3DXJA

Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic myxopyronin
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha; CHAIN A, B, K, L
publication title The RNA polymerase "switch region" is a target for inhibitors.
pubmed doi rcsb
molecule tags Transcription,transferase
total genus 48
structure length 231
sequence length 231
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3dxjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3dxjA01
1IW7A 3H0GC 4XSXA 3PO2C 5M5YK 4NOIA 3HOWC 4YFXA 2NVYC 1TWCC 2JA7C 1TWCK 2NVYK 4QJVB 4Q4ZA 4KMUA 5TMCA 2JA8C 2JA7K 4LLGA 2JA8K 5C44K 3GTMK 2A68A 1R9TC 3S1QK 1K83C 1K83K 2JA5K 4YFNA 3S1MK 1TWHC 1TWHK 2YU9K 3HOZC 3HOZK 4BY7C 5C4XC 4XSZA 1Y1WK 3GTJK 5C4JC 3HOYC 5M5XK 4XLPA 5C4JK 3HOYK 4QJVA 2A6EA 2PA8D 3S1NC 2PA8L 3S1RK 4KN4A 4BBRC 4BBRK 4A3FC 2NVTC 1YNNA 4C3HC 1TWFK 4C3HK 2NVTK 2E2JC 2E2JK 5FLMC 5FLMK 1TWGK 3GTPC 5M3MK 3GTGC 3S15C 3H3VD 2E2HK 1WCMK 3RZOC 3GTGK 3H3VL 4Y52C 4Y52K 1SFOC 4G7HA 3H0GK 4A3CK 3PO2K 2Y0SD 4BXXC 2Y0SL 2NVXC 4BXXK 3HOWK 2BE5A 4MQ9A 3WODA 1Y1VC 4AYBD 1R9TK 2A6HA 4Y7NC 4JK1A 4G7OA 4KN7A 4Y7NK 4MEYA 4QIWD 4A3LC 4QIWL 4A3LK 4G7ZA 2PMZD 2CW0A 2PMZL 3HOUC 3HOUK 5C4XK 4BY7K 3S2DC 1ZYRA 4BY1C 5IP7C 5IP7K 3GTOC 2E2IC 3PO3C 1I6HC 3PO3K 3S1NK 4A3EC 4A3FK 4BBSC 2R7ZC 2R7ZK 3GTKC 4BBSK 5IYCC 3RZDC 4A3CC 5IYCK 3S1QC 3RZDK 4YG2A 2A69A 3GTQC 3HOVC 3GTQK 3GTPK 3S15K 2WAQD 5IYBC 4C2MC 4XLNA 2WAQL 4C2MK 1SMYA 3RZOK 1SFOK 4LK0A 5IYDC 4X6AC 3M3YK 4X6AK 3EQLA 5M5WK 3S16C 3S16K 3S17C 3S17K 2JA6C 2JA6K 3HOXC 3HOXK 2NVXK 3S14C 1HQMA 3M4OC 4OIOA 4OINA 4A93C 1Y1VK 4A93K 4AYBL 5C3EC 5C3EK 3K7AC 4C3JC 4C3JK 2NVQC 4A3MC 4A3MK 2O5IA 3I4MC 4Q5SA 4MEXA 3I4MK 1I3QC 4LK1A 4A3JC 4YFKA 4OIPA 2PPBA 3S2DK 3FKIC 3FKIK 1YNJA 4BY1K 1I50C 5TMFA 1I50K 2E2IK 3GTOK 1I6HK 5D4DA 4A3GC 1TWAC 1TWAK 4A3EK 3HKZD 4A3IC 3HKZL 3GTKK 1BDFA 3GTLC 3GTLK 3HOVK 2VUMC 4OIRA 2VUMK 5IYBK 3M3YC 4LJZA 5IYDK 3DXJA 2O5JA 5C44C 2R92C 4ZH4A 4C3IC 2WB1D 3GTMC 2WB1L 4C3IK 2R92K 3S14K 3I4NC 3I4NK 2JA5C 5IP9C 2R93C 3S1MC 5IP9K 5M3FK 3M4OK 1I6VA 2R93K 2YU9C 3CQZC 3CQZK 4OIQA 3K7AK 1Y1WC 2NVQK 2B63C 4A3KC 4A3KK 2B63K 1I3QK 3S2HC 1XPPA 3S1RC 3S2HK 4A3DC 5FJ8K 4A3DK 4A3JK 1TWFC 4GZYA 1TWGC 4A3BC 4A3BK 2E2HC 4A3GK 1WCMC 3GTJC 4A3IK
chains in the Genus database with same CATH superfamily
