3DXCA

Crystal structure of the intracellular domain of human app in complex with fe65-ptb2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
NELVQKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein-binding family B member 1
publication title Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 130
sequence length 130
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3dxcA00
1ISNA 2YS5A 2EMTA 1U5EA 3PP2A 1MKEA 3PG7A 2I5FA 3BJIA 1QQGA 3M1IB 4GXBA 1WI1A 2H7DA 2KCJA 4GMXB 4H8SA 3MDBC 2LULA 4DXAB 3HQCA 2YT0A 1MPHA 5EFXA 4A6FA 1U29A 2DYNA 3TFMA 3OANA 2D9YA 1MIXA 5DIFB 4L6EA 3GYPA 2ADZA 1IRSA 4PNKA 1V89A 2R0DA 1UPRA 1WJMA 5KCVA 1BWNA 4EMOA 3ODWA 4IAPA 2FJLA 3DXDA 5D3YA 2DFKA 5HE0A 1NU2A 3PSCA 1MIZB 4HB2B 4IFSA 1RJ2A 3DXEA 3ODXA 2COAA 2D10A 2LOZA 1M7RA 2K2JA 2BCJA 1U5GA 4D0NB 1V5PA 4HHVA 5C79A 5GOWB 3RCPA 1MK9B 1U5FA 3QIJA 2H7EA 3PVUA 1X1GA 1Y19B 1ZC3B 2DTCA 3KY9A 5HE1A 1EF1A 1DDMA 3TW1A 1MAIA 5CLQB 2I5CA 2Y8GA 1TXDA 2LG1A 1I7AA 3BINA 1M7EA 3CXBB 1WGUA 3KRWA 3UZTA 5C6RA 2M38A 1OQNA 3SNHA 4F7GA 1DYNA 2W2XD 1I2HA 5J3QA 4MT7A 4TKNA 4P7IA 2J59M 1PLSA 2COCA 1NTYA 1NTVA 1KI1B 1ZM0A 4KVGB 3N7CA 4GZUA 3TCAA 4CHJA 1FGYA 1FB8A 3KZ1A 4GN1A 4DX90 2D11A 2YSZA 4IOYX 1WVHA 3TO1A 4YL8A 3DXCA 2DHJA 2P0HA 4ZRIA 2UZSA 4HB4B 2I1KA 2Z0PA 3FEHA 2JP2A 4B6HA 1FGZA 1V88A 3HW2B 2DA0A 1K5GB 2NZ8B 4DX8A 2YVCA 5J3TA 1BAKA 4A6KA 1WJ1A 4Z2MB 2CY4A 3U8ZA 4F7UP 2DKPA 2MKRA 2IYBA 1FHWA 2RNRB 4MK0A 2EC1A 2KUPA 2CRFA 2DHKA 2XQNM 3FSSA 2ELBA 1WG7A 2VSZA 3HK0A 1Y5OA 4K81A 1UEFA 4HAZB 2DX5A 1OMWA 1UNRA 4K17A 1BTKA 2D9VA 2YRYA 1U2BA 4NSWA 4KHBB 4KHOA 5D27A 2GJYA 1UNQA 2N0YA 2QKMA 1BTNA 2QKLA 3QBVB 3D8FA 3G9WA 3U7DA 1EVHA 2P0DA 1P5TA 2DLWA 5HE2A 2D2QA 1W1HA 1FOEA 4NY0A 3D8EA 3X23A 2NMBA 3P6AA 3QWMA 1W1GA 1SHCA 1XX0A 1XKEA 1H10A 5JHGA 2PZ1A 2P0FA 5DI9B 2CAYA 1EGXA 5HE3A 1RRPB 2OTXA 1DBHA 3VIAA 2R09A 1XD4A 3ODOA 1U27A 4HAXB 2YF0A 1TQZA 2J0JA 1XR0B 5C5BB 1ZC4B 5C16A 2ELAA 3ULBA 4XWXA 2HE7A 4EJNA 1AWEA 3AU4A 1J0WA 1XODA 4Z2NA 4HDOA 3V5WA 2MWNB 4CHMA 2D9ZA 3VOQA 4MY6A 1E5WA 1FHXA 2Z0OA 1X11A 4GMVA 4ZRJA 2AL6A 3A98B 2RSGA 2YS1A 3A8PA 2Z0QA 3PVWA 3WYFB 4WJ7A 1FHOA 1B55A 3AU5A 3SV1A 2UVMA 2YT1A 5KQ4A 2GS0A 1GC7A 1KZGA 2CODA 4TYZA 4WVFB 2GCLA 4HAVB 1DDVA 2ROZB 2EMSA 5JP4A 1N3HA 2W2XC 3SYXA 5LONB 1SGHA 3KRXA 5D3WA 2LYDA 1V5UA 1V61A 5D3VA 2RUKB 2M14A 4HDQA 2Q13A 3A8QA 2RLOA 5DH9B 2K00A 3PEGA 2DN6A 1LW3A 1GG3A 2E2XA 1ZVRA 2UZRA 4EKUA 1MK7B 2P8VA 4KAXB 3ZDTA 2CY5A 3FM8C 4WSFA 3PZDA 2DKQA 4K2OA 5D3XA 2L2IA 5J3YA 4HAUB 1KZ7A 4F7HA 4HB3B 3F5RA 3D8DA 4A6FB 1P3RA 5DHFB 2GCJA 2MDXA 5FI1A 3ULCA 2LKOA 4C0AA 4ZRKA 1K5DB 3SO6A 2DYQA 5FI0A 3SUZA 4YONA 3CIKA 1FAOA 1X1FA 2V76A 2Y7BA 3MPXA 2COFA 3IVFA 1J19A 1NI2A 5KQ1A 4Y94A 1LB1A 1QC6A 1X86A 4HAYB 1WGQA 5L81A 2I1JA 2W2WA 2ZPYA 5JLJB 3F0WA 5C5BA 3T06A 4A6HA 4A5KA 5DHAB 2L1CA 2Y8FA 1XCGA 2EJ8A 5JHHA 4HAWB 4KHAA 1Q67A 2J0KA 2IFSA 1DDWA 1ZSQA 2ROVA 1PFJA 1V5MA 2RVBB 3KSYA 1OY2A 2DX1A 3NSUA 2X18A 2HTHB 3PVLA 1H4RA 2J0MA 3ML4A 4HATB 2D9XA 1PMSA 1U5DA 3WA0A 4BBKA 1Z87A 3TVVA 1X05A 2DHIA 2VKIA 5CLLB 2YS3A 2RGNB 1EAZA 3AJ4A 2OQBA 4PQ0A 2G35A 1AQCA 2D4QA 3LJUX 1UPQA 2LOXA 4CYEA 4HB0B 1UNPA 2VRWB 5LOPB 1W1DA 3O96A 1DROA 4K2PA 3GYOA 3P7ZA 1P6SA 2KGXB 1TJ6A 4DBBA 4GPTB 3ZVRA 2MFQA 2K2UA 1GC6A 2N23A 2D9WA 2AEHA
