3DXCA

Crystal structure of the intracellular domain of human app in complex with fe65-ptb2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Amyloid beta A4 protein-binding family B member 1
total genus 39
structure length 130
sequence length 130
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxcA00
2RNRB 3MDBC 1TJ6A 4WJ7A 1OY2A 2H7DA 1W1HA 1U5GA 2YVCA 3ODWA 3NSUA 3ML4A 1MIXA 1PMSA 2COAA 1AQCA 2ZPYA 4TKNA 4EJNA 3PVUA 2I5FA 2RUKB 4HB0B 2OTXA 4IAPA 3BINA 4KHAA 4TYZA 1DYNA 1U29A 3KSYA 3QBVB 3FM8C 2RVBB 1NTVA 3A98B 2D9WA 1AWEA 1I2HA 4HB2B 1FB8A 1K5DB 1U27A 2NZ8B 4GMVA 5DHFB 1K5GB 2OQBA 1BAKA 3ULCA 1X05A 3A8PA 2RGNB 2LULA 3CIKA 5EFXA 1TQZA 2RLOA 4CHJA 3G9WA 4DX90 2DA0A 4A6KA 2ELBA 4K2PA 1ZC4B 3VIAA 4HAWB 3HK0A 1EAZA 5CLQB 1BTNA 1GC7A 1P5TA 2YT1A 2W2XC 5FI1A 5J3YA 2LYDA 1WVHA 1Y19B 1SHCA 5DIFB 1V5PA 4MK0A 1ZSQA 5JHHA 1B55A 1U5FA 2R09A 1V5MA 2VKIA 3TFMA 3AU5A 2K00A 2YS5A 2EC1A 2Z0OA 1WI1A 5DHAB 3ODXA 3SO6A 2ROVA 2Y8FA 1MIZB 1I7AA 5DI9B 1QQGA 4B6HA 2HTHB 5C6RA 4HDOA 5KCVA 5D3YA 4YONA 5D3VA 2W2XD 2D9XA 3KY9A 3ULBA 5C79A 2DKQA 5HE1A 2EMSA 4GN1A 4DBBA 3D8DA 1XKEA 3PG7A 2CY4A 2QKMA 3SYXA 1Q67A 2I5CA 1WG7A 2AL6A 3ODOA 4Y94A 5CLLB 3LJUX 1V61A 3OANA 1KZGA 2PZ1A 2MDXA 5HE2A 1UEFA 2ELAA 1WJMA 4IFSA 3CXBB 3U8ZA 2CY5A 2DFKA 2VSZA 3SV1A 3BJIA 4HATB 4K17A 4PNKA 1WGUA 5J3QA 3D8EA 5D27A 1U5EA 2YS3A 3IVFA 1X1FA 3HQCA 4A6FA 1OQNA 1WGQA 4HB4B 4NSWA 1SGHA 1BWNA 1KZ7A 1IRSA 3PVWA 1H4RA 3MPXA 2HE7A 2D2QA 3M1IB 1V88A 5JP4A 2J59M 2QKLA 2Q13A 3F0WA 1ZM0A 3KRWA 3A8QA 1UPRA 4D0NB 2DX1A 2DYNA 2D11A 4KHOA 3QWMA 1PFJA 1NI2A 3DXEA 3X23A 1DDWA 2G35A 2DHKA 1NU2A 2J0MA 4Z2NA 2CRFA 2CAYA 2N0YA 4ZRJA 4HAZB 1U5DA 3PVLA 2L2IA 2BCJA 4DX8A 4EMOA 2UVMA 4EKUA 2X18A 2P8VA 1MKEA 4BBKA 2JP2A 1FGZA 4GXBA 1MK9B 1M7RA 1X86A 2CODA 4YL8A 3P7ZA 3PZDA 1QC6A 2UZSA 1P6SA 3PP2A 2KGXB 2VRWB 1XX0A 3GYPA 4HB3B 2GJYA 5C5BB 1FGYA 2H7EA 4XWXA 1LB1A 3UZTA 2XQNM 3DXDA 5FI0A 1P3RA 3VOQA 2Y8GA 2LKOA 5D3WA 2D9ZA 4HDQA 1EGXA 5DH9B 3WYFB 2M38A 3TCAA 3O96A 2COFA 2Z0QA 4H8SA 5D3XA 4F7HA 4CHMA 4NY0A 5LONB 2NMBA 2LOZA 3PEGA 2DYQA 2DN6A 3FSSA 3GYOA 2RSGA 2Z0PA 1KI1B 2GS0A 3U7DA 4HAVB 2LOXA 4CYEA 4PQ0A 1UNQA 2IYBA 2ADZA 1DBHA 1Z87A 1J19A 2DHJA 4IOYX 1FHXA 3QIJA 1FHOA 2P0DA 1FHWA 4Z2MB 3DXCA 1ISNA 1V89A 3PSCA 1EVHA 3V5WA 2K2UA 1ZVRA 4WVFB 5JLJB 1TXDA 2IFSA 1Y5OA 1GC6A 2DLWA 2W2WA 3P6AA 4K81A 2D9YA 5HE0A 1W1DA 2UZRA 2YT0A 4GMXB 3F5RA 5LOPB 3KZ1A 2N23A 1RJ2A 2J0JA 5J3TA 5GOWB 4DXAB 1ZC3B 3N7CA 1MAIA 2KCJA 4KAXB 2P0HA 2K2JA 3TVVA 3FEHA 1N3HA 1OMWA 2DHIA 4KVGB 1FAOA 1NTYA 2COCA 1LW3A 1H10A 5HE3A 5KQ1A 1M7EA 4HAYB 4A6HA 2FJLA 4ZRIA 1XCGA 5C5BA 1V5UA 2DX5A 3SUZA 2MFQA 3WA0A 2LG1A 3AU4A 3AJ4A 2MWNB 3ZDTA 2DTCA 4MY6A 1W1GA 1EF1A 2Y7BA 3SNHA 1XD4A 1E5WA 2P0FA 1DROA 1PLSA 1X1GA 1MK7B 3ZVRA 4P7IA 3TO1A 1UNPA 2L1CA 1J0WA 4GZUA 4ZRKA 4F7GA 5C16A 2I1KA 2DKPA 1BTKA 2M14A 2E2XA 1GG3A 2EJ8A 2YRYA 4WSFA 2J0KA 4K2OA 2D10A 4A5KA 1U2BA 3T06A 4C0AA 1RRPB 3D8FA 3TW1A 1XR0B 3HW2B 4MT7A 5L81A 4L6EA 2R0DA 4HHVA 3KRXA 2YF0A 2AEHA 2GCLA 2KUPA 1MPHA 2D9VA 1X11A 5JHGA 4HAUB 1WJ1A 2MKRA 5KQ4A 4KHBB 2ROZB 2YS1A 4HAXB 4F7UP 2V76A 1UPQA 2D4QA 2I1JA 1UNRA 4A6FB 1XODA 1DDMA 2EMTA 1FOEA 3RCPA 4GPTB 2YSZA 2GCJA 1DDVA
