2F0O A;  4NDX A;  2EYL A;  5C4J B;  1EOT A;  1HA6 A;  5IGB A;  4JK1 C;  4RGO S;  4ODG A;  3TZU A;  4IUV A;  3CRK C;  4IFD I;  2F0L A;  4DGZ A;  2EYO A;  1LTR D;  3I73 A;  4P2C B;  5NUC A;  3QIA A;  1SND A;  2B2T C;  3I90 A;  3QG1 A;  4KTA A;  2Z1C A;  2IX3 A;  4IUR A;  2EYH A;  1DD2 A;  5DAU A;  1XYI A;  2WIN B;  1PRT F;  3K5N A;  1Q1E A;  3ERQ A;  4OHJ A;  1SMY C;  2NN6 H;  1AP0 A;  3OIP A;  1R9T B;  1DJR D;  2F0F A;  3GTG B;  4J8Q A;  1PFB A;  1TS4 A;  1LLR D;  5EKI A;  3A55 A;  3FKI B;  3QOL A;  1I50 B;  4HED A;  4IQZ A;  1EEF D;  3TDQ A;  3URY A;  1STA A;  1SNQ A;  3L9A X;  1FYC A;  3HOU B;  2K5Q A;  1WTV A;  3R3O A;  2A69 C;  3VR3 A;  1JOR A;  3HGB A;  2RDH A;  2NTS A;  4QB4 A;  5J1Z A;  4A3G B;  2RSN A;  3NWS A;  2QCP X;  1JWU D;  3K57 A;  4G7O C;  1ENC A;  2KJX A;  3DXJ C;  2JE6 I;  2RBM A;  3H09 A;  1EY8 A;  2FJ2 A;  4HMJ A;  1ROD A;  3PUZ A;  3BVM A;  2BE5 C;  2ZT9 C;  1ET6 A;  2N55 A;  1GUS A;  2EOT A;  2A6E C;  4M1U B;  3V96 A;  5J22 A;  1KDB A;  1B3A A;  3GTM B;  1LT5 D;  1A3T A;  3FRP B;  3Q6S A;  5CV7 A;  1F9Q A;  4IUP A;  5I9O A;  3BYY B;  5JJZ A;  3NBI A;  2K32 A;  3S16 B;  4IUN A;  5EPK A;  3IFT A;  1PDQ A;  1PZJ D;  4K5W A;  3TP5 A;  1A2U A;  1CTM A;  1D1K A;  1F2Y A;  2NYZ D;  1MSG A;  1SEB D;  1C48 A;  5DM7 3;  4HR7 B;  2A73 B;  2K03 A;  5FO9 B;  3M4O B;  2NBF A;  2WP8 J;  4HMI A;  3UI2 A;  5IIF A;  4H44 C;  1HFN A;  5BN5 A;  2F0E A;  2MHV A;  3D4R A;  2NVX B;  4XXE A;  2FMM A;  3J81 L;  4K5V A;  2R92 B;  4XQQ A;  5COR A;  2HCC A;  5C0X J;  3BDO A;  4LMQ D;  1FNW A;  3VR6 A;  1BF4 A;  1QOH A;  4G7Z C;  1VCI A;  4EQP A;  3BS1 A;  1S4Z A;  1X32 A;  2O5J C;  4HSV A;  5C3E B;  1I6H B;  1B44 D;  1SYG A;  5EQ0 A;  1DM0 B;  1UAP A;  1F9P A;  2OXP A;  4XQJ A;  5I2Y A;  2PZU A;  1LT6 D;  1Q1B A;  2FFK B;  1CA6 A;  1JOQ A;  2NN6 I;  5ELF A;  2FHT A;  3H0G B;  3OPO A;  1D2B A;  4QIW B;  3LWE A;  1LTB D;  3OOC A;  1X3P A;  3G7L A;  3O13 A;  1A15 A;  2X6G A;  2M2L A;  2B2V A;  5FO8 B;  4OO1 H;  4HAE A;  3S1M B;  2KEC A;  3ONA B;  3WOE A;  1LTS D;  1X3Q A;  5C4H A;  1TS5 A;  3PMF A;  3C3L A;  5E4W C;  1EYD A;  1EIG A;  2EY2 A;  2MP1 A;  2F0S A;  4B08 A;  4C1N