3DWQA

Crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Subtilase cytotoxin, subunit B
total genus 26
structure length 116
sequence length 116
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwqA00
1EEID 4RHSA 1RDPD 1ET6A 1BCPC 2ICIA 4RFBA 1HTLD 1S5DD 4RGNA 5I4DA 1XXGA 2AQ1B 1PTOB 2XRSD 1LTTD 1V1PA 1HQRD 1UNSA 1SE3A 1I4GA 1FNUA 1F77A 3EFXD 3MFGA 1JWSD 1LT4D 1V1OA 3BVGA 1TS3A 1LTGD 1PRTB 2RDGA 1PTOD 4BWGB 1LTSD 1PRTF 2AQ2B 1S5FD 1SJED 2XRQD 2R61A 1S5BD 1T5XD 1LTRD 1GOZA 5FKAC 1CHPD 1HXYD 1I4QA 1RCVD 5ELFA 1TS4A 1PZKD 1BXTA 2SEBD 1STEA 4ZYSA 1FNWA 1ET9A 1BCPF 1PZJD 2NTTA 1EU3A 3DWAA 1I4XA 1L0YB 4RGOS 1TY0A 1LLRD 3MC0B 4RGTA 3V05A 1AW7A 1PTOC 1V1PB 1PRTD 3BVMA 1G8ZD 4O1NA 1LO5D 1D5ZC 1SBBB 1XTCD 1ESFA 1KLGD 1M4VA 5FK9C 1EFID 1JQYD 1LTID 1LT6D 1ENFA 2G9HD 2IPKD 1I4PA 3TSSA 4DXFA 3SEBA 1LTBD 1CQVA 1LTAD 2CHBD 1FNVA 3BYTB 1EWCA 1CHQD 1CK1A 4K6LA 2NTSA 1QILA 1JWMD 1TS2A 3OWEB 1KTKA 2QEJC 2RDHA 3DWPA 4Z9CB 1I4HA 5ELCA 2XNAC 1TY2A 1PYWD 1RF2D 1D6EC 1SJHD 1EU4A 1SE2A 5ELEA 2Z8LA 2AQ3B 4DXGA 4L6TB 1MD2D 4RGMA 1B1ZA 5D3DA 4RCOA 1PTOH 1FD7D 1PTOF 5ELBA 1UUPA 1D5MC 2TSSA 4L63B 5D3IB 3EA6A 1D5XC 3BVZA 3R8BA 3W2DA 1SE4A 4RHRA 1JR0D 1S5CD 1AN8A 4RH6A 5ELDA 3CHBD 3URYA 1DYQA 3DWQA 3BZDB 1I4RA 2WV6D 3GP7A 2IJ0A 1B44D 1KLUD 1SEBD 1LT5D 1TS5A 3O13A 1EEFD 1FGBD 2XN9C 5TSSA 1BCPD 1RD9D 1CT1D 1DJRD 1LT3D 2J4XA 4C56C 1PZID 4OHJA 1PRTC 3BYYB 3KLSX 4TSSA 1BCPB 1L0XB 2QILA 2O2LD 3R2TA 1JWUD 1JCKB 3R2IA 4UDUC 1SXTA 1HA5A 1S5ED
chains in the Genus database with same CATH superfamily
1JOKA 1PFMA 1ET6A 5COYA 3E9HA 1X54A 4K8IA 5M5XH 1G291 4DV7Q 5EKLA 3P7JA 1EIGA 2L0CA 5IE8A 3MXNB 1FVIA 4LK1C 2JA6H 3HOWB 4DR2L 2FHTA 4DAYA 1I6VC 4B3MQ 5I2XA 1MJCA 3AEVA 3M4PA 1G2TA 3H6MA 1LTSD 1TWFH 2IWHA 2RSNA 3K59A 4GOPA 4IJHA 2KCTA 1QCBD 3G71A 1AH9A 2WIIB 3I7FA 2JA7G 3F2DA 2WINB 2SEBD 3F2UA 1Q3LA 3X3MA 1FJGL 4LJZC 3PF5A 2QEXA 2YV5A 1UWVA 5IT9c 1KHIA 3GTKH 4LF4L 4Y7NH 4PMBA 3MC0B 3HRZC 4CDEC 4R8IA 4IO9A 1GJXA 5KNCA 2VS1A 3NQIA 4JBKA 3T1YQ 2E2JH 4ME5A 2OTLA 1E2VA 2LSSA 4OWWB 1FJGQ 2SDFA 5CYUA 2K1BA 4YHHL 1LTID 3GQBA 4L5QA 2X69A 1J9OA 1PH7A 2H1EA 3I73A 1E3PA 3DWPA 5FJ8H 3X3NA 2H5XA 1N32L 2HCCA 3N6RA 1EY6A 1ZKOA 3NK9A 4H13C 3I2ZA 4GLVB 3HKSA 5IGBA 3VDYA 3ZJYC 1BBUA 1SE4A 3S2HB 4QIWB 5GQOA 1JR0D 4A3EB 3UDXA 1QB5D 2B29A 4DF7A 2R93B 3KF6B 4R9WA 3S9WA 4ODGA 1PLFA 4OX9L 4BY7B 3BS1A 5EKIA 1YJWA 4TQUS 3RD4A 4JI6Q 2ZM6Q 4O0AA 4HN7A 3J80E 2UU9Q 4E6IA 2UUAL 3CCMA 1YVCA 4YCWA 3A8KE 4RMFA 2QILA 3T1HL 2O2LD 2D0OA 1UAPA 4HSPA 4IUNA 2PMZB 3DHQA 3K80C 4ME3A 2IHFA 4MN3A 5G3LD 3UDIA 1U4MA 1RDPD 1FL0A 2F0GA 2NZOA 1ZEQX 3SXHA 1XYIA 1PYSB 4OELB 4C3JH 3M3YH 4PZ8A 1VQOA 2B63B 1R9TB 1RKNA 5C4JH 3E0EA 2E2IH 5EPKA 1SAPA 3K5NA 1Y1VB 1A63A 1FNUA 2F0FA 4CKEA 4R8NA 3PV0A 5I6WA 2KHJA 2QKIC 1JJCB 2R7ZG 1TS3A 3BDOA 3I56A 4KY6A 1KAAA 2WB1B 1V8QA 1PRTB 3CMEA 2OT2A 4CJ2C 3PO3H 3FPUB 2AHOB 4R4IA 3U50C 2JP1A 1CZGA 4NB3A 5F2DA 5J22A 4OIJA 3VYTA 4ZKBB 2KEDA 2K6AA 1LLRD 4AIMA 5KRUA 4B3RL 2D2CC 1U4PA 1M4VA 2L11A 5IGFA 5KYLA 2N3SA 3PO3B 1NY4A 5C3XA 1NAPA 1WD1A 1AZPA 1BKBA 1MHWC 4R1JA 3I72A 1CQVA 2WFWA 4MTNA 3U9SA 4OONA 1SYBA 1VQ6A 3T56B 2NTSA 1TS2A 1YZ6A 1QUQA 3HOVB 3AFQA 4HJ5A 4LUZA 3KBGA 3PMFA 4X3KA 3I4NG 2NVXB 2YTXA 1VQHA 1VMCA 2RCNA 2VXWA 4UP9A 3GTLB 4XYOA 4JI0Q 3E5SA 1OO9B 2UXDQ 2JE6I 5ELBA 1HZBA 3G4SA 1D5MC 1BF4A 3PO2G 1QVGA 3H3VC 2K33A 5D3IB 2NVQH 2EYLA 3PO2H 3W2DA 2VUMG 3U9OA 1BNZA 1QWYA 3ULPA 4HIMA 3EVQA 5EPJA 3S1NB 4DR7Q 1KD1C 3CHBD 2F1MA 2MP1A 4BA1I 1KLUD 1JB7A 1LT5D 1NE3A 3O13A 5A35A 5JEAH 1BCPD 2C5CA 1UEBA 5EAYA 2F0JA 1EYAA 2J4XA 3HOZG 1SLJA 4JI1Q 1EOTA 4KI0A 4NPSA 2B2VA 1EL0A 1G51A 4WJWA 1EEID 1VDZA 2RKSA 2DN8A 3T1HQ 2Z6KC 5KNBA 1Q8IA 5DLQE 2HUGA 1GXDC 3U4VA 1EY8A 1I50B 1PDQA 2ICEC 3NUCA 4TVAB 2JA8H 3EBEA 1XPRA 2RQXA 1TIID 3AQQA 4NXMQ 2K5HA 3PSIA 4IFDG 2E76C 3PIP3 3NTHA 1STGA 3TQYA 1PFBA 3RR5A 1QNKA 1CA5A 2Q2TA 1SYGA 3RZDB 1T5XD 2LXJA 4LUVA 3P20A 3G48A 1EOVA 3HOYB 2I5LX 1N9WA 5C4XH 1EU3A 1LABA 2NVTB 1I4XA 3NQTA 3HKZG 5IYBG 1IW7D 4Y7NB 3NWSA 5IP9G 3QOLA 4HIDA 3TREA 1MIUA 4B3TQ 1GUOA 4KKTA 1F9SA 3CCLA 1VQIA 1NR4A 4JI4L 4NP5A 2HD3A 4EQ5A 4C1NI 1KIXA 1HH2P 4C3IB 1HZ9A 1EWCA 4BBSG 2G5DA 1E7ZA 3K57A 1V1QA 4C3HH 1J8IA 2JSOA 3W5OA 1TY2A 1RF2D 1PH6A 2JA5G 5DM63 1HUNA 4HJ7A 5M3FB 2E75C 2EYHA 4JI4Q 1RHPA 5FO9B 4RCOA 1PTOF 5EPLA 4AYBE 1PH2A 2Z9HA 1IBML 2EXDA 5I9OA 1IL8A 1KNAA 3SK6A 3RN5A 4EQOA 1A6XA 5T1IA 3URYA 1J6QA 5IODA 3KDFB 3A5UA 3VR6A 1S72A 2QCPX 2KVMA 1VQKA 4JV5L 1XMOQ 1CSQA 1Q12A 4C1NK 1CT1D 4CDCC 1DJRD 3HOYG 1AE3A 1PV4A 1CA6A 3VR5A 3S15H 4TSSA 1VQLA 1KC8C 4X3UA 4IFDI 4BY1B 4LF4Q 3TP8A 1IKLA 5JPMC 1GUSA 2XWJB 4FO2A 4JI7Q 1SYDA 5K36G 2OCEA 2Y0SE 1KDBA 5DM73 4RFBA 4P75A 3KBXA 4DR3Q 3Q24A 4KTAA 5AFWA 1F9PA 4KKSA 3J81j 4DV1Q 3M3YB 3PGZA 2F0PA 4A3JB 1GM5A 3GTQB 2UXCL 4NW2A 5EBDA 5JPNC 1A15A 4I7ZC 3L2PA 1SYFA 1V1OA 2YYZA 1VQDA 3BVGA 4YWMA 2JA5B 3SHLA 5E3FA 2D0PA 4OO1G 2YU9B 1V43A 1LTRD 4A3IG 1CTMA 1SMYD 2AWNA 5E4XA 3RZOB 1W2BA 2OWOA 1C7YA 4QB4A 1ET9A 1T9HA 2O5JC 3DWAA 1E2ZA 2B2YA 4KJNA 3CCJA 4LMQD 1H9RA 2F0KA 2HHHQ 3SVMA 5JJLA 1CKNB 5C5MA 3K6OA 1M1KC 1LO5D 4A3FH 3MEHA 5FLXE 1K0RA 3QJYA 4A3LG 2PPBC 4A75A 2RF4A 4JPBW 1ESRA 2BH2A 4WRDA 4BBRB 2JA7H 4DNTB 5EBCA 1YITA 4GNXB 3GTMB 4FF4A 5NUCA 4POGA 3GTMH 4C2MH 4JI1L 3K8AA 4X65Q 4QL5A 4H7BA 1D6EC 5IT9E 2I46A 2QDLA 4DXGA 3CC4A 3CKIB 4LWCA 3K7UC 3RLFA 4POFA 4L5RC 2ZJPA 4A3JG 4MTKA 4DAPA 1VS0A 3H94A 4BXXH 4IALA 1KNEA 3RMHA 3KK7A 2X6LA 5C0XJ 1LYLA 2B8GA 4DR4L 1DYQA 3GO5A 1IZ6A 2D62A 5LMUL 4OO1H 3RLNA 3QO2A 5JEAG 4A3IB 1Q8KA 1F2MA 3HOXB 3GTGB 1JICA 3RZDH 4J6HA 2A73B 1UEAB 2EJFC 4M8AA 4PZ6A 2X6GA 3I8ZA 1L0XB 1UE1A 2Q8RE 3UDGA 4OX9Q 4U68A 5IGGA 4LF8L 2PQAA 1W6KA 1NCVA 3OSOA 1DONA 1KDCA 2A68C 3RUZA 1D1KA 2IX1A 4DN4M 1MBYA 1MSGA 3T4AC 3MXNA 1XNQL 1UNSA 3NE5B 1J5EL 5I9PA 3IL8A 4JYAL 1O78A 2A8VA 2CKZB 3MFGA 4N9TA 4DV7L 4DV1L 3TBIB 4H44C 4DNRB 1I6HB 1A0IA 2MUYA 1GUGA 2N49A 5M5YH 2Z6BA 4LF5L 4EGVA 5M5YB 2BE5D 2MO0A 4HR7B 2VNUD 4O42A 2BDNA 1Q86C 3I4MH 2ASBA 3TP7A 3I4MG 5C4XB 4C3HB 4ID6A 1H9SA 3QOJA 4QCLA 4K5VA 1VQ7A 2ZXPA 3S1MB 2F4VL 3DLLA 3D3RA 4CJ0B 2CH4A 3GTPH 2NN6I 1TT2A 1IBKL 4UY8C 2NWGA 3S14B 1WCMH 3M4QA 2VUMH 2UXBL 3S16H 2CHBD 3TN2A 1Z6HA 2IW3A 1XPUA 2VQFL 4K6LA 1PA6A 3FKIB 4LF7Q 3LNNA 1SSOA 2PI2A 1SNQA 1STBA 5GAGC 4JI7L 4L6TB 1TWAH 4R4OA 2Z4IA 1X32A 3UE1A 4IUUA 5EJWA 1ML0D 2EYPA 2K14A 3KUPA 1YEZA 2B2UA 4RHRA 1S5CD 2EJMA 3HGBA 2JA5H 4WJ3M 1DOMA 3C2PA 2WV6D 3EQLC 3TMEA 2Q2UA 1B9MA 4YY3Q 5C3EG 4GKJL 4DV0Q 3J7A5 1RJTA 1JMCA 4RKBA 2QW7A 2N8NA 1TWAB 4X66L 1WD0A 1EQTA 1B53A 2YTVA 1H95A 2V1CC 3S17H 1KRSA 4XXEA 2WAQG 2NN6H 3AB9A 1STNA 1UE6A 5KYIA 1LTLA 2HQLA 2VQEQ 3R2TA 1WJJA 2F0NA 5M5WH 2O4XA 4OWXB 1F9QA 1S5ED 3J7AF 4BY7G 3IRBA 4RHSA 2PZUA 5J39A 1EUJA 4BBRH 3VYUA 3H91A 3GTOB 1F77A 4B9XA 3M9BA 5I6YA 1HPCA 4YCUA 3LWUA 4F87A 1YIJA 3FP9A 1PTOD 3FPPA 4DUYL 1QVFA 4GKJQ 4WFN3 4G7OC 4X65L 5IYCH 3SR1A 3FEWX 4CKBA 2BH8A 1U0LA 5M3MH 3U58A 5CBAE 1HXYD 4IOAA 2Z0SA 1G2SA 4P73A 2NBFA 4LUOA 1E1OA 4GNXA 4ZUJA 4C2MB 3ITPA 2R6GA 2R7ZB 3OW7A 5C0XI 4JBMA 1C9OA 2LKVA 2JXMB 4P71A 3I4NH 2Q2IA 2UUBL 3DEPA 5M5XB 2P5ZX 1STYA 2WAQB 2A5HA 1ENFA 4DR6L 1IBLL 4A76A 4IPHA 2JA6B 1TQOA 2FFKB 3M4OB 1HJPA 1WTVA 1FYCA 3OYYA 2XSCA 1Y1WH 1K8GA 1JWMD 4IFDH 1N34L 4H0LC 2B39A 5I2YA 1SYEA 4A3GH 2AUKA 3I3CA 1D7QA 1PTOH 4JG2A 3RNUA 4EX5A 1X3FA 3VR3A 1Y1VG 1HCZA 5C44B 2RDFA 1VQPA 3FHWA 1EY4A 1XMQL 2WB1G 1A62A 1Y8NB 2ZXOA 2GN5A 3NENA 3CRKC 3TZUA 1FGUA 1X65A 4A3KB 2XN9C 2UUBQ 1O7YA 2DY8A 1MI2A 1CSPA 2RHSB 1LT3D 3Q8DA 4C56C 5AJ3Q 1PZID 1PRTC 4JI5Q 1BCPB 4B3SL 3D4RA 1SR3A 1WTQA 3R2IA 4UDUC 4IOCA 2UXCQ 1CUKA 3AU7A 1N33Q 3K5MA 3BDLA 1VQBA 1Z9FA 4JI3L 2B2WC 4A3KH 4LF6L 2F03A 1K3RA 2UUCL 1K83H 2PI2E 3HOZB 3AMUA 3CC2A 1SNOA 1HQRD 1WTRA 2EOTA 2QGQA 4R4QA 1SN8A 2A6EC 4S3SA 2PQAB 3ZYYX 2A19A 1IYVA 2PYKA 1A8VA 4N9PA 3KF8B 4JC0A 3KLWA 2EYOA 2M9VA 3A0JA 4BWGB 1PRTF 2M00A 1TWCH 4LAAA 1EY7A 2F0OA 1CHPD 1I4QA 1PZKD 5CMDA 2IY5B 1W3SA 1WI5A 1X6OA 3BZCA 3V2TA 1PZJD 5IYBH 4JK1C 2EYJA 4APVA 3TDQA 4A4IA 1NNXA 1C48A 3E6ZX 4EQPA 4ZLTF 1YHQA 4K6DA 3LWEA 4NXNQ 1G8ZD 3FMCA 3STBC 1DD2A 1P8LA 4DR7L 4RA8A 1ESFA 4KD3A 1HNWL 1B50A 4C3JB 3KJOA 1EFID 5C3WA 2Q8IB 1SFOH 4YY3L 3IFTA 3NELA 1KRTA 3LX0A 4PZ7A 1XJVA 2ID0A 4KD4A 2IPKD 2KOLA 