chains in the Genus database with same CATH superfamily
2KIGA 2RNRB 3MDBC 1TJ6A 4WJ7A 1OY2A 3A58A 2H7DA 1W1HA 1U5GA 2YVCA 3ODWA 3NSUA 3ML4A 1MIXA 1PMSA 2COAA 1AQCA 2ZPYA 4TKNA 4EJNA 3PVUA 2I5FA 2RUKB 4HB0B 4D6WA 2Z14A 2OTXA 4IAPA 3BINA 4KHAA 4TYZA 5I2SA 1DYNA 1U29A 3KSYA 3QBVB 1BAKA 3FM8C 2RVBB 1NTVA 3A98B 2D9WA 1AWEA 1I2HA 4HB2B 1FB8A 1K5DB 1U27A 2K8EA 2NZ8B 4GMVA 1K5GB 2OQBA 5DHFB 3ULCA 1X05A 3A8PA 2RGNB 2LULA 3CIKA 5EFXA 1TQZA 2RLOA 2KIEA 4CHJA 4QJ3B 3G9WA 4DX90 2DA0A 4A6KA 2ELBA 4K2PA 1ZC4B 3VIAA 4HAWB 3HK0A 1EAZA 5CLQB 1BTNA 1GC7A 1P5TA 2YT1A 2W2XC 5FI1A 5J3YA 2LYDA 1WVHA 1Y19B 1SHCA 5DIFB 1V5PA 4MK0A 1ZSQA 2GUMA 5JHHA 1B55A 1U5FA 2R09A 1V5MA 2VKIA 3TFMA 3AU5A 2K00A 2YS5A 2EC1A 2Z0OA 1WI1A 5DHAB 3ODXA 3SO6A 2K49A 2FJUB 2ROVA 2Y8FA 1MIZB 1I7AA 5DI9B 1QQGA 1T77A 2HTHB 2Z13A 4HDOA 4B6HA 5C6RA 5KCVA 5M4YB 5D3YA 4YONA 5D3VA 2W2XD 4OSNA 2D9XA 3KY9A 3ULBA 5C79A 2DKQA 5HE1A 2EMSA 4GN1A 5IRSA 4DBBA 3D8DA 1XKEA 3NWAA 3PG7A 2CY4A 2QKMA 3SYXA 1Q67A 2I5CA 1WG7A 2AL6A 3ODOA 4Y94A 5CLLB 3LJUX 1V61A 3OANA 3HIEA 1KZGA 2PZ1A 2MDXA 5HE2A 1UEFA 2ELAA 1WJMA 4IFSA 3CXBB 3U8ZA 2CY5A 2DFKA 2VSZA 3SV1A 3BJIA 3FVCA 4HATB 4K17A 4PNKA 1WGUA 5J3QA 3D8EA 5D27A 1U5EA 2YS3A 3IVFA 1X1FA 3HQCA 4A6FA 4CSQA 1OQNA 1WGQA 4HB4B 4NSWA 3U12A 1SGHA 1BWNA 1KZ7A 1IRSA 3PVWA 3NWDA 1H4RA 3MPXA 2HE7A 2D2QA 3M1IB 1V88A 5JP4A 2J59M 2QKLA 2Q13A 3F0WA 1ZM0A 3KRWA 3A8QA 1UPRA 4D0NB 2DX1A 2DYNA 2Z4DA 2D11A 4KHOA 3QWMA 1PFJA 1NI2A 3DXEA 5LG4B 2ZKMX 3X23A 1DDWA 2G35A 2NBVA 2DHKA 1NU2A 2J0MA 4Z2NA 2CRFA 2CAYA 2N0YA 4ZRJA 4QJ4B 2Z59A 4HAZB 1U5DA 3PVLA 2L2IA 2BCJA 4DX8A 4EMOA 2UVMA 4EKUA 2X18A 2P8VA 1MKEA 4BBKA 2JP2A 1FGZA 4GXBA 1MK9B 1M7RA 1X86A 2CODA 4YL8A 2R2YA 3P7ZA 3PZDA 1QC6A 2UZSA 4QJ5B 1P6SA 3PP2A 2KGXB 2VRWB 1XX0A 3GYPA 4HB3B 2GJYA 5C5BB 1FGYA 2H7EA 4XWXA 1LB1A 3UZTA 2XQNM 3DXDA 5FI0A 1P3RA 4GNKB 3VOQA 2Y8GA 2LKOA 4HSIA 5D3WA 2D9ZA 2KR0A 4HDQA 1EGXA 5DH9B 3WYFB 2M38A 3TCAA 3O96A 2COFA 2Z0QA 4H8SA 5D3XA 4F7HA 2RRFA 4CHMA 4NY0A 5LONB 2NMBA 2LOZA 4DIXA 3PEGA 2DYQA 2DN6A 3FSSA 3GYOA 2RSGA 2Z0PA 1KI1B 2GS0A 4OT1A 3U7DA 4HAVB 2LOXA 4CYEA 4PQ0A 1MI1A 1UNQA 2IYBA 2ADZA 1DBHA 1Z87A 1J19A 2DHJA 4IOYX 1FHXA 3QIJA 1FHOA 2P0DA 1FHWA 4Z2MB 3DXCA 1ISNA 1V89A 3PSCA 1EVHA 3V5WA 2K2UA 1ZVRA 4WVFB 5JLJB 2KUQA 1TXDA 2IFSA 1Y5OA 1GC6A 2DLWA 2W2WA 3P6AA 4K81A 2D9YA 5HE0A 1W1DA 2UZRA 4QXAB 2YT0A 4GMXB 3F5RA 5LOPB 3KZ1A 3HSAA 2N23A 1RJ2A 2J0JA 5J3TA 5GOWB 4DXAB 1ZC3B 3N7CA 1MAIA 2KCJA 4KAXB 2P0HA 2K2JA 3TVVA 3FEHA 1N3HA 1OMWA 2DHIA 3DCXA 3NWFA 4KVGB 1FAOA 1NTYA 2COCA 1LW3A 