K;  1LO5 D;  2WAC A;  1VF7 A;  3HRZ C;  4UAI A;  2RQX A;  4I7Z C;  1CQF A;  2E2I B;  2F1M A;  1AW7 A;  3U9O A;  1STG A;  4C3H B;  4GZY C;  2J7Z A;  4KKT A;  2K04 A;  4KV6 A;  1SNP A;  5J39 A;  1A3U A;  1AZP A;  1TT2 A;  1U4P A;  2ZXR A;  5M9O A;  5EPL A;  3A8K E;  1RF2 D;  4OIJ A;  2F0N A;  2NWG A;  1GUW A;  1AFP A;  4HN7 A;  4DAY A;  2B2W A;  2H4O A;  2X6L A;  3GTO B;  1BCP C;  5FLX E;  1GUG A;  2K05 A;  2XSC A;  5M5W B;  1JCK B;  1WD0 A;  1WD1 A;  2A5H A;  4A93 B;  2JP1 A;  5CV6 A;  1SYE A;  4NP5 A;  2QEJ C;  3I3C A;  1M4V A;  4C1N I;  3BDC A;  3TME A;  4PMW A;  2E2D C;  2E2H B;  2VNU D;  1FR3 A;  2ID0 A;  3GO5 A;  2OF1 A;  2KHS A;  1Y8N B;  3RD4 A;  1I3Q B;  1RTO A;  4F88 A;  2BDO A;  2KA7 A;  1JOO A;  2PZW A;  2EJG C;  1LTA D;  2BOS A;  2QIL A;  3SK8 A;  1LAB A;  4F8M A;  4L8J A;  4DK0 A;  2F0M A;  1EY4 A;  4DU9 A;  1GHJ A;  1YNN C;  3VA5 A;  4LK1 C;  5HGT A;  2F0P A;  4IFD J;  1HHV A;  1NSN S;  3SR1 A;  3NXW A;  4FXK C;  4FNF A;  4B9W A;  1Y1V B;  2EXZ A;  2B8G A;  1D5X C;  1IW7 C;  2C9O A;  2EYF A;  1BCP B;  3FPP A;  1I4Q A;  1KDC A;  1SYD A;  3H91 A;  3A54 A;  2DNC A;  5KIX A;  4OO1 I;  3M3Y B;  2K1B A;  5KND A;  2LS0 1;  5G3L F;  3QB3 A;  3MXP A;  2HDL A;  1UEA B;  1K83 B;  3MXU A;  4F87 A;  4FO2 A;  5C5M A;  1HA5 A;  3P20 A;  4R9W A;  4IUU A;  2EJF C;  2V4D A;  4V19 0;  4UDU C;  4Y7N B;  4KY7 A;  1TQO A;  3PUV A;  1LTI D;  1PFN A;  5D14 A;  5IOC A;  2RKS A;  3I72 A;  5D3D A;  4K2K A;  5G3L D;  3P7J A;  4KD3 A;  3D8G A;  1JOK A;  1V43 A;  1IKL A;  3DWP A;  3BDL A;  1D6E C;  1CM9 A;  2Z4I A;  3WOF A;  3HS0 C;  1KNE A;  2D9U A;  1H9K A;  5CR3 A;  4DNR B;  1R4Q B;  3LNN A;  2SNM A;  2QF7 A;  1EEI D;  5C6A A;  3EQL C;  3SVM A;  3EFX D;  4BWG B;  1EYC A;  4RGN A;  1G2T A;  1NR2 A;  3I8Z A;  1EZ6 A;  1SE3 A;  2GA4 B;  1SXT A;  4ABN A;  3OMC A;  3I4L A;  4FYD A;  2VB3 X;  4WFN 3;  1O7Z A;  1RD9 D;  4RGM A;  4PV1 C;  2KEE A;  2A68 C;  3S9W A;  3IFD A;  1CHQ D;  2IX0 A;  5JEA J;  5JPN C;  2B2V C;  1PRT C;  1FD7 D;  3ERO A;  1E2W A;  3CU7 A;  5ELB A;  5IGD A;  4ILW A;  2NVY B;  2H1E A;  2F0W A;  1PMR A;  2K28 A;  1Q3L A;  1TU2 B;  2TMP A;  5CMD A;  4WOR A;  2K5D A;  1Q8I