3TSSA 4UPAA 3OW2A 3QIAA 2MO1A 4J15A 4QUFA 1EWHA 2AUJD 1S4ZA 3HOUG 3NWTA 3J81c 4OEMB 2K32A 1B1ZA 1CKOA 4ULLA 5G3LF 3I4LA 1YHAA 3CCQA 4IPCA 2NUCA 4JCVE 5IWAL 4H02A 4Q5VA 3E0JA 5IYDG 2E8GA 1B44D 5IYDH 2MNAA 4AYBG 4DV5Q 1XMQQ 1EEFD 1WTXA 1RIPA 3E9IA 4DUZL 5BN3A 1RD9D 4KHPL 1R4QB 3FVQA 1BO0A 3HKZB 2JYOA 2TMPA 2WKDA 1HQMC 1YNJD 2Z4HA 1XMOL 4XQJA 4DAYB 4K5WA 3STBD 1O80A 1VQ4A 4JI6L 5K36H 5HURA 4A93B 4K2KA 3CCUA 5FOBB 1I3QB 3IKJA 3QG1A 2H4OA 4O2DA 4F7XA 4C3IG 1V1PA 5GROA 3S2DB 4JI3Q 2QDBA 3S1NH 1PFNA 3J7YW 4HEDA 3EN2A 1K8OA 3A7AB 4A93H 3NBHB 3J80c 5AJ3L 3WDNA 2OEOA 1E24A 5ELNA 1B9NA 1B2TA 3A8IE 3CP0A 4RGOS 3HP3A 4HJ9A 4Y52H 3R93A 3T53B 4RGTA 1CKNA 1CKMA 1GVPA 1AW7A 5ISRA 2F0WA 3BVMA 1C0AA 2EJGC 5EKKA 3W3AA 2IHEA 2UUCQ 3HOXH 1XNRQ 2PCFB 4MZ9A 4A3MG 3QWNA 4GN3B 2B3GA 3MA2B 4JV5Q 2FINB 2G9DA 1PH5A 3CXCA 2F0IA 1JORA 2F0HA 1KAWA 2KCNA 1Q82C 1A3TA 4JI5L 1UE7A 1ENCA 2AWOA 2EY6A 3P1HA 3DMUA 4KLKA 1EIHA 1ZYRC 2OQ0A 5J1ZA 1EU4A 1Y8OB 1E22A 4GN4B 3GTJB 3MZ5A 1YJNA 4J1MA 2PZTA 5C0XH 3BVZA 2SNSA 2NZ1D 3ICEA 1G6PA 2D9UA 5D65A 4X64Q 2F0UA 4GLXA 1K8AC 5ELDA 3BZDB 1I4RA 1GUNA 3WOFA 2VQEL 2XTIA 1SNCA 1XNRL 3Q0AA 1MGSA 4FYDA 3L7ZC 1WOCA 1EYCA 1FGBD 3EJIA 4F8MA 4XQNA 2CW0C 3RLOA 3VYSA 4KY7A 3HOWH 1WCMB 2WB1E 2CCZA 2NVQB 1YHBA 3BYYB 3D8GA 2JA8G 3HOWG 1NBWA 2CQOA 1NTGA 1FR3A 5CV6A 2DJFC 3TP5A 1BDOA 2MQHA 1HA5A 4XT1B 3A5ZB 1ENAA 1AE2A 3MXPA 5JVH3 4A3MB 2WKCA 1L1OC 1EZ6A 1HTLD 1CZWA 3D4DA 2RSOA 2RBMA 1NR2A 2J7ZA 2VL6A 2CW0D 3KOJA 2HDMA 3H0GH 2EYFA 3AYHB 2R7DA 1LT4D 2PW7A 2E2JB 4ZAIA 2L15A 3ND8A 4KK7A 3SK8A 4GOPB 4JOIA 4AH6A 2ZM6L 4GLAC 1SFOB 4DKAC 1VF5C 4TKOB 1EWIA 1VQJA 2ZT9C 1BXTA 2OTJA 2K4KA 3E3XA 1BUVT 1BQQT 4Q0FA 4DNIA 5HY6A 4X62L 2K7VA 4P72A 4GKKL 5M9OA 1ZYRD 3V05A 2L4NA 4ZQ3A 5FLMG 1VQFA 2PQEA 3AFPA 5LL6X 3DM1A 4DV3L 4DR4Q 1JB3A 5ELOA 3TP6A 2K01A 5FJ8G 3M7NA 1IKMA 1I94L 5EGTA 3BDCA 3S1RH 4DV5L 3S17B 4DXFA 4A3BG 3L0OA 4CDFC 2M2LA 2VB3X 3MAQA 1QILA 4A3EG 1CI3M 1IBMQ 3T51B 4JVZA 1VQ9A 1N33L 5ELEA 2NB0A 1R4PB 2EZVA 1K83B 1F2ZA 1PVOA 1BBWA 5M3MB 1K8MA 2TSSA 3RZOH 3A54A 1CM9A 1PH1A 4ZUIA 2K28A 2F0SA 3T1YL 1YNXA 2KHSA 2Q2HA 1O7IA 3S2HH 2XGTA 1EIYB 2Q8TA 3A8JE 1STHA 3IAYA 2KECA 3CCRA 1PH4A 1W6JA 4IN3A 5TSSA 4LFBL 5IGDA 2ZTDA 2A68D 4DK1A 2F52A 3UDFA 3KLRA 4KN4C 1OXXK 4I65A 4CGYB 4K5XA 5GAEC 2F0VA 1JE5A 2K5DA 3OOCA 3ER0A 1S5BD 1JT8A 1VQNA 1KABA 2ZTEA 3ULJA 1GUTA 1Y14B 4CKCA 3M7GA 4B08A 3F8TA 2AQ1B 5CV5A 5IYCG 5GAHC 2F0QA 3CPFA 4A3BB 1C4QA 1I3QH 2K52A 1LTTD 1SE3A 3KYHC 5C44H 4J8QA 5BR8Q 3EFXD 4KKUA 2KUMA 1IYUA 2EQSA 2F3WA 2F3IA 3JC66 2EDGA 4KHZA 2B2UC 2N88A 1RTOA 2FXQA 5M3MG 3P75A 1PFSA 4LFBQ 2N55A 5ELFA 2LY7A 3R3OA 2NVYB 4GS3A 2UXDL 4UHVA 4GOPC 1X3EA 3L3OC 3K5LA 4FXKC 4X6AH 4B9WA 3CQZB 3J81E 4HIOA 2V4DA 3S1QH 3BZKA 1VQGA 4XT3B 2DNEA 1H9KA 2CFMA 4IQZA 4DK6C 2A74C 4A3GG 5JAVA 4JBWA 1LT6D 3ERSX 1EQRA 3PUWA 2UUAQ 4FF3A 2F3VA 4NXML 1I4PA 3MXUA 1VCIA 3G6JB 5IT9L 4G4KA 4G7HC 4OO1I 1DOKA 4GN5A 2R92B 3D6WA 1I94Q 4DR1L 1Q1EA 3KJPA 3PUXA 3GV3A 3C46A 1SJHD 3FRPB 3H3VI 5JJZA 3HFZB 3MXGA 1X3PA 3T16A 1WTWA 1N34Q 3K7AH 1HNXL 5FLXL 1Z7TA 3PF4A 4ZRZA 3DEOA 5IP7G 3ERQA 1M90C 3ND9A 3HOVG 3PCOB 1KXLA 1T5EA 3S24A 2IJ0A 1HTPA 5CGKA 1EY0A 2A6HC 3DM3A 4DR5Q 5KIXA 2LMCB 3NPPA 1QVCA 4DV6Q 2RA4A 2VUMB 1VQAA 2DGYA 2F0LA 2E74C 1SNDA 3NHHA 4DK3C 1JJGA 2ICIA 5E1FA 1CFMA 5E4WC 1H9MA 4A3KG 3HZXA 4DV2L 4XTCS 4A3GB 3G7LA 4FVMA 2JA6G 5JJIA 3UE0A 1VMPA 1SMYC 4IUTA 3W1GA 3HOYH 3D6CA 2KEEA 5A2QE 2PMZE 1XWEA 4HSVA 1GO3E 1PH9A 3KDFA 4FF2A 3PUZA 4A3DG 2L1BA 2WP8J 3KF8A 2RDGA 3PQIA 3WOEA 1S40A 2XRQD 1U5KA 2PW5A 4L5TA 1A2TA 2F4IA 5LL6S 1SROA 1MJEA 1GOZA 1TWHB 2B2YC 4V0BA 1J5EQ 4JYAQ 3ONAB 2MJ8A 1QZGA 2K04A 4G7ZC 1B7YB 1ZXTA 2ENBA 4QQBX 4UAIA 1VQ8A 3H3VH 4LF5Q 1SBBB 1JJ2A 2UXBQ 1KL9A 2BA0A 3DUZA 1P16A 2VY3A 1TU2B 3GTPB 5FK9C 4GZYC 3OHXC 5HGTA 1Q7YC 4X66Q 1JE4A 3HS0C 1BBXC 2QF7A 2IL8A 1IW7C 3NXWA 5CV7A 1AFPA 3J7AV 3BYTB 1QJOA 2HCIA 4BS9A 1A2UA 3KLSA 1OXTA 4QF4A 1O7LA 2XNAC 4HCSA 4RWSC 2MPMA 2SNMA 4RGMA 3TEHB 4DR1Q 1PHJA 1OXSC 2F0MA 1EY9A 5BN5A 4LF6Q 3NTIA 4V190 1D5XC 4L8JA 3QR8A 2MGSA 2C35B 4A3DB 2HHHL 3VR4A 4BY1G 2K5WA 4A3DH 1N8RC 1G91A 4RH6A 2GA4B 1Z47A 4KMUC 1X56A 2R93H 3MVVA 1G6ZA 3OMGA 3TS0A 2NVYH 3T13A 4K0KQ 3I55A 4BY1H 2ZJRA 1GD7A 4EQNA 1L1OB 2KA7A 3A56A 4N8FA 4GKKQ 2K03A 1JWUD 1NMFA 1QE6A 5C3EH 1HR0L 3MHBA 4C3JG 2XIWA 4AYBB 1BCPC 2YU9H 1Y8PB 4XYQA 4B3TL 3OIQA 2A6HD 1S5DD 2IX0A 2KCCA 1PYBA 2K50A 1WVLA 1HNXQ 1HNWQ 3GTJH 1VF7A 1PTOB 4ABNA 1YJ9A 2L12A 5C4JB 1E1TA 3L9AX 1QUQB 1D1IA 1LV9A 3HOVH 5CR3A 5M5WB 4KJOA 1U4RA 4XDXA 1HUMA 3D0FA 3I91A 3VYRA 4IJLA 1Q46A 2B2TA 4OL7A 4JI2Q 3J81i 3A74A 4ZCKA 1ILPA 2LXKA 4IPDA 2E5LL 5C5LA 3J7ZC 1X55A 3BG3A 3B6YA 2Y0SB 1MKHA 4OIKA 4CJ1B 1KLGD 1ASZA 1GHJA 2DUDA 1SNMA 1DOLA 5LMNQ 4DR2Q 5FO7B 4OGQC 1YBYA 1DM0B 1WTPA 1XNQQ 4BA2I 3SEBA 4KHPQ 1NMGA 4DV6L 3S2DH 4DAMA 2NYZD 4LFCQ 2R92H 1KTKA 2QEJC 2RDHA 2HIXA 1ILQA 5ELCA 4MHEA 1PYWD 4ILWA 4MNOA 3NP8A 4A3MH 1SE2A 1XX8A 3K58A 3GD7A 2NVXH 5JOBA 2VQFQ 5K5PA 1R9TH 1FD7D 1A3UA 1UUPA 1AZQA 4DV2Q 3OIPA 2BOSA 2JA7B 5DEHA 1OXVA 3K7AB 4JI8Q 4JW0A 1RL2A 3WWVA 1TWGH 3I90A 4P74A 1E2WA 2PZWA 1KDAA 2F4VQ 4A3IH 2BCOA 3U4ZA 3K0XA 3JAMc 4DV4Q 4DFAA 2Y0SG 3HEJA 5IP7H 1SYCA 5L37A 1WFQA 2E2HH 4BBSH 4LFCL 4WORA 3JAML 1SXTA 5CV8A 1O7ZA 4N8X1 3HOXG 4A3LH 5C4HA 1WTHA 1HNZQ 4HAEA 5I4DA 3HOZH 3TS2A 2JA8B 1AEXA 2MHVA 4X3TA 1HHVA 1C8CA 1HZCA 2A6ED 5IIFA 5DNFA 1EYGA 3KF6A 2E2HB 5C4XG 1VQMA 1LTGD 1EQQA 5BN4A 4KHVA 2R93G 1SRUA 2UU9L 4DU9A 3JAME 3J80L 2EYMA 1DXMA 4PV1C 4HCEA 4GNXC 5JJKA 4A3CG 4NXNL 1II3A 1IXRA 1RCVD 2JJQA 1TS4A 2K5VA 1X9NA 1STEA 2EIFA 4RG1A 3CD6A 4IFDJ 3F2BA 4QGUA 1TVXA 3VA5A 4CBVA 1TY0A 4G57A 1H9SB 2O5IC 1PRTD 1Q81C 2K5NA 1D5ZC 4X64L 1XTCD 3MTSA 5LMUQ 4KV6A 1HA6A 4X62Q 3SK5A 1DGSA 3CW2C 4I7AA 1WCMG 3OPOA 1STAA 5FO8B 4IURA 4CHTB 4F88A 1Y69U 1PXUA 1AP0A 4UP8A 3I4MB 4C3HG 1QNUA 1CK1A 4K2LA 3SGIA 2LS01 4Z9CB 1X3QA 4DUYQ 4JI2L 1JC7A 3TRZA 1U9RA 2EY1A 2KQ3A 1I50H 3CRLC 3F1ZA 4JOIC 5IY0A 2DY7A 4YWLA 2RCFA 2JEAI 2VZAA 2JN4A 3FKIG 1B4OA 3CQZH 4DPGA 3DWQA 2RHQB 3GDEA 1JOOA 3GP7A 1N36L 2GVBA 2SOBA 5CC4A 1MSHA 2MFIA 5IWAQ 2B63G 4PNYA 2NVTH 2OQKA 4QUCA 1BOSA 2A69D 3MWYW 4HMIA 4HJAA 2I0QA 4K8JA 4FXGC 2B2WA 1Y1WG 3H15A 4IZ8A 4A3FB 4JI0L 4YWKA 4OWTB 1EQVA 5C3EB 3GTLH 4A3CH 2KHIA 4WJ4A 3D31A 4RGNA 5CV4A 2FJ2A 3H09A 3PO2B 2JK8A 5KEEA 3Q23A 2R7ZH 4LNQA 5FLMH 1JWSD 3HOUH 5IGCA 4DV0L 1YNND 4XQQA 1N36Q 1SE8A 1S5FD 1OXUA 2JEBI 2R61A 2VB2X 3CF5A 2EE1A 3PO3G 3D4WA 3SE0A 1HFGA 1PH3A 4FP5D 4LFAQ 1FNWA 1IYJB 2F0EA 2OF1A 2A69C 1X3GA 4ZKCB 1BVSA 1RTNA 4IUVA 3Q6SA 3GTOH 1TWGB 1VQEA 2L9HA 4RCNA 4JI8L 3ULLA 3W1BA 3I4NB 2L55A 2N78A 2ZXRA 3SK4A 5T1GA 2CH4W 4R4CA 4DAVA 3M85A 2E2DC 3KFUA 3C1FA 3GV6A 2B2VC 5CBEE 1LM0A 2KENA 1Y1VH 2LFNA 1FNVA 3H0GB 3K81C 2ALYB 1B3AA 3PIOA 1Y1WB 1CHQD 4A3FG 3M4OH 3OWEB 4B3ML 4FF1A 2Z6KA 1ASYA 2JA9A 3NSWA 3CC7A 1HR0Q 3OWFA 1A3VA 2EY5A 4IPGA 1YI2A 1KQSA 1M8AA 2Z8LA 2R7FA 1HFNA 1EFWA 2HDLA 2B63H 2CQAA 5D3DA 1B70B 1L2FA 2EPBA 1GKHA 1VQCA 3R8BA 3NBIA 5GADC 2R92G 3OTOL 1EYDA 2BA1A 2ZTCA 3S1QB 5BR8L 2CWAA 3QB3A 2WAQE 2K75A 4LW1A 1K9MC 1I5FA 4MIUA 1TS5A 4DGZA 3C1EA 3CPWA 4HJ8A 5C44G 1SMXA 3TZDA 1Q90A 3EIVA 2F0DA 4BBSB 5H1SE 4AQYQ 1TWCB 1EIFA 2D5DA 4DA2A 4PG3A 2Z1CA 2PNHA 2K05A 5M3FG 5A2QL 4PMWA 2BDOA 3H0GG 1YNJC 1IBLQ 1CQFA 4FXDA 3M4YA 5FLXc 1ONLA 2NN6G 4AQYL 1SNPA 5C4ZA 3RN2A 1XPOA 2E5LQ 4HMJA 3CU7A 1TWFB 3S1MH 1TXYA 3BU2A 2EY2A 4QMGA 5IGEA 2AQ2B 2I5MX 1SJED 4X3SA 5M3FH 5LHY1 4DUZQ 3S14H 1V9PA 3I70A 3F2CA 1RODA 1K0SA 5C6AA 3S16B 1TR5A 3GTKB 3S15B 5LMNL 2NTTA 3MEFA 1L0YB 1LACA 2AMCB 1PTOC 2I5HA 4DR3L 4M1UB 1E0BA 4DR6Q 3GTGH 4LF7L 1QG7A 4U673 4HIKA 1HZAA 1IHZA 3S1RB 4NMZA 4NDXA 1JQYD 5LMNW 2KCMA 2J0TD 4A3BH 4XIGS 5DAUA 1LTBD 5JEAJ 4FDBA 4QIWE 1NUCA 5D14A 5KNDA 1WTOA 1YNNC 4DV3Q 3HKZE 1I4HA 3FKIH 4IUQA 4CDDC 2AQ3B 3V96A 1D8LA 1JOQA 4L63B 5JVG3 4KN7C 3EA6A 1H9JA 4DV4L 1S3OA 2KBNA 3K0YA 1AN8A 3PIO3 4KY5A 5KGUA 4YCVA 3HOUB 2PNRC 1OTCA 1DZ1A 1K3BC 4QY7A 2ATWA 3BJUA 1SEBD 2XVSA 5CV9A 4B3SQ 3OTOQ 3J81L 1IBKQ 2GVAA 2R3ZA 3NBHA 1HNZL 3SDZA 4OHJA 2C9OA 3PUYA 4PQXA 3CCSA 4L5SA 5EQ0A 4BBRG 3G6EA 4LFAL 3Q22A 1L1OA 5CORA 1QZHA 3VA7A 1F9RA 4EVOA 1JCKB 3DXJC 1BR9A 2AKWB 4RKLA 2VW9A 3N52A 4BY7H 4NKLA 4IUPA 4ZK9B 3CCEA 3VR2A 2A1AA 1XXGA 4HTHA 2E2IB 1ICFB 1DCZA 3A7LA 2XRSD 3CCVA 1Q1BA 4LF9L 1I4GA 4FNFA 4C3IH 4UP7A 2I07B 2YTYA 4A3EH 2CVRA 5IP9H 1WYDA 1B3QA 2K5QA 2JQOA 1F2LA 4A93G 1UE5A 5FKAC 4LF9Q 4YIJA 3LGJA 2BE5C 3NTKA 4ZYSA 4TRDA 2IT1A 2FMCA 1GHKA 4LF8Q 1BCPF 4RAUC 4PMCA 1V1PB 2FMMA 1HR0W 3NEMA 4YHHQ 1NSNS 4O1NA 3PIPA 1VQ5A 5J3BA 3PUVA 2CWPA 1HRJA 1B8AA 2G9HD 1D2BA 2L5TA 1QOHA 4DK0A 2DNCA 3C3LA 1N32Q 2HT1A 1LTAD 2ES2A 3GTQH 2ZJQA 4K0KL 1ICWA 1PH8A 2HIVA 2OXPA 2F0TA 3K5OA 3JAMi 2QA4A 3MFYA 3A55A 1F2YA 1EZ8A 1SDFA 2EVBA 3HG9A 4JBJA 1XTDA 1L0WA 4K14A 4ALPA 1MD2D 1GUWA 3CAMA 1TWHH 5C0XG 4BXXG 1LUZA 2B2TC 4A3JH 4B3RQ 1EY5A 2WACA 5E7NA 2HQEA 4OXPA 3IFDA 4P2CB 1K73C 4R4TA 1I6HH 1U4LA 5IOCA 2DJGC 2EXZA 3J80i 2RVLA 3I4OA 1TKWB 3UI2A 5HGQA 4QJFA 3CMAA 2XWBB 3FDTA 2NZHA 2IX3A 3EROA 1IL2A 3KLSX 2B8FA 1PMRA 2KJXA 3OMCA 4DR5L 2PO4A 1NJIC 1K28A