chains in the Genus database with same CATH superfamily
1ISNA 2YS5A 2EMTA 1U5EA 3PP2A 1MKEA 3PG7A 2I5FA 3BJIA 1QQGA 3M1IB 4GXBA 1WI1A 2H7DA 2KCJA 4GMXB 4H8SA 3MDBC 2LULA 4DXAB 3HSAA 3HQCA 2YT0A 1MPHA 5EFXA 4A6FA 1U29A 2DYNA 3TFMA 3OANA 2D9YA 1MIXA 5DIFB 2AEHA 3GYPA 4L6EA 2ADZA 1IRSA 4PNKA 1V89A 2R0DA 1UPRA 1WJMA 5KCVA 1BWNA 4EMOA 3ODWA 4IAPA 2FJLA 3DXDA 5D3YA 2DFKA 5HE0A 1NU2A 3PSCA 1MIZB 4HB2B 4IFSA 1RJ2A 3DXEA 3ODXA 2COAA 4OSNA 2D10A 2LOZA 1M7RA 2K2JA 2BCJA 1U5GA 4D0NB 1V5PA 4HHVA 5C79A 5GOWB 3RCPA 1MK9B 1U5FA 3QIJA 2H7EA 3PVUA 1X1GA 1Y19B 1ZC3B 2DTCA 3KY9A 5HE1A 1EF1A 4DIXA 1DDMA 3TW1A 5IRSA 1MAIA 5CLQB 2I5CA 2Y8GA 1TXDA 2LG1A 1I7AA 3BINA 1M7EA 3CXBB 1WGUA 3KRWA 3UZTA 3NWFA 5C6RA 2M38A 1OQNA 3SNHA 4F7GA 1DYNA 2Z14A 2W2XD 2ZKMX 1I2HA 5J3QA 4MT7A 4TKNA 4P7IA 2J59M 1PLSA 2COCA 1NTYA 1NTVA 1KI1B 2KIEA 1ZM0A 4KVGB 3N7CA 4GZUA 3TCAA 4CHJA 1FGYA 1FB8A 3KZ1A 4GN1A 4DX90 2D11A 4QJ3B 2YSZA 2GUMA 4IOYX 1WVHA 3TO1A 4YL8A 3DXCA 2DHJA 2P0HA 4ZRIA 1T77A 2UZSA 4HB4B 2I1KA 2Z0PA 3FEHA 2JP2A 4B6HA 1FGZA 1V88A 3NWAA 5M4YB 4HSIA 3HW2B 2DA0A 1K5GB 2NZ8B 4DX8A 2YVCA 5J3TA 1BAKA 4A6KA 1WJ1A 4Z2MB 2CY4A 3U8ZA 4F7UP 2DKPA 2MKRA 2IYBA 1FHWA 2RNRB 4MK0A 2EC1A 2KUPA 2CRFA 2DHKA 2XQNM 3FSSA 2ELBA 1WG7A 4L1RA 2VSZA 3HK0A 1Y5OA 4K81A 1UEFA 4HAZB 2DX5A 5LG4B 1OMWA 1MI1A 1UNRA 1BTKA 4K17A 2D9VA 2YRYA 1U2BA 4NSWA 4KHBB 4KHOA 5D27A 2GJYA 1UNQA 2N0YA 4QJ4B 2QKMA 1BTNA 2QKLA 3QBVB 3D8FA 3G9WA 3U7DA 1EVHA 3B77A 2P0DA 1P5TA 2DLWA 5HE2A 2D2QA 1W1HA 1FOEA 4NY0A 3D8EA 3X23A 2Z13A 2NMBA 3P6AA 3QWMA 1W1GA 1SHCA 1XX0A 1XKEA 1H10A 5JHGA 2PZ1A 2P0FA 5DI9B 2CAYA 1EGXA 5HE3A 1RRPB 2OTXA 1DBHA 3VIAA 2R09A 1XD4A 3ODOA 1U27A 4HAXB 2YF0A 1TQZA 2J0JA 1XR0B 5C5BB 2YT2A 1ZC4B 5C16A 2ELAA 3ULBA 4XWXA 2HE7A 4EJNA 1AWEA 3AU4A 1J0WA 4QXAB 1XODA 4Z2NA 4HDOA 3V5WA 2MWNB 4GNKB 4CHMA 2Z4DA 2D9ZA 2RRFA 3VOQA 4MY6A 1E5WA 1FHXA 2Z0OA 2KIGA 1X11A 4GMVA 4ZRJA 2AL6A 5I2MA 3A98B 2RSGA 2YS1A 3U12A 3A8PA 2Z0QA 3PVWA 3WYFB 4WJ7A 1FHOA 1B55A 3AU5A 3SV1A 2UVMA 2YT1A 5KQ4A 2GS0A 1GC7A 1KZGA 2CODA 4TYZA 4WVFB 2GCLA 4HAVB 1DDVA 2ROZB 2EMSA 5JP4A 1N3HA 5I2SA 2W2XC 3SYXA 5LONB 1SGHA 3KRXA 5D3WA 2LYDA 1V5UA 1V61A 5D3VA 2RUKB 2M14A 4HDQA 2Q13A 3A8QA 2RLOA 5DH9B 2K00A 3PEGA 2DN6A 1LW3A 1GG3A 2R2YA 2E2XA 1ZVRA 2Z59A 2UZRA 4EKUA 1MK7B 2K49A 2P8VA 2KUQA 4KAXB 3ZDTA 2CY5A 3FM8C 4WSFA 4KHBA 3OHMB 2NBVA 3PZDA 2DKQA 4K2OA 5D3XA 2L2IA 5J3YA 4HAUB 1KZ7A 4F7HA 4HB3B 3F5RA 3D8DA 4A6FB 1P3RA 5DHFB 2GCJA 2MDXA 5FI1A 3ULCA 2LKOA 4C0AA 