1IW7A 3PIOS 1WOSA 3PO2C 5JVGS 1XZQB 4QJVB 5C44K 3TTGA 1I50A 1R9TC 3GTOA 4YFNA 3GTKA 3HOZC 3HOZK 1J6XA 1USMA 1Y1WK 5C4JC 3HOYC 5C4JK 4XLPA 3HOYK 4KN4A 4BBRC 4BBRK 3AQOA 4A3FC 3GDZA 4WFBS 2E2JC 2E2JK 1F93A 3GTGC 3S15C 3GTGK 3H3VL 5E68A 3GIRA 4Y52C 4Y52K 3DLLS 3TFJA 3H0GK 1ZXOA 4KMDA 4FZBA 3AQPA 2Y0SL 3T01A 3HOWK 2V6UA 1VLOA 2XCOA 2BE5A 4LQYA 4G7OA 3AH5A 4G7ZA 3N3YA 5IOTA 2CW0A 3JSTA 4BY1C 5L46A 3RZDC 2XCQA 3RZDK 2WAQD 5IYBC 4C2MC 3NUHA 4C2MK 4LK0A 4X6AC 3M3YK 4X6AK 1Y1WA 2JA6C 2JA6K 3HOXC 3HOXK 3GEHA 3M4OC 3BP8C 4C45A 3ADAC 5C3EC 5C3EK 3BP3A 3K7AC 3GTGA 3H0GA 4A3JC 2PPBA 3FKIC 3FKIK 1VGXA 2E2IK 5DM7S 5D4DA 1WQFA 4A3EK 1WQHA 1O2AA 5IOQA 1ISEA 3OEPA 1BDFA 3HOVK 3IPJA 4KARA 3M3YC 5IYDK 3DXJA 2R92C 1JOEA 2R92K 4KAWX 3LYWA 2ZJQS 5IP9C 5IP9K 5IORA 5M3FK 3LAPA 2PHCB 5HQHA 4BKWA 2NVQK 2FQTA 1O2FB 4KMAA 1PJ7A 3S2HC 4KATA 3S2HK 2GSNA 2JA6A 1O27A 5JVHS 4WCES 1VJEA 1IBAA 1YX2A 1WCMC 4IOCS 5HL8A 4FM9A 3LPXA 3ERED 1O2BA 2NVYC 1TWCC 1TWCK 4IOAS 2NVYK 4Q4ZA 2JA8C 4GFQA 4LLGA 2JA8K 3FKIA 3GTMK 2A68A 2E2IA 1K83C 1K83K 2EBBA 1TWHC 1TWHK 4BY7C 5C4XC 1ZBSA 4XSZA 2ZJPS 3S1RK 2PA8L 5TJ3A 2GAHC 2R92A 1TWFK 1WOOA 1BJTA 4KB4A 4KB2A 1TWGK 2E2HK 1O26A 2JH3A 1SFOC 1F9NA 3PO2K 2NVXC 4PABA 3SZYA 3LAJA 4MQ9A 1R9TK 1F7UA 2L3UA 2RGRA 1O25A 1VH2A 4QIWL 1XZPB 5IOSA 5DM6S 2PMZL 1ZYRA 5IP7C 2NVYA 1I6HC 1TWCA 5IP7K 3GEEA 4KC6A 4A3FK 1F7VA 2R7ZC 2R7ZK 3GTMA 1RU0A 3A8KA 3GTQC 4KM8A 1K83A 3GTQK 2V6TA 3S15K 4XLNA 1TWHA 4O2DA 5M5WK 2B63A 3S14C 2CFAA 1HQMA 2GSUA 4OIOA 1TWFA 1EK8A 3S0XA 1O28A 1TWGA 2ZFZA 2E2HA 1BGWA 4Q5SA 1USOA 4LOWA 1I3QC 4LK1A 3FOEA 4YFKA 4OIPA 1YNJA 4BY1K 1KQ4A 4GTLA 3HKZD 4A3IC 2XCRB 1DCHA 1R9TA 5HL7S 3GTLC 3GTLK 2VUMC 2VUMK 5IYBK 1XXBA 2E2HC 4LJZA 4PAAA 2O5JA 2WB1L 1UV7A 3I4NC 3I4NK 2JA5C 2R93C 2ZUEA 3S1MC 3M4OK 2R93K 2R7ZA 1EI6A 2YU9C 3CQZC 3CQZK 4OIQA 3K7AK 3GTQA 4A3KC 1DCOA 4A3KK 4GT9A 1FEUA 4P5BA 4A3JK 4GZYA 4XCHA 5JFEA 5CJ9A 2FQOA 4WJ3M 3GTJC 3GTJK 5M5YK 1WORA 4GTEA 4YFXA 2JA7C 1WSVA 2JA7K 2GAGC 3V4GA 1J6WA 4P9SA 1IQ0A 3CAGA 1O29A 4WF9S 5CHPA 2V6SA 1EH1A 3GTLA 4WFNS 2VUMA 1XZQA 4ILDA 4QJVA 2A6EA 3S1NC 2NVTC 1YNNA 4C3HC 4C3HK 2NVTK 1L0WA 5FLMC 5FLMK 3GTPC 2R93A 3H3VD 1WCMK 3RZOC 3T02A 3N0BA 3CQZA 3A8IA 2Y0SD 4BXXC 1ZVUA 4M1XA 4BXXK 4GTFA 4KDDA 1Y1VC 2W7VA 3AD9C 4KMHA 3L4KA 2ZUFA 4A3LC 4A3LK 3GTJA 2P5MA 2KQ1A 3HOUC 3HOUK 5EGHA 5C4XK 4BY7K 3S2DC 1DCPA 3GTOC 3VA7A 2JA7A 3MMLB 