3DWQA

Crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilase cytotoxin, subunit B
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 116
sequence length 116
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwqA00
1BXTA 1PRTB 1F77A 1SBBB 4TSSA 1ESFA 4ZYSA 3BYTB 4UDUC 1BCPC 1JCKB 4RHSA 3DWPA 1V1PA 1GOZA 1I4RA 1TS4A 1UUPA 3KLSX 1BCPD 3R8BA 1BCPB 1FNVA 2R61A 1KLUD 1JQYD 1HTLD 1XXGA 5TSSA 1STEA 2IJ0A 2ICIA 1TS2A 4RGMA 1MD2D 4RH6A 3R2TA 1CHQD 1SE3A 1FD7D 4RGNA 2AQ1B 1LTAD 1TY2A 3BYYB 1LTTD 1UNSA 4RCOA 1LTRD 1S5FD 1M4VA 2XNAC 1LTSD 1PTOH 1FNWA 1G8ZD 1SEBD 3DWAA 2XRSD 1JWSD 1V1OA 3MFGA 3BVGA 3R2IA 4RFBA 1SJHD 3EFXD 1LTGD 1XTCD 2NTTA 1L0XB 3TSSA 1ET6A 1EEID 1EFID 4O1NA 1PZID 1I4PA 3SEBA 5I4DA 1I4XA 1HXYD 5ELFA 1TY0A 2QEJC 1CT1D 4OHJA 3V05A 2O2LD 4RGTA 1FGBD 1PRTF 2XRQD 1ET9A 1D5MC 1D6EC 3URYA 1QILA 1T5XD 1HA5A 5D3IB 1BCPF 1RCVD 1B1ZA 3MC0B 5ELEA 1SE4A 5ELDA 1S5DD 3W2DA 1EU4A 5D3DA 2QILA 1SXTA 1PTOC 1PZJD 3GP7A 1CK1A 1PZKD 1PTOD 1PTOB 1I4QA 1LLRD 1SE2A 4RGOS 1SJED 2RDHA 2NTSA 2WV6D 1DYQA 3BZDB 3EA6A 2AQ3B 1JWMD 2SEBD 4DXFA 1HQRD 2G9HD 2TSSA 1CHPD 5ELBA 1KLGD 2J4XA 4L6TB 4Z9CB 3O13A 1LT5D 1TS5A 1EWCA 3BVZA 1KTKA 3DWQA 1L0YB 1LO5D 2XN9C 1RD9D 1PYWD 4L63B 1B44D 4RHRA 1ENFA 1CQVA 1LTID 1I4GA 1S5BD 5FKAC 2RDGA 3BVMA 2Z8LA 4DXGA 1S5CD 1RDPD 5ELCA 1DJRD 1TS3A 4BWGB 5FK9C 1D5ZC 1D5XC 3OWEB 1EEFD 1RF2D 2IPKD 4C56C 3CHBD 1LT3D 1JR0D 1LT4D 2AQ2B 1LTBD 4K6LA 1JWUD 1AN8A 1I4HA 1EU3A 1PRTC 1PTOF 1AW7A 1FNUA 2CHBD 1S5ED 1V1PB 1PRTD 1LT6D
chains in the Genus database with same CATH superfamily
1PRTB 4FVMA 1SBBB 2L55A 4A3FG 1KABA 1O7YA 1VF5C 4KJNA 1WVLA 3I90A 2B2YA 3GV6A 4I65A 1IYVA 1XNRL 4A4IA 1PFBA 4LAAA 2ZXRA 3EN2A 4B3RL 3HOXB 2TMPA 1C9OA 3FEWX 1RIPA 1WFQA 3KF8B 1E1OA 2JA7H 1Z6HA 2L0CA 2EY5A 2B63G 3QG1A 2KQ3A 1B3AA 3OSOA 1IBML 3MTSA 1ZKOA 1TY0A 1ICWA 4IUPA 4TVAB 1TQOA 1O7ZA 4K0KL 2XRQD 5C4ZA 1AH9A 3KLWA 2RA4A 1QILA 1T5XD 4HEDA 2XIWA 4PZ6A 2OTJA 5IP7H 5KYIA 4OO1G 2NUCA 2DJFC 1SYGA 1SXTA 3KJPA 2KJXA 4YHHQ 1O7LA 4JI5Q 5IT9c 2FINB 3PIP3 1I4QA 4QUFA 4BY1H 4NXNQ 5T1GA 2CKZB 3PGZA 1GVPA 3HOUH 2EJGC 1SNOA 4J15A 2RVLA 5GADC 1KHIA 2YU9H 4CHTB 4A3MG 3I4MG 5FLMG 1CHPD 3G7LA 4A3GH 5EKIA 2K33A 3KF6B 2CW0D 2LFNA 2XN9C 3SE0A 5M3FH 4G57A 1RD9D 1DOMA 5CORA 4NPSA 5IP9G 5CYUA 2HIVA 2PI2A 1YBYA 4BY7G 3U50C 3SHLA 1EY0A 4A3BB 3Q8DA 4ME3A 4DXGA 4LF8Q 3OW7A 2NYZD 1CFMA 4C2MB 4DR3Q 2E2JH 3GTJB 1YEZA 4OELB 1TR5A 3NSWA 1Y1WG 3U9OA 2AQ2B 1SLJA 5FLXc 2WINB 1K8OA 1AE2A 2CHBD 1SN8A 3T1HL 4Q0FA 2JXMB 4R4CA 3D8GA 5JPNC 5JJIA 2DJGC 4G7ZC 4QF4A 5BN3A 2PYKA 5I2XA 3U4ZA 1XPRA 1HNXQ 2Z0SA 2R93B 4KKSA 2AUKA 4P72A 2I5HA 3T4AC 2VB3X 2ZJRA 5IGBA 4X65L 4CDEC 3A5ZB 3VR4A 2NN6H 4ZCKA 3X3MA 1SE3A 4DUZL 1TY2A 1S5FD 1E2VA 4DUYQ 1BF4A 1DCZA 4ULLA 4V0BA 1X6OA 3R93A 4DV1Q 3BS1A 5M5YH 2AWNA 2OWOA 3R2IA 1H9JA 1OXSC 3ND8A 2F0WA 2JN4A 1DGSA 2MHVA 3S14B 1OXXK 2B29A 3GQBA 1KIXA 3DM3A 3CQZB 4GKJQ 4DV0L 4IFDJ 1G51A 3GD7A 1MJCA 5L37A 4JBMA 3DUZA 1HNWL 1HR0L 3A56A 1SE4A 4C3JH 3CC7A 3NTIA 3S16H 1SFOB 4JC0A 3G6EA 4LUZA 2K50A 2UXCQ 1QVFA 3SK8A 3GDEA 1N33L 1GKHA 1SYCA 4A3MB 1UEBA 2SEBD 3S1MB 5F2DA 4DXFA 1K28A 5AFWA 4IUVA 3WOEA 1F2LA 1TS5A 2HQEA 1TWFB 1KTKA 3J80i 3BDOA 4Y7NB 1E2ZA 5J1ZA 4BY7B 1N32L 2QF7A 3IL8A 2VY3A 2WB1B 4BBSG 2UUBL 1EIYB 5JEAH 1DM0B 4N8FA 1OXVA 1ENFA 1CQVA 1I3QB 3DHQA 2GVAA 1AZQA 1GD7A 2VQFQ 1Y1WB 4PMWA 4PZ8A 2D62A 1JB3A 2NBFA 5FK9C 3V96A 3HOXH 3CD6A 1HZCA 3J80c 3CHBD 2N88A 3M4QA 5C4JH 2NVTB 1AN8A 2ICEC 1V1PB 5LMUL 4OGQC 4A3DB 3PUWA 1NJIC 1UUPA 1FGUA 2M9VA 3HFZB 1A0IA 4JK1C 2R6GA 1WTRA 1EZ8A 3NE5B 2A6HD 2B2WA 4C3HG 4X64L 2ZM6L 3W1GA 2E2HB 5C0XH 2PNRC 2KBNA 2Y0SG 1PH7A 4G4KA 3M7GA 4IPHA 3P7JA 4HN7A 3OPOA 3WDNA 4OX9Q 1II3A 2OF1A 4RCOA 3GTKB 4LFAQ 3J81L 1Q12A 2Z6KC 4A3IB 1EYCA 1Q90A 4O2DA 4BA1I 1PHJA 5EKKA 2XRSD 3K80C 4JI8L 2BDOA 1TIID 1LTGD 1XTCD 3KDFA 1Y8PB 3MVVA 3TMEA 2PPBC 4NDXA 4NW2A 3VR2A 4A3KG 1VQOA 4OHJA 4IFDI 1D5MC 2F0JA 4X3TA 4Q5VA 2ID0A 1HHVA 2VQEL 3MXNA 1UE7A 1FJGL 3S2DH 3FHWA 2WP8J 1BCPF 1RCVD 5ELDA 1JJ2A 4DR6L 5D3DA 2F0EA 4O42A 3ONAB 2SDFA 3MFYA 1HPCA 4A3BH 1CK1A 4R4TA 1V1QA 1X3GA 1PH1A 2R92G 3TEHB 4C2MH 3J81E 1IKLA 3GTJH 2ZTCA 4KY6A 4KK7A 1JOOA 1JORA 4DAYA 1XPUA 4B3MQ 4A3LG 3CCQA 1EY9A 2C5CA 3J7AF 1OXTA 1N8RC 1F2YA 3SGIA 4BBSB 4QJFA 1LT5D 1F9PA 2EYMA 3KUPA 1U4RA 1TWGB 2CWAA 2R93H 1IXRA 1B44D 1EUJA 3IFTA 1UWVA 1X3QA 4QUCA 4Y52H 3P75A 3PIOA 3OMGA 4DV2Q 1RHPA 4DA2A 4GN5A 3OTOQ 1YNXA 2QCPX 3CXCA 5J22A 3OWEB 2A6ED 2AHOB 2IPKD 5ELOA 1GUTA 4U68A 1A3TA 1X3FA 5I2YA 3K57A 1Q81C 4GLAC 1H95A 3UI2A 2RSNA 1W6JA 3NTKA 4DFAA 2RBMA 4FO2A 3SDZA 2IX3A 3T1YQ 3BZCA 1A62A 2GN5A 3HKZG 4C3HB 3S14H 1BCPB 1PH5A 4TQUS 1IBLQ 3NPPA 3HOYG 2CWPA 3CQZH 5C5MA 4MNOA 4OO1H 1GM5A 1H9KA 1GJXA 2F4VQ 2WACA 1BDOA 1AE3A 1EQQA 1QUQB 1TS2A 4LF6L 5HURA 2JA8G 1W6KA 4X66L 2KHJA 3NQIA 2F3WA 2RF4A 3CCUA 1SFOH 3K6OA 3D6WA 1SMYC 1A8VA 1D1KA 4GNXB 2K5WA 3I4MH 4A3MH 4A3KB 3DXJC 5FLMH 2ES2A 3CMEA 3S1MH 2Z4IA 4KY7A 1DONA 2VZAA 4O1NA 1XYIA 3CCVA 5IP9H 5JEAJ 2EY2A 2E2IB 2EYHA 1TWFH 5C44G 5BR8L 5IYDH 4Y7NH 1ASYA 3D4RA 3NEMA 3OW2A 1C7YA 4BY7H 3URYA 2F0TA 3GTGB 2R92B 1STNA 1EU4A 4HJ5A 3IAYA 1I3QH 1BBUA 4JVZA 4OWXB 1QB5D 5A35A 3DM1A 1YNNC 2PZUA 2DUDA 1QZHA 2NVQB 4I7AA 1VQMA 1Y1WH 4L5RC 4GNXA 3HGBA 2R7ZG 4K5XA 1JWMD 1A2TA 1PFNA 2JEAI 2EZVA 1XNRQ 2K52A 2J4XA 3UDFA 3QOJA 4Z9CB 3O13A 1KC8C 4A3DH 4DNTB 3D6CA 3F2DA 3RMHA 4B3RQ 5FOBB 1PH4A 1JOKA 1IW7D 5C0XJ 1YNJD 1KNEA 5E1FA 1XNQL 3TRZA 1TXYA 4JI1L 5FKAC 5IYBG 2E2HH 4ID6A 4A3CG 3J7AV 1NY4A 5CV4A 1YZ6A 3SVMA 1CSQA 5C3XA 4UAIA 3BDLA 5FO7B 3T13A 5FLXL 1VDZA 5BN4A 3GTKH 3T51B 4AYBE 1FYCA 2B2TA 5M3MG 1JT8A 4K0KQ 4A3IH 3MZ5A 1CKNB 5J39A 3RD4A 1SNQA 3HKZB 1QVGA 3HOYB 4XQJA 2L11A 4ZYSA 1STHA 4GLXA 2KCCA 1KQSA 1F2MA 2CH4W 2ZT9C 3NK9A 3HZXA 2K05A 3E0JA 5EQ0A 1W2BA 2H5XA 1U9RA 4YCUA 4IJHA 1K0RA 1WD0A 5IWAL 1VQEA 2HD3A 4FXGC 5G3LF 1VQPA 2PMZB 4A3GB 2A68C 3S24A 3M9BA 2VS1A 1WCMG 2BH8A 3LWUA 2PQEA 2MFIA 3RR5A 1HH2P 1MKHA 1EFID 1O78A 3H94A 1PZID 1EY7A 1DOKA 2MQHA 4FF1A 1H9RA 3QO2A 5LMNW 1R4PB 4K6DA 4JI7L 4BBSH 3PUZA 1IKMA 2M00A 1WJJA 1SROA 4JI2L 1YJ9A 2YTVA 1TWGH 3A7AB 5ISRA 4B9WA 1JC7A 3M7NA 1TT2A 3J7A5 2BA1A 2WKCA 2WAQG 4X3UA 2R7ZB 3T1HQ 1PZKD 3FVQA 3SK5A 1WD1A 5IOCA 2K4KA 3VR3A 5K36G 2F3VA 4LMQD 4DV3L 2HUGA 3GTMH 4CDDC 2BE5C 3I7FA 4KKTA 1EFWA 1F9RA 3HG9A 1DD2A 4X65Q 1Q1EA 2Z9HA 2O4XA 1ZYRC 3MHBA 3SR1A 2UUCL 4DUZQ 3KJOA 3E6ZX 3S1QB 2VNUD 1Y1VG 4JOIC 4C3HH 4YY3L 5EJWA 2DN8A 2HCIA 4GKKL 1C0AA 2EPBA 3HOVB 2RCNA 5GAHC 1RKNA 3BJUA 4DR5L 4F88A 2RDGA 3BVMA 5M5YB 3VA7A 1JMCA 1PV4A 3TZDA 3CPWA 3E9HA 3FPPA 2V1CC 3PSIA 1C8CA 1CZGA 1D1IA 3Q23A 4DV0Q 3MXGA 1SR3A 1PTOF 1EU3A 1B7YB 1VQAA 3CAMA 1P8LA 3EQLC 4A3KH 2XSCA 3MWYW 2NVXH 1QG7A 2VUMG 4MTKA 1Q8KA 1HNWQ 1HA6A 1HR0Q 2LKVA 4F87A 2ZJQA 2F0FA 4C3JB 1TS4A 2MP1A 3GTPB 1QCBD 3S16B 3OYYA 4BXXG 2E2IH 4JBJA 1N33Q 2KVMA 3DLLA 4HSPA 2PO4A 2IJ0A 2AKWB 1X65A 4ILWA 5D65A 4RGMA 3GTGH 4WJWA 2EXDA 2R92H 1FD7D 1WCMB 2NWGA 5E3FA 4HCEA 2PQAA 5J3BA 1CTMA 5AJ3L 3CCLA 2LS01 1MI2A 3ITPA 3VR6A 2NVQH 1FNWA 2F0LA 1B53A 3TZUA 4R9WA 1G2TA 1FL0A 1N32Q 4HMJA 5IYCG 1V1OA 2WIIB 1HJPA 2UUBQ 2IY5B 1AFPA 3EFXD 1QNUA 5EPKA 1L2FA 4UPAA 3F2BA 1PMRA 5CMDA 1TU2B 1XMQL 4YIJA 5DLQE 1GUGA 3CF5A 1I50B 4AH6A 2PZTA 3V05A 4RGTA 4UY8C 4PQXA 4QCLA 1EY5A 2XWBB 3PCOB 4L5TA 2WAQB 3NXWA 3RUZA 4DPGA 5JPMC 3PF5A 2K7VA 5C4JB 4I7ZC 1A3UA 1YITA 1BVSA 1UEAB 1N34L 5LMUQ 2K5DA 1Y8OB 1PTOB 3I55A 1SJED 3I70A 1XPOA 4IPDA 1CZWA 2KCNA 1EIHA 1EOTA 3M4OB 4RAUC 4X64Q 1Y1VB 4L6TB 1X56A 2A74C 5DNFA 1XMOL 3HOYH 3S1RH 3L7ZC 4EQNA 1A2UA 3F8TA 4OO1I 1M90C 2B2YC 5CC4A 4JI0L 1J5EL 1D2BA 2UU9L 1U4PA 2JA8H 3MXPA 1S5BD 4KTAA 5DM73 4JI8Q 4XDXA 1HNZL 1RF2D 2RDFA 4IZ8A 1L1OB 1PRTC 2VQEQ 1FJGQ 2G9DA 1WTXA 1KXLA 2R7FA 2DY8A 3RN2A 1VQ9A 3S2DB 4XYQA 4UHVA 2F0VA 2B2UC 4ME5A 3A8JE 1SNDA 2LXJA 2MGSA 2JA6G 3FP9A 1LYLA 1MGSA 4FDBA 2N8NA 1MHWC 3SK6A 1X3EA 3PUXA 2EY6A 2IX0A 4OONA 4OEMB 1C48A 3GTLB 2OCEA 3H0GG 1CHQD 4A3FB 1LTAD 1M8AA 2XGTA 5IIFA 5C4XG 1V43A 2BH2A 2R7ZH 3EVQA 4OIKA 1Q3LA 1SMYD 1G8ZD 1O80A 1L1OA 4CDCC 3S15B 3MA2B 3FPUB 3OOCA 3U9SA 2K6AA 1I6HB 4NXML 4K2KA 4HJ7A 4P75A 3ERSX 3PIPA 4DAVA 3CCMA 3GTOH 3S1QH 2KHSA 4ZKBB 1X9NA 3I8ZA 2J0TD 1NNXA 4A3CH 3HOVH 2QILA 2B63B 1HQMC 3GP7A 1W3SA 3HOZG 4HAEA 1YNND 2Q8RE 1RODA 5I6YA 