4ZRKA 1K5DB 3SO6A 2DYQA 5FI0A 4D6WA 3SUZA 4YONA 3CIKA 3HIEA 1FAOA 1X1FA 2V76A 2Y7BA 3MPXA 2COFA 3IVFA 1J19A 1NI2A 5KQ1A 4Y94A 1LB1A 1QC6A 3NW8A 1X86A 4HAYB 3NWDA 1WGQA 5L81A 2I1JA 2W2WA 2ZPYA 5JLJB 3F0WA 5C5BA 3T06A 4A6HA 4A5KA 5DHAB 2L1CA 2Y8FA 4QJ5B 1XCGA 2EJ8A 5JHHA 4HAWB 4KHAA 1Q67A 2J0KA 2IFSA 4CSQA 1DDWA 1ZSQA 2ROVA 1PFJA 4OT1A 1V5MA 2RVBB 3KSYA 1OY2A 2DX1A 3NSUA 2X18A 2HTHB 1H4RA 3PVLA 2J0MA 3ML4A 4GOUA 2K8EA 4HATB 2D9XA 1PMSA 1U5DA 3WA0A 4BBKA 2KR0A 1Z87A 3TVVA 1X05A 3DCXA 2DHIA 2VKIA 5CLLB 2YS3A 2RGNB 1EAZA 3AJ4A 2OQBA 3FVCA 4PQ0A 2G35A 1AQCA 2D4QA 3LJUX 1UPQA 2LOXA 4CYEA 4HB0B 1UNPA 2VRWB 1ZYIA 5LOPB 1W1DA 3O96A 1DROA 4K2PA 3GYOA 3P7ZA 1P6SA 2KGXB 1TJ6A 4DBBA 4GPTB 3ZVRA 2MFQA 2K2UA 1GC6A 2N23A 2D9WA 2FJUB 3A58A
chains in the Genus database with same CATH topology
1ISNA 2YS5A 2EMTA 1U5EA 3PP2A 1MKEA 3PG7A 2I5FA 3BJIA 1QQGA 3M1IB 4GXBA 1WI1A 2H7DA 2KCJA 4GMXB 4H8SA 3MDBC 2LULA 4DXAB 3HQCA 2YT0A 1MPHA 5EFXA 4A6FA 1U29A 2DYNA 3TFMA 3OANA 2D9YA 1MIXA 5DIFB 4L6EA 3GYPA 2ADZA 1IRSA 4PNKA 1V89A 2R0DA 1UPRA 1WJMA 5KCVA 1BWNA 4EMOA 3ODWA 4IAPA 2FJLA 3DXDA 5D3YA 2DFKA 5HE0A 1NU2A 3PSCA 1MIZB 4HB2B 4IFSA 1RJ2A 3DXEA 3ODXA 2COAA 2D10A 2LOZA 1M7RA 2K2JA 2BCJA 1U5GA 4D0NB 1V5PA 4HHVA 5C79A 5GOWB 3RCPA 1MK9B 1U5FA 3QIJA 2H7EA 3PVUA 1X1GA 1Y19B 1ZC3B 2DTCA 3KY9A 5HE1A 1EF1A 1DDMA 3TW1A 1MAIA 5CLQB 2I5CA 2Y8GA 1TXDA 2LG1A 1I7AA 3BINA 1M7EA 3CXBB 1WGUA 3KRWA 3UZTA 5C6RA 2M38A 1OQNA 3SNHA 4F7GA 1DYNA 2W2XD 1I2HA 5J3QA 4MT7A 4TKNA 4P7IA 2J59M 1PLSA 2COCA 1NTYA 1NTVA 1KI1B 1ZM0A 4KVGB 3N7CA 4GZUA 3TCAA 4CHJA 1FGYA 1FB8A 3KZ1A 4GN1A 4DX90 2D11A 2YSZA 4IOYX 1WVHA 3TO1A 4YL8A 3DXCA 2DHJA 2P0HA 4ZRIA 2UZSA 4HB4B 2I1KA 2Z0PA 3FEHA 2JP2A 4B6HA 1FGZA 1V88A 3HW2B 2DA0A 1K5GB 2NZ8B 4DX8A 2YVCA 5J3TA 1BAKA 4A6KA 1WJ1A 4Z2MB 2CY4A 3U8ZA 4F7UP 2DKPA 2MKRA 2IYBA 1FHWA 2RNRB 4MK0A 2EC1A 2KUPA 2CRFA 2DHKA 2XQNM 3FSSA 2ELBA 1WG7A 2VSZA 3HK0A 1Y5OA 4K81A 1UEFA 4HAZB 2DX5A 1OMWA 1UNRA 4K17A 1BTKA 2D9VA 2YRYA 1U2BA 4NSWA 4KHBB 4KHOA 5D27A 2GJYA 1UNQA 2N0YA 2QKMA 1BTNA 2QKLA 3QBVB 3D8FA 3G9WA 3U7DA 1EVHA 2P0DA 1P5TA 2DLWA 5HE2A 2D2QA 1W1HA 1FOEA 4NY0A 3D8EA 3X23A 2NMBA 3P6AA 3QWMA 1W1GA 1SHCA 1XX0A 1XKEA 1H10A 5JHGA 2PZ1A 2P0FA 5DI9B 2CAYA 1EGXA 5HE3A 1RRPB 2OTXA 1DBHA 3VIAA 2R09A 1XD4A 3ODOA 1U27A 4HAXB 2YF0A 1TQZA 2J0JA 1XR0B 5C5BB 1ZC4B 5C16A 2ELAA 3ULBA 4XWXA 2HE7A 4EJNA 1AWEA 3AU4A 1J0WA 1XODA 4Z2NA 4HDOA 3V5WA 2MWNB 4CHMA 2D9ZA 3VOQA 4MY6A 1E5WA 1FHXA 2Z0OA 1X11A 4GMVA 4ZRJA 2AL6A 3A98B 2RSGA 2YS1A 3A8PA 2Z0QA 3PVWA 3WYFB 4WJ7A 1FHOA 1B55A 3AU5A 3SV1A 2UVMA 2YT1A 5KQ4A 2GS0A 1GC7A 1KZGA 2CODA 4TYZA 4WVFB 2GCLA 4HAVB 1DDVA 2ROZB 2EMSA 5JP4A 1N3HA 2W2XC 3SYXA 5LONB 1SGHA 3KRXA 5D3WA 2LYDA 1V5UA 1V61A 5D3VA 2RUKB 2M14A 4HDQA 2Q13A 3A8QA 2RLOA 5DH9B 2K00A 3PEGA 2DN6A 1LW3A 1GG3A 2E2XA 1ZVRA 2UZRA 4EKUA 1MK7B 2P8VA 4KAXB 3ZDTA 2CY5A 3FM8C 4WSFA 