1EQRA 4G0UA 3AD8C 2KPUA 3GTKC 4A3CC 4A3CK 4G0WA 2WAQL 1SMYA 1SFOK 3OPFA 3S17C 3S17K 1INNA 5EGEA 2NVXK 3N0CA 4A93C 4A93K 4AYBL 1WCMA 4A3MC 4A3MK 4MEXA 2RH6A 3GEIA 4IO9S 4GTAA 4U67S 5TMFA 1I6HK 1EFWA 4A3GC 1TWAC 1TWAK 2P8TA 1PJ6A 3GSIA 1X31C 3OREA 4DDQA 1IE0A 1JQWA 2GSOA 5C44C 4WJ4A 1XXCA 4ZH4A 4G0VA 4GTCA 1G51A 3S14K 3Q3QA 3FHZA 1J6VA 4LR2A 1Y1WC 4BLAA 1SFOA 1I3QK 4A3DC 5FJ8K 4A3DK 4J3NA 3FOFA 3CF5S 2NVXA 1WOPA 3BUEA 4A3BC 4A3BK 3G4CA 1GE9A 4KASA 1PJ5A 4A3IK 3H0GC 4XSXA 4NOIA 3HOWC 4KMUA 5TMCA 4GTBA 1IL2A 4BLBA 2JA5K 1TWAA 3S1MK 2YU9K 1DD5A 5JVOA 5M5XK 2L5NA 2PA8D 3HXAA 5M3MK 1C0AA 3TFHA 4G7HA 4AH6A 1V5VA 4RMFA 1IS1A 1I3QA 3QX3A 1O24A 3AD7C 3WODA 4AYBD 3PIPS 2A6HA 4Y7NC 4JK1A 4Y7NK 4KN7A 4MEYA 4QIWD 1B4AA 1BS2A 1HI9A 3TFIA 2PMZD 2E2IC 3PO3C 1J98A 2CFAB 2D6FC 3S1NK 3PO3K 4A3EC 4BBSC 4BBSK 5IYCC 5IYCK 3S1QC 3S1QK 4YG2A 2A69A 3HOVC 3GTPK 2JA5A 1WQGA 3RZOK 1XZPA 2YU9A 5IYDC 3EQLA 3S16C 3S16K 1YCLA 3G4AA 4OINA 1Y1VK 3A8JA 4C3JC 1ZQ1C 2KXYA 2NVQC 4C3JK 2O5IA 3I4MC 3I4MK 4GTDA 3S2DK 4KM9A 1I50C 1I50K 3GTOK 1XXAA 3HKZL 4WFAS 3GTKK 3T00A 4OIRA 1WSRA 1WIHA 3L4JA 1B4BA 4P5AA 4C3IC 3GTMC 2WB1D 4C3IK 2Y3PA 1I6VA 1JVIA 2KWAA 3GTPA 2B63C 2B63K 1XPPA 3S1RC 1AB4A 1TWFC 2ZJRS 4WILA 1TWGC 3SZZA 1VRQC 4A3GK 1Y1VA
chains in the Genus database with same CATH topology
1IW7A 3H0GC 4XSXA 3PO2C 5M5YK 4NOIA 3HOWC 4YFXA 2NVYC 1TWCC 2JA7C 1TWCK 2NVYK 4QJVB 4Q4ZA 4KMUA 5TMCA 2JA8C 2JA7K 4LLGA 2JA8K 5C44K 3GTMK 2A68A 1R9TC 3S1QK 1K83C 1K83K 2JA5K 4YFNA 3S1MK 1TWHC 1TWHK 2YU9K 3HOZC 3HOZK 4BY7C 5C4XC 4XSZA 1Y1WK 3GTJK 5C4JC 3HOYC 5M5XK 4XLPA 5C4JK 3HOYK 4QJVA 2A6EA 2PA8D 3S1NC 2PA8L 3S1RK 4KN4A 4BBRC 4BBRK 4A3FC 2NVTC 1YNNA 4C3HC 1TWFK 4C3HK 2NVTK 2E2JC 2E2JK 5FLMC 5FLMK 1TWGK 3GTPC 5M3MK 3GTGC 3S15C 3H3VD 2E2HK 1WCMK 3RZOC 3GTGK 3H3VL 4Y52C 4Y52K 1SFOC 4G7HA 3H0GK 4A3CK 3PO2K 2Y0SD 4BXXC 2Y0SL 2NVXC 4BXXK 3HOWK 2BE5A 4MQ9A 3WODA 1Y1VC 4AYBD 1R9TK 2A6HA 4Y7NC 4JK1A 4G7OA 4KN7A 4Y7NK 4MEYA 4QIWD 4A3LC 4QIWL 4A3LK 4G7ZA 2PMZD 2CW0A 2PMZL 3HOUC 3HOUK 5C4XK 4BY7K 3S2DC 1ZYRA 4BY1C 5IP7C 5IP7K 3GTOC 2E2IC 3PO3C 1I6HC 3PO3K 3S1NK 4A3EC 4A3FK 4BBSC 2R7ZC 2R7ZK 3GTKC 4BBSK 5IYCC 3RZDC 4A3CC 5IYCK 3S1QC 3RZDK 4YG2A 2A69A 3GTQC 3HOVC 3GTQK 3GTPK 3S15K 2WAQD 5IYBC 4C2MC 4XLNA 2WAQL 4C2MK 1SMYA 3RZOK 1SFOK 4LK0A 5IYDC 4X6AC 3M3YK 4X6AK 3EQLA 5M5WK 3S16C 3S16K 