1H10A 5HE3A 5KQ1A 1M7EA 4HAYB 4A6HA 2FJLA 4ZRIA 1XCGA 5C5BA 1V5UA 2DX5A 3SUZA 2MFQA 3WA0A 2LG1A 3AU4A 3AJ4A 3NW8A 2MWNB 3ZDTA 2DTCA 4MY6A 1W1GA 1EF1A 2Y7BA 3SNHA 1XD4A 1E5WA 2P0FA 5I2MA 1DROA 1PLSA 1X1GA 1MK7B 3ZVRA 4P7IA 3TO1A 1UNPA 2L1CA 1J0WA 4GZUA 4ZRKA 4F7GA 5C16A 2I1KA 2DKPA 1BTKA 2M14A 2E2XA 1GG3A 2EJ8A 2YRYA 4WSFA 2J0KA 4K2OA 2D10A 4A5KA 1U2BA 3T06A 4C0AA 1RRPB 3D8FA 3OHMB 3TW1A 1XR0B 3B77A 3HW2B 4MT7A 5L81A 4L6EA 4GOUA 2R0DA 4HHVA 3KRXA 2YF0A 2AEHA 2GCLA 2KUPA 1MPHA 2D9VA 1ZYIA 1X11A 5JHGA 4HAUB 1WJ1A 2MKRA 5KQ4A 4L1RA 4KHBB 2ROZB 2YS1A 4HAXB 2YT2A 4F7UP 2V76A 1UPQA 2D4QA 2I1JA 1UNRA 4A6FB 1XODA 1DDMA 2EMTA 1FOEA 4KHBA 3RCPA 4GPTB 2YSZA 2GCJA 1DDVA
chains in the Genus database with same CATH topology
2RNRB 3MDBC 1TJ6A 4WJ7A 1OY2A 2H7DA 1W1HA 1U5GA 2YVCA 3ODWA 3NSUA 3ML4A 1MIXA 1PMSA 2COAA 1AQCA 2ZPYA 4TKNA 4EJNA 3PVUA 2I5FA 2RUKB 4HB0B 2OTXA 4IAPA 3BINA 4KHAA 4TYZA 1DYNA 1U29A 3KSYA 3QBVB 3FM8C 2RVBB 1NTVA 3A98B 2D9WA 1AWEA 1I2HA 4HB2B 1FB8A 1K5DB 1U27A 2NZ8B 4GMVA 5DHFB 1K5GB 2OQBA 1BAKA 3ULCA 1X05A 3A8PA 2RGNB 2LULA 3CIKA 5EFXA 1TQZA 2RLOA 4CHJA 3G9WA 4DX90 2DA0A 4A6KA 2ELBA 4K2PA 1ZC4B 3VIAA 4HAWB 3HK0A 1EAZA 5CLQB 1BTNA 1GC7A 1P5TA 2YT1A 2W2XC 5FI1A 5J3YA 2LYDA 1WVHA 1Y19B 1SHCA 5DIFB 1V5PA 4MK0A 1ZSQA 5JHHA 1B55A 1U5FA 2R09A 1V5MA 2VKIA 3TFMA 3AU5A 2K00A 2YS5A 2EC1A 2Z0OA 1WI1A 5DHAB 3ODXA 3SO6A 2ROVA 2Y8FA 1MIZB 1I7AA 5DI9B 1QQGA 4B6HA 2HTHB 5C6RA 4HDOA 5KCVA 5D3YA 4YONA 5D3VA 2W2XD 2D9XA 3KY9A 3ULBA 5C79A 2DKQA 5HE1A 2EMSA 4GN1A 4DBBA 3D8DA 1XKEA 3PG7A 2CY4A 2QKMA 3SYXA 1Q67A 2I5CA 1WG7A 2AL6A 3ODOA 4Y94A 5CLLB 3LJUX 1V61A 3OANA 1KZGA 2PZ1A 2MDXA 5HE2A 1UEFA 2ELAA 1WJMA 4IFSA 3CXBB 3U8ZA 2CY5A 2DFKA 2VSZA 3SV1A 3BJIA 4HATB 4K17A 4PNKA 1WGUA 5J3QA 3D8EA 5D27A 1U5EA 2YS3A 3IVFA 1X1FA 3HQCA 4A6FA 1OQNA 1WGQA 4HB4B 4NSWA 1SGHA 1BWNA 1KZ7A 1IRSA 3PVWA 1H4RA 3MPXA 2HE7A 2D2QA 3M1IB 1V88A 5JP4A 2J59M 2QKLA 2Q13A 3F0WA 1ZM0A 3KRWA 3A8QA 1UPRA 4D0NB 2DX1A 2DYNA 2D11A 4KHOA 3QWMA 1PFJA 1NI2A 3DXEA 3X23A 1DDWA 2G35A 2DHKA 1NU2A 2J0MA 4Z2NA 2CRFA 2CAYA 2N0YA 4ZRJA 4HAZB 1U5DA 3PVLA 2L2IA 2BCJA 4DX8A 4EMOA 2UVMA 4EKUA 2X18A 2P8VA 1MKEA 4BBKA 2JP2A 1FGZA 4GXBA 1MK9B 1M7RA 1X86A 2CODA 4YL8A 3P7ZA 3PZDA 1QC6A 2UZSA 1P6SA 3PP2A 2KGXB 2VRWB 1XX0A 3GYPA 4HB3B 2GJYA 5C5BB 1FGYA 2H7EA 4XWXA 1LB1A 3UZTA 2XQNM 3DXDA 5FI0A 1P3RA 3VOQA 2Y8GA 2LKOA 5D3WA 2D9ZA 4HDQA 1EGXA 5DH9B 3WYFB 2M38A 3TCAA 3O96A 2COFA 2Z0QA 4H8SA 5D3XA 4F7HA 4CHMA 4NY0A 5LONB 2NMBA 2LOZA 3PEGA 2DYQA 2DN6A 3FSSA 3GYOA 2RSGA 2Z0PA 1KI1B 2GS0A 3U7DA 4HAVB 2LOXA 4CYEA 4PQ0A 1UNQA 2IYBA 2ADZA 1DBHA 1Z87A 1J19A 2DHJA 4IOYX 1FHXA 3QIJA 1FHOA 2P0DA 1FHWA 4Z2MB 3DXCA 1ISNA 1V89A 3PSCA 1EVHA 3V5WA 2K2UA 1ZVRA 4WVFB 5JLJB 1TXDA 2IFSA 1Y5OA 1GC6A 2DLWA 2W2WA 3P6AA 4K81A 2D9YA 5HE0A 1W1DA 2UZRA 2YT0A 4GMXB 3F5RA 5LOPB 3KZ1A 2N23A 1RJ2A 2J0JA 5J3TA 5GOWB 