3PZDA 2DKQA 4K2OA 5D3XA 2L2IA 5J3YA 4HAUB 1KZ7A 4F7HA 4HB3B 3F5RA 3D8DA 4A6FB 1P3RA 5DHFB 2GCJA 2MDXA 5FI1A 3ULCA 2LKOA 4C0AA 4ZRKA 1K5DB 3SO6A 2DYQA 5FI0A 3SUZA 4YONA 3CIKA 1FAOA 1X1FA 2V76A 2Y7BA 3MPXA 2COFA 3IVFA 1J19A 1NI2A 5KQ1A 4Y94A 1LB1A 1QC6A 1X86A 4HAYB 1WGQA 5L81A 2I1JA 2W2WA 2ZPYA 5JLJB 3F0WA 5C5BA 3T06A 4A6HA 4A5KA 5DHAB 2L1CA 2Y8FA 1XCGA 2EJ8A 5JHHA 4HAWB 4KHAA 1Q67A 2J0KA 2IFSA 1DDWA 1ZSQA 2ROVA 1PFJA 1V5MA 2RVBB 3KSYA 1OY2A 2DX1A 3NSUA 2X18A 2HTHB 3PVLA 1H4RA 2J0MA 3ML4A 4HATB 2D9XA 1PMSA 1U5DA 3WA0A 4BBKA 1Z87A 3TVVA 1X05A 2DHIA 2VKIA 5CLLB 2YS3A 2RGNB 1EAZA 3AJ4A 2OQBA 4PQ0A 2G35A 1AQCA 2D4QA 3LJUX 1UPQA 2LOXA 4CYEA 4HB0B 1UNPA 2VRWB 5LOPB 1W1DA 3O96A 1DROA 4K2PA 3GYOA 3P7ZA 1P6SA 2KGXB 1TJ6A 4DBBA 4GPTB 3ZVRA 2MFQA 2K2UA 1GC6A 2N23A 2D9WA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISN A;  2YS5 A;  2EMT A;  1U5E A;  3PP2 A;  1MKE A;  3PG7 A;  2I5F A;  3BJI A;  1QQG A;  3M1I B;  4GXB A;  1WI1 A;  2H7D A;  2KCJ A;  4GMX B;  4H8S A;  3MDB C;  2LUL A;  4DXA B;  3HQC A;  2YT0 A;  1MPH A;  5EFX A;  4A6F A;  1U29 A;  2DYN A;  3TFM A;  3OAN A;  2D9Y A;  1MIX A;  5DIF B;  4L6E A;  3GYP A;  2ADZ A;  1IRS A;  4PNK A;  1V89 A;  2R0D A;  1UPR A;  1WJM A;  5KCV A;  1BWN A;  4EMO A;  3ODW A;  4IAP A;  2FJL A;  3DXD A;  5D3Y A;  2DFK A;  5HE0 A;  1NU2 A;  3PSC A;  1MIZ B;  4HB2 B;  4IFS A;  1RJ2 A;  3DXE A;  3ODX A;  2COA A;  2D10 A;  2LOZ A;  1M7R A;  2K2J A;  2BCJ A;  1U5G A;  4D0N B;  1V5P A;  4HHV A;  5C79 A;  5GOW B;  3RCP A;  1MK9 B;  1U5F A;  3QIJ A;  2H7E A;  3PVU A;  1X1G A;  1Y19 B;  1ZC3 B;  2DTC A;  3KY9 A;  5HE1 A;  1EF1 A;  1DDM A;  3TW1 A;  1MAI A;  5CLQ B;  2I5C A;  2Y8G A;  1TXD A;  2LG1 A;  1I7A A;  3BIN A;  1M7E A;  3CXB B;  1WGU A;  3KRW A;  3UZT A;  5C6R A;  2M38 A;  1OQN A;  3SNH A;  4F7G A;  1DYN A;  2W2X D;  1I2H A;  5J3Q A;  4MT7 A;  4TKN A;  4P7I A;  2J59 M;  1PLS A;  2COC A;  1NTY A;  1NTV A;  1KI1 B;  1ZM0 A;  4KVG B;  3N7C A;  4GZU A;  3TCA A;  4CHJ A;  1FGY A;  1FB8 A;  3KZ1 A;  4GN1 A;  4DX9 0;  2D11 A;  2YSZ A;  4IOY X;  1WVH A;  3TO1 A;  4YL8 A;  3DXC A;  2DHJ A;  2P0H A;  4ZRI A;  2UZS A;  4HB4 B;  2I1K A;  2Z0P A;  3FEH A;  2JP2 A;  4B6H A;  1FGZ A;  1V88 A;  3HW2 B;  2DA0 A;  1K5G B;  2NZ8 B;  4DX8 A;  2YVC A;  5J3T A;  1BAK A;  4A6K A;  1WJ1 A;  4Z2M B;  2CY4 A;  3U8Z A;  4F7U P;  2DKP A;  2MKR A;  2IYB A;  1FHW A;  2RNR B;  4MK0 A;  2EC1 A;  2KUP A;  2CRF A;  2DHK A;  2XQN M;  3FSS A;  2ELB A;  1WG7 A;  2VSZ A;  3HK0 A;  1Y5O A;  4K81 A;  1UEF A;  4HAZ B;  2DX5 A;  1OMW A;  1UNR A;  4K17 A;  1BTK A;  2D9V A;  2YRY A;  1U2B A;  4NSW A;  4KHB B;  4KHO A;  5D27 A;  2GJY A;  1UNQ A;  2N0Y A;  2QKM A;  1BTN A;  2QKL A;  3QBV B;  3D8F A;  3G9W A;  3U7D A;  1EVH A;  2P0D A;  1P5T A;  2DLW A;  5HE2 A;  2D2Q A;  1W1H A;  1FOE A;  4NY0 A;  3D8E A;  3X23 A;  2NMB A;  3P6A A;  3QWM