3S17C 3S17K 2JA6C 2JA6K 3HOXC 3HOXK 2NVXK 3S14C 1HQMA 3M4OC 4OIOA 4OINA 4A93C 1Y1VK 4A93K 4AYBL 5C3EC 5C3EK 3K7AC 4C3JC 4C3JK 2NVQC 4A3MC 4A3MK 2O5IA 3I4MC 4Q5SA 4MEXA 3I4MK 1I3QC 4LK1A 4A3JC 4YFKA 4OIPA 2PPBA 3S2DK 3FKIC 3FKIK 1YNJA 4BY1K 1I50C 5TMFA 1I50K 2E2IK 3GTOK 1I6HK 5D4DA 4A3GC 1TWAC 1TWAK 4A3EK 3HKZD 4A3IC 3HKZL 3GTKK 1BDFA 3GTLC 3GTLK 3HOVK 2VUMC 4OIRA 2VUMK 5IYBK 3M3YC 4LJZA 5IYDK 3DXJA 2O5JA 5C44C 2R92C 4ZH4A 4C3IC 2WB1D 3GTMC 2WB1L 4C3IK 2R92K 3S14K 3I4NC 3I4NK 2JA5C 5IP9C 2R93C 3S1MC 5IP9K 5M3FK 3M4OK 1I6VA 2R93K 2YU9C 3CQZC 3CQZK 4OIQA 3K7AK 1Y1WC 2NVQK 2B63C 4A3KC 4A3KK 2B63K 1I3QK 3S2HC 1XPPA 3S1RC 3S2HK 4A3DC 5FJ8K 4A3DK 4A3JK 1TWFC 4GZYA 1TWGC 4A3BC 4A3BK 2E2HC 4A3GK 1WCMC 3GTJC 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 A;  3H0G C;  4XSX A;  3PO2 C;  5M5Y K;  4NOI A;  3HOW C;  4YFX A;  2NVY C;  1TWC C;  2JA7 C;  1TWC K;  2NVY K;  4QJV B;  4Q4Z A;  4KMU A;  5TMC A;  2JA8 C;  2JA7 K;  4LLG A;  2JA8 K;  5C44 K;  3GTM K;  2A68 A;  1R9T C;  3S1Q K;  1K83 C;  1K83 K;  2JA5 K;  4YFN A;  3S1M K;  1TWH C;  1TWH K;  2YU9 K;  3HOZ C;  3HOZ K;  4BY7 C;  5C4X C;  4XSZ A;  1Y1W K;  3GTJ K;  5C4J C;  3HOY C;  5M5X K;  4XLP A;  5C4J K;  3HOY K;  4QJV A;  2A6E A;  2PA8 D;  3S1N C;  2PA8 L;  3S1R K;  4KN4 A;  4BBR C;  4BBR K;  4A3F C;  2NVT C;  1YNN A;  4C3H C;  1TWF K;  4C3H K;  2NVT K;  2E2J C;  2E2J K;  5FLM C;  5FLM K;  1TWG K;  3GTP C;  5M3M K;  3GTG C;  3S15 C;  3H3V D;  2E2H K;  1WCM K;  3RZO C;  3GTG K;  3H3V L;  4Y52 C;  4Y52 K;  1SFO C;  4G7H A;  3H0G K;  4A3C K;  3PO2 K;  2Y0S D;  4BXX C;  2Y0S L;  2NVX C;  4BXX K;  3HOW K;  2BE5 A;  4MQ9 A;  3WOD A;  1Y1V C;  4AYB D;  1R9T K;  2A6H A;  4Y7N C;  4JK1 A;  4G7O A;  4KN7 A;  4Y7N K;  4MEY A;  4QIW D;  4A3L C;  4QIW L;  4A3L K;  4G7Z A;  2PMZ D;  2CW0 A;  2PMZ L;  3HOU C;  3HOU K;  5C4X K;  4BY7 K;  3S2D C;  1ZYR A;  4BY1 C;  5IP7 C;  5IP7 K;  3GTO C;  2E2I C;  3PO3 C;  1I6H C;  3PO3 K;  3S1N K;  4A3E C;  4A3F K;  4BBS C;  2R7Z C;  2R7Z K;  3GTK C;  4BBS K;  5IYC C;  3RZD C;  4A3C C;  5IYC K;  3S1Q C;  3RZD K;  4YG2 A;  2A69 A;  3GTQ C;  3HOV C;  3GTQ K;  3GTP K;  3S15 K;  2WAQ D;  5IYB C;  4C2M C;  4XLN A;  2WAQ L;  4C2M K;  1SMY A;  3RZO K;  1SFO K;  4LK0 A;  5IYD C;  4X6A C;  3M3Y K;  4X6A K;  3EQL A;  5M5W K;  3S16 C;  3S16 K;  3S17 C;  3S17 