4DXAB 1ZC3B 3N7CA 1MAIA 2KCJA 4KAXB 2P0HA 2K2JA 3TVVA 3FEHA 1N3HA 1OMWA 2DHIA 4KVGB 1FAOA 1NTYA 2COCA 1LW3A 1H10A 5HE3A 5KQ1A 1M7EA 4HAYB 4A6HA 2FJLA 4ZRIA 1XCGA 5C5BA 1V5UA 2DX5A 3SUZA 2MFQA 3WA0A 2LG1A 3AU4A 3AJ4A 2MWNB 3ZDTA 2DTCA 4MY6A 1W1GA 1EF1A 2Y7BA 3SNHA 1XD4A 1E5WA 2P0FA 1DROA 1PLSA 1X1GA 1MK7B 3ZVRA 4P7IA 3TO1A 1UNPA 2L1CA 1J0WA 4GZUA 4ZRKA 4F7GA 5C16A 2I1KA 2DKPA 1BTKA 2M14A 2E2XA 1GG3A 2EJ8A 2YRYA 4WSFA 2J0KA 4K2OA 2D10A 4A5KA 1U2BA 3T06A 4C0AA 1RRPB 3D8FA 3TW1A 1XR0B 3HW2B 4MT7A 5L81A 4L6EA 2R0DA 4HHVA 3KRXA 2YF0A 2AEHA 2GCLA 2KUPA 1MPHA 2D9VA 1X11A 5JHGA 4HAUB 1WJ1A 2MKRA 5KQ4A 4KHBB 2ROZB 2YS1A 4HAXB 4F7UP 2V76A 1UPQA 2D4QA 2I1JA 1UNRA 4A6FB 1XODA 1DDMA 2EMTA 1FOEA 3RCPA 4GPTB 2YSZA 2GCJA 1DDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNR B;  3MDB C;  1TJ6 A;  4WJ7 A;  1OY2 A;  2H7D A;  1W1H A;  1U5G A;  2YVC A;  3ODW A;  3NSU A;  3ML4 A;  1MIX A;  1PMS A;  2COA A;  1AQC A;  2ZPY A;  4TKN A;  4EJN A;  3PVU A;  2I5F A;  2RUK B;  4HB0 B;  2OTX A;  4IAP A;  3BIN A;  4KHA A;  4TYZ A;  1DYN A;  1U29 A;  3KSY A;  3QBV B;  3FM8 C;  2RVB B;  1NTV A;  3A98 B;  2D9W A;  1AWE A;  1I2H A;  4HB2 B;  1FB8 A;  1K5D B;  1U27 A;  2NZ8 B;  4GMV A;  5DHF B;  1K5G B;  2OQB A;  1BAK A;  3ULC A;  1X05 A;  3A8P A;  2RGN B;  2LUL A;  3CIK A;  5EFX A;  1TQZ A;  2RLO A;  4CHJ A;  3G9W A;  4DX9 0;  2DA0 A;  4A6K A;  2ELB A;  4K2P A;  1ZC4 B;  3VIA A;  4HAW B;  3HK0 A;  1EAZ A;  5CLQ B;  1BTN A;  1GC7 A;  1P5T A;  2YT1 A;  2W2X C;  5FI1 A;  5J3Y A;  2LYD A;  1WVH A;  1Y19 B;  1SHC A;  5DIF B;  1V5P A;  4MK0 A;  1ZSQ A;  5JHH A;  1B55 A;  1U5F A;  2R09 A;  1V5M A;  2VKI A;  3TFM A;  3AU5 A;  2K00 A;  2YS5 A;  2EC1 A;  2Z0O A;  1WI1 A;  5DHA B;  3ODX A;  3SO6 A;  2ROV A;  2Y8F A;  1MIZ B;  1I7A A;  5DI9 B;  1QQG A;  4B6H A;  2HTH B;  5C6R A;  4HDO A;  5KCV A;  5D3Y A;  4YON A;  5D3V A;  2W2X D;  2D9X A;  3KY9 A;  3ULB A;  5C79 A;  2DKQ A;  5HE1 A;  2EMS A;  4GN1 A;  4DBB A;  3D8D A;  1XKE A;  3PG7 A;  2CY4 A;  2QKM A;  3SYX A;  1Q67 A;  2I5C A;  1WG7 A;  2AL6 A;  3ODO A;  4Y94 A;  5CLL B;  3LJU X;  1V61 A;  3OAN A;  1KZG A;  2PZ1 A;  2MDX A;  5HE2 A;  1UEF A;  2ELA A;  1WJM A;  4IFS A;  3CXB B;  3U8Z A;  2CY5 A;  2DFK A;  2VSZ A;  3SV1 A;  3BJI A;  4HAT B;  4K17 A;  4PNK A;  1WGU A;  5J3Q A;  3D8E A;  5D27 A;  1U5E A;  2YS3 A;  3IVF A;  1X1F A;  3HQC A;  4A6F A;  1OQN A;  1WGQ A;  4HB4 B;  4NSW A;  1SGH A;  1BWN A;  1KZ7 A;  1IRS A;  3PVW A;  1H4R A;  3MPX A;  2HE7 A;  2D2Q A;  3M1I B;  1V88 A;  5JP4 A;  2J59 M;  2QKL A;  2Q13 A;  3F0W A;  1ZM0 A;  3KRW A;  3A8Q A;  1UPR A;  4D0N B;  2DX1 A;  2DYN A;  2D11 A;  4KHO A;  3QWM A;  1PFJ A;  1NI2 A;  3DXE A;  3X23 A;  1DDW A;  2G35 A;  2DHK A;  1NU2 A;  2J0M A;  4Z2N A;  2CRF A;  2CAY A;  2N0Y A;  4ZRJ A;  4HAZ B;  1U5D A;  3PVL A;  2L2I A;  2BCJ A;  4DX8 A;  4EMO A;  