A;  1W1G A;  1SHC A;  1XX0 A;  1XKE A;  1H10 A;  5JHG A;  2PZ1 A;  2P0F A;  5DI9 B;  2CAY A;  1EGX A;  5HE3 A;  1RRP B;  2OTX A;  1DBH A;  3VIA A;  2R09 A;  1XD4 A;  3ODO A;  1U27 A;  4HAX B;  2YF0 A;  1TQZ A;  2J0J A;  1XR0 B;  5C5B B;  1ZC4 B;  5C16 A;  2ELA A;  3ULB A;  4XWX A;  2HE7 A;  4EJN A;  1AWE A;  3AU4 A;  1J0W A;  1XOD A;  4Z2N A;  4HDO A;  3V5W A;  2MWN B;  4CHM A;  2D9Z A;  3VOQ A;  4MY6 A;  1E5W A;  1FHX A;  2Z0O A;  1X11 A;  4GMV A;  4ZRJ A;  2AL6 A;  3A98 B;  2RSG A;  2YS1 A;  3A8P A;  2Z0Q A;  3PVW A;  3WYF B;  4WJ7 A;  1FHO A;  1B55 A;  3AU5 A;  3SV1 A;  2UVM A;  2YT1 A;  5KQ4 A;  2GS0 A;  1GC7 A;  1KZG A;  2COD A;  4TYZ A;  4WVF B;  2GCL A;  4HAV B;  1DDV A;  2ROZ B;  2EMS A;  5JP4 A;  1N3H A;  2W2X C;  3SYX A;  5LON B;  1SGH A;  3KRX A;  5D3W A;  2LYD A;  1V5U A;  1V61 A;  5D3V A;  2RUK B;  2M14 A;  4HDQ A;  2Q13 A;  3A8Q A;  2RLO A;  5DH9 B;  2K00 A;  3PEG A;  2DN6 A;  1LW3 A;  1GG3 A;  2E2X A;  1ZVR A;  2UZR A;  4EKU A;  1MK7 B;  2P8V A;  4KAX B;  3ZDT A;  2CY5 A;  3FM8 C;  4WSF A;  3PZD A;  2DKQ A;  4K2O A;  5D3X A;  2L2I A;  5J3Y A;  4HAU B;  1KZ7 A;  4F7H A;  4HB3 B;  3F5R A;  3D8D A;  4A6F B;  1P3R A;  5DHF B;  2GCJ A;  2MDX A;  5FI1 A;  3ULC A;  2LKO A;  4C0A A;  4ZRK A;  1K5D B;  3SO6 A;  2DYQ A;  5FI0 A;  3SUZ A;  4YON A;  3CIK A;  1FAO A;  1X1F A;  2V76 A;  2Y7B A;  3MPX A;  2COF A;  3IVF A;  1J19 A;  1NI2 A;  5KQ1 A;  4Y94 A;  1LB1 A;  1QC6 A;  1X86 A;  4HAY B;  1WGQ A;  5L81 A;  2I1J A;  2W2W A;  2ZPY A;  5JLJ B;  3F0W A;  5C5B A;  3T06 A;  4A6H A;  4A5K A;  5DHA B;  2L1C A;  2Y8F A;  1XCG A;  2EJ8 A;  5JHH A;  4HAW B;  4KHA A;  1Q67 A;  2J0K A;  2IFS A;  1DDW A;  1ZSQ A;  2ROV A;  1PFJ A;  1V5M A;  2RVB B;  3KSY A;  1OY2 A;  2DX1 A;  3NSU A;  2X18 A;  2HTH B;  3PVL A;  1H4R A;  2J0M A;  3ML4 A;  4HAT B;  2D9X A;  1PMS A;  1U5D A;  3WA0 A;  4BBK A;  1Z87 A;  3TVV A;  1X05 A;  2DHI A;  2VKI A;  5CLL B;  2YS3 A;  2RGN B;  1EAZ A;  3AJ4 A;  2OQB A;  4PQ0 A;  2G35 A;  1AQC A;  2D4Q A;  3LJU X;  1UPQ A;  2LOX A;  4CYE A;  4HB0 B;  1UNP A;  2VRW B;  5LOP B;  1W1D A;  3O96 A;  1DRO A;  4K2P A;  3GYO A;  3P7Z A;  1P6S A;  2KGX B;  1TJ6 A;  4DBB A;  4GPT B;  3ZVR A;  2MFQ A;  2K2U A;  1GC6 A;  2N23 A;  2D9W A;  2AEH A; 
#chains in the Genus database with same CATH topology
 1ISN A;  2YS5 A;  2EMT A;  1U5E A;  3PP2 A;  1MKE A;  3PG7 A;  2I5F A;  3BJI A;  1QQG A;  3M1I B;  4GXB A;  1WI1 A;  2H7D A;  2KCJ A;  4GMX B;  4H8S A;  3MDB C;  2LUL A;  4DXA B;  3HSA A;  3HQC A;  2YT0 A;  1MPH A;  5EFX A;  4A6F A;  1U29 A;  2DYN A;  3TFM A;  3OAN A;  2D9Y A;  1MIX A;  5DIF B;  2AEH A;  3GYP A;  4L6E A;  2ADZ A;  1IRS A;  4PNK A;  1V89 A;  2R0D A;  1UPR A;  1WJM A;  5KCV A;  1BWN A;  4EMO A;  3ODW A;  4IAP A;  2FJL A;  3DXD A;  5D3Y A;  2DFK A;  5HE0 A;  1NU2 A;  3PSC A;  1MIZ B;  4HB2 B;  4IFS A;  1RJ2 