chains in the Genus database with same CATH topology
1JOKA 1PFMA 1ET6A 5COYA 4K8IA 1G291 5EKLA 3P7JA 1EIGA 2L0CA 4LK1C 3HOWB 2FHTA 4DAYA 1I6VC 5I2XA 1G2TA 3H6MA 1LTSD 2IWHA 2RSNA 3K59A 1QCBD 2WIIB 2WINB 2SEBD 3F2UA 1Q3LA 3X3MA 4LJZC 4R8IA 4PMBA 3MC0B 3HRZC 1GJXA 5KNCA 3NQIA 4ME5A 1E2VA 2SDFA 5CYUA 2K1BA 1LTID 3GQBA 2X69A 1J9OA 2H1EA 3I73A 3DWPA 3X3NA 2HCCA 3N6RA 1EY6A 1ZKOA 3NK9A 4H13C 5IGBA 1SE4A 3S2HB 4QIWB 1JR0D 4A3EB 1QB5D 2R93B 4DF7A 4R9WA 3S9WA 4ODGA 1PLFA 4BY7B 3BS1A 5EKIA 4TQUS 3RD4A 4HN7A 3J80E 4E6IA 3A8KE 2QILA 2O2LD 1UAPA 4HSPA 4IUNA 2PMZB 3DHQA 4MN3A 5G3LD 1U4MA 1RDPD 2F0GA 1ZEQX 3SXHA 1XYIA 2B63B 1R9TB 1RKNA 5EPKA 1SAPA 3K5NA 1Y1VB 1FNUA 2F0FA 4CKEA 4R8NA 3PV0A 5I6WA 2QKIC 1TS3A 3BDOA 2WB1B 1KAAA 4KY6A 1V8QA 1PRTB 2OT2A 4CJ2C 3FPUB 2JP1A 1CZGA 5F2DA 5J22A 4OIJA 3VYTA 4ZKBB 2KEDA 2K6AA 1LLRD 5KRUA 2D2CC 1U4PA 1M4VA 2L11A 5IGFA 5KYLA 3PO3B 5C3XA 1NAPA 1WD1A 1AZPA 3I72A 1CQVA 3U9SA 1SYBA 3T56B 2NTSA 1TS2A 3HOVB 3KBGA 3PMFA 4X3KA 2NVXB 1VMCA 2VXWA 3GTLB 4XYOA 3E5SA 1OO9B 2JE6I 5ELBA 1BF4A 1D5MC 3H3VC 2K33A 5D3IB 2EYLA 3W2DA 3U9OA 1BNZA 1QWYA 3S1NB 3EVQA 5EPJA 3CHBD 2F1MA 2MP1A 4BA1I 1KLUD 1LT5D 3O13A 5A35A 5JEAH 1BCPD 2C5CA 2F0JA 1EYAA 2J4XA 1EOTA 4KI0A 2B2VA 1EL0A 4WJWA 1EEID 1VDZA 2RKSA 2DN8A 5KNBA 1Q8IA 2HUGA 1GXDC 1EY8A 1I50B 1PDQA 2ICEC 3NUCA 2RQXA 1TIID 4IFDG 2E76C 3PIP3 3NTHA 1STGA 1PFBA 1QNKA 1CA5A 1SYGA 3RZDB 1T5XD 3P20A 3HOYB 1EU3A 1LABA 2NVTB 1I4XA 3NQTA 1IW7D 4Y7NB 3NWSA 3QOLA 1GUOA 4KKTA 1F9SA 1NR4A 4NP5A 4C1NI 4C3IB 1EWCA 3K57A 1J8IA 2JSOA 1TY2A 1RF2D 5DM63 1HUNA 5M3FB 2E75C 2EYHA 1RHPA 5FO9B 4RCOA 1PTOF 5EPLA 5I9OA 1IL8A 1KNAA 3SK6A 4EQOA 1A6XA 5T1IA 3URYA 5IODA 3VR6A 2QCPX 2KVMA 1Q12A 4C1NK 1CT1D 1DJRD 1CA6A 3VR5A 4TSSA 4X3UA 4IFDI 4BY1B 3TP8A 1IKLA 5JPMC 1GUSA 2XWJB 4FO2A 5K36G 1SYDA 1KDBA 5DM73 4RFBA 3KBXA 3Q24A 4KTAA 5AFWA 1F9PA 4KKSA 3M3YB 2F0PA 4A3JB 3GTQB 4NW2A 5EBDA 5JPNC 1A15A 4I7ZC 1SYFA 1V1OA 2YYZA 3BVGA 2JA5B 3SHLA 5E3FA 4OO1G 2YU9B 1V43A 1LTRD 1CTMA 1SMYD 2AWNA 5E4XA 3RZOB 4QB4A 1ET9A 2O5JC 3DWAA 1E2ZA 2B2YA 4KJNA 4LMQD 1H9RA 2F0KA 3SVMA 5C5MA 3K6OA 1LO5D 3MEHA 5FLXE 3QJYA 2PPBC 1ESRA 4WRDA 4BBRB 4DNTB 5EBCA 3GTMB 4FF4A 5NUCA 4H7BA 5IT9E 1D6EC 2I46A 4DXGA 3CKIB 3RLFA 4DAPA 3H94A 4IALA 1KNEA 3RMHA 3KK7A 2X6LA 5C0XJ 2B8GA 1DYQA 3GO5A 2D62A 4OO1H 3QO2A 3HOXB 4A3IB 5JEAG 3GTGB 1F2MA 1JICA 4J6HA 2A73B 1UEAB 2EJFC 4M8AA 2X6GA 3I8ZA 1L0XB 2Q8RE 4U68A 5IGGA 1W6KA 1NCVA 3OSOA 1DONA 1KDCA 2A68C 3RUZA 1D1KA 2IX1A 4DN4M 1MBYA 1MSGA 3T4AC 3MXNA 1UNSA 3NE5B 5I9PA 3IL8A 1O78A 3MFGA 4N9TA 3TBIB 4H44C 4DNRB 1I6HB 2MUYA 1GUGA 4EGVA 5M5YB 2BE5D 4HR7B 2VNUD 4O42A 2BDNA 3TP7A 5C4XB 4C3HB 4ID6A 1H9SA 3QOJA 4QCLA 4K5VA 2ZXPA 3S1MB 3D3RA 4CJ0B 2NN6I 1TT2A 2NWGA 3S14B 2CHBD 3TN2A 1Z6HA 2IW3A 4K6LA 3FKIB 3LNNA 1SSOA 1SNQA 1STBA 4L6TB 2Z4IA 1X32A 4IUUA 5EJWA 1ML0D 2EYPA 3KUPA 2B2UA 4RHRA 1S5CD 2EJMA 3HGBA 1DOMA 3C2PA 2WV6D 3EQLC 3TMEA 1B9MA 1RJTA 4RKBA 1TWAB 1WD0A 1EQTA 1B53A 4XXEA 2NN6H 3AB9A 1STNA 5KYIA 3R2TA 2F0NA 2O4XA 1F9QA 1S5ED 3J7AF 4RHSA 2PZUA 5J39A 3VYUA 3H91A 3GTOB 1F77A 4B9XA 5I6YA 1HPCA 3LWUA 4F87A 1PTOD 3FPPA 4WFN3 4G7OC 3SR1A 3FEWX 4CKBA 5CBAE 1HXYD 1G2SA 2NBFA 4ZUJA 4C2MB 3ITPA 2R6GA 2R7ZB 3OW7A 5C0XI 2LKVA 2JXMB 3DEPA 5M5XB 1STYA 2WAQB 2A5HA 1ENFA 2JA6B 1TQOA 2FFKB 3M4OB 1WTVA 1FYCA 2XSCA 1JWMD 4IFDH 4H0LC 2B39A 5I2YA 1SYEA 2AUKA 3I3CA 1PTOH 3VR3A 1HCZA 5C44B 2RDFA 1EY4A 1Y8NB 2ZXOA 3CRKC 3TZUA 4A3KB 2XN9C 1O7YA 2DY8A 1MI2A 1LT3D 4C56C 1PZID 1PRTC 1BCPB 3D4RA 1WTQA 3R2IA 4UDUC 3AU7A 3K5MA 3BDLA 2B2WC 2F03A 3HOZB 3AMUA 1SNOA 1HQRD 1WTRA 2EOTA 2A6EC 4S3SA 3ZYYX 1IYVA 2PYKA 4N9PA 2EYOA 2M9VA 4BWGB 1PRTF 2M00A 4LAAA 1EY7A 2F0OA 1CHPD 1I4QA 1PZKD 5CMDA 3V2TA 1PZJD 4JK1C 2EYJA 3TDQA 3E6ZX 1C48A 4EQPA 4ZLTF 4K6DA 3LWEA 1G8ZD 3FMCA 1DD2A 4RA8A 1ESFA 4KD3A 1B50A 4C3JB 1EFID 5C3WA 2Q8IB 3IFTA 3LX0A 2ID0A 4KD4A 2IPKD 2KOLA 3TSSA 3QIAA 4QUFA 1EWHA 2AUJD 1S4ZA 3NWTA 2K32A 1B1ZA 4ULLA 5G3LF 3I4LA 2NUCA 4Q5VA 3E0JA 1B44D 1EEFD 1WTXA 5BN3A 1RD9D 1R4QB 3FVQA 1BO0A 3HKZB 2JYOA 2TMPA 2WKDA 1HQMC 1YNJD 2Z4HA 4XQJA 4K5WA 1O80A 5K36H 5HURA 4A93B 4K2KA 5FOBB 1I3QB 3IKJA 3QG1A 2H4OA 4F7XA 4C3IG 1V1PA 3S2DB 2QDBA 1PFNA 3J7YW 4HEDA 1K8OA 3A7AB 3WDNA 2OEOA 1B9NA 1B2TA 3A8IE 4RGOS 3HP3A 3R93A 3T53B 4RGTA 1AW7A 5ISRA 2F0WA 3BVMA 2EJGC 5EKKA 3W3AA 2PCFB 3QWNA 3MA2B 2FINB 2G9DA 2F0IA 1JORA 2F0HA 2KCNA 1A3TA 2AWOA 1ENCA 2EY6A 3P1HA 3DMUA 1EIHA 1ZYRC 5J1ZA 1EU4A 1Y8OB 3GTJB 3MZ5A 4J1MA 2PZTA 5C0XH 3BVZA 2SNSA 2NZ1D 2D9UA 5D65A 2F0UA 5ELDA 3BZDB 1I4RA 1GUNA 3WOFA 1SNCA 3Q0AA 1MGSA 4FYDA 3L7ZC 3EJIA 1EYCA 1FGBD 4F8MA 4XQNA 2CW0C 3VYSA 4KY7A 1WCMB 2NVQB 3BYYB 3D8GA 1FR3A 5CV6A 3TP5A 1BDOA 1HA5A 4XT1B 1ENAA 3MXPA 5JVH3 4A3MB 2WKCA 1EZ6A 1HTLD 1CZWA 3D4DA 2RSOA 2RBMA 1NR2A 2J7ZA 2CW0D 2HDMA 2EYFA 1LT4D 2PW7A 2E2JB 4ZAIA 3ND8A 4KK7A 3SK8A 1SFOB 1VF5C 4TKOB 2ZT9C 1BXTA 1BUVT 1BQQT 4Q0FA 2K7VA 5M9OA 1ZYRD 3V05A 2L4NA 4ZQ3A 2PQEA 5LL6X 3DM1A 1JB3A 3TP6A 2K01A 3M7NA 1IKMA 5EGTA 3BDCA 3S17B 4DXFA 2M2LA 2VB3X 3MAQA 1QILA 1CI3M 3T51B 5ELEA 2NB0A 1R4PB 2EZVA 1K83B 1F2ZA 5M3MB 1K8MA 2TSSA 3A54A 1CM9A 4ZUIA 2K28A 2F0SA 2KHSA 2Q8TA 3A8JE 1STHA 3IAYA 2KECA 1W6JA 4IN3A 5TSSA 5IGDA 2A68D 4DK1A 3KLRA 4KN4C 1OXXK 4I65A 4CGYB 4K5XA 2F0VA 2K5DA 3OOCA 1S5BD 1KABA 1GUTA 4CKCA 3M7GA 4B08A 2AQ1B 5CV5A 2F0QA 4A3BB 1C4QA 1LTTD 1SE3A 4J8QA 3EFXD 4KKUA 2KUMA 1IYUA 2F3WA 2EDGA 4KHZA 2B2UC 2N88A 1RTOA 3P75A 2N55A 5ELFA 2LY7A 3R3OA 2NVYB 3L3OC 3K5LA 4FXKC 4B9WA 3CQZB 3J81E 2V4DA 4XT3B 2DNEA 1H9KA 4IQZA 2A74C 5JAVA 4JBWA 1LT6D 3PUWA 4FF3A 2F3VA 1I4PA 4G7HC 3G6JB 1VCIA 3MXUA 4G4KA 5IT9L 4OO1I 1DOKA 2R92B 3D6WA 1Q1EA 3PUXA 3GV3A 3C46A 1SJHD 3FRPB 5JJZA 3MXGA 1X3PA 3T16A 1WTWA 5FLXL 1Z7TA 4ZRZA 3DEOA 3ERQA 3ND9A 1T5EA 2IJ0A 1HTPA 5CGKA 1EY0A 2A6HC 5KIXA 2LMCB 3NPPA 2RA4A 2VUMB 2F0LA 2E74C 1SNDA 3NHHA 2ICIA 5E1FA 1CFMA 5E4WC 1H9MA 3HZXA 4XTCS 4A3GB 3G7LA 4FVMA 1VMPA 1SMYC 4IUTA 3D6CA 2KEEA 5A2QE 1XWEA 4HSVA 4FF2A 3PUZA 2L1BA 2WP8J 3KF8A 2RDGA 3WOEA 2XRQD 2PW5A 5LL6S 1A2TA 2F4IA 1GOZA 1TWHB 2B2YC 4V0BA 3ONAB 2MJ8A 2K04A 4G7ZC 2ENBA 1ZXTA 4UAIA 1SBBB 3DUZA 2BA0A 3GTPB 1TU2B 4GZYC 5FK9C 3OHXC 5HGTA 1JE4A 3HS0C 1BBXC 2QF7A 2IL8A 1IW7C 3NXWA 5CV7A 1AFPA 3J7AV 3BYTB 1QJOA 2HCIA 4BS9A 1A2UA 3KLSA 1OXTA 4QF4A 1O7LA 2XNAC 4HCSA 4RWSC 2MPMA 2SNMA 4RGMA 1OXSC 2F0MA 1EY9A 5BN5A 3NTIA 4V190 1D5XC 4L8JA 2MGSA 4A3DB 3VR4A 2K5WA 1G91A 4RH6A 2GA4B 1Z47A 4KMUC 3MVVA 1G6ZA 3OMGA 3T13A 4EQNA 2KA7A 3A56A 2K03A 1JWUD 1QE6A 3MHBA 4C3JG 2XIWA 4AYBB 1BCPC 1Y8PB 4XYQA 3OIQA 2A6HD 1S5DD 2IX0A 2KCCA 1WVLA 1VF7A 1PTOB 4ABNA 2L12A 5C4JB 3L9AX 1D1IA 1LV9A 5CR3A 5M5WB 4KJOA 1U4RA 4XDXA 1HUMA 3I91A 3VYRA 2B2TA 4OL7A 1ILPA 5C5LA 3BG3A 2Y0SB 4OIKA 4CJ1B 1KLGD 1GHJA 1SNMA 1DOLA 5FO7B 4OGQC 1WTPA 1DM0B 4BA2I 3SEBA 2NYZD 1KTKA 2QEJC 2RDHA 5ELCA 1ILQA 4MHEA 1PYWD 4ILWA 3NP8A 1SE2A 1XX8A 3K58A 3GD7A 5JOBA 5K5PA 1FD7D 1A3UA 1UUPA 1AZQA 3OIPA 2BOSA 2JA7B 5DEHA 1OXVA 3K7AB 3I90A 1E2WA 2PZWA 1KDAA 2BCOA 4DFAA 3HEJA 1SYCA 4WORA 3JAML 1SXTA 5CV8A 1O7ZA 5C4HA 4HAEA 5I4DA 2JA8B 1AEXA 2MHVA 4X3TA 1HHVA 1C8CA 2A6ED 5IIFA 5DNFA 2E2HB 1LTGD 5BN4A 4KHVA 4DU9A 3JAME 3J80L 2EYMA 1DXMA 4PV1C 4HCEA 1II3A 1RCVD 1TS4A 1STEA 4IFDJ 1TVXA 3VA5A 4CBVA 1TY0A 4G57A 1H9SB 2O5IC 1PRTD 1D5ZC 1XTCD 3MTSA 4KV6A 1HA6A 3SK5A 3OPOA 1STAA 5FO8B 4IURA 4CHTB 4F88A 1Y69U 1PXUA 1AP0A 3I4MB 4C3HG 1QNUA 1CK1A 4K2LA 2LS01 4Z9CB 1X3QA 1JC7A 1U9RA 