A;  4X3S A;  3SDZ A;  1CQV A;  2TSS A;  1ENF A;  3S14 B;  2PYK A;  2KOL A;  2K5W A;  2BA0 A;  4TSS A;  5JVH 3;  4C2M B;  3SK5 A;  3SEB A;  1OXX K;  4XYQ A;  2R7Z B;  2IJ0 A;  4IFD G;  2B39 A;  1TKW B;  1KAA A;  1CK1 A;  3NQI A;  2F0H A;  1IHZ A;  1ILP A;  2SOB A;  2PW5 A;  3Q23 A;  3T16 A;  3L7Z C;  1EWC A;  3K59 A;  3T51 B;  2B2W C;  4BS9 A;  3DWQ A;  2F03 A;  4OGQ C;  1IKM A;  3R93 A;  1OXT A;  2E75 C;  2B2U A;  5ELC A;  3IKJ A;  2XNA C;  3TBI B;  3KK7 A;  1PRT B;  1I4R A;  1A2T A;  3A7A B;  4FF1 A;  1MGS A;  1TWG B;  1HCZ A;  3VYR A;  1PTO H;  3IAY A;  2PQE A;  2MGS A;  4BY7 B;  2NUC A;  2R6G A;  2OT2 A;  2ICE C;  1O78 A;  1TY2 A;  4RH6 A;  1EY9 A;  2D5D A;  4R8I A;  3BG3 A;  4K5X A;  2IL8 A;  1Y1W B;  1GUN A;  1DOM A;  1SYC A;  1BOS A;  1D5Z C;  1YNJ D;  1SDF A;  1BUV T;  5M5Y B;  1CA5 A;  1ICW A;  3PUX A;  3VYT A;  1ESR A;  3QO2 A;  4N9P A;  3C2P A;  3SE0 A;  2F0U A;  1Q12 A;  4CJ1 B;  1LT4 D;  4DK1 A;  4A3I B;  1SNC A;  2EY5 A;  5K36 H;  4RHS A;  3DEP A;  2BCO A;  5C5L A;  1KLG D;  1T5X D;  3FMC A;  4H13 C;  3T56 B;  1JE4 A;  3GD7 A;  5JEA G;  1ENA A;  2XVS A;  2KUM A;  1TS2 A;  1D1I A;  2Y0S B;  2RVL A;  3EVQ A;  3N52 A;  1BO0 A;  4FF4 A;  1TWH B;  4DA2 A;  3A56 A;  1S5C D;  2ICI A;  5EJW A;  2PNR C;  1HPC A;  5KYI A;  4K14 A;  2DY8 A;  5C4X B;  2EYJ A;  1K8O A;  3NWT A;  2NTT A;  4N9T A;  4PQX A;  4RGT A;  5C3X A;  3A7L A;  3W3A A;  1RJT A;  2AWO A;  2WKC A;  3ITP A;  1WCM B;  5BN4 A;  5C0X H;  1RCV D;  2A6H D;  4TRD A;  4U67 3;  3T4A C;  1WTQ A;  1I6V C;  2JXM B;  2F0D A;  4C3H G;  1STE A;  1QE6 A;  4RWS C;  3PIO 3;  3QJY A;  3MHB A;  4O1N A;  4FP5 D;  5DNF A;  1L0X B;  3KBX A;  1QWY A;  2IPK D;  3M85 A;  1V8Q A;  3DEO A;  3VR4 A;  5BN3 A;  3VR2 A;  2FIN B;  3KLR A;  2JA8 B;  1F9R A;  3M7N A;  3D3R A;  3HOV B;  2NN6 G;  4FVM A;  5KNB A;  4KKS A;  1F77 A;  1SJH D;  2JEB I;  2L5T A;  3J7A V;  1ZXT A;  1CI3 M;  2JSO A;  1GOZ A;  3G6J B;  4C56 C;  5C4Z A;  4KI0 A;  4E6I A;  4C3I G;  3KF8 A;  4FXG C;  5AFW A;  4C3J G;  2PZT A;  3NTI A;  1U4M A;  4QUC A;  4L63 B;  1G29 1;  1OO9 B;  1Y8O B;  3DHQ A;  1UUP A;  1STB A;  2E74 C;  3FPU B;  3NE5 B;  1AEX A;  2XRS D;  