A;  3DXE A;  3ODX A;  2COA A;  4OSN A;  2D10 A;  2LOZ A;  1M7R A;  2K2J A;  2BCJ A;  1U5G A;  4D0N B;  1V5P A;  4HHV A;  5C79 A;  5GOW B;  3RCP A;  1MK9 B;  1U5F A;  3QIJ A;  2H7E A;  3PVU A;  1X1G A;  1Y19 B;  1ZC3 B;  2DTC A;  3KY9 A;  5HE1 A;  1EF1 A;  4DIX A;  1DDM A;  3TW1 A;  5IRS A;  1MAI A;  5CLQ B;  2I5C A;  2Y8G A;  1TXD A;  2LG1 A;  1I7A A;  3BIN A;  1M7E A;  3CXB B;  1WGU A;  3KRW A;  3UZT A;  3NWF A;  5C6R A;  2M38 A;  1OQN A;  3SNH A;  4F7G A;  1DYN A;  2Z14 A;  2W2X D;  2ZKM X;  1I2H A;  5J3Q A;  4MT7 A;  4TKN A;  4P7I A;  2J59 M;  1PLS A;  2COC A;  1NTY A;  1NTV A;  1KI1 B;  2KIE A;  1ZM0 A;  4KVG B;  3N7C A;  4GZU A;  3TCA A;  4CHJ A;  1FGY A;  1FB8 A;  3KZ1 A;  4GN1 A;  4DX9 0;  2D11 A;  4QJ3 B;  2YSZ A;  2GUM A;  4IOY X;  1WVH A;  3TO1 A;  4YL8 A;  3DXC A;  2DHJ A;  2P0H A;  4ZRI A;  1T77 A;  2UZS A;  4HB4 B;  2I1K A;  2Z0P A;  3FEH A;  2JP2 A;  4B6H A;  1FGZ A;  1V88 A;  3NWA A;  5M4Y B;  4HSI A;  3HW2 B;  2DA0 A;  1K5G B;  2NZ8 B;  4DX8 A;  2YVC A;  5J3T A;  1BAK A;  4A6K A;  1WJ1 A;  4Z2M B;  2CY4 A;  3U8Z A;  4F7U P;  2DKP A;  2MKR A;  2IYB A;  1FHW A;  2RNR B;  4MK0 A;  2EC1 A;  2KUP A;  2CRF A;  2DHK A;  2XQN M;  3FSS A;  2ELB A;  1WG7 A;  4L1R A;  2VSZ A;  3HK0 A;  1Y5O A;  4K81 A;  1UEF A;  4HAZ B;  2DX5 A;  5LG4 B;  1OMW A;  1MI1 A;  1UNR A;  1BTK A;  4K17 A;  2D9V A;  2YRY A;  1U2B A;  4NSW A;  4KHB B;  4KHO A;  5D27 A;  2GJY A;  1UNQ A;  2N0Y A;  4QJ4 B;  2QKM A;  1BTN A;  2QKL A;  3QBV B;  3D8F A;  3G9W A;  3U7D A;  1EVH A;  3B77 A;  2P0D A;  1P5T A;  2DLW A;  5HE2 A;  2D2Q A;  1W1H A;  1FOE A;  4NY0 A;  3D8E A;  3X23 A;  2Z13 A;  2NMB A;  3P6A A;  3QWM A;  1W1G A;  1SHC A;  1XX0 A;  1XKE A;  1H10 A;  5JHG A;  2PZ1 A;  2P0F A;  5DI9 B;  2CAY A;  1EGX A;  5HE3 A;  1RRP B;  2OTX A;  1DBH A;  3VIA A;  2R09 A;  1XD4 A;  3ODO A;  1U27 A;  4HAX B;  2YF0 A;  1TQZ A;  2J0J A;  1XR0 B;  5C5B B;  2YT2 A;  1ZC4 B;  5C16 A;  2ELA A;  3ULB A;  4XWX A;  2HE7 A;  4EJN A;  1AWE A;  3AU4 A;  1J0W A;  4QXA B;  1XOD A;  4Z2N A;  4HDO A;  3V5W A;  2MWN B;  4GNK B;  4CHM A;  2Z4D A;  2D9Z A;  2RRF A;  3VOQ A;  4MY6 A;  1E5W A;  1FHX A;  2Z0O A;  2KIG A;  1X11 A;  4GMV A;  4ZRJ A;  2AL6 A;  5I2M A;  3A98 B;  2RSG A;  2YS1 A;  3U12 A;  3A8P A;  2Z0Q A;  3PVW A;  3WYF B;  4WJ7 A;  1FHO A;  1B55 A;  3AU5 A;  3SV1 A;  2UVM A;  2YT1 A;  5KQ4 A;  2GS0 A;  1GC7 A;  1KZG A;  2COD A;  4TYZ A;  4WVF B;  2GCL A;  4HAV B;  1DDV A;  2ROZ B;  2EMS A;  5JP4 A;  1N3H A;  5I2S A;  2W2X C;  3SYX A;  5LON B;  1SGH A;  3KRX A;  5D3W A;  2LYD A;  1V5U A;  1V61 A;  5D3V A;  2RUK B;  2M14 A;  4HDQ A;  2Q13 A;  3A8Q A;  2RLO A;  5DH9 B;  2K00 A;  3PEG A;  2DN6 A;  1LW3 A;  1GG3 A;  2R2Y A;  2E2X A;  1ZVR A;  2Z59 A;  2UZR A;  4EKU A;  1MK7 B;  2K49 A;  2P8V A;  2KUQ A;  4KAX B;  3ZDT A;  2CY5 A;  3FM8 C;  4WSF A;  4KHB A;  3OHM