K;  2JA6 C;  2JA6 K;  3HOX C;  3HOX K;  2NVX K;  3S14 C;  1HQM A;  3M4O C;  4OIO A;  4OIN A;  4A93 C;  1Y1V K;  4A93 K;  4AYB L;  5C3E C;  5C3E K;  3K7A C;  4C3J C;  4C3J K;  2NVQ C;  4A3M C;  4A3M K;  2O5I A;  3I4M C;  4Q5S A;  4MEX A;  3I4M K;  1I3Q C;  4LK1 A;  4A3J C;  4YFK A;  4OIP A;  2PPB A;  3S2D K;  3FKI C;  3FKI K;  1YNJ A;  4BY1 K;  1I50 C;  5TMF A;  1I50 K;  2E2I K;  3GTO K;  1I6H K;  5D4D A;  4A3G C;  1TWA C;  1TWA K;  4A3E K;  3HKZ D;  4A3I C;  3HKZ L;  3GTK K;  1BDF A;  3GTL C;  3GTL K;  3HOV K;  2VUM C;  4OIR A;  2VUM K;  5IYB K;  3M3Y C;  4LJZ A;  5IYD K;  3DXJ A;  2O5J A;  5C44 C;  2R92 C;  4ZH4 A;  4C3I C;  2WB1 D;  3GTM C;  2WB1 L;  4C3I K;  2R92 K;  3S14 K;  3I4N C;  3I4N K;  2JA5 C;  5IP9 C;  2R93 C;  3S1M C;  5IP9 K;  5M3F K;  3M4O K;  1I6V A;  2R93 K;  2YU9 C;  3CQZ C;  3CQZ K;  4OIQ A;  3K7A K;  1Y1W C;  2NVQ K;  2B63 C;  4A3K C;  4A3K K;  2B63 K;  1I3Q K;  3S2H C;  1XPP A;  3S1R C;  3S2H K;  4A3D C;  5FJ8 K;  4A3D K;  4A3J K;  1TWF C;  4GZY A;  1TWG C;  4A3B C;  4A3B K;  2E2H C;  4A3G K;  1WCM C;  3GTJ C;  4A3I K; 
#chains in the Genus database with same CATH topology
 1IW7 A;  3PIO S;  1WOS A;  3PO2 C;  5JVG S;  1XZQ B;  4QJV B;  5C44 K;  3TTG A;  1I50 A;  1R9T C;  3GTO A;  4YFN A;  3GTK A;  3HOZ C;  3HOZ K;  1J6X A;  1USM A;  1Y1W K;  5C4J C;  3HOY C;  5C4J K;  4XLP A;  3HOY K;  4KN4 A;  4BBR C;  4BBR K;  3AQO A;  4A3F C;  3GDZ A;  4WFB S;  2E2J C;  2E2J K;  1F93 A;  3GTG C;  3S15 C;  3GTG K;  3H3V L;  5E68 A;  3GIR A;  4Y52 C;  4Y52 K;  3DLL S;  3TFJ A;  3H0G K;  1ZXO A;  4KMD A;  4FZB A;  3AQP A;  2Y0S L;  3T01 A;  3HOW K;  2V6U A;  1VLO A;  2XCO A;  2BE5 A;  4LQY A;  4G7O A;  3AH5 A;  4G7Z A;  3N3Y A;  5IOT A;  2CW0 A;  3JST A;  4BY1 C;  5L46 A;  3RZD C;  2XCQ A;  3RZD K;  2WAQ D;  5IYB C;  4C2M C;  3NUH A;  4C2M K;  4LK0 A;  4X6A C;  3M3Y K;  4X6A K;  1Y1W A;  2JA6 C;  2JA6 K;  3HOX C;  3HOX K;  3GEH A;  3M4O C;  3BP8 C;  4C45 A;  3ADA C;  5C3E C;  5C3E K;  3BP3 A;  3K7A C;  3GTG A;  3H0G A;  4A3J C;  2PPB A;  3FKI C;  3FKI K;  1VGX A;  2E2I K;  5DM7 S;  5D4D A;  1WQF A;  4A3E K;  1WQH A;  1O2A A;  5IOQ A;  1ISE A;  3OEP A;  1BDF A;  3HOV K;  3IPJ A;  4KAR A;  3M3Y C;  5IYD K;  3DXJ A;  2R92 C;  1JOE A;  2R92 K;  4KAW X;  3LYW A;  2ZJQ S;  5IP9 C;  5IP9 K;  5IOR A;  5M3F K;  3LAP A;  