5M3MH 5HY6A 2F0QA 1QVCA 1JICA 2IHEA 1V8QA 1H9MA 1YJWA 1U0LA 2FMMA 1RL2A 3A54A 4JI3L 4GN4B 2QA4A 4LJZC 4ZLTF 3F1ZA 4LF6Q 5C4HA 4X66Q 4DU9A 1VQ5A 3GTPH 5CV9A 3I4NG 3QB3A 2EVBA 2F0KA 2DNCA 4P71A 5CV6A 4MHEA 4P2CB 4IQZA 1D7QA 1GHJA 3I4MB 1EIFA 2Z8LA 2EYLA 3TP5A 4HIDA 4TRDA 3J81j 2EYPA 4KI0A 1WCMH 2RKSA 3NWSA 1ONLA 2O5IC 2UXBL 5BR8Q 4XIGS 2F0HA 3OIPA 5LL6S 5LL6X 1HUMA 1BXTA 4TSSA 4X3KA 4G7HC 3NENA 4H44C 4CJ2C 3FRPB 3I56A 4HJ9A 4IURA 1I50H 2Q2IA 3PV0A 3VYTA 3SK4A 4H7BA 3EJIA 3NHHA 1TWCB 5GAGC 4X6AH 3R3OA 3WOFA 1SNPA 2XTIA 2KEEA 5K36H 2K32A 4LF4L 4CJ1B 3PUYA 5COYA 1VS0A 1SAPA 1XJVA 2XNAC 3STBC 1PTOH 3P1HA 2K1BA 4IUNA 1AEXA 3KDFB 4BBRG 3VYUA 1IYJB 3OHXC 1ILPA 3ZJYC 1K8AC 1XNQQ 2Z6KA 1EEID 4JI1Q 2EE1A 3I72A 2VXWA 3M4OH 1Y1VH 4ABNA 4JI4L 3H09A 5DAUA 3MXNB 2B8FA 3Q0AA 1PFMA 1B4OA 4KMUC 3KYHC 2JP1A 4J6HA 4R4IA 3W1BA 3A55A 1PLFA 2RCFA 1STAA 2UXDQ 1E2WA 4DAYB 4P74A 2NTSA 1WI5A 2WV6D 1Q82C 3QWNA 2K5QA 3BZDB 3EA6A 1A15A 1A6XA 2E75C 3G6JB 1SYDA 2VUMH 1OXUA 1S3OA 4PMBA 3CCSA 2BE5D 3TDQA 4AQYL 3K5NA 4JI6L 1A3VA 2OQ0A 3LWEA 2F0MA 1IBKL 2O5JC 5IWAQ 3M3YB 4A93G 3GTQB 2OTLA 2B2WC 1U5KA 1FVIA 1LTID 3U4VA 5A2QL 5H1SE 4DV6L 4DV7L 4K5WA 1WTOA 1GUOA 3EROA 2ZXPA 4HJ8A 3GTLH 5ELCA 3JAML 4A3FH 1D5ZC 1VQ7A 1LABA 3VYRA 4JI7Q 4KV6A 4HMIA 2J7ZA 2K28A 4XT3B 4JI2Q 3H91A 1EY4A 1VF7A 1IL8A 1ESFA 1UE5A 2K14A 3S15H 4KHPL 3I73A 1PA6A 1GOZA 1I4RA 3R8BA 1HZAA 1I6HH 1EQRA 4JBKA 4OWTB 1GXDC 1VQ4A 5LMNL 2IX1A 1KL9A 3CCEA 4ZAIA 4DV3Q 2I07B 5A2QE 3RZOB 3GTMB 4B08A 5NUCA 2F3IA 4HSVA 1QE6A 2IT1A 4LUVA 1IL2A 2B63H 1LTRD 5CR3A 1X55A 4IN3A 3JAME 3AB9A 2UUCQ 4U673 2E5LL 3CRKC 5CGKA 2AWOA 4YY3Q 5C6AA 1EY8A 1O7IA 4GKKQ 1L0XB 3ULPA 3TP7A 3S9WA 4NP5A 2Y0SB 1MJEA 1YHBA 4EQOA 3VA5A 3RNUA 5C5LA 1IZ6A 4DR5Q 1KDAA 1K3RA 2H1EA 1BOSA 4F8MA 3MAQA 5BN5A 2JA7G 2F0NA 2R3ZA 1B70B 4MTNA 3W5OA 1B8AA 3LNNA 4DNIA 4KKUA 1KDBA 3K8AA 4B3SL 5IY0A 3FMCA 2RSOA 2FFKB 2NVXB 3CPFA 3N52A 4CBVA 1DZ1A 2B2VC 2HDMA 4EQPA 4A3EG 2DNEA 3K5MA 4L8JA 3DEPA 4IOAA 1SDFA 2A5HA 2EY1A 4ZK9B 3TQYA 1JJGA 5EBDA 4BY1G 1RTOA 3PF4A 2FJ2A 1Z7TA 2BA0A 4OWWB 2L4NA 3HOWG 2A69C 5AJ3Q 5IT9L 3L9AX 1I6VC 4RHRA 5I6WA 1EYDA 3H0GH 3D0FA 1MSHA 3E3XA 3TREA 1TWCH 3J7YW 3E9IA 1E3PA 4B3TL 1S5CD 1BUVT 4ZUIA 2PZWA 3S1NB 2K01A 3K7UC 1XMQQ 2DGYA 1VQNA 1D5XC 3K59A 1WYDA 3ER0A 4GN3B 1PH8A 3H3VH 4DR7L 5JJKA 1BBXC 3UDIA 3K5LA 1PRTD 1S72A 4AIMA 3MXUA 3Q24A 3I3CA 2WFWA 3BYTB 1BCPC 4QIWE 4RHSA 1YHQA 1VCIA 2NZHA 3KLSX 2Q2UA 2Q8IB 2R61A 1KLUD 3TS0A 4A75A 1S40A 4YWLA 3CCJA 3PMFA 5IT9E 1LTLA 2L1BA 4KD4A 1IBMQ 3I91A 3AFPA 3HOZH 4H0LC 2KEDA 5ELNA 4OXPA 1EIGA 2AUJD 4DKAC 3GV3A 4E6IA 4GNXC 1XMOQ 1E22A 1LTSD 4QQBX 2RHSB 4K2LA 3X3NA 4DNRB 2NN6G 3S1RB 2QEXA 1PFSA 4JI0Q 2HDLA 3T56B 3TSSA 1J5EQ 2UU9Q 4V190 3SEBA 2YYZA 5I4DA 2CCZA 4LF7L 4AYBG 5ELFA 2QEJC 2JA8B 5EGTA 4LWCA 1Y69U 4K8IA 2VW9A 3HRZC 3I4NH 1YI2A 1HNZQ 1KNAA 3PQIA 2F1MA 5KRUA 5FJ8G 3M3YH 5D3IB 1I94L 2F0DA 3GTQH 2X6LA 4KHZA 5EKLA 2PCFB 1PZJD 4FYDA 4A3EB 5FLXE 4YCWA 4DGZA 2P5ZX 4C1NK 3Q22A 4MZ9A 3NQTA 2B2TC 1QJOA 2F0UA 5C44B 4GOPB 1XWEA 3P20A 5M5WH 4IJLA 3MEFA 1PVOA 3HOWB 1KLGD 4HIMA 4LW1A 1PH2A 4WORA 4YWKA 1TVXA 4DAMA 3J81i 5HGQA 4PNYA 4JOIA 1QOHA 1AZPA 1LACA 4LK1C 3RZOH 1HFNA 3K0YA 1CSPA 5EAYA 5KGUA 4NXMQ 2EJFC 3ULJA 2C9OA 1JE4A 4GOPA 4JYAL 2DY7A 1AW7A 4JBWA 1S5ED 1F77A 3GTOB 4PMCA 3J81c 2HCCA 3HOXG 3AQQA 1NSNS 4JPBW 1LUZA 5E7NA 3S17H 2R7DA 4CKBA 2PI2E 3L0OA 4LFCL 4ALPA 3AMUA 2A1AA 1ENAA 2K03A 2XWJB 1HTLD 3LX0A 4LF5L 2ZTDA 5M3MB 3BU2A 3J80L 2PQAB 1PYSB 4RH6A 3CC2A 5GROA 2LXKA 3BYYB 4IPGA 3MEHA 1FR3A 2EYFA 1M4VA 4JI3Q 4JCVE 3AEVA 5C0XG 4IUQA 2FHTA 4IPCA 3STBD 1J8IA 3DWAA 4MN3A 3MFGA 1J9OA 1SJHD 2K5VA 2SNMA 1EQTA 1SRUA 2NTTA 3RLOA 5E4WC 1EZ6A 4C3IG 1F9SA 1N36L 1EYGA 2YTYA 1VQDA 4LNQA 3NWTA 4R4QA 1U4MA 1ILQA 4PZ7A 4RMFA 4XTCS 1HA5A 1R9TB 1GHKA 3CW2C 3HS0C 5EPJA 2UXBQ 2I46A 4FF2A 1VQKA 1HRJA 4KN7C 3J80E 2JA5G 4A3LH 1Q1BA 1NUCA 1P16A 1LLRD 4LFBL 3S1NH 4FNFA 1SMXA 2Z1CA 4CJ0B 2F4IA 1HQRD 5C3EG 1KAAA 3QJYA 2TSSA 3F2UA 5ELBA 3KK7A 2LY7A 1ESRA 2OXPA 4LF9L 1IHZA 2H4OA 1L0YB 2ZXOA 3BG3A 4LF4Q 4N9TA 4JG2A 3S2HB 1HZ9A 1F2ZA 2RHQB 2B39A 2IHFA 4DV4L 1HCZA 1WTHA 1EQVA 4N9PA 2R93G 1ICFB 4JI4Q 1CI3M 4HR7B 4KLKA 2ZM6Q 1LT4D 4K6LA 4K14A 2JEBI 3G71A 2UUAL 4EVOA 4IALA 5EPLA 1X3PA 5DEHA 1TWAB 4KN4C 5M5XH 3DWPA 2FMCA 1YIJA 1IYUA 5LHY1 1E1TA 2Z4HA 4M1UB 4XQQA 3D4WA 1CA5A 1STBA 1JQYD 1E7ZA 4A76A 1XXGA 5KNBA 3C3LA 2B2UA 3M4YA 2ICIA 5IGFA 4RGNA 3RLNA 2JK8A 2VUMB 2CQAA 5CBEE 4AQYQ 1UNSA 1UE6A 4DK3C 4A3EH 4RCNA 4JI6Q 5JAVA 2N55A 4C3IB 1IBKQ 3KBXA 1L0WA 4WJ4A 2Q2TA 4DR6Q 1F9QA 4DV5L 5C44H 3G4SA 3KF8A 1HUNA 1Q46A 3NTHA 3W3AA 4DV6Q 4DV7Q 3HOWH 1CT1D 1NCVA 2I5MX 2WB1E 4RG1A 1DXMA 1VQFA 1TKWB 3I4LA 2JA5B 1JE5A 5GQOA 1IW7C 4DR4L 3MC0B 1YNJC 1JOQA 4YWMA 2L9HA 1S5DD 1QNKA 1PTOC 5IYDG 5KNCA 2KCMA 2A8VA 2ZTEA 2JE6I 5FO8B 1K9MC 2WB1G 1SE2A 2SNSA 5C3EB 3H3VI 4DR2L 4HJAA 4KHPQ 4DN4M 4S3SA 2NZ1D 5LMNQ 2HHHL 2D2CC 3IKJA 4R4OA 3PUVA 3RN5A 1K8MA 3BDCA 4X62L 3T16A 1G91A 5IYBH 1VQIA 3PO2G 2F03A 1LM0A 1Z47A 3KF6A 4XXEA 5HGTA 1BR9A 2A69D 4L63B 3TP6A 3J7ZC 1B2TA 1A63A 4DR1L 2E5LQ 4A3DG 2RQXA 3PO3G 4DF7A 3G48A 1YHAA 1WTWA 1GUNA 3I2ZA 2LMCB 3CRLC 3OMCA 1EEFD 1GUWA 4TKOB 1L1OC 2YV5A 3ERQA 1KDCA 1LTBD 3HP3A 2D5DA 1XTDA 1FNUA 4K8JA 3CMAA 4A3JG 1EL0A 3FKIG 3VYSA 1JJCB 1JCKB 2OQKA 2E8GA 4JV5L 1QZGA 4A3IG 1BCPD 4BA2I 1VQHA 4B3SQ 5FJ8H 4QL5A 3C2PA 4KJOA 3E5SA 5EBCA 2VL6A 5JVH3 5TSSA 2GVBA 4LUOA 3KBGA 1VQCA 1TWHH 1R9TH 1UE1A 4DK1A 4ZKCB 3UDXA 1BNZA 1KRSA 2M2LA 4J8QA 1G291 1CM9A 3NBHB 2NB0A 3KOJA 4GZYC 1G6ZA 4L5QA 1JWSD 1C4QA 1NMGA 4KD3A 2JA6B 4CKCA 3BVGA 4FP5D 3ICEA 1WOCA 3TS2A 3RZDH 1WTPA 1HXYD 3H0GB 3K58A 1KD1C 1NE3A 4EQ5A 4B3TQ 5C4XB 2OEOA 3TP8A 3ND9A 3K81C 5IGDA 4FXDA 1K3BC 1X32A 4IO9A 2QDBA 3K0XA 5IODA 1PH3A 3S2HH 1B1ZA 4DR7Q 3UE1A 5IGEA 1S4ZA 2A68D 2QGQA 1EOVA 3UDGA 4RA8A 3EBEA 2RDHA 3NBHA 1BBWA 2CVRA 2EOTA 1T5EA 2KUMA 1ENCA 3QR8A 2IW3A 1VQ6A 4ZRZA 3CC4A 1MIUA 4RKLA 3PO2B 3KFUA 1UAPA 1NR4A 3CP0A 4IUTA 1Q8IA 2Y0SE 4F7XA 1CKMA 1TWAH 3HOZB 1NMFA 3PO3B 5CV7A 4HCSA 1NAPA 3IFDA 5JVG3 3AU7A 2EIFA 4UP7A 2FXQA 1YJNA 3ZYYX 2ZJPA 3KLSA 2NZOA 5IGGA 2PNHA 2EJMA 3H6MA 3D3RA 2N3SA 4WRDA 4LF7Q 2LSSA 2ENBA 3N6RA 4OL7A 4A3JB 2MNAA 3FKIB 4C56C 1VMPA 3NP8A 2N49A 1JR0D 2EQSA 2XVSA 3PIO3 2CQOA 4C3IH 2ASBA 1B9NA 4BXXH 3I4NB 1B9MA 4YHHL 4JI5L 1I94Q 1ZYRD 4NXNL 5IGCA 3D4DA 1V1PA 4PV1C 3JC66 4O0AA 3NUCA 1WTQA 1PH9A 4XT1B 2JA5H 4IFDG 1G6PA 1H9SB 3T53B 5IYCH 1N9WA 1K83B 3R2TA 5CV8A 3H3VC 5C3WA 5M5WB 1STGA 4QB4A 3HKSA 4GS3A 4HIKA 3L3OC 5C3EH 2SOBA 4FXKC 2L15A 4XYOA 1Y8NB 2KCTA 4NB3A 4RFBA 1GUSA 1K0SA 4YCVA 4LF8L 2MJ8A 1ET6A 4IUUA 2JQOA 2Q2HA 4DR3L 2IL8A 1STYA 5IE8A 2O2LD 3UE0A 3FDTA 1YVCA 1Z9FA 3L2PA 1VQLA 2HIXA 4BBRB 1H9SA 5JJZA 1NR2A 3EIVA 1Q7YC 3W2DA 5K5PA 4JYAQ 1HNXL 4N8X1 3BZKA 2D0PA 3NBIA 1DYQA 2I5LX 3S17B 2NVYB 3HKZE 2K75A 5FO9B 4BS9A 4LFCQ 1KRTA 4LF5Q 2B2VA 3CKIB 1Y14B 3TN2A 4R8IA 2CW0C 2K5NA 4DUYL 1WTVA 5CBAE 2K5HA 1EWCA 5GAEC 3BVZA 3OWFA 5JOBA 4DV1L 2F52A 3DMUA 4ODGA 1HR0W 2ATWA 1VMCA 1I4GA 5G3LD 4M8AA 5IP7G 1CKOA 4GKJL 1T9HA 1N36Q 2PMZE 1EWHA 1NBWA 2EYJA 1PYBA 1B3QA 3K5OA 4ZQ3A 5KEEA 1ZXTA 2YTXA 2OT2A 1JWUD 2JSOA 4A93B 4WJ3M 2KECA 1ML0D 1K73C 3HOUG 2E2DC 2JA6H 1ET9A 2UXCL 3IRBA 4NKLA 3WWVA 3H15A 1SYEA 1OTCA 4A3GG 2B3GA 1J6QA 4H02A 4GLVB 5I9OA 3LGJA 5M3FG 4ZUJA 5C4XH 4LFBQ 4RWSC 5D14A 3CU7A 1STEA 1CQFA 2EDGA 3B6YA 3QIAA 3C1FA 1BKBA 2BOSA 2IWHA 2WKDA 1MD2D 2MUYA 2AQ1B 4R8NA 1LTTD 3A5UA 1QUQA 2E76C 3K7AB 3RLFA 4LF9Q 4MIUA 2KENA 2E74C 3ULLA 1SEBD 1E24A 1X54A 4UP8A 5KYLA 1N34Q 2VQFL 3AYHB 4C1NI 2B8GA 3PO2H 2MO0A 3VDYA 1VQBA 4DV4Q 2NVTH 4G7OC 2HT1A 2GA4B 4EGVA 1ZEQX 1D6EC 4WFN3 1B50A 2F0SA 3PO3H 1JB7A 2I0QA 1CA6A 4FF3A 2Z6BA 1SNMA 2L12A 2UUAQ 3KLRA 2NN6I 1MSGA 1PTOD 3C46A 5DM63 2EXZA 1EWIA 4CDFC 2KOLA 5M5XB 3HOVG 2JA7B 3F2CA 4HIOA 4A3JH 2PW7A 3FKIH 1E0BA 1K8GA 2L5TA 4OX9L 5KNDA 3SXHA 2JJQA 4LFAL 4PG3A 2JA9A 3DWQA 2G5DA 1LO5D 4X3SA 2CFMA 2PW5A 2UXDL 1V9PA 1PYWD 1R4QB 4OIJA 1QWYA 1M1KC 3C1EA 2A73B 2CH4A 3E0EA 4DV5Q 3M85A 4C3JG 4BY1B 1ASZA 1DJRD 1TS3A 3OIQA 1K83H 4R1JA 1SSOA 3A8IE 3HOUB 4DK0A 2YU9B 2D0OA 4H13C 3I4OA 1VQGA 4FF4A 2ALYB 1LT6D 3DEOA 4DR4Q 2F0GA 5M9OA 1CKNA 4UDUC 5M3FB 4L5SA 4NMZA 4P73A 3A7LA 5JJLA 2WAQE 1FNVA 1HFGA 2A6HC 4B3ML 2K04A 1HTPA 4DR2Q 4QMGA 4POFA 4DK6C 5JEAG 2HQLA 2C35B 1KAWA 2BDNA 1RTNA 1EYAA 4BBRH 2HHHQ 1CUKA 2E2JB 2X6GA 2F0PA 1BQQT 1U4LA 1PDQA 2AMCB 5I9PA 4KY5A 1SNCA 4UP9A 1MBYA 3A0JA 4X62Q 3Q6SA 1G2SA 5KIXA 2N78A 3D31A 4DV2L 1D8LA 3OTOL 1LV9A 1XX8A 1EY6A 2NVYH 4JW0A 4DR1Q 2KA7A 1I4PA 1I4XA 1HZBA 1Q86C 5E4XA 4QIWB 4CGYB 1FGBD 1PRTF 1DOLA 2BCOA 1SYFA 1PXUA 1RJTA 3M4PA 1AP0A 4EX5A 3A74A 2VB2X 3JAMi 2D9UA 4B9XA 3AFQA 5ELEA 4CKEA 3T1YL 5C0XI 4XQNA 4POGA 4RKBA 1IBLL 1I5FA 1NTGA 4IOCA 3NELA 4AYBB 1OO9B 4RGOS 5T1IA 4GOPC 2F4VL 4JV5Q 2AQ3B 3VR5A 2A19A 1SE8A 2V4DA 2QW7A 2QKIC 2G9HD 4A93H 3GO5A 3JAMc 2X69A 3QOLA 1TWHB 1BO0A 3HEJA 3U58A 4KHVA 4APVA 3CCRA 2KHIA 1VQ8A 2QDLA 4K5VA 4IFDH 4HTHA 2MO1A 1SYBA 2JYOA 2F0OA 2Q8TA 1RDPD 1GO3E 2MPMA 2A6EC 3A8KE 4BWGB 4A3BG 4QY7A 1VQJA 4QGUA 3RZDB 2F0IA 1LT3D 3V2TA 3K7AH 4J1MA 5CV5A 3TBIB 1I4HA 1PH6A 4DAPA 2EYOA