2UVM A;  4EKU A;  2X18 A;  2P8V A;  1MKE A;  4BBK A;  2JP2 A;  1FGZ A;  4GXB A;  1MK9 B;  1M7R A;  1X86 A;  2COD A;  4YL8 A;  3P7Z A;  3PZD A;  1QC6 A;  2UZS A;  1P6S A;  3PP2 A;  2KGX B;  2VRW B;  1XX0 A;  3GYP A;  4HB3 B;  2GJY A;  5C5B B;  1FGY A;  2H7E A;  4XWX A;  1LB1 A;  3UZT A;  2XQN M;  3DXD A;  5FI0 A;  1P3R A;  3VOQ A;  2Y8G A;  2LKO A;  5D3W A;  2D9Z A;  4HDQ A;  1EGX A;  5DH9 B;  3WYF B;  2M38 A;  3TCA A;  3O96 A;  2COF A;  2Z0Q A;  4H8S A;  5D3X A;  4F7H A;  4CHM A;  4NY0 A;  5LON B;  2NMB A;  2LOZ A;  3PEG A;  2DYQ A;  2DN6 A;  3FSS A;  3GYO A;  2RSG A;  2Z0P A;  1KI1 B;  2GS0 A;  3U7D A;  4HAV B;  2LOX A;  4CYE A;  4PQ0 A;  1UNQ A;  2IYB A;  2ADZ A;  1DBH A;  1Z87 A;  1J19 A;  2DHJ A;  4IOY X;  1FHX A;  3QIJ A;  1FHO A;  2P0D A;  1FHW A;  4Z2M B;  3DXC A;  1ISN A;  1V89 A;  3PSC A;  1EVH A;  3V5W A;  2K2U A;  1ZVR A;  4WVF B;  5JLJ B;  1TXD A;  2IFS A;  1Y5O A;  1GC6 A;  2DLW A;  2W2W A;  3P6A A;  4K81 A;  2D9Y A;  5HE0 A;  1W1D A;  2UZR A;  2YT0 A;  4GMX B;  3F5R A;  5LOP B;  3KZ1 A;  2N23 A;  1RJ2 A;  2J0J A;  5J3T A;  5GOW B;  4DXA B;  1ZC3 B;  3N7C A;  1MAI A;  2KCJ A;  4KAX B;  2P0H A;  2K2J A;  3TVV A;  3FEH A;  1N3H A;  1OMW A;  2DHI A;  4KVG B;  1FAO A;  1NTY A;  2COC A;  1LW3 A;  1H10 A;  5HE3 A;  5KQ1 A;  1M7E A;  4HAY B;  4A6H A;  2FJL A;  4ZRI A;  1XCG A;  5C5B A;  1V5U A;  2DX5 A;  3SUZ A;  2MFQ A;  3WA0 A;  2LG1 A;  3AU4 A;  3AJ4 A;  2MWN B;  3ZDT A;  2DTC A;  4MY6 A;  1W1G A;  1EF1 A;  2Y7B A;  3SNH A;  1XD4 A;  1E5W A;  2P0F A;  1DRO A;  1PLS A;  1X1G A;  1MK7 B;  3ZVR A;  4P7I A;  3TO1 A;  1UNP A;  2L1C A;  1J0W A;  4GZU A;  4ZRK A;  4F7G A;  5C16 A;  2I1K A;  2DKP A;  1BTK A;  2M14 A;  2E2X A;  1GG3 A;  2EJ8 A;  2YRY A;  4WSF A;  2J0K A;  4K2O A;  2D10 A;  4A5K A;  1U2B A;  3T06 A;  4C0A A;  1RRP B;  3D8F A;  3TW1 A;  1XR0 B;  3HW2 B;  4MT7 A;  5L81 A;  4L6E A;  2R0D A;  4HHV A;  3KRX A;  2YF0 A;  2AEH A;  2GCL A;  2KUP A;  1MPH A;  2D9V A;  1X11 A;  5JHG A;  4HAU B;  1WJ1 A;  2MKR A;  5KQ4 A;  4KHB B;  2ROZ B;  2YS1 A;  4HAX B;  4F7U P;  2V76 A;  1UPQ A;  2D4Q A;  2I1J A;  1UNR A;  4A6F B;  1XOD A;  1DDM A;  2EMT A;  1FOE A;  3RCP A;  4GPT B;  2YSZ A;  2GCJ A;  1DDV A; 
#chains in the Genus database with same CATH topology
 2KIG A;  2RNR B;  3MDB C;  1TJ6 A;  4WJ7 A;  1OY2 A;  3A58 A;  2H7D A;  1W1H A;  1U5G A;  2YVC A;  3ODW A;  3NSU A;  3ML4 A;  1MIX A;  1PMS A;  2COA A;  1AQC A;  2ZPY A;  4TKN A;  4EJN A;  3PVU A;  2I5F A;  2RUK B;  4HB0 B;  4D6W A;  2Z14 A;  2OTX A;  4IAP A;  3BIN A;  4KHA A;  4TYZ A;  5I2S A;  1DYN A;  1U29 A;  3KSY A;  3QBV B;  1BAK A;  3FM8 C;  2RVB B;  1NTV A;  3A98 B;  2D9W A;  1AWE A;  1I2H A;  4HB2 B;  1FB8 A;  1K5D B;  1U27 A;  2K8E A;  2NZ8 B;  4GMV A;  1K5G B;  2OQB A;  5DHF B;  3ULC A;  1X05 A;  3A8P A;  2RGN B;  2LUL A;  3CIK A;  5EFX A;  1TQZ A;  2RLO A;  2KIE A;  4CHJ A;  4QJ3 B;  3G9W A;  4DX9 0;  2DA0 A;  4A6K A;  2ELB A;  4K2P A;  1ZC4 B;  3VIA A;  4HAW B;  3HK0 A;  1EAZ A;  5CLQ B;  1BTN A;  1GC7 A;  1P5T A;  2YT1 A;  2W2X C;  5FI1 A;  5J3Y A;  2LYD A;  1WVH A;  1Y19 B;  1SHC A;  5DIF B;  1V5P A;  4MK0 A;  1ZSQ A;  2GUM A;  5JHH A;  1B55 A;  1U5F A;  2R09 A;  1V5M A;  2VKI A;  3TFM A;  3AU5 A;  2K00 A;  2YS5 A;  2EC1 A;  2Z0O A;  1WI1 A;  5DHA B;  3ODX A;  3SO6 A;  2K49 A;  2FJU B;  2ROV A;  2Y8F A;  1MIZ B;  1I7A A;  5DI9 B;  1QQG A;  1T77 A;  2HTH B;  2Z13 A;  4HDO A;  4B6H A;  5C6R A;  5KCV A;  5M4Y B;  5D3Y A;  4YON A;  5D3V A;  2W2X D;  4OSN A;  2D9X A;  3KY9 A;  3ULB A;  5C79 A;  2DKQ A;  5HE1 A;  2EMS A;  4GN1 A;  5IRS A;  4DBB A;  3D8D A;  1XKE A;  3NWA A;  3PG7 A;  2CY4 A;  2QKM A;  3SYX A;  1Q67 A;  2I5C A;  1WG7 A;  2AL6 A;  3ODO A;  4Y94 A;  5CLL B;  3LJU X;  1V61 A;  3OAN A;  3HIE A;  1KZG A;  2PZ1 A;  2MDX A;  5HE2 A;  1UEF A;  2ELA A;  1WJM A;  4IFS A;  3CXB B;  3U8Z A;  2CY5 A;  2DFK A;  2VSZ A;  3SV1 A;  3BJI A;  3FVC A;  4HAT B;  4K17 A;  4PNK A;  1WGU A;  5J3Q A;  3D8E A;  5D27 A;  1U5E A;  2YS3 A;  3IVF A;  1X1F A;  3HQC A;  4A6F A;  4CSQ A;  1OQN A;  1WGQ A;  4HB4 B;  4NSW A;  3U12 A;  1SGH A;  1BWN A;  1KZ7 A;  1IRS A;  3PVW A;  3NWD A;  1H4R A;  3MPX A;  2HE7 A;  2D2Q A;  3M1I B;  1V88 A;  5JP4 A;  2J59 M;  2QKL A;  2Q13 A;  3F0W A;  1ZM0 A;  3KRW A;  3A8Q A;  1UPR A;  4D0N B;  2DX1 A;  2DYN A;  2Z4D A;  2D11 A;  4KHO A;  3QWM A;  1PFJ A;  1NI2 A;  3DXE A;  5LG4 B;  2ZKM X;  3X23 A;  1DDW A;  2G35 A;  2NBV A;  2DHK A;  1NU2 A;  2J0M A;  4Z2N A;  2CRF A;  2CAY A;  2N0Y A;  4ZRJ A;  4QJ4 B;  2Z59 A;  4HAZ B;  1U5D A;  3PVL A;  2L2I A;  2BCJ A;  4DX8 A;  4EMO A;  2UVM A;  4EKU A;  2X18 A;  2P8V A;  1MKE A;  4BBK A;  2JP2 A;  1FGZ A;  4GXB A;  1MK9 B;  1M7R A;  1X86 A;  2COD A;  4YL8 A;  2R2Y A;  3P7Z A;  3PZD A;  1QC6 A;  2UZS A;  4QJ5 B;  1P6S A;  3PP2 A;  2KGX B;  2VRW B;  1XX0 A;  3GYP A;  4HB3 B;  2GJY A;  5C5B B;  1FGY A;  2H7E A;  4XWX A;  1LB1 A;  3UZT A;  2XQN M;  3DXD A;  5FI0 A;  1P3R A;  4GNK B;  3VOQ A;  2Y8G A;  2LKO A;  4HSI A;  5D3W A;  2D9Z A;  2KR0 A;  4HDQ A;  1EGX A;  5DH9 B;  3WYF B;  2M38 A;  3TCA A;  3O96 A;  2COF A;  2Z0Q A;  4H8S A;  5D3X A;  4F7H A;  2RRF A;  4CHM A;  4NY0 A;  5LON B;  2NMB A;  2LOZ A;  4DIX A;  3PEG A;  2DYQ A;  2DN6 A;  3FSS A;  3GYO A;  2RSG A;  2Z0P A;  1KI1 B;  2GS0 A;  4OT1 A;  3U7D A;  4HAV B;  2LOX A;  4CYE A;  4PQ0 A;  1MI1 A;  1UNQ A;  2IYB A;  2ADZ A;  1DBH A;  1Z87 A;  1J19 A;  2DHJ A;  4IOY X;  1FHX A;  3QIJ A;  1FHO A;  2P0D A;  1FHW A;  4Z2M B;  3DXC A;  1ISN A;  1V89 A;  3PSC A;  1EVH A;  3V5W A;  2K2U A;  1ZVR A;  4WVF B;  5JLJ B;  2KUQ A;  1TXD A;  2IFS A;  1Y5O A;  1GC6 A;  2DLW A;  2W2W A;  3P6A A;  4K81 A;  2D9Y A;  5HE0 A;  1W1D A;  2UZR A;  4QXA B;  