2PHC B;  5HQH A;  4BKW A;  2NVQ K;  2FQT A;  1O2F B;  4KMA A;  1PJ7 A;  3S2H C;  4KAT A;  3S2H K;  2GSN A;  2JA6 A;  1O27 A;  5JVH S;  4WCE S;  1VJE A;  1IBA A;  1YX2 A;  1WCM C;  4IOC S;  5HL8 A;  4FM9 A;  3LPX A;  3ERE D;  1O2B A;  2NVY C;  1TWC C;  1TWC K;  4IOA S;  2NVY K;  4Q4Z A;  2JA8 C;  4GFQ A;  4LLG A;  2JA8 K;  3FKI A;  3GTM K;  2A68 A;  2E2I A;  1K83 C;  1K83 K;  2EBB A;  1TWH C;  1TWH K;  4BY7 C;  5C4X C;  1ZBS A;  4XSZ A;  2ZJP S;  3S1R K;  2PA8 L;  5TJ3 A;  2GAH C;  2R92 A;  1TWF K;  1WOO A;  1BJT A;  4KB4 A;  4KB2 A;  1TWG K;  2E2H K;  1O26 A;  2JH3 A;  1SFO C;  1F9N A;  3PO2 K;  2NVX C;  4PAB A;  3SZY A;  3LAJ A;  4MQ9 A;  1R9T K;  1F7U A;  2L3U A;  2RGR A;  1O25 A;  1VH2 A;  4QIW L;  1XZP B;  5IOS A;  5DM6 S;  2PMZ L;  1ZYR A;  5IP7 C;  2NVY A;  1I6H C;  1TWC A;  5IP7 K;  3GEE A;  4KC6 A;  4A3F K;  1F7V A;  2R7Z C;  2R7Z K;  3GTM A;  1RU0 A;  3A8K A;  3GTQ C;  4KM8 A;  1K83 A;  3GTQ K;  2V6T A;  3S15 K;  4XLN A;  1TWH A;  4O2D A;  5M5W K;  2B63 A;  3S14 C;  2CFA A;  1HQM A;  2GSU A;  4OIO A;  1TWF A;  1EK8 A;  3S0X A;  1O28 A;  1TWG A;  2ZFZ A;  2E2H A;  1BGW A;  4Q5S A;  1USO A;  4LOW A;  1I3Q C;  4LK1 A;  3FOE A;  4YFK A;  4OIP A;  1YNJ A;  4BY1 K;  1KQ4 A;  4GTL A;  3HKZ D;  4A3I C;  2XCR B;  1DCH A;  1R9T A;  5HL7 S;  3GTL C;  3GTL K;  2VUM C;  2VUM K;  5IYB K;  1XXB A;  2E2H C;  4LJZ A;  4PAA A;  2O5J A;  2WB1 L;  1UV7 A;  3I4N C;  3I4N K;  2JA5 C;  2R93 C;  2ZUE A;  3S1M C;  3M4O K;  2R93 K;  2R7Z A;  1EI6 A;  2YU9 C;  3CQZ C;  3CQZ K;  4OIQ A;  3K7A K;  3GTQ A;  4A3K C;  1DCO A;  4A3K K;  4GT9 A;  1FEU A;  4P5B A;  4A3J K;  4GZY A;  4XCH A;  5JFE A;  5CJ9 A;  2FQO A;  4WJ3 M;  3GTJ C;  3GTJ K;  5M5Y K;  1WOR A;  4GTE A;  4YFX A;  2JA7 C;  1WSV A;  2JA7 K;  2GAG C;  3V4G A;  1J6W A;  4P9S A;  1IQ0 A;  3CAG A;  1O29 A;  4WF9 S;  5CHP A;  2V6S A;  1EH1 A;  3GTL A;  4WFN S;  2VUM A;  1XZQ A;  4ILD A;  4QJV A;  2A6E A;  3S1N C;  2NVT C;  1YNN A;  4C3H C;  4C3H K;  2NVT K;  1L0W A;  5FLM C;  5FLM K;  3GTP C;  2R93 A;  3H3V D;  1WCM K;  3RZO C;  3T02 A;  3N0B A;  3CQZ A;  3A8I A;  2Y0S D;  4BXX C;  1ZVU A;  4M1X A;  4BXX K;  4GTF A;  4KDD A;  1Y1V C;  2W7V A;  3AD9 C;  4KMH A;  3L4K A;  2ZUF A;  4A3L C;  4A3L K;  3GTJ A;  2P5M A;  2KQ1 A;  3HOU C;  3HOU K;  5EGH A;  5C4X K;  4BY7 K;  3S2D C;  1DCP A;  