2EY1A 2KQ3A 3CRLC 2DY7A 2JEAI 1B4OA 3DWQA 1JOOA 3GP7A 2SOBA 5CC4A 1MSHA 4PNYA 4QUCA 1BOSA 2A69D 3MWYW 4HMIA 4FXGC 4K8JA 2B2WA 4IZ8A 4A3FB 1EQVA 5C3EB 3D31A 4RGNA 5CV4A 2FJ2A 3H09A 3PO2B 5KEEA 3Q23A 1JWSD 5IGCA 1YNND 4XQQA 1S5FD 1OXUA 2JEBI 2R61A 2VB2X 2EE1A 3D4WA 3SE0A 1HFGA 4FP5D 1FNWA 2F0EA 2OF1A 2A69C 4ZKCB 1RTNA 4IUVA 3Q6SA 1TWGB 2L9HA 4RCNA 3I4NB 2L55A 2ZXRA 3SK4A 5T1GA 4DAVA 3M85A 2E2DC 3C1FA 3GV6A 2B2VC 5CBEE 2LFNA 1Y1WB 1FNVA 3H0GB 1B3AA 1CHQD 3OWEB 4FF1A 3NSWA 3OWFA 1A3VA 2EY5A 1M8AA 2Z8LA 1HFNA 2HDLA 2CQAA 5D3DA 2EPBA 3R8BA 3NBIA 1EYDA 2BA1A 3S1QB 3QB3A 4MIUA 1TS5A 4DGZA 3C1EA 3TZDA 1Q90A 2F0DA 4BBSB 1TWCB 4DA2A 2D5DA 2Z1CA 2K05A 5A2QL 4PMWA 2BDOA 1YNJC 1CQFA 4FXDA 3M4YA 1ONLA 2NN6G 1SNPA 5C4ZA 4HMJA 3CU7A 1TWFB 2EY2A 4QMGA 5IGEA 2AQ2B 1SJED 4X3SA 5LHY1 3I70A 1RODA 5C6AA 3S16B 1TR5A 3GTKB 3S15B 2NTTA 1L0YB 1LACA 1PTOC 4M1UB 1E0BA 1QG7A 4U673 1IHZA 3S1RB 4NMZA 4NDXA 1JQYD 2J0TD 4XIGS 5DAUA 1LTBD 5JEAJ 1NUCA 5D14A 5KNDA 1WTOA 1YNNC 1I4HA 4IUQA 2AQ3B 3V96A 1JOQA 4L63B 5JVG3 4KN7C 3EA6A 1H9JA 3K0YA 1AN8A 3PIO3 4KY5A 5KGUA 3HOUB 2PNRC 1DZ1A 1SEBD 2XVSA 5CV9A 3J81L 2R3ZA 3NBHA 3SDZA 4OHJA 2C9OA 3PUYA 4PQXA 5EQ0A 3Q22A 5CORA 3VA7A 1F9RA 4EVOA 1JCKB 3DXJC 1BR9A 4RKLA 3N52A 4NKLA 4IUPA 4ZK9B 3VR2A 1XXGA 4HTHA 2E2IB 1DCZA 3A7LA 2XRSD 1Q1BA 1I4GA 4FNFA 2I07B 2CVRA 2K5QA 1F2LA 5FKAC 4YIJA 2BE5C 3NTKA 4ZYSA 4TRDA 2IT1A 2FMCA 1GHKA 1BCPF 4RAUC 4PMCA 1V1PB 2FMMA 1NSNS 4O1NA 3PUVA 1HRJA 2G9HD 1D2BA 2L5TA 1QOHA 4DK0A 2DNCA 3C3LA 1LTAD 1ICWA 2OXPA 2F0TA 3K5OA 3MFYA 3A55A 1F2YA 1EZ8A 1SDFA 2EVBA 3HG9A 4K14A 1MD2D 1GUWA 5C0XG 2B2TC 1EY5A 2WACA 2HQEA 3IFDA 4P2CB 1U4LA 5IOCA 2EXZA 2RVLA 1TKWB 3UI2A 2XWBB 3FDTA 2IX3A 3EROA 3KLSX 2B8FA 1PMRA 2KJXA 3OMCA 2PO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EEI D;  4RHS A;  1RDP D;  1ET6 A;  1BCP C;  2ICI A;  4RFB A;  1HTL D;  1S5D D;  4RGN A;  5I4D A;  1XXG A;  2AQ1 B;  1PTO B;  2XRS D;  1LTT D;  1V1P A;  1HQR D;  1UNS A;  1SE3 A;  1I4G A;  1FNU A;  1F77 A;  3EFX D;  3MFG A;  1JWS D;  1LT4 D;  1V1O A;  3BVG A;  1TS3 A;  1LTG D;  1PRT B;  2RDG A;  1PTO D;  4BWG B;  1LTS D;  1PRT F;  2AQ2 B;  1S5F D;  1SJE D;  2XRQ D;  2R61 A;  1S5B D;  1T5X D;  1LTR D;  1GOZ A;  5FKA C;  1CHP D;  1HXY D;  1I4Q A;  1RCV D;  5ELF A;  1TS4 A;  1PZK D;  1BXT A;  2SEB D;  1STE A;  4ZYS A;  1FNW A;  1ET9 A;  1BCP F;  1PZJ D;  2NTT A;  1EU3 A;  3DWA A;  1I4X A;  1L0Y B;  4RGO S;  1TY0 A;  1LLR D;  3MC0 B;  4RGT A;  3V05 A;  1AW7 A;  1PTO C;  1V1P B;  1PRT D;  3BVM A;  1G8Z D;  4O1N A;  1LO5 D;  1D5Z C;  1SBB B;  1XTC D;  1ESF A;  1KLG D;  1M4V A;  5FK9 C;  1EFI D;  1JQY D;  1LTI D;  1LT6 D;  1ENF A;  2G9H D;  2IPK D;  1I4P A;  3TSS A;  4DXF A;  3SEB A;  1LTB D;  1CQV A;  1LTA D;  2CHB D;  1FNV A;  3BYT B;  1EWC A;  1CHQ D;  1CK1 A;  4K6L A;  2NTS A;  1QIL A;  1JWM D;  1TS2 A;  3OWE B;  1KTK A;  2QEJ C;  2RDH A;  3DWP A;  4Z9C B;  1I4H A;  5ELC A;  2XNA C;  1TY2 A;  1PYW D;  1RF2 D;  1D6E C;  1SJH D;  1EU4 A;  1SE2 A;  5ELE A;  2Z8L A;  2AQ3 B;  4DXG A;  4L6T B;  1MD2 D;  4RGM A;  1B1Z A;  5D3D A;  4RCO A;  1PTO H;  1FD7 D;  1PTO F;  5ELB A;  1UUP A;  1D5M C;  2TSS A;  4L63 B;  5D3I B;  3EA6 A;  1D5X C;  3BVZ A;  3R8B A;  3W2D A;  1SE4 A;  4RHR A;  1JR0 D;  1S5C D;  1AN8 A;  4RH6 A;  5ELD A;  3CHB D;  3URY A;  1DYQ A;  3DWQ A;  3BZD B;  1I4R A;  2WV6 D;  3GP7 A;  2IJ0 A;  1B44 D;  1KLU D;  1SEB D;  1LT5 D;  1TS5 A;  3O13 A;  1EEF D;  1FGB D;  2XN9 C;  5TSS A;  1BCP D;  1RD9 D;  1CT1 D;  1DJR D;  1LT3 D;  2J4X A;  4C56 C;  1PZI D;  4OHJ A;  1PRT C;  3BYY B;  3KLS X;  4TSS A;  1BCP B;  1L0X B;  2QIL A;  2O2L D;  3R2T A;  1JWU D;  1JCK B;  3R2I A;  4UDU C;  1SXT A;  1HA5 A;  1S5E D; 
#chains in the Genus database with same CATH topology
 1JOK A;  1PFM A;  1ET6 A;  5COY A;  3E9H A;  1X54 A;  4K8I A;  5M5X H;  1G29 1;  4DV7 Q;  5EKL A;  3P7J A;  1EIG A;  2L0C A;  5IE8 A;  3MXN B;  1FVI A;  4LK1 C;  2JA6 H;  3HOW B;  4DR2 L;  2FHT A;  4DAY A;  1I6V C;  4B3M Q;  5I2X A;  1MJC A;  3AEV A;  3M4P A;  1G2T A;  3H6M A;  1LTS D;  1TWF H;  2IWH A;  2RSN A;  3K59 A;  4GOP A;  4IJH A;  2KCT A;  1QCB D;  3G71 A;  1AH9 A;  2WII B;  3I7F A;  2JA7 G;  3F2D A;  2WIN B;  2SEB D;  3F2U A;  1Q3L A;  3X3M A;  1FJG L;  4LJZ C;  3PF5 A;  2QEX A;  2YV5 A;  1UWV A;  5IT9 c;  1KHI A;  3GTK H;  4LF4 L;  4Y7N H;  4PMB A;  3MC0 B;  3HRZ C;  4CDE C;  4R8I A;  4IO9 A;  1GJX A;  5KNC A;  2VS1 A;  3NQI A;  4JBK A;  3T1Y Q;  2E2J H;  4ME5 A;  2OTL A;  1E2V A;  2LSS A;  4OWW B;  1FJG Q;  2SDF A;  5CYU A;  2K1B A;  4YHH L;  1LTI D;  3GQB A;  4L5Q A;  2X69 A;  1J9O A;  1PH7 A;  2H1E A;  3I73 A;  1E3P A;  3DWP A;  5FJ8 H;  3X3N A;  2H5X A;  1N32 L;  2HCC A;  3N6R A;  1EY6 A;  1ZKO A;  3NK9 A;  4H13 C;  3I2Z A;  4GLV B;  3HKS A;  5IGB A;  3VDY A;  3ZJY C;  1BBU A;  1SE4 A;  3S2H B;  4QIW B;  5GQO A;  1JR0 D;  4A3E B;  3UDX A;  1QB5 D;  2B29 A;  4DF7 A;  2R93 B;  3KF6 B;  4R9W A;  3S9W A;  4ODG A;  1PLF A;  4OX9 L;  4BY7 B;  3BS1 A;  5EKI A;  1YJW A;  4TQU S;  3RD4 A;  4JI6 Q;  2ZM6 Q;  4O0A A;  4HN7 A;  3J80 E;  2UU9 Q;  4E6I A;  2UUA L;  3CCM A;  1YVC A;  4YCW A;  3A8K E;  4RMF A;  2QIL A;  3T1H L;  2O2L D;  2D0O A;  1UAP A;  4HSP A;  4IUN A;  2PMZ B;  3DHQ A;  3K80 C;  4ME3 A;  2IHF A;  4MN3 A;  5G3L D;  3UDI A;  1U4M A;  1RDP D;  1FL0 A;  2F0G A;  2NZO A;  1ZEQ X;  3SXH A;  1XYI A;  1PYS B;  4OEL B;  4C3J H;  3M3Y H;  4PZ8 A;  1VQO A;  2B63 B;  1R9T B;  1RKN A;  5C4J H;  3E0E A;  2E2I H;  5EPK A;  1SAP A;  3K5N A;  1Y1V B;  1A63 A;  1FNU A;  2F0F A;  4CKE A;  4R8N A;  3PV0 A;  5I6W A;  2KHJ A;  2QKI C;  1JJC B;  2R7Z G;  1TS3 A;  3BDO A;  3I56 A;  4KY6 A;  1KAA A;  2WB1 B;  1V8Q A;  1PRT B;  3CME A;  2OT2 A;  4CJ2 C;  3PO3 H;  3FPU B;  2AHO B;  4R4I A;  3U50 C;  2JP1 A;  1CZG A;  4NB3 A;  5F2D A;  5J22 A;  4OIJ A;  3VYT A;  4ZKB B;  2KED A;  2K6A A;  1LLR D;  4AIM A;  5KRU A;  4B3R L;  2D2C C;  1U4P A;  1M4V A;  2L11 A;  5IGF A;  5KYL A;  2N3S A;  3PO3 B;  1NY4 A;  5C3X A;  1NAP A;  1WD1 A;  1AZP A;  1BKB A;  1MHW C;  4R1J A;  3I72 A;  1CQV A;  2WFW A;  4MTN A;  3U9S A;  4OON A;  1SYB A;  1VQ6 A;  3T56 B;  2NTS A;  1TS2 A;  1YZ6 A;  1QUQ A;  3HOV B;  3AFQ A;  4HJ5 A;  4LUZ A;  3KBG A;  3PMF A;  4X3K A;  3I4N G;  2NVX B;  2YTX A;  1VQH A;  1VMC A;  2RCN A;  2VXW A;  4UP9 A;  3GTL B;  4XYO A;  4JI0 Q;  3E5S A;  1OO9 B;  2UXD Q;  2JE6 I;  5ELB A;  1HZB A;  3G4S A;  1D5M C;  1BF4 A;  3PO2 G;  1QVG A;  3H3V C;  2K33 A;  5D3I B;  2NVQ H;  2EYL A;  3PO2 H;  3W2D A;  2VUM G;  3U9O A;  1BNZ A;  1QWY A;  3ULP A;  4HIM A;  3EVQ A;  5EPJ A;  3S1N B;  4DR7 Q;  1KD1 C;  3CHB D;  2F1M A;  2MP1 A;  4BA1 I;  1KLU D;  1JB7 A;  1LT5 D;  1NE3 A;  3O13 A;  5A35 A;  5JEA H;  1BCP D;  2C5C A;  1UEB A;  5EAY A;  2F0J A;  1EYA A;  2J4X A;  3HOZ G;  1SLJ A;  4JI1 Q;  1EOT A;  4KI0 A;  4NPS A;  2B2V A;  1EL0 A;  1G51 A;  4WJW A;  1EEI D;  1VDZ A;  2RKS A;  2DN8 A;  3T1H Q;  2Z6K C;  5KNB A;  1Q8I A;  5DLQ E;  2HUG A;  1GXD C;  3U4V A;  1EY8 A;  1I50 B;  1PDQ A;  2ICE C;  3NUC A;  4TVA B;  2JA8 H;  3EBE A;  1XPR A;  2RQX A;  1TII D;  3AQQ A;  4NXM Q;  2K5H A;  3PSI A;  4IFD G;  2E76 C;  3PIP 3;  3NTH A;  1STG A;  3TQY A;  1PFB A;  3RR5 A;  1QNK A;  1CA5 A;  2Q2T A;  1SYG A;  3RZD B;  1T5X D;  2LXJ A;  4LUV A;  3P20 A;  3G48 A;  1EOV A;  3HOY B;  2I5L X;  1N9W A;  5C4X H;  1EU3 A;  1LAB A;  2NVT B;  1I4X A;  3NQT A;  3HKZ G;  5IYB G;  1IW7 D;  4Y7N B;  3NWS A;  5IP9 G;  3QOL A;  4HID A;  3TRE A;  1MIU A;  4B3T Q;  1GUO A;  4KKT A;  1F9S A;  3CCL A;  1VQI A;  1NR4 A;  4JI4 L;  4NP5 A;  2HD3 A;  4EQ5 A;  4C1N I;  1KIX A;  1HH2 P;  4C3I B;  1HZ9 A;  1EWC A;  4BBS G;  2G5D A;  1E7Z A;  3K57 A;  1V1Q A;  4C3H H;  1J8I A;  2JSO A;  3W5O A;  1TY2 A;  1RF2 D;  1PH6 A;  2JA5 G;  5DM6 3;  1HUN A;  4HJ7 A;  5M3F B;  2E75 C;  2EYH A;  4JI4 Q;  1RHP A;  5FO9 B;  4RCO A;  1PTO F;  5EPL A;  4AYB E;  1PH2 A;  2Z9H A;  1IBM L;  2EXD A;  5I9O A;  1IL8 A;  1KNA A;  3SK6 A;  3RN5 A;  4EQO A;  1A6X A;  5T1I A;  3URY A;  1J6Q A;  5IOD A;  3KDF B;  3A5U A;  3VR6 A;  1S72 A;  2QCP X;  2KVM A;  1VQK A;  4JV5 L;  1XMO Q;  1CSQ A;  1Q12 A;  4C1N K;  1CT1 D;  4CDC C;  1DJR D;  