chains in the Genus database with same CATH topology
1PRTB 4FVMA 1SBBB 2L55A 1KABA 1O7YA 1VF5C 4KJNA 1WVLA 3I90A 2B2YA 3GV6A 4I65A 1IYVA 1PFBA 4LAAA 2ZXRA 3HOXB 2TMPA 3FEWX 1Z6HA 2L0CA 2EY5A 3QG1A 2KQ3A 1B3AA 3OSOA 3MTSA 1ZKOA 1TY0A 1ICWA 4IUPA 1TQOA 1O7ZA 2XRQD 5C4ZA 2RA4A 1QILA 1T5XD 4HEDA 2XIWA 5KYIA 4OO1G 2NUCA 1SYGA 1SXTA 2KJXA 1O7LA 2FINB 3PIP3 1I4QA 4QUFA 5T1GA 2EJGC 1SNOA 2RVLA 4CHTB 1CHPD 3G7LA 5EKIA 2K33A 2CW0D 2LFNA 2XN9C 3SE0A 4G57A 1RD9D 1DOMA 5CORA 5CYUA 3SHLA 1EY0A 4A3BB 4DXGA 3OW7A 2NYZD 1CFMA 4C2MB 3GTJB 1TR5A 3NSWA 3U9OA 2AQ2B 2WINB 1K8OA 2CHBD 4Q0FA 2JXMB 3D8GA 5JPNC 4G7ZC 5I2XA 5BN3A 2PYKA 4QF4A 2R93B 4KKSA 2AUKA 3T4AC 2VB3X 5IGBA 3VR4A 2NN6H 3X3MA 1SE3A 1TY2A 1S5FD 1E2VA 1BF4A 1DCZA 4ULLA 4V0BA 3R93A 3BS1A 2AWNA 3R2IA 1H9JA 1OXSC 3ND8A 2F0WA 2MHVA 3S14B 1OXXK 3GQBA 3CQZB 4IFDJ 3GD7A 3DUZA 3A56A 1SE4A 3NTIA 1SFOB 3SK8A 1SYCA 4A3MB 2SEBD 3S1MB 5F2DA 4DXFA 5AFWA 4IUVA 3WOEA 1F2LA 1TS5A 2HQEA 1TWFB 1KTKA 3BDOA 4Y7NB 1E2ZA 5J1ZA 4BY7B 2QF7A 3IL8A 2WB1B 5JEAH 1DM0B 1OXVA 1ENFA 1CQVA 1I3QB 3DHQA 1AZQA 1Y1WB 4PMWA 2D62A 1JB3A 2NBFA 5FK9C 3V96A 3CHBD 2N88A 2NVTB 1AN8A 2ICEC 1V1PB 4OGQC 4A3DB 3PUWA 1UUPA 2M9VA 4JK1C 2R6GA 1WTRA 1EZ8A 3NE5B 2A6HD 2B2WA 4C3HG 2E2HB 5C0XH 2PNRC 3M7GA 4G4KA 3P7JA 4HN7A 3OPOA 3WDNA 1II3A 2OF1A 4RCOA 3GTKB 3J81L 1Q12A 4A3IB 1EYCA 1Q90A 4BA1I 5EKKA 2XRSD 2BDOA 1TIID 1LTGD 1XTCD 1Y8PB 3MVVA 3TMEA 2PPBC 4NDXA 4NW2A 3VR2A 4OHJA 4IFDI 1D5MC 2F0JA 4X3TA 4Q5VA 2ID0A 1HHVA 3MXNA 2WP8J 1BCPF 1RCVD 5ELDA 5D3DA 2F0EA 4O42A 3ONAB 2SDFA 3MFYA 1HPCA 1CK1A 3J81E 1IKLA 4KY6A 4KK7A 1JOOA 1JORA 4DAYA 1EY9A 2C5CA 3J7AF 1OXTA 1F2YA 4BBSB 1LT5D 1F9PA 2EYMA 3KUPA 1U4RA 1TWGB 1B44D 3IFTA 1X3QA 4QUCA 3P75A 3OMGA 1RHPA 4DA2A 2QCPX 5J22A 3OWEB 2A6ED 2IPKD 1GUTA 4U68A 1A3TA 5I2YA 3K57A 3UI2A 2RSNA 1W6JA 3NTKA 4DFAA 2RBMA 4FO2A 3SDZA 2IX3A 4C3HB 1BCPB 4TQUS 3NPPA 5C5MA 4OO1H 1GJXA 1H9KA 2WACA 1BDOA 1TS2A 5HURA 1W6KA 3NQIA 2F3WA 3K6OA 3D6WA 1SMYC 1D1KA 2K5WA 4A3KB 3DXJC 2Z4IA 4KY7A 1DONA 4O1NA 1XYIA 5JEAJ 2EY2A 2E2IB 2EYHA 3D4RA 3URYA 2F0TA 3GTGB 2R92B 1STNA 1EU4A 3IAYA 1QB5D 5A35A 3DM1A 1YNNC 2PZUA 2NVQB 3HGBA 4K5XA 1JWMD 1A2TA 1PFNA 2JEAI 2EZVA 2J4XA 3QOJA 4Z9CB 3O13A 4DNTB 3D6CA 3RMHA 5FOBB 1JOKA 1IW7D 5C0XJ 1YNJD 1KNEA 5E1FA 5FKAC 4ID6A 3J7AV 5CV4A 3SVMA 5C3XA 4UAIA 3BDLA 5FO7B 3T13A 5FLXL 1VDZA 5BN4A 3T51B 1FYCA 2B2TA 3MZ5A 5J39A 3RD4A 1SNQA 3HKZB 3HOYB 4XQJA 2L11A 4ZYSA 1STHA 2KCCA 1F2MA 2ZT9C 3NK9A 3HZXA 2K05A 3E0JA 5EQ0A 1U9RA 1WD0A 4FXGC 5G3LF 2PMZB 4A3GB 2A68C 3LWUA 2PQEA 1O78A 1EFID 3H94A 1PZID 1EY7A 1DOKA 4FF1A 1H9RA 3QO2A 1R4PB 4K6DA 3PUZA 1IKMA 2M00A 3A7AB 5ISRA 4B9WA 1JC7A 3M7NA 1TT2A 2BA1A 2WKCA 4X3UA 2R7ZB 1PZKD 3FVQA 3SK5A 1WD1A 5IOCA 3VR3A 5K36G 2F3VA 4LMQD 2HUGA 2BE5C 4KKTA 1F9RA 3HG9A 1DD2A 1Q1EA 2O4XA 1ZYRC 3MHBA 3SR1A 3E6ZX 3S1QB 2VNUD 5EJWA 2DN8A 2HCIA 2EPBA 3HOVB 1RKNA 4F88A 2RDGA 3BVMA 5M5YB 3VA7A 3TZDA 3FPPA 1C8CA 1CZGA 1D1IA 3Q23A 3MXGA 1PTOF 1EU3A 3EQLC 2XSCA 3MWYW 1QG7A 1HA6A 2LKVA 4F87A 2F0FA 4C3JB 1TS4A 2MP1A 3GTPB 1QCBD 3S16B 2KVMA 4HSPA 2PO4A 2IJ0A 4ILWA 5D65A 4RGMA 4WJWA 1FD7D 1WCMB 2NWGA 5E3FA 4HCEA 1CTMA 2LS01 1MI2A 3ITPA 3VR6A 1FNWA 2F0LA 1B53A 3TZUA 4R9WA 1G2TA 4HMJA 1V1OA 2WIIB 1AFPA 3EFXD 1QNUA 5EPKA 1PMRA 5CMDA 1TU2B 4YIJA 1GUGA 1I50B 2PZTA 3V05A 4RGTA 4PQXA 4QCLA 1EY5A 2XWBB 2WAQB 3NXWA 3RUZA 5JPMC 2K7VA 5C4JB 4I7ZC 1A3UA 1UEAB 2K5DA 1Y8OB 1PTOB 1SJED 3I70A 1CZWA 2KCNA 1EIHA 1EOTA 3M4OB 4RAUC 1Y1VB 4L6TB 2A74C 5DNFA 3L7ZC 4EQNA 1A2UA 4OO1I 2B2YC 5CC4A 1D2BA 1U4PA 3MXPA 1S5BD 4KTAA 5DM73 4XDXA 1RF2D 2RDFA 4IZ8A 1PRTC 2G9DA 1WTXA 2DY8A 3S2DB 4XYQA 2F0VA 2B2UC 4ME5A 3A8JE 1SNDA 2MGSA 1MGSA 3SK6A 3PUXA 2EY6A 2IX0A 1C48A 3GTLB 1CHQD 4A3FB 1LTAD 1M8AA 5IIFA 1V43A 3EVQA 4OIKA 1Q3LA 1SMYD 1G8ZD 1O80A 3S15B 3FPUB 3MA2B 3OOCA 3U9SA 2K6AA 1I6HB 4K2KA 4DAVA 2KHSA 4ZKBB 3I8ZA 2J0TD 2QILA 2B63B 1HQMC 3GP7A 4HAEA 1YNND 2Q8RE 1RODA 5I6YA 2F0QA 1JICA 1V8QA 1H9MA 2FMMA 3A54A 4LJZC 4ZLTF 5C4HA 4DU9A 5CV9A 3QB3A 2EVBA 2F0KA 2DNCA 5CV6A 4MHEA 4P2CB 4IQZA 1GHJA 3I4MB 2Z8LA 2EYLA 3TP5A 4TRDA 2EYPA 4KI0A 2RKSA 3NWSA 1ONLA 2O5IC 4XIGS 2F0HA 3OIPA 5LL6S 5LL6X 1HUMA 1BXTA 4TSSA 4X3KA 4G7HC 4H44C 4CJ2C 3FRPB 4IURA 3PV0A 3VYTA 3SK4A 4H7BA 3EJIA 3NHHA 1TWCB 3R3OA 3WOFA 1SNPA 2KEEA 5K36H 2K32A 4CJ1B 3PUYA 5COYA 1SAPA 2XNAC 1PTOH 3P1HA 2K1BA 4IUNA 1AEXA 3VYUA 3OHXC 1ILPA 1EEID 2EE1A 3I72A 2VXWA 4ABNA 3H09A 5DAUA 2B8FA 3Q0AA 1PFMA 1B4OA 4KMUC 2JP1A 4J6HA 3A55A 1PLFA 1STAA 1E2WA 2NTSA 2WV6D 3QWNA 2K5QA 3BZDB 3EA6A 1A15A 1A6XA 2E75C 3G6JB 1SYDA 1OXUA 4PMBA 2BE5D 3TDQA 3K5NA 1A3VA 3LWEA 2F0MA 2O5JC 3M3YB 3GTQB 2B2WC 1LTID 5A2QL 4K5WA 1WTOA 1GUOA 3EROA 2ZXPA 5ELCA 3JAML 1D5ZC 1LABA 3VYRA 4KV6A 4HMIA 2J7ZA 2K28A 4XT3B 3H91A 1EY4A 1VF7A 1IL8A 1ESFA 3I73A 1GOZA 1I4RA 3R8BA 1GXDC 2IX1A 4ZAIA 2I07B 5A2QE 3RZOB 3GTMB 4B08A 5NUCA 4HSVA 1QE6A 2IT1A 1LTRD 5CR3A 4IN3A 3JAME 3AB9A 4U673 3CRKC 5CGKA 2AWOA 5C6AA 1EY8A 1L0XB 3TP7A 3S9WA 4NP5A 2Y0SB 4EQOA 3VA5A 5C5LA 1KDAA 2H1EA 1BOSA 4F8MA 3MAQA 5BN5A 2F0NA 2R3ZA 3LNNA 4KKUA 1KDBA 3FMCA 2RSOA 2FFKB 2NVXB 3N52A 4CBVA 1DZ1A 2B2VC 2HDMA 4EQPA 2DNEA 3K5MA 4L8JA 3DEPA 1SDFA 2A5HA 2EY1A 4ZK9B 5EBDA 1RTOA 2FJ2A 1Z7TA 2BA0A 2L4NA 2A69C 5IT9L 3L9AX 1I6VC 4RHRA 5I6WA 1EYDA 1MSHA 3J7YW 1S5CD 1BUVT 4ZUIA 2PZWA 3S1NB 2K01A 1D5XC 3K59A 1BBXC 3K5LA 1PRTD 3MXUA 3Q24A 3I3CA 3BYTB 1BCPC 4RHSA 1VCIA 3KLSX 2Q8IB 2R61A 1KLUD 5IT9E 3PMFA 2L1BA 4KD4A 3I91A 4H0LC 2KEDA 1EIGA 2AUJD 3GV3A 4E6IA 1LTSD 4K2LA 3X3NA 4DNRB 2NN6G 3S1RB 2HDLA 3T56B 3TSSA 4V190 3SEBA 2YYZA 5I4DA 5ELFA 2QEJC 2JA8B 5EGTA 1Y69U 4K8IA 3HRZC 1KNAA 2F1MA 5KRUA 5D3IB 2F0DA 2X6LA 4KHZA 5EKLA 2PCFB 1PZJD 4FYDA 4A3EB 5FLXE 4DGZA 4C1NK 3Q22A 3NQTA 2B2TC 1QJOA 2F0UA 5C44B 1XWEA 3P20A 3HOWB 1KLGD 4WORA 1TVXA 4PNYA 1AZPA 1QOHA 1LACA 4LK1C 1HFNA 3K0YA 5KGUA 2EJFC 2C9OA 1JE4A 2DY7A 1AW7A 4JBWA 1S5ED 1F77A 3GTOB 4PMCA 2HCCA 1NSNS 4CKBA 3AMUA 1ENAA 2K03A 2XWJB 1HTLD 3LX0A 5M3MB 3J80L 4RH6A 3BYYB 3MEHA 1FR3A 2EYFA 1M4VA 5C0XG 4IUQA 2FHTA 1J8IA 3DWAA 4MN3A 3MFGA 1J9OA 1SJHD 2SNMA 1EQTA 2NTTA 4C3IG 1EZ6A 5E4WC 1F9SA 3NWTA 1U4MA 1ILQA 4XTCS 1HA5A 1R9TB 1GHKA 3HS0C 5EPJA 2I46A 4FF2A 1HRJA 4KN7C 3J80E 1Q1BA 1NUCA 1LLRD 4FNFA 2Z1CA 4CJ0B 2F4IA 1HQRD 1KAAA 3QJYA 2TSSA 3F2UA 5ELBA 3KK7A 2LY7A 1ESRA 2OXPA 1IHZA 2H4OA 1L0YB 2ZXOA 3BG3A 4N9TA 3S2HB 1F2ZA 2B39A 1HCZA 1EQVA 4N9PA 1CI3M 4HR7B 1LT4D 4K6LA 4K14A 2JEBI 4EVOA 4IALA 5EPLA 1X3PA 5DEHA 1TWAB 4KN4C 3DWPA 2FMCA 1IYUA 5LHY1 2Z4HA 4M1UB 4XQQA 3D4WA 1CA5A 1STBA 1JQYD 1XXGA 5KNBA 3C3LA 2B2UA 3M4YA 2ICIA 5IGFA 4RGNA 2VUMB 2CQAA 5CBEE 1UNSA 4RCNA 5JAVA 2N55A 4C3IB 3KBXA 1F9QA 3KF8A 1HUNA 3NTHA 3W3AA 1CT1D 1NCVA 1DXMA 1TKWB 3I4LA 2JA5B 1IW7C 3MC0B 1YNJC 1JOQA 2L9HA 1S5DD 1QNKA 1PTOC 5KNCA 2JE6I 5FO8B 1SE2A 2SNSA 5C3EB 4DN4M 4S3SA 2NZ1D 2D2CC 3IKJA 3PUVA 1K8MA 3BDCA 3T16A 1G91A 2F03A 1Z47A 4XXEA 5HGTA 1BR9A 2A69D 4L63B 3TP6A 1B2TA 2RQXA 4DF7A 1WTWA 1GUNA 2LMCB 3CRLC 3OMCA 1EEFD 1GUWA 4TKOB 3ERQA 1KDCA 1LTBD 3HP3A 2D5DA 4K8JA 1FNUA 1EL0A 3VYSA 1JCKB 4BA2I 1BCPD 3C2PA 4KJOA 3E5SA 5EBCA 5JVH3 5TSSA 3KBGA 4DK1A 4ZKCB 1BNZA 2M2LA 4J8QA 1G291 1CM9A 2NB0A 4GZYC 1G6ZA 1JWSD 1C4QA 4KD3A 2JA6B 4CKCA 3BVGA 4FP5D 1WTPA 1HXYD 3H0GB 3K58A 5C4XB 2OEOA 3TP8A 3ND9A 5IGDA 4FXDA 1X32A 2QDBA 5IODA 1B1ZA 5IGEA 1S4ZA 2A68D 4RA8A 2RDHA 3NBHA 2CVRA 2EOTA 1T5EA 2KUMA 1ENCA 2IW3A 4ZRZA 4RKLA 3PO2B 1UAPA 1NR4A 4IUTA 