4IUQ A;  2JA5 B;  2X69 A;  3MWY W;  3LWU A;  1DZ1 A;  4FF2 A;  2AWN A;  3HG9 A;  1GUO A;  3VYS A;  1O7L A;  2Q8T A;  1WTX A;  1MI2 A;  2FMC A;  2F0J A;  5CV9 A;  3GV3 A;  4WRD A;  4LJZ C;  5F2D A;  1DOK A;  3OHX C;  5KNC A;  3SXH A;  1PTO F;  1SAP A;  1F2L A;  1H9J A;  2I46 A;  2EPB A;  1BNZ A;  5JAV A;  3MC0 B;  4KY5 A;  1XTC D;  2B2U C;  5CBE E;  3S15 B;  1IYV A;  3GTJ B;  3NPP A;  1G6Z A;  1WVL A;  3U9S A;  4C3I B;  5M3M B;  3MFY A;  4U68 A;  3D6W A;  5FLX L;  4C3J B;  2D2C C;  3GV6 A;  4TKO B;  3BZD B;  4KHZ A;  1CZW A;  3EA6 A;  1F2M A;  2JA7 B;  5IGE A;  4K2L A;  5ELD A;  1PTO D;  1QG7 A;  3DM1 A;  1S5D D;  2XIW A;  1G8Z D;  1EFI D;  2JA6 B;  1PYW D;  5CV5 A;  1HTP A;  2F3W A;  2PO4 A;  1RDP D;  4NKL A;  3GP7 A;  5M3F B;  2IT1 A;  1JQY D;  5KYL A;  1A3V A;  1A6X A;  3S1R B;  2EY1 A;  5EBD A;  1S5F D;  3PO3 B;  1KNA A;  2L4N A;  2O2L D;  3NTK A;  3C1F A;  1JWM D;  2LFN A;  2CW0 D;  4WJW A;  1H9R A;  5M5X B;  2C5C A;  5I6Y A;  3LX0 A;  3I4N B;  4PNY A;  2AUK A;  1E2V A;  4KN7 C;  3HEJ A;  1EU3 A;  5CGK A;  3GTL B;  1DOL A;  4CJ0 B;  2PPB C;  4KJO A;  5C44 B;  4RCN A;  3HOX B;  3Q24 A;  3V2T A;  3D31 A;  2L55 A;  2F0G A;  2F4I A;  2IWH A;  4OO1 G;  2J0T D;  5EKL A;  4ZUI A;  1Y69 U;  3M4Y A;  1U4L A;  4J6H A;  4HSP A;  4A3J B;  4O42 A;  3MAQ A;  3MVV A;  3FDT A;  3ZYY X;  2CVR A;  5I4D A;  1MSH A;  3KLS X;  3BYT B;  2L11 A;  2VUM B;  5JOB A;  4ULL A;  4DXF A;  2HCI A;  2EDG A;  2EZV A;  4BA1 I;  4S3S A;  1BXT A;  1S5E D;  4TQU S;  3PV0 A;  1H9S A;  1QNK A;  5FOB B;  2K33 A;  4I65 A;  1ZYR D;  1STN A;  4K8I A;  4K6D A;  2RDF A;  2M9V A;  1EWH A;  1QIL A;  1TY0 A;  2Q8I B;  3X3N A;  3RZD B;  2E2J B;  1KAB A;  1HRJ A;  1ZKO A;  3J7Y W;  4IUT A;  3TP7 A;  2R61 A;  1QNU A;  5IT9 E;  4A3M B;  3VR5 A;  3IL8 A;  4KMU C;  1C8C A;  3OSO A;  3MA2 B;  1EY6 A;  2NVT B;  3HKZ B;  2HQE A;  5FKA C;  3KUP A;  3BVG A;  3T53 B;  5LL6 X;  2JYO A;  1XWE A;  5I2X A;  4EGV A;  2DN8 A;  1E0B A;  3GTK B;  1YNJ C;  4RAU C;  5TSS A;  3QOJ A;  1KLU D;  4DN4 M;  2B2Y A;  4G7H C;  2L1B A;  1EIH A;  3HP3 A;  3RUZ A;  2F0Q A;  3A8I E;  2KVM A;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...