3HOY G;  1AE3 A;  1PV4 A;  1CA6 A;  3VR5 A;  3S15 H;  4TSS A;  1VQL A;  1KC8 C;  4X3U A;  4IFD I;  4BY1 B;  4LF4 Q;  3TP8 A;  1IKL A;  5JPM C;  1GUS A;  2XWJ B;  4FO2 A;  4JI7 Q;  1SYD A;  5K36 G;  2OCE A;  2Y0S E;  1KDB A;  5DM7 3;  4RFB A;  4P75 A;  3KBX A;  4DR3 Q;  3Q24 A;  4KTA A;  5AFW A;  1F9P A;  4KKS A;  3J81 j;  4DV1 Q;  3M3Y B;  3PGZ A;  2F0P A;  4A3J B;  1GM5 A;  3GTQ B;  2UXC L;  4NW2 A;  5EBD A;  5JPN C;  1A15 A;  4I7Z C;  3L2P A;  1SYF A;  1V1O A;  2YYZ A;  1VQD A;  3BVG A;  4YWM A;  2JA5 B;  3SHL A;  5E3F A;  2D0P A;  4OO1 G;  2YU9 B;  1V43 A;  1LTR D;  4A3I G;  1CTM A;  1SMY D;  2AWN A;  5E4X A;  3RZO B;  1W2B A;  2OWO A;  1C7Y A;  4QB4 A;  1ET9 A;  1T9H A;  2O5J C;  3DWA A;  1E2Z A;  2B2Y A;  4KJN A;  3CCJ A;  4LMQ D;  1H9R A;  2F0K A;  2HHH Q;  3SVM A;  5JJL A;  1CKN B;  5C5M A;  3K6O A;  1M1K C;  1LO5 D;  4A3F H;  3MEH A;  5FLX E;  1K0R A;  3QJY A;  4A3L G;  2PPB C;  4A75 A;  2RF4 A;  4JPB W;  1ESR A;  2BH2 A;  4WRD A;  4BBR B;  2JA7 H;  4DNT B;  5EBC A;  1YIT A;  4GNX B;  3GTM B;  4FF4 A;  5NUC A;  4POG A;  3GTM H;  4C2M H;  4JI1 L;  3K8A A;  4X65 Q;  4QL5 A;  4H7B A;  1D6E C;  5IT9 E;  2I46 A;  2QDL A;  4DXG A;  3CC4 A;  3CKI B;  4LWC A;  3K7U C;  3RLF A;  4POF A;  4L5R C;  2ZJP A;  4A3J G;  4MTK A;  4DAP A;  1VS0 A;  3H94 A;  4BXX H;  4IAL A;  1KNE A;  3RMH A;  3KK7 A;  2X6L A;  5C0X J;  1LYL A;  2B8G A;  4DR4 L;  1DYQ A;  3GO5 A;  1IZ6 A;  2D62 A;  5LMU L;  4OO1 H;  3RLN A;  3QO2 A;  5JEA G;  4A3I B;  1Q8K A;  1F2M A;  3HOX B;  3GTG B;  1JIC A;  3RZD H;  4J6H A;  2A73 B;  1UEA B;  2EJF C;  4M8A A;  4PZ6 A;  2X6G A;  3I8Z A;  1L0X B;  1UE1 A;  2Q8R E;  3UDG A;  4OX9 Q;  4U68 A;  5IGG A;  4LF8 L;  2PQA A;  1W6K A;  1NCV A;  3OSO A;  1DON A;  1KDC A;  2A68 C;  3RUZ A;  1D1K A;  2IX1 A;  4DN4 M;  1MBY A;  1MSG A;  3T4A C;  3MXN A;  1XNQ L;  1UNS A;  3NE5 B;  1J5E L;  5I9P A;  3IL8 A;  4JYA L;  1O78 A;  2A8V A;  2CKZ B;  3MFG A;  4N9T A;  4DV7 L;  4DV1 L;  3TBI B;  4H44 C;  4DNR B;  1I6H B;  1A0I A;  2MUY A;  1GUG A;  2N49 A;  5M5Y H;  2Z6B A;  4LF5 L;  4EGV A;  5M5Y B;  2BE5 D;  2MO0 A;  4HR7 B;  2VNU D;  4O42 A;  2BDN A;  1Q86 C;  3I4M H;  2ASB A;  3TP7 A;  3I4M G;  5C4X B;  4C3H B;  4ID6 A;  1H9S A;  3QOJ A;  4QCL A;  4K5V A;  1VQ7 A;  2ZXP A;  3S1M B;  2F4V L;  3DLL A;  3D3R A;  4CJ0 B;  2CH4 A;  3GTP H;  2NN6 I;  1TT2 A;  1IBK L;  4UY8 C;  2NWG A;  3S14 B;  1WCM H;  3M4Q A;  2VUM H;  2UXB L;  3S16 H;  2CHB D;  3TN2 A;  1Z6H A;  2IW3 A;  1XPU A;  2VQF L;  4K6L A;  1PA6 A;  3FKI B;  4LF7 Q;  3LNN A;  1SSO A;  2PI2 A;  1SNQ A;  1STB A;  5GAG C;  4JI7 L;  4L6T B;  1TWA H;  4R4O A;  2Z4I A;  1X32 A;  3UE1 A;  4IUU A;  5EJW A;  1ML0 D;  2EYP A;  2K14 A;  3KUP A;  1YEZ A;  2B2U A;  4RHR A;  1S5C D;  2EJM A;  3HGB A;  2JA5 H;  4WJ3 M;  1DOM A;  3C2P A;  2WV6 D;  3EQL C;  3TME A;  2Q2U A;  1B9M A;  4YY3 Q;  5C3E G;  4GKJ L;  4DV0 Q;  3J7A 5;  1RJT A;  1JMC A;  4RKB A;  2QW7 A;  2N8N A;  1TWA B;  4X66 L;  1WD0 A;  1EQT A;  1B53 A;  2YTV A;  1H95 A;  2V1C C;  3S17 H;  1KRS A;  4XXE A;  2WAQ G;  2NN6 H;  3AB9 A;  1STN A;  1UE6 A;  5KYI A;  1LTL A;  2HQL A;  2VQE Q;  3R2T A;  1WJJ A;  2F0N A;  5M5W H;  2O4X A;  4OWX B;  1F9Q A;  1S5E D;  3J7A F;  4BY7 G;  3IRB A;  4RHS A;  2PZU A;  5J39 A;  1EUJ A;  4BBR H;  3VYU A;  3H91 A;  3GTO B;  1F77 A;  4B9X A;  3M9B A;  5I6Y A;  1HPC A;  4YCU A;  3LWU A;  4F87 A;  1YIJ A;  3FP9 A;  1PTO D;  3FPP A;  4DUY L;  1QVF A;  4GKJ Q;  4WFN 3;  4G7O C;  4X65 L;  5IYC H;  3SR1 A;  3FEW X;  4CKB A;  2BH8 A;  1U0L A;  5M3M H;  3U58 A;  5CBA E;  1HXY D;  4IOA A;  2Z0S A;  1G2S A;  4P73 A;  2NBF A;  4LUO A;  1E1O A;  4GNX A;  4ZUJ A;  4C2M B;  3ITP A;  2R6G A;  2R7Z B;  3OW7 A;  5C0X I;  4JBM A;  1C9O A;  2LKV A;  2JXM B;  4P71 A;  3I4N H;  2Q2I A;  2UUB L;  3DEP A;  5M5X B;  2P5Z X;  1STY A;  2WAQ B;  2A5H A;  1ENF A;  4DR6 L;  1IBL L;  4A76 A;  4IPH A;  2JA6 B;  1TQO A;  2FFK B;  3M4O B;  1HJP A;  1WTV A;  1FYC A;  3OYY A;  2XSC A;  1Y1W H;  1K8G A;  1JWM D;  4IFD H;  1N34 L;  4H0L C;  2B39 A;  5I2Y A;  1SYE A;  4A3G H;  2AUK A;  3I3C A;  1D7Q A;  1PTO H;  4JG2 A;  3RNU A;  4EX5 A;  1X3F A;  3VR3 A;  1Y1V G;  1HCZ A;  5C44 B;  2RDF A;  1VQP A;  3FHW A;  1EY4 A;  1XMQ L;  2WB1 G;  1A62 A;  1Y8N B;  2ZXO A;  2GN5 A;  3NEN A;  3CRK C;  3TZU A;  1FGU A;  1X65 A;  4A3K B;  2XN9 C;  2UUB Q;  1O7Y A;  2DY8 A;  1MI2 A;  1CSP A;  2RHS B;  1LT3 D;  3Q8D A;  4C56 C;  5AJ3 Q;  1PZI D;  1PRT C;  4JI5 Q;  1BCP B;  4B3S L;  3D4R A;  1SR3 A;  1WTQ A;  3R2I A;  4UDU C;  4IOC A;  2UXC Q;  1CUK A;  3AU7 A;  1N33 Q;  3K5M A;  3BDL A;  1VQB A;  1Z9F A;  4JI3 L;  2B2W C;  4A3K H;  4LF6 L;  2F03 A;  1K3R A;  2UUC L;  1K83 H;  2PI2 E;  3HOZ B;  3AMU A;  3CC2 A;  1SNO A;  1HQR D;  1WTR A;  2EOT A;  2QGQ A;  4R4Q A;  1SN8 A;  2A6E C;  4S3S A;  2PQA B;  3ZYY X;  2A19 A;  1IYV A;  2PYK A;  1A8V A;  4N9P A;  3KF8 B;  4JC0 A;  3KLW A;  2EYO A;  2M9V A;  3A0J A;  4BWG B;  1PRT F;  2M00 A;  1TWC H;  4LAA A;  1EY7 A;  2F0O A;  1CHP D;  1I4Q A;  1PZK D;  5CMD A;  2IY5 B;  1W3S A;  1WI5 A;  1X6O A;  3BZC A;  3V2T A;  1PZJ D;  5IYB H;  4JK1 C;  2EYJ A;  4APV A;  3TDQ A;  4A4I A;  1NNX A;  1C48 A;  3E6Z X;  4EQP A;  4ZLT F;  1YHQ A;  4K6D A;  3LWE A;  4NXN Q;  1G8Z D;  3FMC A;  3STB C;  1DD2 A;  1P8L A;  4DR7 L;  4RA8 A;  1ESF A;  4KD3 A;  1HNW L;  1B50 A;  4C3J B;  3KJO A;  1EFI D;  5C3W A;  2Q8I B;  1SFO H;  4YY3 L;  3IFT A;  3NEL A;  1KRT A;  3LX0 A;  4PZ7 A;  1XJV A;  2ID0 A;  4KD4 A;  2IPK D;  2KOL A;  3TSS A;  4UPA A;  3OW2 A;  3QIA A;  2MO1 A;  4J15 A;  4QUF A;  1EWH A;  2AUJ D;  1S4Z A;  3HOU G;  3NWT A;  3J81 c;  4OEM B;  2K32 A;  1B1Z A;  1CKO A;  4ULL A;  5G3L F;  3I4L A;  1YHA A;  3CCQ A;  4IPC A;  2NUC A;  4JCV E;  5IWA L;  4H02 A;  4Q5V A;  3E0J A;  5IYD G;  2E8G A;  1B44 D;  5IYD H;  2MNA A;  4AYB G;  4DV5 Q;  1XMQ Q;  1EEF D;  1WTX A;  1RIP A;  3E9I A;  4DUZ L;  5BN3 A;  1RD9 D;  4KHP L;  1R4Q B;  3FVQ A;  1BO0 A;  3HKZ B;  2JYO A;  2TMP A;  2WKD A;  1HQM C;  1YNJ D;  2Z4H A;  1XMO L;  4XQJ A;  4DAY B;  4K5W A;  3STB D;  1O80 A;  1VQ4 A;  4JI6 L;  5K36 H;  5HUR A;  4A93 B;  4K2K A;  3CCU A;  5FOB B;  1I3Q B;  3IKJ A;  3QG1 A;  2H4O A;  4O2D A;  4F7X A;  4C3I G;  1V1P A;  5GRO A;  3S2D B;  4JI3 Q;  2QDB A;  3S1N H;  1PFN A;  3J7Y W;  4HED A;  3EN2 A;  1K8O A;  3A7A B;  4A93 H;  3NBH B;  3J80 c;  5AJ3 L;  3WDN A;  2OEO A;  1E24 A;  5ELN A;  1B9N A;  1B2T A;  3A8I E;  3CP0 A;  4RGO S;  3HP3 A;  4HJ9 A;  4Y52 H;  3R93 A;  3T53 B;  4RGT A;  1CKN A;  1CKM A;  1GVP A;  1AW7 A;  5ISR A;  2F0W A;  3BVM A;  1C0A A;  2EJG C;  5EKK A;  3W3A A;  2IHE A;  2UUC Q;  3HOX H;  1XNR Q;  2PCF B;  4MZ9 A;  4A3M G;  3QWN A;  4GN3 B;  2B3G A;  3MA2 B;  4JV5 Q;  2FIN B;  2G9D A;  1PH5 A;  3CXC A;  2F0I A;  1JOR A;  2F0H A;  1KAW A;  2KCN A;  1Q82 C;  1A3T A;  4JI5 L;  1UE7 A;  1ENC A;  2AWO A;  2EY6 A;  3P1H A;  3DMU A;  4KLK A;  1EIH A;  1ZYR C;  2OQ0 A;  5J1Z A;  1EU4 A;  1Y8O B;  1E22 A;  4GN4 B;  3GTJ B;  3MZ5 A;  1YJN A;  4J1M A;  2PZT A;  5C0X H;  3BVZ A;  2SNS A;  2NZ1 D;  3ICE A;  1G6P A;  2D9U A;  5D65 A;  4X64 Q;  2F0U A;  4GLX A;  1K8A C;  5ELD A;  3BZD B;  1I4R A;  1GUN A;  3WOF A;  2VQE L;  2XTI A;  1SNC A;  1XNR L;  3Q0A A;  1MGS A;  4FYD A;  3L7Z C;  1WOC A;  1EYC A;  1FGB D;  3EJI A;  4F8M A;  4XQN A;  2CW0 C;  3RLO A;  3VYS A;  4KY7 A;  3HOW H;  1WCM B;  2WB1 E;  2CCZ A;  2NVQ B;  1YHB A;  3BYY B;  3D8G A;  2JA8 G;  3HOW G;  1NBW A;  2CQO A;  1NTG A;  1FR3 A;  5CV6 A;  2DJF C;  3TP5 A;  1BDO A;  2MQH A;  1HA5 A;  4XT1 B;  3A5Z B;  1ENA A;  1AE2 A;  3MXP A;  5JVH 3;  4A3M B;  2WKC A;  1L1O C;  1EZ6 A;  1HTL D;  1CZW A;  3D4D A;  2RSO A;  2RBM A;  1NR2 A;  2J7Z A;  2VL6 A;  2CW0 D;  3KOJ A;  2HDM A;  3H0G H;  2EYF A;  3AYH B;  2R7D A;  1LT4 D;  2PW7 A;  2E2J B;  4ZAI A;  2L15 A;  3ND8 A;  4KK7 A;  3SK8 A;  4GOP B;  4JOI A;  4AH6 A;  2ZM6 L;  4GLA C;  1SFO B;  4DKA C;  1VF5 C;  4TKO B;  1EWI A;  1VQJ A;  2ZT9 C;  1BXT A;  2OTJ A;  2K4K A;  3E3X A;  1BUV T;  1BQQ T;  4Q0F A;  4DNI A;  5HY6 A;  4X62 L;  2K7V A;  4P72 A;  4GKK L;  5M9O A;  1ZYR D;  3V05 A;  2L4N A;  4ZQ3 A;  5FLM G;  1VQF A;  2PQE