1Q8IA 4F7XA 3HOZB 3PO3B 5CV7A 4HCSA 1NAPA 3IFDA 5JVG3 3AU7A 3ZYYX 3KLSA 5IGGA 2EJMA 3H6MA 3D3RA 4WRDA 2ENBA 3N6RA 4OL7A 4A3JB 3FKIB 4C56C 1VMPA 3NP8A 1JR0D 2XVSA 3PIO3 1B9NA 3I4NB 1B9MA 1ZYRD 5IGCA 3D4DA 1V1PA 4PV1C 3NUCA 1WTQA 4XT1B 4IFDG 1H9SB 3T53B 3R2TA 1K83B 5CV8A 3H3VC 5C3WA 5M5WB 1STGA 4QB4A 3L3OC 2SOBA 4FXKC 4XYOA 1Y8NB 4RFBA 1GUSA 2MJ8A 1ET6A 4IUUA 2IL8A 1STYA 2O2LD 3FDTA 4BBRB 1H9SA 5JJZA 1NR2A 3W2DA 5K5PA 3NBIA 1DYQA 3S17B 2NVYB 5FO9B 4BS9A 2B2VA 3CKIB 3TN2A 4R8IA 2CW0C 1WTVA 5CBAE 1EWCA 3BVZA 3OWFA 5JOBA 3DMUA 4ODGA 1VMCA 1I4GA 5G3LD 4M8AA 1EWHA 2EYJA 3K5OA 4ZQ3A 5KEEA 1ZXTA 2OT2A 1JWUD 2JSOA 4A93B 2KECA 1ML0D 2E2DC 1ET9A 4NKLA 1SYEA 5I9OA 4ZUJA 4RWSC 5D14A 3CU7A 1STEA 1CQFA 2EDGA 3QIAA 3C1FA 2BOSA 2IWHA 2WKDA 1MD2D 2MUYA 2AQ1B 4R8NA 1LTTD 2E76C 3K7AB 3RLFA 4MIUA 2E74C 1SEBD 5KYLA 4C1NI 2B8GA 4G7OC 2GA4B 4EGVA 1ZEQX 1D6EC 4WFN3 1B50A 2F0SA 1CA6A 4FF3A 1SNMA 2L12A 3KLRA 2NN6I 1MSGA 1PTOD 3C46A 5DM63 2EXZA 2KOLA 5M5XB 2JA7B 2PW7A 1E0BA 2L5TA 5KNDA 3SXHA 3DWQA 1LO5D 4X3SA 2PW5A 1PYWD 1R4QB 4OIJA 1QWYA 3C1EA 2A73B 3M85A 4C3JG 4BY1B 1DJRD 1TS3A 3OIQA 1SSOA 3A8IE 3HOUB 4DK0A 2YU9B 4H13C 4FF4A 1LT6D 3DEOA 2F0GA 5M9OA 4UDUC 5M3FB 4NMZA 3A7LA 1FNVA 1HFGA 2A6HC 2K04A 1HTPA 4QMGA 5JEAG 2BDNA 1RTNA 1EYAA 2E2JB 2X6GA 2F0PA 1BQQT 1U4LA 1PDQA 5I9PA 4KY5A 1SNCA 1MBYA 3Q6SA 1G2SA 5KIXA 3D31A 1LV9A 1XX8A 1EY6A 2KA7A 1I4PA 1I4XA 5E4XA 4QIWB 4CGYB 1FGBD 1PRTF 1DOLA 2BCOA 1SYFA 1PXUA 1RJTA 1AP0A 2VB2X 2D9UA 4B9XA 4CKEA 5ELEA 5C0XI 4XQNA 4RKBA 4AYBB 1OO9B 4RGOS 5T1IA 2AQ3B 3VR5A 2V4DA 2QKIC 2G9HD 3GO5A 2X69A 3QOLA 1TWHB 1BO0A 3HEJA 4KHVA 4K5VA 4IFDH 4HTHA 1SYBA 2JYOA 2F0OA 2Q8TA 1RDPD 2MPMA 2A6EC 3A8KE 4BWGB 3RZDB 2F0IA 1LT3D 3V2TA 4J1MA 3TBIB 5CV5A 1I4HA 4DAPA 2EYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXT A;  1PRT B;  1F77 A;  1SBB B;  4TSS A;  1ESF A;  4ZYS A;  3BYT B;  4UDU C;  1BCP C;  1JCK B;  4RHS A;  3DWP A;  1V1P A;  1GOZ A;  1I4R A;  1TS4 A;  1UUP A;  3KLS X;  1BCP D;  3R8B A;  1BCP B;  1FNV A;  2R61 A;  1KLU D;  1JQY D;  1HTL D;  1XXG A;  5TSS A;  1STE A;  2IJ0 A;  2ICI A;  1TS2 A;  4RGM A;  1MD2 D;  4RH6 A;  3R2T A;  1CHQ D;  1SE3 A;  1FD7 D;  4RGN A;  2AQ1 B;  1LTA D;  1TY2 A;  3BYY B;  1LTT D;  1UNS A;  4RCO A;  1LTR D;  1S5F D;  1M4V A;  2XNA C;  1LTS D;  1PTO H;  1FNW A;  1G8Z D;  1SEB D;  3DWA A;  2XRS D;  1JWS D;  1V1O A;  3MFG A;  3BVG A;  3R2I A;  4RFB A;  1SJH D;  3EFX D;  1LTG D;  1XTC D;  2NTT A;  1L0X B;  3TSS A;  1ET6 A;  1EEI D;  1EFI D;  4O1N A;  1PZI D;  1I4P A;  3SEB A;  5I4D A;  1I4X A;  1HXY D;  5ELF A;  1TY0 A;  2QEJ C;  1CT1 D;  4OHJ A;  3V05 A;  2O2L D;  4RGT A;  1FGB D;  1PRT F;  2XRQ D;  1ET9 A;  1D5M C;  1D6E C;  3URY A;  1QIL A;  1T5X D;  1HA5 A;  5D3I B;  1BCP F;  1RCV D;  1B1Z A;  3MC0 B;  5ELE A;  1SE4 A;  5ELD A;  1S5D D;  3W2D A;  1EU4 A;  5D3D A;  2QIL A;  1SXT A;  1PTO C;  1PZJ D;  3GP7 A;  1CK1 A;  1PZK D;  1PTO D;  1PTO B;  1I4Q A;  1LLR D;  1SE2 A;  4RGO S;  1SJE D;  2RDH A;  2NTS A;  2WV6 D;  1DYQ A;  3BZD B;  3EA6 A;  2AQ3 B;  1JWM D;  2SEB D;  4DXF A;  1HQR D;  2G9H D;  2TSS A;  1CHP D;  5ELB A;  1KLG D;  2J4X A;  4L6T B;  4Z9C B;  3O13 A;  1LT5 D;  1TS5 A;  1EWC A;  3BVZ A;  1KTK A;  3DWQ A;  1L0Y B;  1LO5 D;  2XN9 C;  1RD9 D;  1PYW D;  4L63 B;  1B44 D;  4RHR A;  1ENF A;  1CQV A;  1LTI D;  1I4G A;  1S5B D;  5FKA C;  2RDG A;  3BVM A;  2Z8L A;  4DXG A;  1S5C D;  1RDP D;  5ELC A;  1DJR D;  1TS3 A;  4BWG B;  5FK9 C;  1D5Z C;  1D5X C;  3OWE B;  1EEF D;  1RF2 D;  2IPK D;  4C56 C;  3CHB D;  1LT3 D;  1JR0 D;  1LT4 D;  2AQ2 B;  1LTB D;  4K6L A;  1JWU D;  1AN8 A;  1I4H A;  1EU3 A;  1PRT C;  1PTO F;  1AW7 A;  1FNU A;  2CHB D;  1S5E D;  1V1P B;  1PRT D;  1LT6 D; 
#chains in the Genus database with same CATH topology
 1PRT B;  4FVM A;  1SBB B;  2L55 A;  4A3F G;  1KAB A;  1O7Y A;  1VF5 C;  4KJN A;  1WVL A;  3I90 A;  2B2Y A;  3GV6 A;  4I65 A;  1IYV A;  1XNR L;  4A4I A;  1PFB A;  4LAA A;  2ZXR A;  3EN2 A;  4B3R L;  3HOX B;  2TMP A;  1C9O A;  3FEW X;  1RIP A;  1WFQ A;  3KF8 B;  1E1O A;  2JA7 H;  1Z6H A;  2L0C A;  2EY5 A;  2B63 G;  3QG1 A;  2KQ3 A;  1B3A A;  3OSO A;  1IBM L;  3MTS A;  1ZKO A;  1TY0 A;  1ICW A;  4IUP A;  4TVA B;  1TQO A;  1O7Z A;  4K0K L;  2XRQ D;  5C4Z A;  1AH9 A;  3KLW A;  2RA4 A;  1QIL A;  1T5X D;  4HED A;  2XIW A;  4PZ6 A;  2OTJ A;  5IP7 H;  5KYI A;  4OO1 G;  2NUC A;  2DJF C;  1SYG A;  1SXT A;  3KJP A;  2KJX A;  4YHH Q;  1O7L A;  4JI5 Q;  5IT9 c;  2FIN B;  3PIP 3;  1I4Q A;  4QUF A;  4BY1 H;  4NXN Q;  5T1G A;  2CKZ B;  3PGZ A;  1GVP A;  3HOU H;  2EJG C;  1SNO A;  4J15 A;  2RVL A;  5GAD C;  1KHI A;  2YU9 H;  4CHT B;  4A3M G;  3I4M G;  5FLM G;  1CHP D;  3G7L A;  4A3G H;  5EKI A;  2K33 A;  3KF6 B;  2CW0 D;  2LFN A;  2XN9 C;  3SE0 A;  5M3F H;  4G57 A;  1RD9 D;  1DOM A;  5COR A;  4NPS A;  5IP9 G;  5CYU A;  2HIV A;  2PI2 A;  1YBY A;  4BY7 G;  3U50 C;  3SHL A;  1EY0 A;  4A3B B;  3Q8D A;  4ME3 A;  4DXG A;  4LF8 Q;  3OW7 A;  2NYZ D;  1CFM A;  4C2M B;  4DR3 Q;  2E2J H;  3GTJ B;  1YEZ A;  4OEL B;  1TR5 A;  3NSW A;  1Y1W G;  3U9O A;  2AQ2 B;  1SLJ A;  5FLX c;  2WIN B;  1K8O A;  1AE2 A;  2CHB D;  1SN8 A;  3T1H L;  4Q0F A;  2JXM B;  4R4C A;  3D8G A;  5JPN C;  5JJI A;  2DJG C;  4G7Z C;  4QF4 A;  5BN3 A;  2PYK A;  5I2X A;  3U4Z A;  1XPR A;  1HNX Q;  2Z0S A;  2R93 B;  4KKS A;  2AUK A;  4P72 A;  2I5H A;  3T4A C;  2VB3 X;  2ZJR A;  5IGB A;  4X65 L;  4CDE C;  3A5Z B;  3VR4 A;  2NN6 H;  4ZCK A;  3X3M A;  1SE3 A;  4DUZ L;  1TY2 A;  1S5F D;  1E2V A;  4DUY Q;  1BF4 A;  1DCZ A;  4ULL A;  4V0B A;  1X6O A;  3R93 A;  4DV1 Q;  3BS1 A;  5M5Y H;  2AWN A;  2OWO A;  3R2I A;  1H9J A;  1OXS C;  3ND8 A;  2F0W A;  2JN4 A;  1DGS A;  2MHV A;  3S14 B;  1OXX K;  2B29 A;  3GQB A;  1KIX A;  3DM3 A;  3CQZ B;  4GKJ Q;  4DV0 L;  4IFD J;  1G51 A;  3GD7 A;  1MJC A;  5L37 A;  4JBM A;  3DUZ A;  1HNW L;  1HR0 L;  3A56 A;  1SE4 A;  4C3J H;  3CC7 A;  3NTI A;  3S16 H;  1SFO B;  4JC0 A;  3G6E A;  4LUZ A;  2K50 A;  2UXC Q;  1QVF A;  3SK8 A;  3GDE A;  1N33 L;  1GKH A;  1SYC A;  4A3M B;  1UEB A;  2SEB D;  3S1M B;  5F2D A;  4DXF A;  1K28 A;  5AFW A;  4IUV A;  3WOE A;  1F2L A;  1TS5 A;  2HQE A;  1TWF B;  1KTK A;  3J80 i;  3BDO A;  4Y7N B;  1E2Z A;  5J1Z A;  4BY7 B;  1N32 L;  2QF7 A;  3IL8 A;  2VY3 A;  2WB1 B;  4BBS G;  2UUB L;  1EIY B;  5JEA H;  1DM0 B;  4N8F A;  1OXV A;  1ENF A;  1CQV A;  1I3Q B;  3DHQ A;  2GVA A;  1AZQ A;  1GD7 A;  2VQF Q;  1Y1W B;  4PMW A;  4PZ8 A;  2D62 A;  1JB3 A;  2NBF A;  5FK9 C;  3V96 A;  3HOX H;  3CD6 A;  1HZC A;  3J80 c;  3CHB D;  2N88 A;  3M4Q A;  5C4J H;  2NVT B;  1AN8 A;  2ICE C;  1V1P B;  5LMU L;  4OGQ C;  4A3D B;  3PUW A;  1NJI C;  1UUP A;  1FGU A;  2M9V A;  3HFZ B;  1A0I A;  4JK1 C;  2R6G A;  1WTR A;  1EZ8 A;  3NE5 B;  2A6H D;  2B2W A;  4C3H G;  4X64 L;  2ZM6 L;  3W1G A;  2E2H B;  5C0X H;  2PNR C;  2KBN A;  2Y0S G;  1PH7 A;  4G4K A;  3M7G A;  4IPH A;  3P7J A;  4HN7 A;  3OPO A;  3WDN A;  4OX9 Q;  1II3 A;  2OF1 A;  4RCO A;  3GTK B;  4LFA Q;  3J81 L;  1Q12 A;  2Z6K C;  4A3I B;  1EYC A;  1Q90 A;  4O2D A;  4BA1 I;  1PHJ A;  5EKK A;  2XRS D;  3K80 C;  4JI8 L;  2BDO A;  1TII D;  1LTG D;  1XTC D;  3KDF A;  1Y8P B;  3MVV A;  3TME A;  2PPB C;  4NDX A;  4NW2 A;  3VR2 A;  4A3K G;  1VQO A;  4OHJ A;  4IFD I;  1D5M C;  2F0J A;  4X3T A;  4Q5V A;  2ID0 A;  1HHV A;  2VQE L;  3MXN A;  1UE7 A;  1FJG L;  3S2D H;  3FHW A;  2WP8 J;  1BCP F;  1RCV D;  5ELD A;  1JJ2 A;  4DR6 L;  5D3D A;  2F0E A;  4O42 A;  3ONA B;  2SDF A;  3MFY A;  1HPC A;  4A3B H;  1CK1 A;  4R4T A;  1V1Q A;  1X3G A;  1PH1 A;  2R92 G;  3TEH B;  4C2M H;  3J81 E;  1IKL A;  3GTJ H;  2ZTC A;  4KY6 A;  4KK7 A;  1JOO A;  1JOR A;  4DAY A;  1XPU A;  4B3M Q;  4A3L G;  3CCQ A;  1EY9 A;  2C5C A;  3J7A F;  1OXT A;  1N8R C;  1F2Y A;  3SGI A;  4BBS B;  4QJF A;  1LT5 D;  1F9P A;  2EYM A;  3KUP A;  1U4R A;  1TWG B;  2CWA A;  2R93 H;  1IXR A;  1B44 D;  1EUJ A;  3IFT A;  1UWV A;  1X3Q A;  4QUC A;  4Y52 H;  3P75 A;  3PIO A;  3OMG A;  4DV2 Q;  1RHP A;  4DA2 A;  4GN5 A;  3OTO Q;  1YNX A;  2QCP X;  3CXC A;  5J22 A;  3OWE B;  2A6E D;  2AHO B;  2IPK D;  5ELO A;  1GUT A;  4U68 A;  1A3T A;  1X3F A;  5I2Y A;  3K57 A;  1Q81 C;  4GLA C;  1H95 A;  3UI2 A;  2RSN