3GTO C;  3VA7 A;  2JA7 A;  3MML B;  1EQR A;  4G0U A;  3AD8 C;  2KPU A;  3GTK C;  4A3C C;  4A3C K;  4G0W A;  2WAQ L;  1SMY A;  1SFO K;  3OPF A;  3S17 C;  3S17 K;  1INN A;  5EGE A;  2NVX K;  3N0C A;  4A93 C;  4A93 K;  4AYB L;  1WCM A;  4A3M C;  4A3M K;  4MEX A;  2RH6 A;  3GEI A;  4IO9 S;  4GTA A;  4U67 S;  5TMF A;  1I6H K;  1EFW A;  4A3G C;  1TWA C;  1TWA K;  2P8T A;  1PJ6 A;  3GSI A;  1X31 C;  3ORE A;  4DDQ A;  1IE0 A;  1JQW A;  2GSO A;  5C44 C;  4WJ4 A;  1XXC A;  4ZH4 A;  4G0V A;  4GTC A;  1G51 A;  3S14 K;  3Q3Q A;  3FHZ A;  1J6V A;  4LR2 A;  1Y1W C;  4BLA A;  1SFO A;  1I3Q K;  4A3D C;  5FJ8 K;  4A3D K;  4J3N A;  3FOF A;  3CF5 S;  2NVX A;  1WOP A;  3BUE A;  4A3B C;  4A3B K;  3G4C A;  1GE9 A;  4KAS A;  1PJ5 A;  4A3I K;  3H0G C;  4XSX A;  4NOI A;  3HOW C;  4KMU A;  5TMC A;  4GTB A;  1IL2 A;  4BLB A;  2JA5 K;  1TWA A;  3S1M K;  2YU9 K;  1DD5 A;  5JVO A;  5M5X K;  2L5N A;  2PA8 D;  3HXA A;  5M3M K;  1C0A A;  3TFH A;  4G7H A;  4AH6 A;  1V5V A;  4RMF A;  1IS1 A;  1I3Q A;  3QX3 A;  1O24 A;  3AD7 C;  3WOD A;  4AYB D;  3PIP S;  2A6H A;  4Y7N C;  4JK1 A;  4Y7N K;  4KN7 A;  4MEY A;  4QIW D;  1B4A A;  1BS2 A;  1HI9 A;  3TFI A;  2PMZ D;  2E2I C;  3PO3 C;  1J98 A;  2CFA B;  2D6F C;  3S1N K;  3PO3 K;  4A3E C;  4BBS C;  4BBS K;  5IYC C;  5IYC K;  3S1Q C;  3S1Q K;  4YG2 A;  2A69 A;  3HOV C;  3GTP K;  2JA5 A;  1WQG A;  3RZO K;  1XZP A;  2YU9 A;  5IYD C;  3EQL A;  3S16 C;  3S16 K;  1YCL A;  3G4A A;  4OIN A;  1Y1V K;  3A8J A;  4C3J C;  1ZQ1 C;  2KXY A;  2NVQ C;  4C3J K;  2O5I A;  3I4M C;  3I4M K;  4GTD A;  3S2D K;  4KM9 A;  1I50 C;  1I50 K;  3GTO K;  1XXA A;  3HKZ L;  4WFA S;  3GTK K;  3T00 A;  4OIR A;  1WSR A;  1WIH A;  3L4J A;  1B4B A;  4P5A A;  4C3I C;  3GTM C;  2WB1 D;  4C3I K;  2Y3P A;  1I6V A;  1JVI A;  2KWA A;  3GTP A;  2B63 C;  2B63 K;  1XPP A;  3S1R C;  1AB4 A;  1TWF C;  2ZJR S;  4WIL A;  1TWG C;  3SZZ A;  1VRQ C;  4A3G K;  1Y1V A; 
#chains in the Genus database with same CATH homology
 1IW7 A;  3H0G C;  4XSX A;  3PO2 C;  5M5Y K;  4NOI A;  3HOW C;  4YFX A;  2NVY C;  1TWC C;  2JA7 C;  1TWC K;  2NVY K;  4QJV B;  4Q4Z A;  4KMU A;  5TMC A;  2JA8 C;  2JA7 K;  4LLG A;  2JA8 K;  5C44 K;  3GTM K;  2A68 A;  1R9T C;  3S1Q K;  1K83 C;  1K83 K;  2JA5 K;  4YFN A;  3S1M K;  1TWH C;  1TWH K;  2YU9 K;  3HOZ C;  3HOZ K;  4BY7 C;  5C4X C;  4XSZ A;  1Y1W K;  3GTJ K;  5C4J C;  3HOY C;  5M5X K;  4XLP A;  5C4J K;  3HOY K;  4QJV A;  2A6E A;  2PA8 D;  3S1N C;  2PA8 L;  3S1R K;  4KN4 A;  4BBR C;  4BBR K;  4A3F C;  2NVT C;  1YNN A;  4C3H C;  1TWF K;  4C3H K;  2NVT K;  2E2J C;  2E2J K;  5FLM C;  5FLM K;  1TWG K;  3GTP C;  5M3M K;  3GTG C;  3S15 C;  3H3V D;  2E2H K;  1WCM K;  3RZO C;  3GTG K;  3H3V L;  4Y52 C;  4Y52 K;  1SFO C;  4G7H A;  3H0G K;  4A3C K;  3PO2 K;  2Y0S D;  4BXX C;  2Y0S L;  2NVX C;  4BXX K;  3HOW K;  2BE5 A;  4MQ9 A;  3WOD A;  1Y1V C;  4AYB D;  1R9T K;  2A6H A;  4Y7N C;  4JK1 A;  4G7O A;  4KN7 A;  4Y7N K;  4MEY A;  4QIW D;  4A3L C;  4QIW L;  4A3L K;  4G7Z A;  2PMZ D;  2CW0 A;  2PMZ L;  3HOU C;  3HOU K;  5C4X K;  4BY7 K;  3S2D C;  1ZYR A;  4BY1 C;  5IP7 C;  5IP7 K;  3GTO C;  2E2I C;  3PO3 C;  1I6H C;  3PO3 K;  3S1N K;  4A3E C;  4A3F K;  4BBS C;  2R7Z C;  2R7Z K;  3GTK C;  4BBS K;  5IYC C;  3RZD C;  4A3C C;  5IYC K;  3S1Q C;  3RZD K;  4YG2 A;  2A69 A;  3GTQ C;  3HOV C;  3GTQ K;  3GTP K;  3S15 K;  2WAQ D;  5IYB C;  4C2M C;  4XLN A;  2WAQ L;  4C2M K;  1SMY A;  3RZO K;  1SFO K;  4LK0 A;  5IYD C;  4X6A C;  3M3Y K;  4X6A K;  3EQL A;  5M5W K;  3S16 C;  3S16 K;  3S17 C;  3S17 K;  2JA6 C;  2JA6 K;  3HOX C;  3HOX K;  2NVX K;  3S14 C;  1HQM A;  3M4O C;  4OIO A;  4OIN A;  4A93 C;  1Y1V K;  4A93 K;  4AYB L;  5C3E C;  5C3E K;  3K7A C;  4C3J C;  4C3J K;  2NVQ C;  4A3M C;  4A3M K;  2O5I A;  3I4M C;  4Q5S A;  4MEX A;  3I4M K;  1I3Q C;  4LK1 A;  4A3J C;  4YFK A;  4OIP A;  2PPB A;  3S2D K;  3FKI C;  3FKI K;  1YNJ A;  4BY1 K;  1I50 C;  5TMF A;  1I50 K;  2E2I K;  3GTO K;  1I6H K;  5D4D A;  4A3G C;  1TWA C;  1TWA K;  4A3E K;  3HKZ D;  4A3I C;  3HKZ L;  3GTK K;  1BDF A;  3GTL C;  3GTL K;  3HOV K;  2VUM C;  4OIR A;  2VUM K;  5IYB K;  3M3Y C;  4LJZ A;  5IYD K;  3DXJ A;  2O5J A;  5C44 C;  2R92 C;  4ZH4 A;  4C3I C;  2WB1 D;  3GTM C;  2WB1 L;  4C3I K;  2R92 K;  3S14 K;  3I4N C;  3I4N K;  2JA5 C;  5IP9 C;  2R93 C;  3S1M C;  5IP9 K;  5M3F K;  3M4O K;  1I6V A;  2R93 K;  2YU9 C;  3CQZ C;  3CQZ K;  4OIQ A;  3K7A K;  1Y1W C;  2NVQ K;  2B63 C;  4A3K C;  4A3K K;  2B63 K;  1I3Q K;  3S2H C;  1XPP A;  3S1R C;  3S2H K;  4A3D C;  5FJ8 K;  4A3D K;  4A3J K;  1TWF C;  4GZY A;  1TWG C;  4A3B C;  4A3B K;  2E2H C;  4A3G K;  1WCM C;  3GTJ C;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...