A;  3AFP A;  5LL6 X;  3DM1 A;  4DV3 L;  4DR4 Q;  1JB3 A;  5ELO A;  3TP6 A;  2K01 A;  5FJ8 G;  3M7N A;  1IKM A;  1I94 L;  5EGT A;  3BDC A;  3S1R H;  4DV5 L;  3S17 B;  4DXF A;  4A3B G;  3L0O A;  4CDF C;  2M2L A;  2VB3 X;  3MAQ A;  1QIL A;  4A3E G;  1CI3 M;  1IBM Q;  3T51 B;  4JVZ A;  1VQ9 A;  1N33 L;  5ELE A;  2NB0 A;  1R4P B;  2EZV A;  1K83 B;  1F2Z A;  1PVO A;  1BBW A;  5M3M B;  1K8M A;  2TSS A;  3RZO H;  3A54 A;  1CM9 A;  1PH1 A;  4ZUI A;  2K28 A;  2F0S A;  3T1Y L;  1YNX A;  2KHS A;  2Q2H A;  1O7I A;  3S2H H;  2XGT A;  1EIY B;  2Q8T A;  3A8J E;  1STH A;  3IAY A;  2KEC A;  3CCR A;  1PH4 A;  1W6J A;  4IN3 A;  5TSS A;  4LFB L;  5IGD A;  2ZTD A;  2A68 D;  4DK1 A;  2F52 A;  3UDF A;  3KLR A;  4KN4 C;  1OXX K;  4I65 A;  4CGY B;  4K5X A;  5GAE C;  2F0V A;  1JE5 A;  2K5D A;  3OOC A;  3ER0 A;  1S5B D;  1JT8 A;  1VQN A;  1KAB A;  2ZTE A;  3ULJ A;  1GUT A;  1Y14 B;  4CKC A;  3M7G A;  4B08 A;  3F8T A;  2AQ1 B;  5CV5 A;  5IYC G;  5GAH C;  2F0Q A;  3CPF A;  4A3B B;  1C4Q A;  1I3Q H;  2K52 A;  1LTT D;  1SE3 A;  3KYH C;  5C44 H;  4J8Q A;  5BR8 Q;  3EFX D;  4KKU A;  2KUM A;  1IYU A;  2EQS A;  2F3W A;  2F3I A;  3JC6 6;  2EDG A;  4KHZ A;  2B2U C;  2N88 A;  1RTO A;  2FXQ A;  5M3M G;  3P75 A;  1PFS A;  4LFB Q;  2N55 A;  5ELF A;  2LY7 A;  3R3O A;  2NVY B;  4GS3 A;  2UXD L;  4UHV A;  4GOP C;  1X3E A;  3L3O C;  3K5L A;  4FXK C;  4X6A H;  4B9W A;  3CQZ B;  3J81 E;  4HIO A;  2V4D A;  3S1Q H;  3BZK A;  1VQG A;  4XT3 B;  2DNE A;  1H9K A;  2CFM A;  4IQZ A;  4DK6 C;  2A74 C;  4A3G G;  5JAV A;  4JBW A;  1LT6 D;  3ERS X;  1EQR A;  3PUW A;  2UUA Q;  4FF3 A;  2F3V A;  4NXM L;  1I4P A;  3MXU A;  1VCI A;  3G6J B;  5IT9 L;  4G4K A;  4G7H C;  4OO1 I;  1DOK A;  4GN5 A;  2R92 B;  3D6W A;  1I94 Q;  4DR1 L;  1Q1E A;  3KJP A;  3PUX A;  3GV3 A;  3C46 A;  1SJH D;  3FRP B;  3H3V I;  5JJZ A;  3HFZ B;  3MXG A;  1X3P A;  3T16 A;  1WTW A;  1N34 Q;  3K7A H;  1HNX L;  5FLX L;  1Z7T A;  3PF4 A;  4ZRZ A;  3DEO A;  5IP7 G;  3ERQ A;  1M90 C;  3ND9 A;  3HOV G;  3PCO B;  1KXL A;  1T5E A;  3S24 A;  2IJ0 A;  1HTP A;  5CGK A;  1EY0 A;  2A6H C;  3DM3 A;  4DR5 Q;  5KIX A;  2LMC B;  3NPP A;  1QVC A;  4DV6 Q;  2RA4 A;  2VUM B;  1VQA A;  2DGY A;  2F0L A;  2E74 C;  1SND A;  3NHH A;  4DK3 C;  1JJG A;  2ICI A;  5E1F A;  1CFM A;  5E4W C;  1H9M A;  4A3K G;  3HZX A;  4DV2 L;  4XTC S;  4A3G B;  3G7L A;  4FVM A;  2JA6 G;  5JJI A;  3UE0 A;  1VMP A;  1SMY C;  4IUT A;  3W1G A;  3HOY H;  3D6C A;  2KEE A;  5A2Q E;  2PMZ E;  1XWE A;  4HSV A;  1GO3 E;  1PH9 A;  3KDF A;  4FF2 A;  3PUZ A;  4A3D G;  2L1B A;  2WP8 J;  3KF8 A;  2RDG A;  3PQI A;  3WOE A;  1S40 A;  2XRQ D;  1U5K A;  2PW5 A;  4L5T A;  1A2T A;  2F4I A;  5LL6 S;  1SRO A;  1MJE A;  1GOZ A;  1TWH B;  2B2Y C;  4V0B A;  1J5E Q;  4JYA Q;  3ONA B;  2MJ8 A;  1QZG A;  2K04 A;  4G7Z C;  1B7Y B;  1ZXT A;  2ENB A;  4QQB X;  4UAI A;  1VQ8 A;  3H3V H;  4LF5 Q;  1SBB B;  1JJ2 A;  2UXB Q;  1KL9 A;  2BA0 A;  3DUZ A;  1P16 A;  2VY3 A;  1TU2 B;  3GTP B;  5FK9 C;  4GZY C;  3OHX C;  5HGT A;  1Q7Y C;  4X66 Q;  1JE4 A;  3HS0 C;  1BBX C;  2QF7 A;  2IL8 A;  1IW7 C;  3NXW A;  5CV7 A;  1AFP A;  3J7A V;  3BYT B;  1QJO A;  2HCI A;  4BS9 A;  1A2U A;  3KLS A;  1OXT A;  4QF4 A;  1O7L A;  2XNA C;  4HCS A;  4RWS C;  2MPM A;  2SNM A;  4RGM A;  3TEH B;  4DR1 Q;  1PHJ A;  1OXS C;  2F0M A;  1EY9 A;  5BN5 A;  4LF6 Q;  3NTI A;  4V19 0;  1D5X C;  4L8J A;  3QR8 A;  2MGS A;  2C35 B;  4A3D B;  2HHH L;  3VR4 A;  4BY1 G;  2K5W A;  4A3D H;  1N8R C;  1G91 A;  4RH6 A;  2GA4 B;  1Z47 A;  4KMU C;  1X56 A;  2R93 H;  3MVV A;  1G6Z A;  3OMG A;  3TS0 A;  2NVY H;  3T13 A;  4K0K Q;  3I55 A;  4BY1 H;  2ZJR A;  1GD7 A;  4EQN A;  1L1O B;  2KA7 A;  3A56 A;  4N8F A;  4GKK Q;  2K03 A;  1JWU D;  1NMF A;  1QE6 A;  5C3E H;  1HR0 L;  3MHB A;  4C3J G;  2XIW A;  4AYB B;  1BCP C;  2YU9 H;  1Y8P B;  4XYQ A;  4B3T L;  3OIQ A;  2A6H D;  1S5D D;  2IX0 A;  2KCC A;  1PYB A;  2K50 A;  1WVL A;  1HNX Q;  1HNW Q;  3GTJ H;  1VF7 A;  1PTO B;  4ABN A;  1YJ9 A;  2L12 A;  5C4J B;  1E1T A;  3L9A X;  1QUQ B;  1D1I A;  1LV9 A;  3HOV H;  5CR3 A;  5M5W B;  4KJO A;  1U4R A;  4XDX A;  1HUM A;  3D0F A;  3I91 A;  3VYR A;  4IJL A;  1Q46 A;  2B2T A;  4OL7 A;  4JI2 Q;  3J81 i;  3A74 A;  4ZCK A;  1ILP A;  2LXK A;  4IPD A;  2E5L L;  5C5L A;  3J7Z C;  1X55 A;  3BG3 A;  3B6Y A;  2Y0S B;  1MKH A;  4OIK A;  4CJ1 B;  1KLG D;  1ASZ A;  1GHJ A;  2DUD A;  1SNM A;  1DOL A;  5LMN Q;  4DR2 Q;  5FO7 B;  4OGQ C;  1YBY A;  1DM0 B;  1WTP A;  1XNQ Q;  4BA2 I;  3SEB A;  4KHP Q;  1NMG A;  4DV6 L;  3S2D H;  4DAM A;  2NYZ D;  4LFC Q;  2R92 H;  1KTK A;  2QEJ C;  2RDH A;  2HIX A;  1ILQ A;  5ELC A;  4MHE A;  1PYW D;  4ILW A;  4MNO A;  3NP8 A;  4A3M H;  1SE2 A;  1XX8 A;  3K58 A;  3GD7 A;  2NVX H;  5JOB A;  2VQF Q;  5K5P A;  1R9T H;  1FD7 D;  1A3U A;  1UUP A;  1AZQ A;  4DV2 Q;  3OIP A;  2BOS A;  2JA7 B;  5DEH A;  1OXV A;  3K7A B;  4JI8 Q;  4JW0 A;  1RL2 A;  3WWV A;  1TWG H;  3I90 A;  4P74 A;  1E2W A;  2PZW A;  1KDA A;  2F4V Q;  4A3I H;  2BCO A;  3U4Z A;  3K0X A;  3JAM c;  4DV4 Q;  4DFA A;  2Y0S G;  3HEJ A;  5IP7 H;  1SYC A;  5L37 A;  1WFQ A;  2E2H H;  4BBS H;  4LFC L;  4WOR A;  3JAM L;  1SXT A;  5CV8 A;  1O7Z A;  4N8X 1;  3HOX G;  4A3L H;  5C4H A;  1WTH A;  1HNZ Q;  4HAE A;  5I4D A;  3HOZ H;  3TS2 A;  2JA8 B;  1AEX A;  2MHV A;  4X3T A;  1HHV A;  1C8C A;  1HZC A;  2A6E D;  5IIF A;  5DNF A;  1EYG A;  3KF6 A;  2E2H B;  5C4X G;  1VQM A;  1LTG D;  1EQQ A;  5BN4 A;  4KHV A;  2R93 G;  1SRU A;  2UU9 L;  4DU9 A;  3JAM E;  3J80 L;  2EYM A;  1DXM A;  4PV1 C;  4HCE A;  4GNX C;  5JJK A;  4A3C G;  4NXN L;  1II3 A;  1IXR A;  1RCV D;  2JJQ A;  1TS4 A;  2K5V A;  1X9N A;  1STE A;  2EIF A;  4RG1 A;  3CD6 A;  4IFD J;  3F2B A;  4QGU A;  1TVX A;  3VA5 A;  4CBV A;  1TY0 A;  4G57 A;  1H9S B;  2O5I C;  1PRT D;  1Q81 C;  2K5N A;  1D5Z C;  4X64 L;  1XTC D;  3MTS A;  5LMU Q;  4KV6 A;  1HA6 A;  4X62 Q;  3SK5 A;  1DGS A;  3CW2 C;  4I7A A;  1WCM G;  3OPO A;  1STA A;  5FO8 B;  4IUR A;  4CHT B;  4F88 A;  1Y69 U;  1PXU A;  1AP0 A;  4UP8 A;  3I4M B;  4C3H G;  1QNU A;  1CK1 A;  4K2L A;  3SGI A;  2LS0 1;  4Z9C B;  1X3Q A;  4DUY Q;  4JI2 L;  1JC7 A;  3TRZ A;  1U9R A;  2EY1 A;  2KQ3 A;  1I50 H;  3CRL C;  3F1Z A;  4JOI C;  5IY0 A;  2DY7 A;  4YWL A;  2RCF A;  2JEA I;  2VZA A;  2JN4 A;  3FKI G;  1B4O A;  3CQZ H;  4DPG A;  3DWQ A;  2RHQ B;  3GDE A;  1JOO A;  3GP7 A;  1N36 L;  2GVB A;  2SOB A;  5CC4 A;  1MSH A;  2MFI A;  5IWA Q;  2B63 G;  4PNY A;  2NVT H;  2OQK A;  4QUC A;  1BOS A;  2A69 D;  3MWY W;  4HMI A;  4HJA A;  2I0Q A;  4K8J A;  4FXG C;  2B2W A;  1Y1W G;  3H15 A;  4IZ8 A;  4A3F B;  4JI0 L;  4YWK A;  4OWT B;  1EQV A;  5C3E B;  3GTL H;  4A3C H;  2KHI A;  4WJ4 A;  3D31 A;  4RGN A;  5CV4 A;  2FJ2 A;  3H09 A;  3PO2 B;  2JK8 A;  5KEE A;  3Q23 A;  2R7Z H;  4LNQ A;  5FLM H;  1JWS D;  3HOU H;  5IGC A;  4DV0 L;  1YNN D;  4XQQ A;  1N36 Q;  1SE8 A;  1S5F D;  1OXU A;  2JEB I;  2R61 A;  2VB2 X;  3CF5 A;  2EE1 A;  3PO3 G;  3D4W A;  3SE0 A;  1HFG A;  1PH3 A;  4FP5 D;  4LFA Q;  1FNW A;  1IYJ B;  2F0E A;  2OF1 A;  2A69 C;  1X3G A;  4ZKC B;  1BVS A;  1RTN A;  4IUV A;  3Q6S A;  3GTO H;  1TWG B;  1VQE A;  2L9H A;  4RCN A;  4JI8 L;  3ULL A;  3W1B A;  3I4N B;  2L55 A;  2N78 A;  2ZXR A;  3SK4 A;  5T1G A;  2CH4 W;  4R4C A;  4DAV A;  3M85 A;  2E2D C;  3KFU A;  3C1F A;  3GV6 A;  2B2V C;  5CBE E;  1LM0 A;  2KEN A;  1Y1V H;  2LFN A;  1FNV A;  3H0G B;  3K81 C;  2ALY B;  1B3A A;  3PIO A;  1Y1W B;  1CHQ D;  4A3F G;  3M4O H;  3OWE B;  4B3M L;  4FF1 A;  2Z6K A;  1ASY A;  2JA9 A;  3NSW A;  3CC7 A;  1HR0 Q;  3OWF A;  1A3V A;  2EY5 A;  4IPG A;  1YI2 A;  1KQS A;  1M8A A;  2Z8L A;  2R7F A;  1HFN A;  1EFW A;  2HDL A;  2B63 H;  2CQA A;  5D3D A;  1B70 B;  1L2F A;  2EPB A;  1GKH A;  1VQC A;  3R8B A;  3NBI A;  5GAD C;  2R92 G;  3OTO L;  1EYD A;  2BA1 A;  2ZTC A;  3S1Q B;  5BR8 L;  2CWA A;  3QB3 A;  2WAQ E;  2K75 A;  4LW1 A;  1K9M C;  1I5F A;  4MIU A;  1TS5 A;  4DGZ A;  3C1E A;  3CPW A;  4HJ8 A;  5C44 G;  1SMX A;  3TZD A;  1Q90 A;  3EIV A;  2F0D A;  4BBS B;  5H1S E;  4AQY Q;  1TWC B;  1EIF A;  2D5D A;  4DA2 A;  4PG3 A;  2Z1C A;  2PNH A;  2K05 A;  5M3F G;  5A2Q L;  4PMW A;  2BDO A;  3H0G G;  1YNJ C;  1IBL Q;  1CQF A;  4FXD