A;  1W6J A;  3NTK A;  4DFA A;  2RBM A;  4FO2 A;  3SDZ A;  2IX3 A;  3T1Y Q;  3BZC A;  1A62 A;  2GN5 A;  3HKZ G;  4C3H B;  3S14 H;  1BCP B;  1PH5 A;  4TQU S;  1IBL Q;  3NPP A;  3HOY G;  2CWP A;  3CQZ H;  5C5M A;  4MNO A;  4OO1 H;  1GM5 A;  1H9K A;  1GJX A;  2F4V Q;  2WAC A;  1BDO A;  1AE3 A;  1EQQ A;  1QUQ B;  1TS2 A;  4LF6 L;  5HUR A;  2JA8 G;  1W6K A;  4X66 L;  2KHJ A;  3NQI A;  2F3W A;  2RF4 A;  3CCU A;  1SFO H;  3K6O A;  3D6W A;  1SMY C;  1A8V A;  1D1K A;  4GNX B;  2K5W A;  3I4M H;  4A3M H;  4A3K B;  3DXJ C;  5FLM H;  2ES2 A;  3CME A;  3S1M H;  2Z4I A;  4KY7 A;  1DON A;  2VZA A;  4O1N A;  1XYI A;  3CCV A;  5IP9 H;  5JEA J;  2EY2 A;  2E2I B;  2EYH A;  1TWF H;  5C44 G;  5BR8 L;  5IYD H;  4Y7N H;  1ASY A;  3D4R A;  3NEM A;  3OW2 A;  1C7Y A;  4BY7 H;  3URY A;  2F0T A;  3GTG B;  2R92 B;  1STN A;  1EU4 A;  4HJ5 A;  3IAY A;  1I3Q H;  1BBU A;  4JVZ A;  4OWX B;  1QB5 D;  5A35 A;  3DM1 A;  1YNN C;  2PZU A;  2DUD A;  1QZH A;  2NVQ B;  4I7A A;  1VQM A;  1Y1W H;  4L5R C;  4GNX A;  3HGB A;  2R7Z G;  4K5X A;  1JWM D;  1A2T A;  1PFN A;  2JEA I;  2EZV A;  1XNR Q;  2K52 A;  2J4X A;  3UDF A;  3QOJ A;  4Z9C B;  3O13 A;  1KC8 C;  4A3D H;  4DNT B;  3D6C A;  3F2D A;  3RMH A;  4B3R Q;  5FOB B;  1PH4 A;  1JOK A;  1IW7 D;  5C0X J;  1YNJ D;  1KNE A;  5E1F A;  1XNQ L;  3TRZ A;  1TXY A;  4JI1 L;  5FKA C;  5IYB G;  2E2H H;  4ID6 A;  4A3C G;  3J7A V;  1NY4 A;  5CV4 A;  1YZ6 A;  3SVM A;  1CSQ A;  5C3X A;  4UAI A;  3BDL A;  5FO7 B;  3T13 A;  5FLX L;  1VDZ A;  5BN4 A;  3GTK H;  3T51 B;  4AYB E;  1FYC A;  2B2T A;  5M3M G;  1JT8 A;  4K0K Q;  4A3I H;  3MZ5 A;  1CKN B;  5J39 A;  3RD4 A;  1SNQ A;  3HKZ B;  1QVG A;  3HOY B;  4XQJ A;  2L11 A;  4ZYS A;  1STH A;  4GLX A;  2KCC A;  1KQS A;  1F2M A;  2CH4 W;  2ZT9 C;  3NK9 A;  3HZX A;  2K05 A;  3E0J A;  5EQ0 A;  1W2B A;  2H5X A;  1U9R A;  4YCU A;  4IJH A;  1K0R A;  1WD0 A;  5IWA L;  1VQE A;  2HD3 A;  4FXG C;  5G3L F;  1VQP A;  2PMZ B;  4A3G B;  2A68 C;  3S24 A;  3M9B A;  2VS1 A;  1WCM G;  2BH8 A;  3LWU A;  2PQE A;  2MFI A;  3RR5 A;  1HH2 P;  1MKH A;  1EFI D;  1O78 A;  3H94 A;  1PZI D;  1EY7 A;  1DOK A;  2MQH A;  4FF1 A;  1H9R A;  3QO2 A;  5LMN W;  1R4P B;  4K6D A;  4JI7 L;  4BBS H;  3PUZ A;  1IKM A;  2M00 A;  1WJJ A;  1SRO A;  4JI2 L;  1YJ9 A;  2YTV A;  1TWG H;  3A7A B;  5ISR A;  4B9W A;  1JC7 A;  3M7N A;  1TT2 A;  3J7A 5;  2BA1 A;  2WKC A;  2WAQ G;  4X3U A;  2R7Z B;  3T1H Q;  1PZK D;  3FVQ A;  3SK5 A;  1WD1 A;  5IOC A;  2K4K A;  3VR3 A;  5K36 G;  2F3V A;  4LMQ D;  4DV3 L;  2HUG A;  3GTM H;  4CDD C;  2BE5 C;  3I7F A;  4KKT A;  1EFW A;  1F9R A;  3HG9 A;  1DD2 A;  4X65 Q;  1Q1E A;  2Z9H A;  2O4X A;  1ZYR C;  3MHB A;  3SR1 A;  2UUC L;  4DUZ Q;  3KJO A;  3E6Z X;  3S1Q B;  2VNU D;  1Y1V G;  4JOI C;  4C3H H;  4YY3 L;  5EJW A;  2DN8 A;  2HCI A;  4GKK L;  1C0A A;  2EPB A;  3HOV B;  2RCN A;  5GAH C;  1RKN A;  3BJU A;  4DR5 L;  4F88 A;  2RDG A;  3BVM A;  5M5Y B;  3VA7 A;  1JMC A;  1PV4 A;  3TZD A;  3CPW A;  3E9H A;  3FPP A;  2V1C C;  3PSI A;  1C8C A;  1CZG A;  1D1I A;  3Q23 A;  4DV0 Q;  3MXG A;  1SR3 A;  1PTO F;  1EU3 A;  1B7Y B;  1VQA A;  3CAM A;  1P8L A;  3EQL C;  4A3K H;  2XSC A;  3MWY W;  2NVX H;  1QG7 A;  2VUM G;  4MTK A;  1Q8K A;  1HNW Q;  1HA6 A;  1HR0 Q;  2LKV A;  4F87 A;  2ZJQ A;  2F0F A;  4C3J B;  1TS4 A;  2MP1 A;  3GTP B;  1QCB D;  3S16 B;  3OYY A;  4BXX G;  2E2I H;  4JBJ A;  1N33 Q;  2KVM A;  3DLL A;  4HSP A;  2PO4 A;  2IJ0 A;  2AKW B;  1X65 A;  4ILW A;  5D65 A;  4RGM A;  3GTG H;  4WJW A;  2EXD A;  2R92 H;  1FD7 D;  1WCM B;  2NWG A;  5E3F A;  4HCE A;  2PQA A;  5J3B A;  1CTM A;  5AJ3 L;  3CCL A;  2LS0 1;  1MI2 A;  3ITP A;  3VR6 A;  2NVQ H;  1FNW A;  2F0L A;  1B53 A;  3TZU A;  4R9W A;  1G2T A;  1FL0 A;  1N32 Q;  4HMJ A;  5IYC G;  1V1O A;  2WII B;  1HJP A;  2UUB Q;  2IY5 B;  1AFP A;  3EFX D;  1QNU A;  5EPK A;  1L2F A;  4UPA A;  3F2B A;  1PMR A;  5CMD A;  1TU2 B;  1XMQ L;  4YIJ A;  5DLQ E;  1GUG A;  3CF5 A;  1I50 B;  4AH6 A;  2PZT A;  3V05 A;  4RGT A;  4UY8 C;  4PQX A;  4QCL A;  1EY5 A;  2XWB B;  3PCO B;  4L5T A;  2WAQ B;  3NXW A;  3RUZ A;  4DPG A;  5JPM C;  3PF5 A;  2K7V A;  5C4J B;  4I7Z C;  1A3U A;  1YIT A;  1BVS A;  1UEA B;  1N34 L;  5LMU Q;  2K5D A;  1Y8O B;  1PTO B;  3I55 A;  1SJE D;  3I70 A;  1XPO A;  4IPD A;  1CZW A;  2KCN A;  1EIH A;  1EOT A;  3M4O B;  4RAU C;  4X64 Q;  1Y1V B;  4L6T B;  1X56 A;  2A74 C;  5DNF A;  1XMO L;  3HOY H;  3S1R H;  3L7Z C;  4EQN A;  1A2U A;  3F8T A;  4OO1 I;  1M90 C;  2B2Y C;  5CC4 A;  4JI0 L;  1J5E L;  1D2B A;  2UU9 L;  1U4P A;  2JA8 H;  3MXP A;  1S5B D;  4KTA A;  5DM7 3;  4JI8 Q;  4XDX A;  1HNZ L;  1RF2 D;  2RDF A;  4IZ8 A;  1L1O B;  1PRT C;  2VQE Q;  1FJG Q;  2G9D A;  1WTX A;  1KXL A;  2R7F A;  2DY8 A;  3RN2 A;  1VQ9 A;  3S2D B;  4XYQ A;  4UHV A;  2F0V A;  2B2U C;  4ME5 A;  3A8J E;  1SND A;  2LXJ A;  2MGS A;  2JA6 G;  3FP9 A;  1LYL A;  1MGS A;  4FDB A;  2N8N A;  1MHW C;  3SK6 A;  1X3E A;  3PUX A;  2EY6 A;  2IX0 A;  4OON A;  4OEM B;  1C48 A;  3GTL B;  2OCE A;  3H0G G;  1CHQ D;  4A3F B;  1LTA D;  1M8A A;  2XGT A;  5IIF A;  5C4X G;  1V43 A;  2BH2 A;  2R7Z H;  3EVQ A;  4OIK A;  1Q3L A;  1SMY D;  1G8Z D;  1O80 A;  1L1O A;  4CDC C;  3S15 B;  3MA2 B;  3FPU B;  3OOC A;  3U9S A;  2K6A A;  1I6H B;  4NXM L;  4K2K A;  4HJ7 A;  4P75 A;  3ERS X;  3PIP A;  4DAV A;  3CCM A;  3GTO H;  3S1Q H;  2KHS A;  4ZKB B;  1X9N A;  3I8Z A;  2J0T D;  1NNX A;  4A3C H;  3HOV H;  2QIL A;  2B63 B;  1HQM C;  3GP7 A;  1W3S A;  3HOZ G;  4HAE A;  1YNN D;  2Q8R E;  1ROD A;  5I6Y A;  5M3M H;  5HY6 A;  2F0Q A;  1QVC A;  1JIC A;  2IHE A;  1V8Q A;  1H9M A;  1YJW A;  1U0L A;  2FMM A;  1RL2 A;  3A54 A;  4JI3 L;  4GN4 B;  2QA4 A;  4LJZ C;  4ZLT F;  3F1Z A;  4LF6 Q;  5C4H A;  4X66 Q;  4DU9 A;  1VQ5 A;  3GTP H;  5CV9 A;  3I4N G;  3QB3 A;  2EVB A;  2F0K A;  2DNC A;  4P71 A;  5CV6 A;  4MHE A;  4P2C B;  4IQZ A;  1D7Q A;  1GHJ A;  3I4M B;  1EIF A;  2Z8L A;  2EYL A;  3TP5 A;  4HID A;  4TRD A;  3J81 j;  2EYP A;  4KI0 A;  1WCM H;  2RKS A;  3NWS A;  1ONL A;  2O5I C;  2UXB L;  5BR8 Q;  4XIG S;  2F0H A;  3OIP A;  5LL6 S;  5LL6 X;  1HUM A;  1BXT A;  4TSS A;  4X3K A;  4G7H C;  3NEN A;  4H44 C;  4CJ2 C;  3FRP B;  3I56 A;  4HJ9 A;  4IUR A;  1I50 H;  2Q2I A;  3PV0 A;  3VYT A;  3SK4 A;  4H7B A;  3EJI A;  3NHH A;  1TWC B;  5GAG C;  4X6A H;  3R3O A;  3WOF A;  1SNP A;  2XTI A;  2KEE A;  5K36 H;  2K32 A;  4LF4 L;  4CJ1 B;  3PUY A;  5COY A;  1VS0 A;  1SAP A;  1XJV A;  2XNA C;  3STB C;  1PTO H;  3P1H A;  2K1B A;  4IUN A;  1AEX A;  3KDF B;  4BBR G;  3VYU A;  1IYJ B;  3OHX C;  1ILP A;  3ZJY C;  1K8A C;  1XNQ Q;  2Z6K A;  1EEI D;  4JI1 Q;  2EE1 A;  3I72 A;  2VXW A;  3M4O H;  1Y1V H;  4ABN A;  4JI4 L;  3H09 A;  5DAU A;  3MXN B;  2B8F A;  3Q0A A;  1PFM A;  1B4O A;  4KMU C;  3KYH C;  2JP1 A;  4J6H A;  4R4I A;  3W1B A;  3A55 A;  1PLF A;  2RCF A;  1STA A;  2UXD Q;  1E2W A;  4DAY B;  4P74 A;  2NTS A;  1WI5 A;  2WV6 D;  1Q82 C;  3QWN A;  2K5Q A;  3BZD B;  3EA6 A;  1A15 A;  1A6X A;  2E75 C;  3G6J B;  1SYD A;  2VUM H;  1OXU A;  1S3O A;  4PMB A;  3CCS A;  2BE5 D;  3TDQ A;  4AQY L;  3K5N A;  4JI6 L;  1A3V A;  2OQ0 A;  3LWE A;  2F0M A;  1IBK L;  2O5J C;  5IWA Q;  3M3Y B;  4A93 G;  3GTQ B;  2OTL A;  2B2W C;  1U5K A;  1FVI A;  1LTI D;  3U4V A;  5A2Q L;  5H1S E;  4DV6 L;  4DV7 L;  4K5W A;  1WTO A;  1GUO A;  3ERO A;  2ZXP A;  4HJ8 A;  3GTL H;  5ELC A;  3JAM L;  4A3F H;  1D5Z C;  1VQ7 A;  1LAB A;  3VYR A;  4JI7 Q;  4KV6 A;  4HMI A;  2J7Z A;  2K28 A;  4XT3 B;  4JI2 Q;  3H91 A;  1EY4 A;  1VF7 A;  1IL8 A;  1ESF A;  1UE5 A;  2K14 A;  3S15 H;  4KHP L;  3I73 A;  1PA6 A;  1GOZ A;  1I4R A;  3R8B A;  1HZA A;  1I6H H;  1EQR A;  4JBK A;  4OWT B;  1GXD C;  1VQ4 A;  5LMN L;  2IX1 A;  1KL9 A;  3CCE A;  4ZAI A;  4DV3 Q;  2I07 B;  5A2Q E;  3RZO B;  3GTM B;  4B08 A;  5NUC A;  2F3I A;  4HSV A;  1QE6 A;  2IT1 A;  4LUV A;  1IL2 A;  2B63 H;  1LTR D;  5CR3 A;  1X55 A;  4IN3 A;  3JAM E;  3AB9 A;  2UUC Q;  4U67 3;  2E5L L;  3CRK C;  5CGK A;  2AWO A;  4YY3 Q;  5C6A A;  1EY8 A;  1O7I A;  4GKK Q;  1L0X B;  3ULP A;  3TP7 A;  3S9W A;  4NP5 A;  2Y0S B;  1MJE A;  1YHB A;  4EQO A;  3VA5 A;  3RNU A;  5C5L A;  1IZ6 A;  4DR5 Q;  1KDA A;  1K3R A;  2H1E A;  1BOS A;  4F8M A;  3MAQ A;  5BN5 A;  2JA7 G;  2F0N A;  2R3Z A;  1B70 B;  4MTN A;  3W5O A;  1B8A A;  3LNN A;  4DNI A;  4KKU A;  1KDB A;  3K8A A;  4B3S L;  5IY0 A;  3FMC A;  2RSO A;  2FFK B;  2NVX B;  3CPF A;  3N52 A;  4CBV A;  1DZ1 A;  2B2V C;  2HDM A;  4EQP A;  4A3E G;  2DNE A;  3K5M A;  4L8J A;  3DEP A;  4IOA A;  1SDF A;  2A5H A;  2EY1 A;  4ZK9 B;  3TQY A;  1JJG A;  5EBD A;  4BY1 G;  1RTO A;  3PF4 A;  2FJ2 A;  1Z7T A;  2BA0 A;  4OWW B;  2L4N A;  3HOW G;  2A69 C;  5AJ3 Q;  5IT9 L;  3L9A X;  1I6V C;  4RHR A;  5I6W A;  1EYD A;  3H0G H;  3D0F A;  1MSH A;  3E3X A;  3TRE A;  1TWC H;  3J7Y W;  3E9I A;  1E3P A;  4B3T L;  1S5C D;  1BUV T;  4ZUI A;  2PZW A;  3S1N B;  2K01 A;  3K7U C;  1XMQ Q;  2DGY A;  1VQN A;  1D5X C;  3K59 A;  1WYD A;  3ER0 A;  4GN3 B;  1PH8 A;  3H3V H;  4DR7 L;  5JJK A;  1BBX C;  3UDI A;  3K5L A;  1PRT D;  1S72 A;  4AIM A;  3MXU A;  3Q24 A;  3I3C A;  2WFW A;  3BYT B;  1BCP C;  4QIW E;  4RHS A;  1YHQ A;  1VCI A;  2NZH A;  3KLS X;  2Q2U A;  2Q8I B;  2R61 A;  1KLU D;  3TS0 A;  4A75 A;  1S40 A;  4YWL A;  3CCJ A;  3PMF A;  5IT9 E;  1LTL A;  2L1B A;  4KD4 A;  1IBM Q;  3I91 A;  3AFP A;  3HOZ H;  4H0L C;  2KED A;  5ELN A;  4OXP A;  1EIG A;  2AUJ D;  4DKA C;  3GV3 A;  4E6I A;  4GNX C;  1XMO Q;  1E22 A;  1LTS D;  4QQB X;  2RHS B;  4K2L A;  3X3N A;  4DNR B;  2NN6 G;  3S1R B;  2QEX A;  1PFS A;  4JI0 Q;  2HDL A;  3T56 B;  3TSS A;  1J5E Q;  2UU9 Q;  4V19 0;  3SEB A;  2YYZ A;  5I4D A;  2CCZ A;  4LF7 L;  4AYB G;  5ELF A;  2QEJ C;  2JA8 B;  5EGT A;  4LWC A;  1Y69 U;  4K8I A;  2VW9 A;  3HRZ C;  3I4N H;  1YI2 A;  1HNZ Q;  1KNA A;  3PQI A;  2F1M A;  5KRU A;  5FJ8 G;  3M3Y H;  5D3I B;  1I94 L;  2F0D A;  3GTQ H;  2X6L A;  4KHZ A;  5EKL A;  2PCF B;  1PZJ D;  4FYD A;  4A3E B;  5FLX E;  4YCW A;  4DGZ A;  2P5Z X;  4C1N K;  3Q22 A;  4MZ9 A;  3NQT A;  2B2T C;  1QJO A;  2F0U A;  5C44 B;  4GOP B;  1XWE A;  3P20 A;  5M5W H;  4IJL A;  3MEF A;  1PVO A;  3HOW B;  1KLG D;  4HIM A;  4LW1 A;  1PH2 A;  4WOR A;  4YWK A;  1TVX A;  4DAM A;  3J81 i;  5HGQ A;  4PNY A;  4JOI A;  1QOH A;  1AZP A;  1LAC A;  4LK1 C;  3RZO H;  1HFN A;  3K0Y A;  1CSP A;  5EAY A;  5KGU A;  4NXM Q;  2EJF C;  3ULJ A;  2C9O A;  1JE4 A;  4GOP A;  4JYA L;  2DY7 A;  1AW7 A;  4JBW A;  1S5E D;  1F77 A;  3GTO B;  4PMC A;  3J81 c;  2HCC A;  3HOX G;  3AQQ A;  1NSN S;  4JPB W;  1LUZ A;  5E7N A;  3S17 H;  2R7D A;  4CKB A;  2PI2 E;  3L0O A;  4LFC L;  4ALP A;  3AMU A;  2A1A A;  1ENA A;  2K03 A;  2XWJ B;  1HTL D;  3LX0 A;  4LF5 L;  2ZTD A;  5M3M B;  3BU2 A;  3J80 L;  2PQA B;  1PYS B;  4RH6 A;  3CC2 A;  5GRO A;  2LXK A;  3BYY B;  4IPG A;  3MEH A;  1FR3 A;  2EYF A;  1M4V A;  4JI3 Q;  4JCV E;  3AEV A;  5C0X G;  4IUQ A;  2FHT A;  4IPC A;  3STB D;  1J8I A;  3DWA A;  4MN3 A;  3MFG A;  1J9O A;  1SJH D;  2K5V A;  2SNM A;  1EQT A;  1SRU A;  2NTT A;  3RLO A;  5E4W C;  1EZ6 A;  4C3I G;  1F9S A;  1N36 L;  1EYG A;  2YTY A;  1VQD A;  4LNQ A;  3NWT A;  4R4Q A;  1U4M A;  1ILQ A;  4PZ7 A;  4RMF A;  4XTC S;  1HA5 A;  1R9T B;  1GHK A;  3CW2 C;  3HS0 C;  5EPJ A;  2UXB Q;  2I46 A;  4FF2 A;  1VQK A;  1HRJ A;  4KN7 C;  3J80 E;  2JA5 G;  4A3L H;  1Q1B A;  1NUC A;  1P16 A;  1LLR D;  4LFB L;  3S1N H;  4FNF A;  1SMX A;  2Z1C A;  4CJ0 B;  2F4I A;  1HQR D;  5C3E G;  1KAA A;  3QJY A;  2TSS A;  3F2U A;  5ELB A;  3KK7 A;  2LY7 A;  1ESR A;  2OXP A;  4LF9 L;  1IHZ A;  2H4O A;  1L0Y B;  2ZXO A;  3BG3 A;  4LF4 Q;  4N9T A;  4JG2 A;  3S2H B;  1HZ9 A;  1F2Z A;  2RHQ B;  2B39 A;  2IHF A;  4DV4 L;  1HCZ A;  1WTH A;  1EQV A;  4N9P A;  2R93 G;  1ICF B;  4JI4 Q;  1CI3 M;  4HR7 B;  4KLK A;  2ZM6 Q;  1LT4 D;  4K6L A;  4K14 A;  2JEB I;  3G71 A;  2UUA L;  4EVO A;  4IAL A;  5EPL A;  1X3P A;  5DEH A;  1TWA B;  4KN4 C;  5M5X H;  3DWP A;  2FMC A;  1YIJ A;  1IYU A;  5LHY 1;  1E1T A;  2Z4H A;  4M1U B;  4XQQ A;  3D4W A;  1CA5 A;  1STB A;  1JQY D;  1E7Z A;  4A76 A;  1XXG A;  5KNB A;  3C3L A;  2B2U A;  3M4Y A;  2ICI A;  5IGF A;  4RGN A;  3RLN A;  2JK8 A;  2VUM B;  2CQA A;  5CBE E;  4AQY Q;  1UNS A;  1UE6 A;  4DK3 C;  4A3E H;  4RCN A;  4JI6 Q;  5JAV A;  2N55 A;  4C3I B;  1IBK Q;  3KBX A;  1L0W A;  4WJ4 A;  2Q2T A;  4DR6 Q;  1F9Q A;  4DV5 L;  5C44 H;  3G4S A;  3KF8 A;  1HUN A;  1Q46 A;  3NTH A;  3W3A A;  4DV6 Q;  4DV7 Q;  3HOW H;  1CT1 D;  1NCV A;  2I5M X;  2WB1 E;  4RG1 A;  1DXM A;  1VQF A;  1TKW B;  3I4L A;  2JA5 B;  1JE5 A;  5GQO A;  1IW7 C;  4DR4 L;  3MC0 B;  1YNJ C;  1JOQ A;  4YWM A;  2L9H A;  1S5D D;  1QNK A;  1PTO C;  5IYD G;  5KNC A;  2KCM A;  2A8V A;  2ZTE A;  2JE6 I;  5FO8 B;  1K9M C;  2WB1 G;  1SE2 A;  2SNS A;  5C3E B;  3H3V I;  4DR2 L;  4HJA A;  4KHP Q;  4DN4 M;  4S3S A;  2NZ1 D;  5LMN Q;  2HHH L;  2D2C C;  3IKJ A;  4R4O A;  3PUV A;  3RN5 A;  1K8M A;  3BDC A;  4X62 L;  3T16 A;  1G91 A;  5IYB H;  1VQI A;  3PO2 G;  2F03 A;  1LM0 A;  1Z47 A;  3KF6 A;  4XXE A;  5HGT A;  1BR9 A;  2A69 D;  4L63 B;  3TP6 A;  3J7Z C;  1B2T A;  1A63 A;  4DR1 L;  2E5L Q;  4A3D G;  2RQX A;  3PO3 G;  4DF7 A;  3G48 A;  1YHA A;  1WTW A;  1GUN A;  3I2Z A;  2LMC B;  3CRL C;  3OMC A;  1EEF D;  1GUW A;  4TKO B;  1L1O C;  2YV5 A;  3ERQ A;  1KDC A;  1LTB D;  3HP3 A;  2D5D A;  1XTD A;  1FNU A;  4K8J A;  3CMA A;  4A3J G;  1EL0 A;  3FKI G;  3VYS A;  1JJC B;  1JCK B;  2OQK A;  2E8G A;  4JV5 L;  1QZG A;  4A3I G;  1BCP D;  4BA2 I;  1VQH A;  4B3S Q;  5FJ8 H;  4QL5 A;  3C2P A;  4KJO A;  3E5S A;  5EBC A;  2VL6 A;  5JVH 3;  5TSS A;  2GVB A;  4LUO A;  3KBG A;  1VQC A;  1TWH H;  1R9T H;  1UE1 A;  4DK1 A;  4ZKC B;  3UDX A;  1BNZ A;  1KRS A;  2M2L A;  4J8Q A;  1G29 1;  1CM9 A;  3NBH B;  2NB0 A;  3KOJ A;  4GZY C;  1G6Z A;  4L5Q A;  1JWS D;  1C4Q A;  1NMG A;  4KD3 A;  2JA6 B;  4CKC A;  3BVG A;  4FP5 D;  3ICE A;  1WOC A;  3TS2 A;  3RZD H;  1WTP A;  1HXY D;  3H0G B;  3K58 A;  1KD1 C;  1NE3 A;  4EQ5 A;  4B3T Q;  5C4X B;  2OEO A;  3TP8 A;  3ND9 A;  3K81 C;  5IGD A;  4FXD A;  1K3B C;  1X32 A;  4IO9 A;  2QDB A;  3K0X A;  5IOD A;  1PH3 A;  3S2H H;  1B1Z A;  4DR7 Q;  3UE1 A;  5IGE A;  1S4Z A;  2A68 D;  2QGQ A;  1EOV A;  3UDG A;  4RA8 A;  3EBE A;  2RDH A;  3NBH A;  1BBW A;  2CVR A;  2EOT A;  1T5E A;  2KUM A;  1ENC A;  3QR8 A;  2IW3 A;  1VQ6 A;  4ZRZ A;  3CC4 A;  1MIU A;  4RKL A;  3PO2 B;  3KFU A;  1UAP A;  1NR4 A;  3CP0 A;  4IUT A;  1Q8I A;  2Y0S E;  4F7X A;  1CKM A;  1TWA H;  3HOZ B;  1NMF A;  3PO3 B;  5CV7 A;  4HCS A;  1NAP A;  3IFD A;  5JVG 3;  3AU7 A;  2EIF A;  4UP7 A;  2FXQ A;  1YJN A;  3ZYY X;  2ZJP A;  3KLS A;  2NZO A;  5IGG A;  2PNH A;  2EJM A;  3H6M A;  3D3R A;  2N3S A;  4WRD A;  4LF7 Q;  2LSS A;  2ENB A;  3N6R A;  4OL7 A;  4A3J B;  2MNA A;  3FKI B;  4C56 C;  1VMP A;  3NP8 A;  2N49 A;  1JR0 D;  2EQS A;  2XVS A;  3PIO 3;  2CQO A;  4C3I H;  2ASB A;  1B9N A;  4BXX H;  3I4N B;  1B9M A;  4YHH L;  4JI5 L;  1I94 Q;  1ZYR D;  4NXN L;  5IGC A;  3D4D A;  1V1P A;  4PV1 C;  3JC6 6;  4O0A A;  3NUC A;  1WTQ A;  1PH9 A;  4XT1 B;  2JA5 H;  4IFD G;  1G6P A;  1H9S B;  3T53 B;  5IYC H;  1N9W A;  1K83 B;  3R2T A;  5CV8 A;  3H3V C;  5C3W A;  5M5W B;  1STG A;  4QB4 A;  3HKS A;  4GS3 A;  4HIK A;  3L3O C;  5C3E H;  2SOB A;  4FXK C;  2L15 A;  4XYO A;  1Y8N B;  2KCT A;  4NB3 A;  4RFB A;  1GUS A;  1K0S A;  4YCV A;  4LF8 L;  2MJ8 A;  1ET6 A;  4IUU A;  2JQO A;  2Q2H A;  4DR3 L;  2IL8 A;  1STY A;  5IE8 A;  2O2L D;  3UE0 A;  3FDT A;  1YVC A;  1Z9F A;  3L2P A;  1VQL A;  2HIX A;  4BBR B;  1H9S A;  5JJZ A;  1NR2 A;  3EIV A;  1Q7Y C;  3W2D A;  5K5P A;  4JYA Q;  1HNX L;  4N8X 1;  3BZK A;  2D0P A;  3NBI A;  1DYQ A;  2I5L X;  3S17 B;  2NVY B;  3HKZ E;  2K75 A;  5FO9 B;  4BS9 A;  4LFC Q;  1KRT A;  4LF5 Q;  2B2V A;  3CKI B;  1Y14 B;  3TN2 A;  4R8I A;  2CW0 C;  2K5N A;  4DUY L;  1WTV A;  5CBA E;  2K5H A;  1EWC A;  5GAE C;  3BVZ A;  3OWF A;  5JOB A;  4DV1 L;  2F52 A;  3DMU A;  4ODG A;  1HR0 W;  2ATW A;  1VMC A;  1I4G A;  5G3L D;  4M8A A;  5IP7 G;  1CKO A;  4GKJ L;  1T9H A;  1N36 Q;  2PMZ E;  1EWH A;  1NBW A;  2EYJ A;  1PYB A;  1B3Q A;  3K5O A;  4ZQ3 A;  5KEE A;  1ZXT A;  2YTX A;  2OT2 A;  1JWU D;  2JSO A;  4A93 B;  4WJ3 M;  2KEC A;  1ML0 D;  1K73 C;  3HOU G;  2E2D C;  2JA6 H;  1ET9 A;  2UXC L;  3IRB A;  4NKL A;  3WWV A;  3H15 A;  1SYE A;  1OTC A;  4A3G G;  2B3G A;  1J6Q A;  4H02 A;  4GLV B;  5I9O A;  3LGJ A;  5M3F G;  4ZUJ A;  5C4X H;  