2YT0 A;  4GMX B;  3F5R A;  5LOP B;  3KZ1 A;  3HSA A;  2N23 A;  1RJ2 A;  2J0J A;  5J3T A;  5GOW B;  4DXA B;  1ZC3 B;  3N7C A;  1MAI A;  2KCJ A;  4KAX B;  2P0H A;  2K2J A;  3TVV A;  3FEH A;  1N3H A;  1OMW A;  2DHI A;  3DCX A;  3NWF A;  4KVG B;  1FAO A;  1NTY A;  2COC A;  1LW3 A;  1H10 A;  5HE3 A;  5KQ1 A;  1M7E A;  4HAY B;  4A6H A;  2FJL A;  4ZRI A;  1XCG A;  5C5B A;  1V5U A;  2DX5 A;  3SUZ A;  2MFQ A;  3WA0 A;  2LG1 A;  3AU4 A;  3AJ4 A;  3NW8 A;  2MWN B;  3ZDT A;  2DTC A;  4MY6 A;  1W1G A;  1EF1 A;  2Y7B A;  3SNH A;  1XD4 A;  1E5W A;  2P0F A;  5I2M A;  1DRO A;  1PLS A;  1X1G A;  1MK7 B;  3ZVR A;  4P7I A;  3TO1 A;  1UNP A;  2L1C A;  1J0W A;  4GZU A;  4ZRK A;  4F7G A;  5C16 A;  2I1K A;  2DKP A;  1BTK A;  2M14 A;  2E2X A;  1GG3 A;  2EJ8 A;  2YRY A;  4WSF A;  2J0K A;  4K2O A;  2D10 A;  4A5K A;  1U2B A;  3T06 A;  4C0A A;  1RRP B;  3D8F A;  3OHM B;  3TW1 A;  1XR0 B;  3B77 A;  3HW2 B;  4MT7 A;  5L81 A;  4L6E A;  4GOU A;  2R0D A;  4HHV A;  3KRX A;  2YF0 A;  2AEH A;  2GCL A;  2KUP A;  1MPH A;  2D9V A;  1ZYI A;  1X11 A;  5JHG A;  4HAU B;  1WJ1 A;  2MKR A;  5KQ4 A;  4L1R A;  4KHB B;  2ROZ B;  2YS1 A;  4HAX B;  2YT2 A;  4F7U P;  2V76 A;  1UPQ A;  2D4Q A;  2I1J A;  1UNR A;  4A6F B;  1XOD A;  1DDM A;  2EMT A;  1FOE A;  4KHB A;  3RCP A;  4GPT B;  2YSZ A;  2GCJ A;  1DDV A; 
#chains in the Genus database with same CATH homology
 2RNR B;  3MDB C;  1TJ6 A;  4WJ7 A;  1OY2 A;  2H7D A;  1W1H A;  1U5G A;  2YVC A;  3ODW A;  3NSU A;  3ML4 A;  1MIX A;  1PMS A;  2COA A;  1AQC A;  2ZPY A;  4TKN A;  4EJN A;  3PVU A;  2I5F A;  2RUK B;  4HB0 B;  2OTX A;  4IAP A;  3BIN A;  4KHA A;  4TYZ A;  1DYN A;  1U29 A;  3KSY A;  3QBV B;  3FM8 C;  2RVB B;  1NTV A;  3A98 B;  2D9W A;  1AWE A;  1I2H A;  4HB2 B;  1FB8 A;  1K5D B;  1U27 A;  2NZ8 B;  4GMV A;  5DHF B;  1K5G B;  2OQB A;  1BAK A;  3ULC A;  1X05 A;  3A8P A;  2RGN B;  2LUL A;  3CIK A;  5EFX A;  1TQZ A;  2RLO A;  4CHJ A;  3G9W A;  4DX9 0;  2DA0 A;  4A6K A;  2ELB A;  4K2P A;  1ZC4 B;  3VIA A;  4HAW B;  3HK0 A;  1EAZ A;  5CLQ B;  1BTN A;  1GC7 A;  1P5T A;  2YT1 A;  2W2X C;  5FI1 A;  5J3Y A;  2LYD A;  1WVH A;  1Y19 B;  1SHC A;  5DIF B;  1V5P A;  4MK0 A;  1ZSQ A;  5JHH A;  1B55 A;  1U5F A;  2R09 A;  1V5M A;  2VKI A;  3TFM A;  3AU5 A;  2K00 A;  2YS5 A;  2EC1 A;  2Z0O A;  1WI1 A;  5DHA B;  3ODX A;  3SO6 A;  2ROV A;  2Y8F A;  1MIZ B;  1I7A A;  5DI9 B;  1QQG A;  4B6H A;  2HTH B;  5C6R A;  4HDO A;  5KCV A;  5D3Y A;  4YON A;  5D3V A;  2W2X D;  2D9X A;  3KY9 A;  3ULB A;  5C79 A;  2DKQ A;  5HE1 A;  2EMS A;  4GN1 A;  4DBB A;  3D8D A;  1XKE A;  3PG7 A;  2CY4 A;  2QKM A;  3SYX A;  1Q67 A;  2I5C A;  1WG7 A;  2AL6 A;  3ODO A;  4Y94 A;  5CLL B;  3LJU X;  1V61 A;  3OAN A;  1KZG A;  2PZ1 A;  2MDX A;  5HE2 A;  1UEF A;  2ELA A;  1WJM A;  4IFS A;  3CXB B;  3U8Z A;  2CY5 A;  2DFK A;  2VSZ A;  3SV1 A;  3BJI A;  4HAT B;  4K17 