A;  3M4Y A;  5FLX c;  1ONL A;  2NN6 G;  4AQY L;  1SNP A;  5C4Z A;  3RN2 A;  1XPO A;  2E5L Q;  4HMJ A;  3CU7 A;  1TWF B;  3S1M H;  1TXY A;  3BU2 A;  2EY2 A;  4QMG A;  5IGE A;  2AQ2 B;  2I5M X;  1SJE D;  4X3S A;  5M3F H;  5LHY 1;  4DUZ Q;  3S14 H;  1V9P A;  3I70 A;  3F2C A;  1ROD A;  1K0S A;  5C6A A;  3S16 B;  1TR5 A;  3GTK B;  3S15 B;  5LMN L;  2NTT A;  3MEF A;  1L0Y B;  1LAC A;  2AMC B;  1PTO C;  2I5H A;  4DR3 L;  4M1U B;  1E0B A;  4DR6 Q;  3GTG H;  4LF7 L;  1QG7 A;  4U67 3;  4HIK A;  1HZA A;  1IHZ A;  3S1R B;  4NMZ A;  4NDX A;  1JQY D;  5LMN W;  2KCM A;  2J0T D;  4A3B H;  4XIG S;  5DAU A;  1LTB D;  5JEA J;  4FDB A;  4QIW E;  1NUC A;  5D14 A;  5KND A;  1WTO A;  1YNN C;  4DV3 Q;  3HKZ E;  1I4H A;  3FKI H;  4IUQ A;  4CDD C;  2AQ3 B;  3V96 A;  1D8L A;  1JOQ A;  4L63 B;  5JVG 3;  4KN7 C;  3EA6 A;  1H9J A;  4DV4 L;  1S3O A;  2KBN A;  3K0Y A;  1AN8 A;  3PIO 3;  4KY5 A;  5KGU A;  4YCV A;  3HOU B;  2PNR C;  1OTC A;  1DZ1 A;  1K3B C;  4QY7 A;  2ATW A;  3BJU A;  1SEB D;  2XVS A;  5CV9 A;  4B3S Q;  3OTO Q;  3J81 L;  1IBK Q;  2GVA A;  2R3Z A;  3NBH A;  1HNZ L;  3SDZ A;  4OHJ A;  2C9O A;  3PUY A;  4PQX A;  3CCS A;  4L5S A;  5EQ0 A;  4BBR G;  3G6E A;  4LFA L;  3Q22 A;  1L1O A;  5COR A;  1QZH A;  3VA7 A;  1F9R A;  4EVO A;  1JCK B;  3DXJ C;  1BR9 A;  2AKW B;  4RKL A;  2VW9 A;  3N52 A;  4BY7 H;  4NKL A;  4IUP A;  4ZK9 B;  3CCE A;  3VR2 A;  2A1A A;  1XXG A;  4HTH A;  2E2I B;  1ICF B;  1DCZ A;  3A7L A;  2XRS D;  3CCV A;  1Q1B A;  4LF9 L;  1I4G A;  4FNF A;  4C3I H;  4UP7 A;  2I07 B;  2YTY A;  4A3E H;  2CVR A;  5IP9 H;  1WYD A;  1B3Q A;  2K5Q A;  2JQO A;  1F2L A;  4A93 G;  1UE5 A;  5FKA C;  4LF9 Q;  4YIJ A;  3LGJ A;  2BE5 C;  3NTK A;  4ZYS A;  4TRD A;  2IT1 A;  2FMC A;  1GHK A;  4LF8 Q;  1BCP F;  4RAU C;  4PMC A;  1V1P B;  2FMM A;  1HR0 W;  3NEM A;  4YHH Q;  1NSN S;  4O1N A;  3PIP A;  1VQ5 A;  5J3B A;  3PUV A;  2CWP A;  1HRJ A;  1B8A A;  2G9H D;  1D2B A;  2L5T A;  1QOH A;  4DK0 A;  2DNC A;  3C3L A;  1N32 Q;  2HT1 A;  1LTA D;  2ES2 A;  3GTQ H;  2ZJQ A;  4K0K L;  1ICW A;  1PH8 A;  2HIV A;  2OXP A;  2F0T A;  3K5O A;  3JAM i;  2QA4 A;  3MFY A;  3A55 A;  1F2Y A;  1EZ8 A;  1SDF A;  2EVB A;  3HG9 A;  4JBJ A;  1XTD A;  1L0W A;  4K14 A;  4ALP A;  1MD2 D;  1GUW A;  3CAM A;  1TWH H;  5C0X G;  4BXX G;  1LUZ A;  2B2T C;  4A3J H;  4B3R Q;  1EY5 A;  2WAC A;  5E7N A;  2HQE A;  4OXP A;  3IFD A;  4P2C B;  1K73 C;  4R4T A;  1I6H H;  1U4L A;  5IOC A;  2DJG C;  2EXZ A;  3J80 i;  2RVL A;  3I4O A;  1TKW B;  3UI2 A;  5HGQ A;  4QJF A;  3CMA A;  2XWB B;  3FDT A;  2NZH A;  2IX3 A;  3ERO A;  1IL2 A;  3KLS X;  2B8F A;  1PMR A;  2KJX A;  3OMC A;  4DR5 L;  2PO4 A;  1NJI C;  1K28 A; 
#chains in the Genus database with same CATH homology
 1JOK A;  1PFM A;  1ET6 A;  5COY A;  4K8I A;  1G29 1;  5EKL A;  3P7J A;  1EIG A;  2L0C A;  4LK1 C;  3HOW B;  2FHT A;  4DAY A;  1I6V C;  5I2X A;  1G2T A;  3H6M A;  1LTS D;  2IWH A;  2RSN A;  3K59 A;  1QCB D;  2WII B;  2WIN B;  2SEB D;  3F2U A;  1Q3L A;  3X3M A;  4LJZ C;  4R8I A;  4PMB A;  3MC0 B;  3HRZ C;  1GJX A;  5KNC A;  3NQI A;  4ME5 A;  1E2V A;  2SDF A;  5CYU A;  2K1B A;  1LTI D;  3GQB A;  2X69 A;  1J9O A;  2H1E A;  3I73 A;  3DWP A;  3X3N A;  2HCC A;  3N6R A;  1EY6 A;  1ZKO A;  3NK9 A;  4H13 C;  5IGB A;  1SE4 A;  3S2H B;  4QIW B;  1JR0 D;  4A3E B;  1QB5 D;  2R93 B;  4DF7 A;  4R9W A;  3S9W A;  4ODG A;  1PLF A;  4BY7 B;  3BS1 A;  5EKI A;  4TQU S;  3RD4 A;  4HN7 A;  3J80 E;  4E6I A;  3A8K E;  2QIL A;  2O2L D;  1UAP A;  4HSP A;  4IUN A;  2PMZ B;  3DHQ A;  4MN3 A;  5G3L D;  1U4M A;  1RDP D;  2F0G A;  1ZEQ X;  3SXH A;  1XYI A;  2B63 B;  1R9T B;  1RKN A;  5EPK A;  1SAP A;  3K5N A;  1Y1V B;  1FNU A;  2F0F A;  4CKE A;  4R8N A;  3PV0 A;  5I6W A;  2QKI C;  1TS3 A;  3BDO A;  2WB1 B;  1KAA A;  4KY6 A;  1V8Q A;  1PRT B;  2OT2 A;  4CJ2 C;  3FPU B;  2JP1 A;  1CZG A;  5F2D A;  5J22 A;  4OIJ A;  3VYT A;  4ZKB B;  2KED A;  2K6A A;  1LLR D;  5KRU A;  2D2C C;  1U4P A;  1M4V A;  2L11 A;  5IGF A;  5KYL A;  3PO3 B;  5C3X A;  1NAP A;  1WD1 A;  1AZP A;  3I72 A;  1CQV A;  3U9S A;  1SYB A;  3T56 B;  2NTS A;  1TS2 A;  3HOV B;  3KBG A;  3PMF A;  4X3K A;  2NVX B;  1VMC A;  2VXW A;  3GTL B;  4XYO A;  3E5S A;  1OO9 B;  2JE6 I;  5ELB A;  1BF4 A;  1D5M C;  3H3V C;  2K33 A;  5D3I B;  2EYL A;  3W2D A;  3U9O A;  1BNZ A;  1QWY A;  3S1N B;  3EVQ A;  5EPJ A;  3CHB D;  2F1M A;  2MP1 A;  4BA1 I;  1KLU D;  1LT5 D;  3O13 A;  5A35 A;  5JEA H;  1BCP D;  2C5C A;  2F0J A;  1EYA A;  2J4X A;  1EOT A;  4KI0 A;  2B2V A;  1EL0 A;  4WJW A;  1EEI D;  1VDZ A;  2RKS A;  2DN8 A;  5KNB A;  1Q8I A;  2HUG A;  1GXD C;  1EY8 A;  1I50 B;  1PDQ A;  2ICE C;  3NUC A;  2RQX A;  1TII D;  4IFD G;  2E76 C;  3PIP 3;  3NTH A;  1STG A;  1PFB A;  1QNK A;  1CA5 A;  1SYG A;  3RZD B;  1T5X D;  3P20 A;  3HOY B;  1EU3 A;  1LAB A;  2NVT B;  1I4X A;  3NQT A;  1IW7 D;  4Y7N B;  3NWS A;  3QOL A;  1GUO A;  4KKT A;  1F9S A;  1NR4 A;  4NP5 A;  4C1N I;  4C3I B;  1EWC A;  3K57 A;  1J8I A;  2JSO A;  1TY2 A;  1RF2 D;  5DM6 3;  1HUN A;  5M3F B;  2E75 C;  2EYH A;  1RHP A;  5FO9 B;  4RCO A;  1PTO F;  5EPL A;  5I9O A;  1IL8 A;  1KNA A;  3SK6 A;  4EQO A;  1A6X A;  5T1I A;  3URY A;  5IOD A;  3VR6 A;  2QCP X;  2KVM A;  1Q12 A;  4C1N K;  1CT1 D;  1DJR D;  1CA6 A;  3VR5 A;  4TSS A;  4X3U A;  4IFD I;  4BY1 B;  3TP8 A;  1IKL A;  5JPM C;  1GUS A;  2XWJ B;  4FO2 A;  5K36 G;  1SYD A;  1KDB A;  5DM7 3;  4RFB A;  3KBX A;  3Q24 A;  4KTA A;  5AFW A;  1F9P A;  4KKS A;  3M3Y B;  2F0P A;  4A3J B;  3GTQ B;  4NW2 A;  5EBD A;  5JPN C;  1A15 A;  4I7Z C;  1SYF A;  1V1O A;  2YYZ A;  3BVG A;  2JA5 B;  3SHL A;  5E3F A;  4OO1 G;  2YU9 B;  1V43 A;  1LTR D;  1CTM A;  1SMY D;  2AWN A;  5E4X A;  3RZO B;  4QB4 A;  1ET9 A;  2O5J C;  3DWA A;  1E2Z A;  2B2Y A;  4KJN A;  4LMQ D;  1H9R A;  2F0K A;  3SVM A;  5C5M A;  3K6O A;  1LO5 D;  3MEH A;  5FLX E;  3QJY A;  2PPB C;  1ESR A;  4WRD A;  4BBR B;  4DNT B;  5EBC A;  3GTM B;  4FF4 A;  5NUC A;  4H7B A;  5IT9 E;  1D6E C;  2I46 A;  4DXG A;  3CKI B;  3RLF A;  4DAP A;  3H94 A;  4IAL A;  1KNE A;  3RMH A;  3KK7 A;  2X6L A;  5C0X J;  2B8G A;  1DYQ A;  3GO5 A;  2D62 A;  4OO1 H;  3QO2 A;  3HOX B;  4A3I B;  5JEA G;  3GTG B;  1F2M A;  1JIC A;  4J6H A;  2A73 B;  1UEA B;  2EJF C;  4M8A A;  2X6G A;  3I8Z A;  1L0X B;  2Q8R E;  4U68 A;  5IGG A;  1W6K A;  1NCV A;  3OSO A;  1DON A;  1KDC A;  2A68 C;  3RUZ A;  1D1K A;  2IX1 A;  4DN4 M;  1MBY A;  1MSG A;  3T4A C;  3MXN A;  1UNS A;  3NE5 B;  5I9P A;  3IL8 A;  1O78 A;  3MFG A;  4N9T A;  3TBI B;  4H44 C;  4DNR B;  1I6H B;  2MUY A;  1GUG A;  4EGV A;  5M5Y B;  2BE5 D;  4HR7 B;  2VNU D;  4O42 A;  2BDN A;  3TP7 A;  5C4X B;  4C3H B;  4ID6 A;  1H9S A;  3QOJ A;  4QCL A;  4K5V A;  2ZXP A;  3S1M B;  3D3R A;  4CJ0 B;  2NN6 I;  1TT2 A;  2NWG A;  3S14 B;  2CHB D;  3TN2 A;  1Z6H A;  2IW3 A;  4K6L A;  3FKI B;  3LNN A;  1SSO A;  1SNQ A;  1STB A;  4L6T B;  2Z4I A;  1X32 A;  4IUU A;  5EJW A;  1ML0 D;  2EYP A;  3KUP A;  2B2U A;  4RHR A;  1S5C D;  2EJM A;  3HGB A;  1DOM A;  3C2P A;  2WV6 D;  3EQL C;  3TME A;  1B9M A;  1RJT A;  4RKB A;  1TWA B;  1WD0 A;  1EQT A;  1B53 A;  4XXE A;  2NN6 H;  3AB9 A;  1STN A;  5KYI A;  3R2T A;  2F0N A;  2O4X A;  1F9Q A;  1S5E D;  3J7A F;  4RHS A;  2PZU A;  5J39 A;  3VYU A;  3H91 A;  3GTO B;  1F77 A;  4B9X A;  5I6Y A;  1HPC A;  3LWU A;  4F87 A;  1PTO D;  3FPP A;  4WFN 3;  4G7O C;  3SR1 A;  3FEW X;  4CKB A;  5CBA E;  1HXY D;  1G2S A;  2NBF A;  4ZUJ A;  4C2M B;  3ITP A;  2R6G A;  2R7Z B;  3OW7 A;  5C0X I;  2LKV A;  2JXM B;  3DEP A;  5M5X B;  1STY A;  2WAQ B;  2A5H A;  1ENF A;  2JA6 B;  1TQO A;  2FFK B;  3M4O B;  1WTV A;  1FYC A;  2XSC A;  1JWM D;  4IFD H;  4H0L C;  2B39 A;  5I2Y A;  1SYE A;  2AUK A;  3I3C A;  1PTO H;  3VR3 A;  1HCZ A;  5C44 B;  2RDF A;  1EY4 A;  1Y8N B;  2ZXO A;  3CRK C;  3TZU A;  4A3K B;  2XN9 C;  1O7Y A;  2DY8 A;  1MI2 A;  1LT3 D;  4C56 C;  1PZI D;  1PRT C;  1BCP B;  3D4R A;  1WTQ A;  3R2I A;  4UDU C;  3AU7 A;  3K5M A;  3BDL A;  2B2W C;  2F03 A;  3HOZ B;  3AMU A;  1SNO A;  1HQR D;  1WTR A;  2EOT A;  2A6E C;  4S3S A;  3ZYY X;  1IYV A;  2PYK A;  4N9P A;  2EYO A;  2M9V A;  4BWG B;  1PRT F;  2M00 A;  4LAA A;  1EY7 A;  2F0O A;  1CHP D;  1I4Q A;  1PZK