4LFB Q;  4RWS C;  5D14 A;  3CU7 A;  1STE A;  1CQF A;  2EDG A;  3B6Y A;  3QIA A;  3C1F A;  1BKB A;  2BOS A;  2IWH A;  2WKD A;  1MD2 D;  2MUY A;  2AQ1 B;  4R8N A;  1LTT D;  3A5U A;  1QUQ A;  2E76 C;  3K7A B;  3RLF A;  4LF9 Q;  4MIU A;  2KEN A;  2E74 C;  3ULL A;  1SEB D;  1E24 A;  1X54 A;  4UP8 A;  5KYL A;  1N34 Q;  2VQF L;  3AYH B;  4C1N I;  2B8G A;  3PO2 H;  2MO0 A;  3VDY A;  1VQB A;  4DV4 Q;  2NVT H;  4G7O C;  2HT1 A;  2GA4 B;  4EGV A;  1ZEQ X;  1D6E C;  4WFN 3;  1B50 A;  2F0S A;  3PO3 H;  1JB7 A;  2I0Q A;  1CA6 A;  4FF3 A;  2Z6B A;  1SNM A;  2L12 A;  2UUA Q;  3KLR A;  2NN6 I;  1MSG A;  1PTO D;  3C46 A;  5DM6 3;  2EXZ A;  1EWI A;  4CDF C;  2KOL A;  5M5X B;  3HOV G;  2JA7 B;  3F2C A;  4HIO A;  4A3J H;  2PW7 A;  3FKI H;  1E0B A;  1K8G A;  2L5T A;  4OX9 L;  5KND A;  3SXH A;  2JJQ A;  4LFA L;  4PG3 A;  2JA9 A;  3DWQ A;  2G5D A;  1LO5 D;  4X3S A;  2CFM A;  2PW5 A;  2UXD L;  1V9P A;  1PYW D;  1R4Q B;  4OIJ A;  1QWY A;  1M1K C;  3C1E A;  2A73 B;  2CH4 A;  3E0E A;  4DV5 Q;  3M85 A;  4C3J G;  4BY1 B;  1ASZ A;  1DJR D;  1TS3 A;  3OIQ A;  1K83 H;  4R1J A;  1SSO A;  3A8I E;  3HOU B;  4DK0 A;  2YU9 B;  2D0O A;  4H13 C;  3I4O A;  1VQG A;  4FF4 A;  2ALY B;  1LT6 D;  3DEO A;  4DR4 Q;  2F0G A;  5M9O A;  1CKN A;  4UDU C;  5M3F B;  4L5S A;  4NMZ A;  4P73 A;  3A7L A;  5JJL A;  2WAQ E;  1FNV A;  1HFG A;  2A6H C;  4B3M L;  2K04 A;  1HTP A;  4DR2 Q;  4QMG A;  4POF A;  4DK6 C;  5JEA G;  2HQL A;  2C35 B;  1KAW A;  2BDN A;  1RTN A;  1EYA A;  4BBR H;  2HHH Q;  1CUK A;  2E2J B;  2X6G A;  2F0P A;  1BQQ T;  1U4L A;  1PDQ A;  2AMC B;  5I9P A;  4KY5 A;  1SNC A;  4UP9 A;  1MBY A;  3A0J A;  4X62 Q;  3Q6S A;  1G2S A;  5KIX A;  2N78 A;  3D31 A;  4DV2 L;  1D8L A;  3OTO L;  1LV9 A;  1XX8 A;  1EY6 A;  2NVY H;  4JW0 A;  4DR1 Q;  2KA7 A;  1I4P A;  1I4X A;  1HZB A;  1Q86 C;  5E4X A;  4QIW B;  4CGY B;  1FGB D;  1PRT F;  1DOL A;  2BCO A;  1SYF A;  1PXU A;  1RJT A;  3M4P A;  1AP0 A;  4EX5 A;  3A74 A;  2VB2 X;  3JAM i;  2D9U A;  4B9X A;  3AFQ A;  5ELE A;  4CKE A;  3T1Y L;  5C0X I;  4XQN A;  4POG A;  4RKB A;  1IBL L;  1I5F A;  1NTG A;  4IOC A;  3NEL A;  4AYB B;  1OO9 B;  4RGO S;  5T1I A;  4GOP C;  2F4V L;  4JV5 Q;  2AQ3 B;  3VR5 A;  2A19 A;  1SE8 A;  2V4D A;  2QW7 A;  2QKI C;  2G9H D;  4A93 H;  3GO5 A;  3JAM c;  2X69 A;  3QOL A;  1TWH B;  1BO0 A;  3HEJ A;  3U58 A;  4KHV A;  4APV A;  3CCR A;  2KHI A;  1VQ8 A;  2QDL A;  4K5V A;  4IFD H;  4HTH A;  2MO1 A;  1SYB A;  2JYO A;  2F0O A;  2Q8T A;  1RDP D;  1GO3 E;  2MPM A;  2A6E C;  3A8K E;  4BWG B;  4A3B G;  4QY7 A;  1VQJ A;  4QGU A;  3RZD B;  2F0I A;  1LT3 D;  3V2T A;  3K7A H;  4J1M A;  5CV5 A;  3TBI B;  1I4H A;  1PH6 A;  4DAP A;  2EYO A; 
#chains in the Genus database with same CATH homology
 1PRT B;  4FVM A;  1SBB B;  2L55 A;  1KAB A;  1O7Y A;  1VF5 C;  4KJN A;  1WVL A;  3I90 A;  2B2Y A;  3GV6 A;  4I65 A;  1IYV A;  1PFB A;  4LAA A;  2ZXR A;  3HOX B;  2TMP A;  3FEW X;  1Z6H A;  2L0C A;  2EY5 A;  3QG1 A;  2KQ3 A;  1B3A A;  3OSO A;  3MTS A;  1ZKO A;  1TY0 A;  1ICW A;  4IUP A;  1TQO A;  1O7Z A;  2XRQ D;  5C4Z A;  2RA4 A;  1QIL A;  1T5X D;  4HED A;  2XIW A;  5KYI A;  4OO1 G;  2NUC A;  1SYG A;  1SXT A;  2KJX A;  1O7L A;  2FIN B;  3PIP 3;  1I4Q A;  4QUF A;  5T1G A;  2EJG C;  1SNO A;  2RVL A;  4CHT B;  1CHP D;  3G7L A;  5EKI A;  2K33 A;  2CW0 D;  2LFN A;  2XN9 C;  3SE0 A;  4G57 A;  1RD9 D;  1DOM A;  5COR A;  5CYU A;  3SHL A;  1EY0 A;  4A3B B;  4DXG A;  3OW7 A;  2NYZ D;  1CFM A;  4C2M B;  3GTJ B;  1TR5 A;  3NSW A;  3U9O A;  2AQ2 B;  2WIN B;  1K8O A;  2CHB D;  4Q0F A;  2JXM B;  3D8G A;  5JPN C;  4G7Z C;  5I2X A;  5BN3 A;  2PYK A;  4QF4 A;  2R93 B;  4KKS A;  2AUK A;  3T4A C;  2VB3 X;  5IGB A;  3VR4 A;  2NN6 H;  3X3M A;  1SE3 A;  1TY2 A;  1S5F D;  1E2V A;  1BF4 A;  1DCZ A;  4ULL A;  4V0B A;  3R93 A;  3BS1 A;  2AWN A;  3R2I A;  1H9J A;  1OXS C;  3ND8 A;  2F0W A;  2MHV A;  3S14 B;  1OXX K;  3GQB A;  3CQZ B;  4IFD J;  3GD7 A;  3DUZ A;  3A56 A;  1SE4 A;  3NTI A;  1SFO B;  3SK8 A;  1SYC A;  4A3M B;  2SEB D;  3S1M B;  5F2D A;  4DXF A;  5AFW A;  4IUV A;  3WOE A;  1F2L A;  1TS5 A;  2HQE A;  1TWF B;  1KTK A;  3BDO A;  4Y7N B;  1E2Z A;  5J1Z A;  4BY7 B;  2QF7 A;  3IL8 A;  2WB1 B;  5JEA H;  1DM0 B;  1OXV A;  1ENF A;  1CQV A;  1I3Q B;  3DHQ A;  1AZQ A;  1Y1W B;  4PMW A;  2D62 A;  1JB3 A;  2NBF A;  5FK9 C;  3V96 A;  3CHB D;  2N88 A;  2NVT B;  1AN8 A;  2ICE C;  1V1P B;  4OGQ C;  4A3D B;  3PUW A;  1UUP A;  2M9V A;  4JK1 C;  2R6G A;  1WTR A;  1EZ8 A;  3NE5 B;  2A6H D;  2B2W A;  4C3H G;  2E2H B;  5C0X H;  2PNR C;  3M7G A;  4G4K A;  3P7J A;  4HN7 A;  3OPO A;  3WDN A;  1II3 A;  2OF1 A;  4RCO A;  3GTK B;  3J81 L;  1Q12 A;  4A3I B;  1EYC A;  1Q90 A;  4BA1 I;  5EKK A;  2XRS D;  2BDO A;  1TII D;  1LTG D;  1XTC D;  1Y8P B;  3MVV A;  3TME A;  2PPB C;  4NDX A;  4NW2 A;  3VR2 A;  4OHJ A;  4IFD I;  1D5M C;  2F0J A;  4X3T A;  4Q5V A;  2ID0 A;  1HHV A;  3MXN A;  2WP8 J;  1BCP F;  1RCV D;  5ELD A;  5D3D A;  2F0E A;  4O42 A;  3ONA B;  2SDF A;  3MFY A;  1HPC A;  1CK1 A;  3J81 E;  1IKL A;  4KY6 A;  4KK7 A;  1JOO A;  1JOR A;  4DAY A;  1EY9 A;  2C5C A;  3J7A F;  1OXT A;  1F2Y A;  4BBS B;  1LT5 D;  1F9P A;  2EYM A;  3KUP A;  1U4R A;  1TWG B;  1B44 D;  3IFT A;  1X3Q A;  4QUC A;  3P75 A;  3OMG A;  1RHP A;  4DA2 A;  2QCP X;  5J22 A;  3OWE B;  2A6E D;  2IPK D;  1GUT A;  4U68 A;  1A3T A;  5I2Y A;  3K57 A;  3UI2 A;  2RSN A;  1W6J A;  3NTK A;  4DFA A;  2RBM A;  4FO2 A;  3SDZ A;  2IX3 A;  4C3H B;  1BCP B;  4TQU S;  3NPP A;  5C5M A;  4OO1 H;  1GJX A;  1H9K A;  2WAC A;  1BDO A;  1TS2 A;  5HUR A;  1W6K A;  3NQI A;  2F3W A;  3K6O A;  3D6W A;  1SMY C;  1D1K A;  2K5W A;  4A3K B;  3DXJ C;  2Z4I A;  4KY7 A;  1DON A;  4O1N A;  1XYI A;  5JEA J;  2EY2 A;  2E2I B;  2EYH A;  3D4R A;  3URY A;  2F0T A;  3GTG B;  2R92 B;  1STN A;  1EU4 A;  3IAY A;  1QB5 D;  5A35 A;  3DM1 A;  1YNN C;  2PZU A;  2NVQ B;  3HGB A;  4K5X A;  1JWM D;  1A2T A;  1PFN A;  2JEA I;  2EZV A;  2J4X A;  3QOJ A;  4Z9C B;  3O13 A;  4DNT B;  3D6C A;  3RMH A;  5FOB B;  1JOK A;  1IW7 D;  5C0X J;  1YNJ D;  1KNE A;  5E1F A;  5FKA C;  4ID6 A;  3J7A V;  5CV4 A;  3SVM A;  5C3X A;  4UAI A;  3BDL A;  5FO7 B;  3T13 A;  5FLX L;  1VDZ A;  5BN4 A;  3T51 B;  1FYC A;  2B2T A;  3MZ5 A;  5J39 A;  3RD4 A;  1SNQ A;  3HKZ B;  3HOY B;  4XQJ A;  2L11 A;  4ZYS A;  1STH A;  2KCC A;  1F2M A;  2ZT9 C;  3NK9 A;  3HZX A;  2K05 A;  3E0J A;  5EQ0 A;  1U9R A;  1WD0 A;  4FXG C;  5G3L F;  2PMZ B;  4A3G B;  2A68 C;  3LWU A;  2PQE A;  1O78 A;  1EFI D;  3H94 A;  1PZI D;  1EY7 A;  1DOK A;  4FF1 A;  1H9R A;  3QO2 A;  1R4P B;  4K6D A;  3PUZ A;  1IKM A;  2M00 A;  3A7A B;  5ISR A;  4B9W A;  1JC7 A;  3M7N A;  1TT2 A;  2BA1 A;  2WKC A;  4X3U A;  2R7Z B;  1PZK D;  3FVQ A;  3SK5 A;  1WD1 A;  5IOC A;  3VR3 A;  5K36 G;  2F3V A;  4LMQ D;  2HUG A;  2BE5 C;  4KKT A;  1F9R A;  3HG9 A;  1DD2 A;  1Q1E A;  2O4X A;  1ZYR C;  3MHB A;  3SR1 A;  3E6Z X;  3S1Q B;  2VNU D;  5EJW A;  2DN8 A;  2HCI A;  2EPB A;  3HOV B;  1RKN A;  4F88 A;  2RDG A;  3BVM A;  5M5Y B;  3VA7 A;  3TZD A;  3FPP A;  1C8C A;  1CZG A;  1D1I A;  3Q23 A;  3MXG A;  1PTO F;  1EU3 A;  3EQL C;  2XSC A;  3MWY W;  1QG7 A;  1HA6 A;  2LKV A;  4F87 A;  2F0F A;  4C3J B;  1TS4 A;  2MP1 A;  3GTP B;  1QCB D;  3S16 B;  2KVM A;  4HSP A;  2PO4 A;  2IJ0 A;  4ILW A;  5D65 A;  4RGM A;  4WJW A;  1FD7 D;  1WCM B;  2NWG A;  5E3F A;  4HCE A;  1CTM A;  2LS0 1;  1MI2 A;  3ITP A;  3VR6 A;  1FNW A;  2F0L A;  1B53 A;  3TZU A;  4R9W A;  1G2T A;  4HMJ A;  1V1O A;  2WII B;  1AFP A;  3EFX D;  1QNU A;  5EPK A;  1PMR A;  5CMD A;  1TU2 B;  4YIJ A;  1GUG A;  1I50 B;  2PZT A;  3V05 A;  4RGT A;  4PQX A;  4QCL A;  1EY5 A;  2XWB B;  2WAQ B;  3NXW A;  3RUZ A;  5JPM C;  2K7V A;  5C4J B;  4I7Z C;  1A3U A;  1UEA B;  2K5D A;  1Y8O B;  1PTO B;  1SJE D;  3I70 A;  1CZW A;  2KCN A;  1EIH A;  1EOT A;  3M4O B;  4RAU C;  1Y1V B;  4L6T B;  2A74 C;  5DNF A;  3L7Z C;  4EQN A;  1A2U A;  4OO1 I;  2B2Y C;  5CC4 A;  1D2B A;  1U4P A;  3MXP A;  1S5B D;  4KTA A;  5DM7 3;  4XDX A;  1RF2 D;  2RDF A;  4IZ8 A;  1PRT C;  2G9D A;  1WTX A;  2DY8 A;  3S2D B;  4XYQ A;  2F0V A;  2B2U C;  4ME5 A;  3A8J E;  1SND A;  2MGS A;  1MGS A;  3SK6 A;  3PUX A;  2EY6 A;  2IX0 A;  