A;  4PNK A;  1WGU A;  5J3Q A;  3D8E A;  5D27 A;  1U5E A;  2YS3 A;  3IVF A;  1X1F A;  3HQC A;  4A6F A;  1OQN A;  1WGQ A;  4HB4 B;  4NSW A;  1SGH A;  1BWN A;  1KZ7 A;  1IRS A;  3PVW A;  1H4R A;  3MPX A;  2HE7 A;  2D2Q A;  3M1I B;  1V88 A;  5JP4 A;  2J59 M;  2QKL A;  2Q13 A;  3F0W A;  1ZM0 A;  3KRW A;  3A8Q A;  1UPR A;  4D0N B;  2DX1 A;  2DYN A;  2D11 A;  4KHO A;  3QWM A;  1PFJ A;  1NI2 A;  3DXE A;  3X23 A;  1DDW A;  2G35 A;  2DHK A;  1NU2 A;  2J0M A;  4Z2N A;  2CRF A;  2CAY A;  2N0Y A;  4ZRJ A;  4HAZ B;  1U5D A;  3PVL A;  2L2I A;  2BCJ A;  4DX8 A;  4EMO A;  2UVM A;  4EKU A;  2X18 A;  2P8V A;  1MKE A;  4BBK A;  2JP2 A;  1FGZ A;  4GXB A;  1MK9 B;  1M7R A;  1X86 A;  2COD A;  4YL8 A;  3P7Z A;  3PZD A;  1QC6 A;  2UZS A;  1P6S A;  3PP2 A;  2KGX B;  2VRW B;  1XX0 A;  3GYP A;  4HB3 B;  2GJY A;  5C5B B;  1FGY A;  2H7E A;  4XWX A;  1LB1 A;  3UZT A;  2XQN M;  3DXD A;  5FI0 A;  1P3R A;  3VOQ A;  2Y8G A;  2LKO A;  5D3W A;  2D9Z A;  4HDQ A;  1EGX A;  5DH9 B;  3WYF B;  2M38 A;  3TCA A;  3O96 A;  2COF A;  2Z0Q A;  4H8S A;  5D3X A;  4F7H A;  4CHM A;  4NY0 A;  5LON B;  2NMB A;  2LOZ A;  3PEG A;  2DYQ A;  2DN6 A;  3FSS A;  3GYO A;  2RSG A;  2Z0P A;  1KI1 B;  2GS0 A;  3U7D A;  4HAV B;  2LOX A;  4CYE A;  4PQ0 A;  1UNQ A;  2IYB A;  2ADZ A;  1DBH A;  1Z87 A;  1J19 A;  2DHJ A;  4IOY X;  1FHX A;  3QIJ A;  1FHO A;  2P0D A;  1FHW A;  4Z2M B;  3DXC A;  1ISN A;  1V89 A;  3PSC A;  1EVH A;  3V5W A;  2K2U A;  1ZVR A;  4WVF B;  5JLJ B;  1TXD A;  2IFS A;  1Y5O A;  1GC6 A;  2DLW A;  2W2W A;  3P6A A;  4K81 A;  2D9Y A;  5HE0 A;  1W1D A;  2UZR A;  2YT0 A;  4GMX B;  3F5R A;  5LOP B;  3KZ1 A;  2N23 A;  1RJ2 A;  2J0J A;  5J3T A;  5GOW B;  4DXA B;  1ZC3 B;  3N7C A;  1MAI A;  2KCJ A;  4KAX B;  2P0H A;  2K2J A;  3TVV A;  3FEH A;  1N3H A;  1OMW A;  2DHI A;  4KVG B;  1FAO A;  1NTY A;  2COC A;  1LW3 A;  1H10 A;  5HE3 A;  5KQ1 A;  1M7E A;  4HAY B;  4A6H A;  2FJL A;  4ZRI A;  1XCG A;  5C5B A;  1V5U A;  2DX5 A;  3SUZ A;  2MFQ A;  3WA0 A;  2LG1 A;  3AU4 A;  3AJ4 A;  2MWN B;  3ZDT A;  2DTC A;  4MY6 A;  1W1G A;  1EF1 A;  2Y7B A;  3SNH A;  1XD4 A;  1E5W A;  2P0F A;  1DRO A;  1PLS A;  1X1G A;  1MK7 B;  3ZVR A;  4P7I A;  3TO1 A;  1UNP A;  2L1C A;  1J0W A;  4GZU A;  4ZRK A;  4F7G A;  5C16 A;  2I1K A;  2DKP A;  1BTK A;  2M14 A;  2E2X A;  1GG3 A;  2EJ8 A;  2YRY A;  4WSF A;  2J0K A;  4K2O A;  2D10 A;  4A5K A;  1U2B A;  3T06 A;  4C0A A;  1RRP B;  3D8F A;  3TW1 A;  1XR0 B;  3HW2 B;  4MT7 A;  5L81 A;  4L6E A;  2R0D A;  4HHV A;  3KRX A;  2YF0 A;  2AEH A;  2GCL A;  2KUP A;  1MPH A;  2D9V A;  1X11 A;  5JHG A;  4HAU B;  1WJ1 A;  2MKR A;  5KQ4 A;  4KHB B;  2ROZ B;  2YS1 A;  4HAX B;  4F7U P;  2V76 A;  1UPQ A;  2D4Q A;  2I1J A;  1UNR A;  4A6F B;  1XOD A;  1DDM A;  2EMT A;  1FOE A;  3RCP A;  4GPT B;  2YSZ A;  2GCJ A;  1DDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...