B;  2NBV A;  3PZD A;  2DKQ A;  4K2O A;  5D3X A;  2L2I A;  5J3Y A;  4HAU B;  1KZ7 A;  4F7H A;  4HB3 B;  3F5R A;  3D8D A;  4A6F B;  1P3R A;  5DHF B;  2GCJ A;  2MDX A;  5FI1 A;  3ULC A;  2LKO A;  4C0A A;  4ZRK A;  1K5D B;  3SO6 A;  2DYQ A;  5FI0 A;  4D6W A;  3SUZ A;  4YON A;  3CIK A;  3HIE A;  1FAO A;  1X1F A;  2V76 A;  2Y7B A;  3MPX A;  2COF A;  3IVF A;  1J19 A;  1NI2 A;  5KQ1 A;  4Y94 A;  1LB1 A;  1QC6 A;  3NW8 A;  1X86 A;  4HAY B;  3NWD A;  1WGQ A;  5L81 A;  2I1J A;  2W2W A;  2ZPY A;  5JLJ B;  3F0W A;  5C5B A;  3T06 A;  4A6H A;  4A5K A;  5DHA B;  2L1C A;  2Y8F A;  4QJ5 B;  1XCG A;  2EJ8 A;  5JHH A;  4HAW B;  4KHA A;  1Q67 A;  2J0K A;  2IFS A;  4CSQ A;  1DDW A;  1ZSQ A;  2ROV A;  1PFJ A;  4OT1 A;  1V5M A;  2RVB B;  3KSY A;  1OY2 A;  2DX1 A;  3NSU A;  2X18 A;  2HTH B;  1H4R A;  3PVL A;  2J0M A;  3ML4 A;  4GOU A;  2K8E A;  4HAT B;  2D9X A;  1PMS A;  1U5D A;  3WA0 A;  4BBK A;  2KR0 A;  1Z87 A;  3TVV A;  1X05 A;  3DCX A;  2DHI A;  2VKI A;  5CLL B;  2YS3 A;  2RGN B;  1EAZ A;  3AJ4 A;  2OQB A;  3FVC A;  4PQ0 A;  2G35 A;  1AQC A;  2D4Q A;  3LJU X;  1UPQ A;  2LOX A;  4CYE A;  4HB0 B;  1UNP A;  2VRW B;  1ZYI A;  5LOP B;  1W1D A;  3O96 A;  1DRO A;  4K2P A;  3GYO A;  3P7Z A;  1P6S A;  2KGX B;  1TJ6 A;  4DBB A;  4GPT B;  3ZVR A;  2MFQ A;  2K2U A;  1GC6 A;  2N23 A;  2D9W A;  2FJU B;  3A58 A; 
#chains in the Genus database with same CATH homology
 1ISN A;  2YS5 A;  2EMT A;  1U5E A;  3PP2 A;  1MKE A;  3PG7 A;  2I5F A;  3BJI A;  1QQG A;  3M1I B;  4GXB A;  1WI1 A;  2H7D A;  2KCJ A;  4GMX B;  4H8S A;  3MDB C;  2LUL A;  4DXA B;  3HQC A;  2YT0 A;  1MPH A;  5EFX A;  4A6F A;  1U29 A;  2DYN A;  3TFM A;  3OAN A;  2D9Y A;  1MIX A;  5DIF B;  4L6E A;  3GYP A;  2ADZ A;  1IRS A;  4PNK A;  1V89 A;  2R0D A;  1UPR A;  1WJM A;  5KCV A;  1BWN A;  4EMO A;  3ODW A;  4IAP A;  2FJL A;  3DXD A;  5D3Y A;  2DFK A;  5HE0 A;  1NU2 A;  3PSC A;  1MIZ B;  4HB2 B;  4IFS A;  1RJ2 A;  3DXE A;  3ODX A;  2COA A;  2D10 A;  2LOZ A;  1M7R A;  2K2J A;  2BCJ A;  1U5G A;  4D0N B;  1V5P A;  4HHV A;  5C79 A;  5GOW B;  3RCP A;  1MK9 B;  1U5F A;  3QIJ A;  2H7E A;  3PVU A;  1X1G A;  1Y19 B;  1ZC3 B;  2DTC A;  3KY9 A;  5HE1 A;  1EF1 A;  1DDM A;  3TW1 A;  1MAI A;  5CLQ B;  2I5C A;  2Y8G A;  1TXD A;  2LG1 A;  1I7A A;  3BIN A;  1M7E A;  3CXB B;  1WGU A;  3KRW A;  3UZT A;  5C6R A;  2M38 A;  1OQN A;  3SNH A;  4F7G A;  1DYN A;  2W2X D;  1I2H A;  5J3Q A;  4MT7 A;  4TKN A;  4P7I A;  2J59 M;  1PLS A;  2COC A;  1NTY A;  1NTV A;  1KI1 B;  1ZM0 A;  4KVG B;  3N7C A;  4GZU A;  3TCA A;  4CHJ A;  1FGY A;  1FB8 A;  3KZ1 A;  4GN1 A;  4DX9 0;  2D11 A;  2YSZ A;  4IOY X;  1WVH A;  3TO1 A;  4YL8 A;  3DXC A;  2DHJ A;  2P0H A;  4ZRI A;  2UZS A;  4HB4 B;  2I1K A;  2Z0P A;  3FEH A;  2JP2 A;  4B6H A;  1FGZ A;  1V88 A;  3HW2 B;  2DA0 A;  1K5G B;  2NZ8 B;  4DX8 A;  2YVC A;  5J3T A;  1BAK A;  4A6K A;  1WJ1 A;  4Z2M B;  2CY4 A;  3U8Z A;  4F7U P;  2DKP A;  2MKR A;  2IYB A;  1FHW A;  2RNR B;  4MK0 A;  2EC1 A;  2KUP A;  2CRF A;  2DHK A;  2XQN M;  3FSS A;  2ELB A;  1WG7 A;  2VSZ A;  3HK0 A;  1Y5O A;  4K81 A;  1UEF A;  4HAZ B;  2DX5 A;  1OMW A;  1UNR A;  4K17 A;  1BTK A;  2D9V A;  2YRY A;  1U2B A;  4NSW A;  4KHB B;  4KHO A;  5D27 A;  2GJY A;  1UNQ A;  2N0Y A;  2QKM A;  1BTN A;  2QKL A;  3QBV B;  3D8F A;  3G9W A;  3U7D A;  1EVH A;  2P0D A;  1P5T A;  2DLW A;  5HE2 A;  2D2Q A;  1W1H A;  1FOE A;  4NY0 A;  3D8E A;  3X23 A;  2NMB A;  3P6A A;  3QWM A;  1W1G A;  1SHC A;  1XX0 A;  1XKE A;  1H10 A;  5JHG A;  2PZ1 A;  2P0F A;  5DI9 B;  2CAY A;  1EGX A;  5HE3 A;  1RRP B;  2OTX A;  1DBH A;  3VIA A;  2R09 A;  1XD4 A;  3ODO A;  1U27 A;  4HAX B;  2YF0 A;  1TQZ A;  2J0J A;  1XR0 B;  5C5B B;  1ZC4 B;  5C16 A;  2ELA A;  3ULB A;  4XWX A;  2HE7 A;  4EJN A;  1AWE A;  3AU4 A;  1J0W A;  1XOD A;  4Z2N A;  4HDO A;  3V5W A;  2MWN B;  4CHM A;  2D9Z A;  3VOQ A;  4MY6 A;  1E5W A;  1FHX A;  2Z0O A;  1X11 A;  4GMV A;  4ZRJ A;  2AL6 A;  3A98 B;  2RSG A;  2YS1 A;  3A8P A;  2Z0Q A;  3PVW A;  3WYF B;  4WJ7 A;  1FHO A;  1B55 A;  3AU5 A;  3SV1 A;  2UVM A;  2YT1 A;  5KQ4 A;  2GS0 A;  1GC7 A;  1KZG A;  2COD A;  4TYZ A;  4WVF B;  2GCL A;  4HAV B;  1DDV A;  2ROZ B;  2EMS A;  5JP4 A;  1N3H A;  2W2X C;  3SYX A;  5LON B;  1SGH A;  3KRX A;  5D3W A;  2LYD A;  1V5U A;  1V61 A;  5D3V A;  2RUK B;  2M14 A;  4HDQ A;  2Q13 A;  3A8Q A;  2RLO A;  5DH9 B;  2K00 A;  3PEG A;  2DN6 A;  1LW3 A;  1GG3 A;  2E2X A;  1ZVR A;  2UZR A;  4EKU A;  1MK7 B;  2P8V A;  4KAX B;  3ZDT A;  2CY5 A;  3FM8 C;  4WSF A;  3PZD A;  2DKQ A;  4K2O A;  5D3X A;  2L2I A;  5J3Y A;  4HAU B;  1KZ7 A;  4F7H A;  4HB3 B;  3F5R A;  3D8D A;  4A6F B;  1P3R A;  5DHF B;  2GCJ A;  2MDX A;  5FI1 A;  3ULC A;  2LKO A;  4C0A A;  4ZRK A;  1K5D B;  3SO6 A;  2DYQ A;  5FI0 A;  3SUZ A;  4YON A;  3CIK A;  1FAO A;  1X1F A;  2V76 A;  2Y7B A;  3MPX A;  2COF A;  3IVF A;  1J19 A;  1NI2 A;  5KQ1 A;  4Y94 A;  1LB1 A;  1QC6 A;  1X86 A;  4HAY B;  1WGQ A;  5L81 A;  2I1J A;  2W2W A;  2ZPY A;  5JLJ B;  3F0W A;  5C5B A;  3T06 A;  4A6H A;  4A5K A;  5DHA B;  2L1C A;  2Y8F A;  1XCG A;  2EJ8 A;  5JHH A;  4HAW B;  4KHA A;  1Q67 A;  2J0K A;  2IFS A;  1DDW A;  1ZSQ A;  2ROV A;  1PFJ A;  1V5M A;  2RVB B;  3KSY A;  1OY2 A;  2DX1 A;  3NSU A;  2X18 A;  2HTH B;  3PVL A;  1H4R A;  2J0M A;  3ML4 A;  4HAT B;  2D9X A;  1PMS A;  1U5D A;  3WA0 A;  4BBK A;  1Z87 A;  3TVV A;  1X05 A;  2DHI A;  2VKI A;  5CLL B;  2YS3 A;  2RGN B;  1EAZ A;  3AJ4 A;  2OQB A;  4PQ0 A;  2G35 A;  1AQC A;  2D4Q A;  3LJU X;  1UPQ A;  2LOX A;  4CYE A;  4HB0 B;  1UNP A;  2VRW B;  5LOP B;  1W1D A;  3O96 A;  1DRO A;  4K2P A;  3GYO A;  3P7Z A;  1P6S A;  2KGX B;  1TJ6 A;  4DBB A;  4GPT B;  3ZVR A;  2MFQ A;  2K2U A;  1GC6 A;  2N23 A;  2D9W A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...