D;  5CMD A;  3V2T A;  1PZJ D;  4JK1 C;  2EYJ A;  3TDQ A;  3E6Z X;  1C48 A;  4EQP A;  4ZLT F;  4K6D A;  3LWE A;  1G8Z D;  3FMC A;  1DD2 A;  4RA8 A;  1ESF A;  4KD3 A;  1B50 A;  4C3J B;  1EFI D;  5C3W A;  2Q8I B;  3IFT A;  3LX0 A;  2ID0 A;  4KD4 A;  2IPK D;  2KOL A;  3TSS A;  3QIA A;  4QUF A;  1EWH A;  2AUJ D;  1S4Z A;  3NWT A;  2K32 A;  1B1Z A;  4ULL A;  5G3L F;  3I4L A;  2NUC A;  4Q5V A;  3E0J A;  1B44 D;  1EEF D;  1WTX A;  5BN3 A;  1RD9 D;  1R4Q B;  3FVQ A;  1BO0 A;  3HKZ B;  2JYO A;  2TMP A;  2WKD A;  1HQM C;  1YNJ D;  2Z4H A;  4XQJ A;  4K5W A;  1O80 A;  5K36 H;  5HUR A;  4A93 B;  4K2K A;  5FOB B;  1I3Q B;  3IKJ A;  3QG1 A;  2H4O A;  4F7X A;  4C3I G;  1V1P A;  3S2D B;  2QDB A;  1PFN A;  3J7Y W;  4HED A;  1K8O A;  3A7A B;  3WDN A;  2OEO A;  1B9N A;  1B2T A;  3A8I E;  4RGO S;  3HP3 A;  3R93 A;  3T53 B;  4RGT A;  1AW7 A;  5ISR A;  2F0W A;  3BVM A;  2EJG C;  5EKK A;  3W3A A;  2PCF B;  3QWN A;  3MA2 B;  2FIN B;  2G9D A;  2F0I A;  1JOR A;  2F0H A;  2KCN A;  1A3T A;  2AWO A;  1ENC A;  2EY6 A;  3P1H A;  3DMU A;  1EIH A;  1ZYR C;  5J1Z A;  1EU4 A;  1Y8O B;  3GTJ B;  3MZ5 A;  4J1M A;  2PZT A;  5C0X H;  3BVZ A;  2SNS A;  2NZ1 D;  2D9U A;  5D65 A;  2F0U A;  5ELD A;  3BZD B;  1I4R A;  1GUN A;  3WOF A;  1SNC A;  3Q0A A;  1MGS A;  4FYD A;  3L7Z C;  3EJI A;  1EYC A;  1FGB D;  4F8M A;  4XQN A;  2CW0 C;  3VYS A;  4KY7 A;  1WCM B;  2NVQ B;  3BYY B;  3D8G A;  1FR3 A;  5CV6 A;  3TP5 A;  1BDO A;  1HA5 A;  4XT1 B;  1ENA A;  3MXP A;  5JVH 3;  4A3M B;  2WKC A;  1EZ6 A;  1HTL D;  1CZW A;  3D4D A;  2RSO A;  2RBM A;  1NR2 A;  2J7Z A;  2CW0 D;  2HDM A;  2EYF A;  1LT4 D;  2PW7 A;  2E2J B;  4ZAI A;  3ND8 A;  4KK7 A;  3SK8 A;  1SFO B;  1VF5 C;  4TKO B;  2ZT9 C;  1BXT A;  1BUV T;  1BQQ T;  4Q0F A;  2K7V A;  5M9O A;  1ZYR D;  3V05 A;  2L4N A;  4ZQ3 A;  2PQE A;  5LL6 X;  3DM1 A;  1JB3 A;  3TP6 A;  2K01 A;  3M7N A;  1IKM A;  5EGT A;  3BDC A;  3S17 B;  4DXF A;  2M2L A;  2VB3 X;  3MAQ A;  1QIL A;  1CI3 M;  3T51 B;  5ELE A;  2NB0 A;  1R4P B;  2EZV A;  1K83 B;  1F2Z A;  5M3M B;  1K8M A;  2TSS A;  3A54 A;  1CM9 A;  4ZUI A;  2K28 A;  2F0S A;  2KHS A;  2Q8T A;  3A8J E;  1STH A;  3IAY A;  2KEC A;  1W6J A;  4IN3 A;  5TSS A;  5IGD A;  2A68 D;  4DK1 A;  3KLR A;  4KN4 C;  1OXX K;  4I65 A;  4CGY B;  4K5X A;  2F0V A;  2K5D A;  3OOC A;  1S5B D;  1KAB A;  1GUT A;  4CKC A;  3M7G A;  4B08 A;  2AQ1 B;  5CV5 A;  2F0Q A;  4A3B B;  1C4Q A;  1LTT D;  1SE3 A;  4J8Q A;  3EFX D;  4KKU A;  2KUM A;  1IYU A;  2F3W A;  2EDG A;  4KHZ A;  2B2U C;  2N88 A;  1RTO A;  3P75 A;  2N55 A;  5ELF A;  2LY7 A;  3R3O A;  2NVY B;  3L3O C;  3K5L A;  4FXK C;  4B9W A;  3CQZ B;  3J81 E;  2V4D A;  4XT3 B;  2DNE A;  1H9K A;  4IQZ A;  2A74 C;  5JAV A;  4JBW A;  1LT6 D;  3PUW A;  4FF3 A;  2F3V A;  1I4P A;  4G7H C;  3G6J B;  1VCI A;  3MXU A;  4G4K A;  5IT9 L;  4OO1 I;  1DOK A;  2R92 B;  3D6W A;  1Q1E A;  3PUX A;  3GV3 A;  3C46 A;  1SJH D;  3FRP B;  5JJZ A;  3MXG A;  1X3P A;  3T16 A;  1WTW A;  5FLX L;  1Z7T A;  4ZRZ A;  3DEO A;  3ERQ A;  3ND9 A;  1T5E A;  2IJ0 A;  1HTP A;  5CGK A;  1EY0 A;  2A6H C;  5KIX A;  2LMC B;  3NPP A;  2RA4 A;  2VUM B;  2F0L A;  2E74 C;  1SND A;  3NHH A;  2ICI A;  5E1F A;  1CFM A;  5E4W C;  1H9M A;  3HZX A;  4XTC S;  4A3G B;  3G7L A;  4FVM A;  1VMP A;  1SMY C;  4IUT A;  3D6C A;  2KEE A;  5A2Q E;  1XWE A;  4HSV A;  4FF2 A;  3PUZ A;  2L1B A;  2WP8 J;  3KF8 A;  2RDG A;  3WOE A;  2XRQ D;  2PW5 A;  5LL6 S;  1A2T A;  2F4I A;  1GOZ A;  1TWH B;  2B2Y C;  4V0B A;  3ONA B;  2MJ8 A;  2K04 A;  4G7Z C;  2ENB A;  1ZXT A;  4UAI A;  1SBB B;  3DUZ A;  2BA0 A;  3GTP B;  1TU2 B;  4GZY C;  5FK9 C;  3OHX C;  5HGT A;  1JE4 A;  3HS0 C;  1BBX C;  2QF7 A;  2IL8 A;  1IW7 C;  3NXW A;  5CV7 A;  1AFP A;  3J7A V;  3BYT B;  1QJO A;  2HCI A;  4BS9 A;  1A2U A;  3KLS A;  1OXT A;  4QF4 A;  1O7L A;  2XNA C;  4HCS A;  4RWS C;  2MPM A;  2SNM A;  4RGM A;  1OXS C;  2F0M A;  1EY9 A;  5BN5 A;  3NTI A;  4V19 0;  1D5X C;  4L8J A;  2MGS A;  4A3D B;  3VR4 A;  2K5W A;  1G91 A;  4RH6 A;  2GA4 B;  1Z47 A;  4KMU C;  3MVV A;  1G6Z A;  3OMG A;  3T13 A;  4EQN A;  2KA7 A;  3A56 A;  2K03 A;  1JWU D;  1QE6 A;  3MHB A;  4C3J G;  2XIW A;  4AYB B;  1BCP C;  1Y8P B;  4XYQ A;  3OIQ A;  2A6H D;  1S5D D;  2IX0 A;  2KCC A;  1WVL A;  1VF7 A;  1PTO B;  4ABN A;  2L12 A;  5C4J B;  3L9A X;  1D1I A;  1LV9 A;  5CR3 A;  5M5W B;  4KJO A;  1U4R A;  4XDX A;  1HUM A;  3I91 A;  3VYR A;  2B2T A;  4OL7 A;  1ILP A;  5C5L A;  3BG3 A;  2Y0S B;  4OIK A;  4CJ1 B;  1KLG D;  1GHJ A;  1SNM A;  1DOL A;  5FO7 B;  4OGQ C;  1WTP A;  1DM0 B;  4BA2 I;  3SEB A;  2NYZ D;  1KTK A;  2QEJ C;  2RDH A;  5ELC A;  1ILQ A;  4MHE A;  1PYW D;  4ILW A;  3NP8 A;  1SE2 A;  1XX8 A;  3K58 A;  3GD7 A;  5JOB A;  5K5P A;  1FD7 D;  1A3U A;  1UUP A;  1AZQ A;  3OIP A;  2BOS A;  2JA7 B;  5DEH A;  1OXV A;  3K7A B;  3I90 A;  1E2W A;  2PZW A;  1KDA A;  2BCO A;  4DFA A;  3HEJ A;  1SYC A;  4WOR A;  3JAM L;  1SXT A;  5CV8 A;  1O7Z A;  5C4H A;  4HAE A;  5I4D A;  2JA8 B;  1AEX A;  2MHV A;  4X3T A;  1HHV A;  1C8C A;  2A6E D;  5IIF A;  5DNF A;  2E2H B;  1LTG D;  5BN4 A;  4KHV A;  4DU9 A;  3JAM E;  3J80 L;  2EYM A;  1DXM A;  4PV1 C;  4HCE A;  1II3 A;  1RCV D;  1TS4 A;  1STE A;  4IFD J;  1TVX A;  3VA5 A;  4CBV A;  1TY0 A;  4G57 A;  1H9S B;  2O5I C;  1PRT D;  1D5Z C;  1XTC D;  3MTS A;  4KV6 A;  1HA6 A;  3SK5 A;  3OPO A;  1STA A;  5FO8 B;  4IUR A;  4CHT B;  4F88 A;  1Y69 U;  1PXU A;  1AP0 A;  3I4M B;  4C3H G;  1QNU A;  1CK1 A;  4K2L A;  2LS0 1;  4Z9C B;  1X3Q A;  1JC7 A;  1U9R A;  2EY1 A;  2KQ3 A;  3CRL C;  2DY7 A;  2JEA I;  1B4O A;  3DWQ A;  1JOO A;  3GP7 A;  2SOB A;  5CC4 A;  1MSH A;  4PNY A;  4QUC A;  1BOS A;  2A69 D;  3MWY W;  4HMI A;  4FXG C;  4K8J A;  2B2W A;  4IZ8 A;  4A3F B;  1EQV A;  5C3E B;  3D31 A;  4RGN A;  5CV4 A;  2FJ2 A;  3H09 A;  3PO2 B;  5KEE A;  3Q23 A;  1JWS D;  5IGC A;  1YNN D;  4XQQ A;  1S5F D;  1OXU A;  2JEB I;  2R61 A;  2VB2 X;  2EE1 A;  3D4W A;  3SE0 A;  1HFG A;  4FP5 D;  1FNW A;  2F0E A;  2OF1 A;  2A69 C;  4ZKC B;  1RTN A;  4IUV A;  3Q6S A;  1TWG B;  2L9H A;  4RCN A;  3I4N B;  2L55 A;  2ZXR A;  3SK4 A;  5T1G A;  4DAV A;  3M85 A;  2E2D C;  3C1F A;  3GV6 A;  2B2V C;  5CBE E;  2LFN A;  1Y1W B;  1FNV A;  3H0G B;  1B3A A;  1CHQ D;  3OWE B;  4FF1 A;  3NSW A;  3OWF A;  1A3V A;  2EY5 A;  1M8A A;  2Z8L A;  1HFN A;  2HDL A;  2CQA A;  5D3D A;  2EPB A;  3R8B A;  3NBI A;  1EYD A;  2BA1 A;  3S1Q B;  3QB3 A;  4MIU A;  1TS5 A;  4DGZ A;  3C1E A;  3TZD A;  1Q90 A;  2F0D A;  4BBS B;  1TWC B;  4DA2 A;  2D5D A;  2Z1C A;  2K05 A;  5A2Q L;  4PMW A;  2BDO A;  1YNJ C;  1CQF A;  4FXD A;  3M4Y A;  1ONL A;  2NN6 G;  1SNP A;  5C4Z A;  4HMJ A;  3CU7 A;  1TWF B;  2EY2 A;  4QMG A;  5IGE A;  2AQ2 B;  1SJE D;  4X3S A;  5LHY 1;  3I70 A;  1ROD A;  5C6A A;  3S16 B;  1TR5 A;  3GTK B;  3S15 B;  2NTT A;  1L0Y B;  1LAC A;  1PTO C;  4M1U B;  1E0B A;  1QG7 A;  4U67 3;  1IHZ A;  3S1R B;  4NMZ A;  4NDX A;  1JQY D;  2J0T D;  4XIG S;  5DAU A;  1LTB D;  5JEA J;  1NUC A;  5D14 A;  5KND A;  1WTO A;  1YNN C;  1I4H A;  4IUQ A;  2AQ3 B;  3V96 A;  1JOQ A;  4L63 B;  5JVG 3;  4KN7 C;  3EA6 A;  1H9J A;  3K0Y A;  1AN8 A;  3PIO 3;  4KY5 A;  5KGU A;  3HOU B;  2PNR C;  1DZ1 A;  1SEB D;  2XVS A;  5CV9 A;  3J81 L;  2R3Z A;  3NBH A;  3SDZ A;  4OHJ A;  2C9O A;  3PUY A;  4PQX A;  5EQ0 A;  3Q22 A;  5COR A;  3VA7 A;  1F9R A;  4EVO A;  1JCK B;  3DXJ C;  1BR9 A;  4RKL A;  3N52 A;  4NKL A;  4IUP A;  4ZK9 B;  3VR2 A;  1XXG A;  4HTH A;  2E2I B;  1DCZ A;  3A7L A;  2XRS D;  1Q1B A;  1I4G A;  4FNF A;  2I07 B;  2CVR A;  2K5Q A;  1F2L A;  5FKA C;  4YIJ A;  2BE5 C;  3NTK A;  4ZYS A;  4TRD A;  2IT1 A;  2FMC A;  1GHK A;  1BCP F;  4RAU C;  4PMC A;  1V1P B;  2FMM A;  1NSN S;  4O1N A;  3PUV A;  1HRJ A;  2G9H D;  1D2B A;  2L5T A;  1QOH A;  4DK0 A;  2DNC A;  3C3L A;  1LTA D;  1ICW A;  2OXP A;  2F0T A;  3K5O A;  3MFY A;  3A55 A;  1F2Y A;  1EZ8 A;  1SDF A;  2EVB A;  3HG9 A;  4K14 A;  1MD2 D;  1GUW A;  5C0X G;  2B2T C;  1EY5 A;  2WAC A;  2HQE A;  3IFD A;  4P2C B;  1U4L A;  5IOC A;  2EXZ A;  2RVL A;  1TKW B;  3UI2 A;  2XWB B;  3FDT A;  2IX3 A;  3ERO A;  3KLS X;  2B8F A;  1PMR A;  2KJX A;  3OMC A;  2PO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...