1C48 A;  3GTL B;  1CHQ D;  4A3F B;  1LTA D;  1M8A A;  5IIF A;  1V43 A;  3EVQ A;  4OIK A;  1Q3L A;  1SMY D;  1G8Z D;  1O80 A;  3S15 B;  3FPU B;  3MA2 B;  3OOC A;  3U9S A;  2K6A A;  1I6H B;  4K2K A;  4DAV A;  2KHS A;  4ZKB B;  3I8Z A;  2J0T D;  2QIL A;  2B63 B;  1HQM C;  3GP7 A;  4HAE A;  1YNN D;  2Q8R E;  1ROD A;  5I6Y A;  2F0Q A;  1JIC A;  1V8Q A;  1H9M A;  2FMM A;  3A54 A;  4LJZ C;  4ZLT F;  5C4H A;  4DU9 A;  5CV9 A;  3QB3 A;  2EVB A;  2F0K A;  2DNC A;  5CV6 A;  4MHE A;  4P2C B;  4IQZ A;  1GHJ A;  3I4M B;  2Z8L A;  2EYL A;  3TP5 A;  4TRD A;  2EYP A;  4KI0 A;  2RKS A;  3NWS A;  1ONL A;  2O5I C;  4XIG S;  2F0H A;  3OIP A;  5LL6 S;  5LL6 X;  1HUM A;  1BXT A;  4TSS A;  4X3K A;  4G7H C;  4H44 C;  4CJ2 C;  3FRP B;  4IUR A;  3PV0 A;  3VYT A;  3SK4 A;  4H7B A;  3EJI A;  3NHH A;  1TWC B;  3R3O A;  3WOF A;  1SNP A;  2KEE A;  5K36 H;  2K32 A;  4CJ1 B;  3PUY A;  5COY A;  1SAP A;  2XNA C;  1PTO H;  3P1H A;  2K1B A;  4IUN A;  1AEX A;  3VYU A;  3OHX C;  1ILP A;  1EEI D;  2EE1 A;  3I72 A;  2VXW A;  4ABN A;  3H09 A;  5DAU A;  2B8F A;  3Q0A A;  1PFM A;  1B4O A;  4KMU C;  2JP1 A;  4J6H A;  3A55 A;  1PLF A;  1STA A;  1E2W A;  2NTS A;  2WV6 D;  3QWN A;  2K5Q A;  3BZD B;  3EA6 A;  1A15 A;  1A6X A;  2E75 C;  3G6J B;  1SYD A;  1OXU A;  4PMB A;  2BE5 D;  3TDQ A;  3K5N A;  1A3V A;  3LWE A;  2F0M A;  2O5J C;  3M3Y B;  3GTQ B;  2B2W C;  1LTI D;  5A2Q L;  4K5W A;  1WTO A;  1GUO A;  3ERO A;  2ZXP A;  5ELC A;  3JAM L;  1D5Z C;  1LAB A;  3VYR A;  4KV6 A;  4HMI A;  2J7Z A;  2K28 A;  4XT3 B;  3H91 A;  1EY4 A;  1VF7 A;  1IL8 A;  1ESF A;  3I73 A;  1GOZ A;  1I4R A;  3R8B A;  1GXD C;  2IX1 A;  4ZAI A;  2I07 B;  5A2Q E;  3RZO B;  3GTM B;  4B08 A;  5NUC A;  4HSV A;  1QE6 A;  2IT1 A;  1LTR D;  5CR3 A;  4IN3 A;  3JAM E;  3AB9 A;  4U67 3;  3CRK C;  5CGK A;  2AWO A;  5C6A A;  1EY8 A;  1L0X B;  3TP7 A;  3S9W A;  4NP5 A;  2Y0S B;  4EQO A;  3VA5 A;  5C5L A;  1KDA A;  2H1E A;  1BOS A;  4F8M A;  3MAQ A;  5BN5 A;  2F0N A;  2R3Z A;  3LNN A;  4KKU A;  1KDB A;  3FMC A;  2RSO A;  2FFK B;  2NVX B;  3N52 A;  4CBV A;  1DZ1 A;  2B2V C;  2HDM A;  4EQP A;  2DNE A;  3K5M A;  4L8J A;  3DEP A;  1SDF A;  2A5H A;  2EY1 A;  4ZK9 B;  5EBD A;  1RTO A;  2FJ2 A;  1Z7T A;  2BA0 A;  2L4N A;  2A69 C;  5IT9 L;  3L9A X;  1I6V C;  4RHR A;  5I6W A;  1EYD A;  1MSH A;  3J7Y W;  1S5C D;  1BUV T;  4ZUI A;  2PZW A;  3S1N B;  2K01 A;  1D5X C;  3K59 A;  1BBX C;  3K5L A;  1PRT D;  3MXU A;  3Q24 A;  3I3C A;  3BYT B;  1BCP C;  4RHS A;  1VCI A;  3KLS X;  2Q8I B;  2R61 A;  1KLU D;  5IT9 E;  3PMF A;  2L1B A;  4KD4 A;  3I91 A;  4H0L C;  2KED A;  1EIG A;  2AUJ D;  3GV3 A;  4E6I A;  1LTS D;  4K2L A;  3X3N A;  4DNR B;  2NN6 G;  3S1R B;  2HDL A;  3T56 B;  3TSS A;  4V19 0;  3SEB A;  2YYZ A;  5I4D A;  5ELF A;  2QEJ C;  2JA8 B;  5EGT A;  1Y69 U;  4K8I A;  3HRZ C;  1KNA A;  2F1M A;  5KRU A;  5D3I B;  2F0D A;  2X6L A;  4KHZ A;  5EKL A;  2PCF B;  1PZJ D;  4FYD A;  4A3E B;  5FLX E;  4DGZ A;  4C1N K;  3Q22 A;  3NQT A;  2B2T C;  1QJO A;  2F0U A;  5C44 B;  1XWE A;  3P20 A;  3HOW B;  1KLG D;  4WOR A;  1TVX A;  4PNY A;  1AZP A;  1QOH A;  1LAC A;  4LK1 C;  1HFN A;  3K0Y A;  5KGU A;  2EJF C;  2C9O A;  1JE4 A;  2DY7 A;  1AW7 A;  4JBW A;  1S5E D;  1F77 A;  3GTO B;  4PMC A;  2HCC A;  1NSN S;  4CKB A;  3AMU A;  1ENA A;  2K03 A;  2XWJ B;  1HTL D;  3LX0 A;  5M3M B;  3J80 L;  4RH6 A;  3BYY B;  3MEH A;  1FR3 A;  2EYF A;  1M4V A;  5C0X G;  4IUQ A;  2FHT A;  1J8I A;  3DWA A;  4MN3 A;  3MFG A;  1J9O A;  1SJH D;  2SNM A;  1EQT A;  2NTT A;  4C3I G;  1EZ6 A;  5E4W C;  1F9S A;  3NWT A;  1U4M A;  1ILQ A;  4XTC S;  1HA5 A;  1R9T B;  1GHK A;  3HS0 C;  5EPJ A;  2I46 A;  4FF2 A;  1HRJ A;  4KN7 C;  3J80 E;  1Q1B A;  1NUC A;  1LLR D;  4FNF A;  2Z1C A;  4CJ0 B;  2F4I A;  1HQR D;  1KAA A;  3QJY A;  2TSS A;  3F2U A;  5ELB A;  3KK7 A;  2LY7 A;  1ESR A;  2OXP A;  1IHZ A;  2H4O A;  1L0Y B;  2ZXO A;  3BG3 A;  4N9T A;  3S2H B;  1F2Z A;  2B39 A;  1HCZ A;  1EQV A;  4N9P A;  1CI3 M;  4HR7 B;  1LT4 D;  4K6L A;  4K14 A;  2JEB I;  4EVO A;  4IAL A;  5EPL A;  1X3P A;  5DEH A;  1TWA B;  4KN4 C;  3DWP A;  2FMC A;  1IYU A;  5LHY 1;  2Z4H A;  4M1U B;  4XQQ A;  3D4W A;  1CA5 A;  1STB A;  1JQY D;  1XXG A;  5KNB A;  3C3L A;  2B2U A;  3M4Y A;  2ICI A;  5IGF A;  4RGN A;  2VUM B;  2CQA A;  5CBE E;  1UNS A;  4RCN A;  5JAV A;  2N55 A;  4C3I B;  3KBX A;  1F9Q A;  3KF8 A;  1HUN A;  3NTH A;  3W3A A;  1CT1 D;  1NCV A;  1DXM A;  1TKW B;  3I4L A;  2JA5 B;  1IW7 C;  3MC0 B;  1YNJ C;  1JOQ A;  2L9H A;  1S5D D;  1QNK A;  1PTO C;  5KNC A;  2JE6 I;  5FO8 B;  1SE2 A;  2SNS A;  5C3E B;  4DN4 M;  4S3S A;  2NZ1 D;  2D2C C;  3IKJ A;  3PUV A;  1K8M A;  3BDC A;  3T16 A;  1G91 A;  2F03 A;  1Z47 A;  4XXE A;  5HGT A;  1BR9 A;  2A69 D;  4L63 B;  3TP6 A;  1B2T A;  2RQX A;  4DF7 A;  1WTW A;  1GUN A;  2LMC B;  3CRL C;  3OMC A;  1EEF D;  1GUW A;  4TKO B;  3ERQ A;  1KDC A;  1LTB D;  3HP3 A;  2D5D A;  4K8J A;  1FNU A;  1EL0 A;  3VYS A;  1JCK B;  4BA2 I;  1BCP D;  3C2P A;  4KJO A;  3E5S A;  5EBC A;  5JVH 3;  5TSS A;  3KBG A;  4DK1 A;  4ZKC B;  1BNZ A;  2M2L A;  4J8Q A;  1G29 1;  1CM9 A;  2NB0 A;  4GZY C;  1G6Z A;  1JWS D;  1C4Q A;  4KD3 A;  2JA6 B;  4CKC A;  3BVG A;  4FP5 D;  1WTP A;  1HXY D;  3H0G B;  3K58 A;  5C4X B;  2OEO A;  3TP8 A;  3ND9 A;  5IGD A;  4FXD A;  1X32 A;  2QDB A;  5IOD A;  1B1Z A;  5IGE A;  1S4Z A;  2A68 D;  4RA8 A;  2RDH A;  3NBH A;  2CVR A;  2EOT A;  1T5E A;  2KUM A;  1ENC A;  2IW3 A;  4ZRZ A;  4RKL A;  3PO2 B;  1UAP A;  1NR4 A;  4IUT A;  1Q8I A;  4F7X A;  3HOZ B;  3PO3 B;  5CV7 A;  4HCS A;  1NAP A;  3IFD A;  5JVG 3;  3AU7 A;  3ZYY X;  3KLS A;  5IGG A;  2EJM A;  3H6M A;  3D3R A;  4WRD A;  2ENB A;  3N6R A;  4OL7 A;  4A3J B;  3FKI B;  4C56 C;  1VMP A;  3NP8 A;  1JR0 D;  2XVS A;  3PIO 3;  1B9N A;  3I4N B;  1B9M A;  1ZYR D;  5IGC A;  3D4D A;  1V1P A;  4PV1 C;  3NUC A;  1WTQ A;  4XT1 B;  4IFD G;  1H9S B;  3T53 B;  3R2T A;  1K83 B;  5CV8 A;  3H3V C;  5C3W A;  5M5W B;  1STG A;  4QB4 A;  3L3O C;  2SOB A;  4FXK C;  4XYO A;  1Y8N B;  4RFB A;  1GUS A;  2MJ8 A;  1ET6 A;  4IUU A;  2IL8 A;  1STY A;  2O2L D;  3FDT A;  4BBR B;  1H9S A;  5JJZ A;  1NR2 A;  3W2D A;  5K5P A;  3NBI A;  1DYQ A;  3S17 B;  2NVY B;  5FO9 B;  4BS9 A;  2B2V A;  3CKI B;  3TN2 A;  4R8I A;  2CW0 C;  1WTV A;  5CBA E;  1EWC A;  3BVZ A;  3OWF A;  5JOB A;  3DMU A;  4ODG A;  1VMC A;  1I4G A;  5G3L D;  4M8A A;  1EWH A;  2EYJ A;  3K5O A;  4ZQ3 A;  5KEE A;  1ZXT A;  2OT2 A;  1JWU D;  2JSO A;  4A93 B;  2KEC A;  1ML0 D;  2E2D C;  1ET9 A;  4NKL A;  1SYE A;  5I9O A;  4ZUJ A;  4RWS C;  5D14 A;  3CU7 A;  1STE A;  1CQF A;  2EDG A;  3QIA A;  3C1F A;  2BOS A;  2IWH A;  2WKD A;  1MD2 D;  2MUY A;  2AQ1 B;  4R8N A;  1LTT D;  2E76 C;  3K7A B;  3RLF A;  4MIU A;  2E74 C;  1SEB D;  5KYL A;  4C1N I;  2B8G A;  4G7O C;  2GA4 B;  4EGV A;  1ZEQ X;  1D6E C;  4WFN 3;  1B50 A;  2F0S A;  1CA6 A;  4FF3 A;  1SNM A;  2L12 A;  3KLR A;  2NN6 I;  1MSG A;  1PTO D;  3C46 A;  5DM6 3;  2EXZ A;  2KOL A;  5M5X B;  2JA7 B;  2PW7 A;  1E0B A;  2L5T A;  5KND A;  3SXH A;  3DWQ A;  1LO5 D;  4X3S A;  2PW5 A;  1PYW D;  1R4Q B;  4OIJ A;  1QWY A;  3C1E A;  2A73 B;  3M85 A;  4C3J G;  4BY1 B;  1DJR D;  1TS3 A;  3OIQ A;  1SSO A;  3A8I E;  3HOU B;  4DK0 A;  2YU9 B;  4H13 C;  4FF4 A;  1LT6 D;  3DEO A;  2F0G A;  5M9O A;  4UDU C;  5M3F B;  4NMZ A;  3A7L A;  1FNV A;  1HFG A;  2A6H C;  2K04 A;  1HTP A;  4QMG A;  5JEA G;  2BDN A;  1RTN A;  1EYA A;  2E2J B;  2X6G A;  2F0P A;  1BQQ T;  1U4L A;  1PDQ A;  5I9P A;  4KY5 A;  1SNC A;  1MBY A;  3Q6S A;  1G2S A;  5KIX A;  3D31 A;  1LV9 A;  1XX8 A;  1EY6 A;  2KA7 A;  1I4P A;  1I4X A;  5E4X A;  4QIW B;  4CGY B;  1FGB D;  1PRT F;  1DOL A;  2BCO A;  1SYF A;  1PXU A;  1RJT A;  1AP0 A;  2VB2 X;  2D9U A;  4B9X A;  4CKE A;  5ELE A;  5C0X I;  4XQN A;  4RKB A;  4AYB B;  1OO9 B;  4RGO S;  5T1I A;  2AQ3 B;  3VR5 A;  2V4D A;  2QKI C;  2G9H D;  3GO5 A;  2X69 A;  3QOL A;  1TWH B;  1BO0 A;  3HEJ A;  4KHV A;  4K5V A;  4IFD H;  4HTH A;  1SYB A;  2JYO A;  2F0O A;  2Q8T A;  1RDP D;  2MPM A;  2A6E C;  3A8K E;  4BWG B;  3RZD B;  2F0I A;  1LT3 D;  3V2T A;  4J1M A;  3TBI B;  5CV5 A;  1I4H A;  4DAP A;  2EYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...