3DXOA

Crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
MTQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized SnoaL-like Protein
publication title Crystal structure of SnoaL-like Protein with Unknown Function (17739112) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.70 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Isomerase
total genus 32
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dxoA00
5AIGA 3MG3A 3DMCA 3DZLA 1K41A 4HM2B 2HMNB 4HM1B 3HZPA 5IG5A 3NBRA 3DXOA 1JB5A 2B24B 3OX9A 5AEWB 2GEXA 3B4PA 1ISKA 3K0ZA 4HKVB 2BMQB 4XBTA 2YFJB 2OWPA 2B1XB 5DREA 4LMIA 3G16A 2GXFA 5JPUA 3EBYA 1GYBA 5IEPA 3B7CA 1Q40B 3LZAA 1W01A 3FLJA 4L8PA 1A2KA 1ULIB 3NV0B 1O7HB 3KZTA 2QIYA 4OVMA 5BXQA 1OCVA 5EVHA 2F99A 3UJMA 1WQLB 1ASKA 1EG9B 2GEYA 3EF8A 2I9WA 1ZX2A 5HGRA 1JN5A 3DM8A 3RGRA 1AR0A 4IIAA 4XDWA 5IG4A 2XRXB 4WYKB 4LEHA 3CPOA 5CF2A 2HMKB 1EA2A 1SJWA 3T8NA 4ORLA 4L7KA 4CDLA 1GY6A 6STDA 5D83A 3SEDA 1W6YA 3NHXA 3KKGA 5AIIA 3JUNA 3STDA 1ZO2A 1OUNA 5BVBA 2CHCA 4HVNA 1O7NB 4HM7B 1U5OA 3KSPA 2BMRB 4HM0B 1OF5B 3OWUA 3S5CA 4FCJA 3F8HA 4HZBB 5AI1A 4J8TA 2YFIB 3BB9A 3MYTA 4N3VA 4XBXA 1JB2A 4HJLB 1HKXA 5IF6A 3CNXA 1NDOB 1Z1SA 4HZ9B 3EHCA 4RZMA 1GY7A 4K1VA 2CKFB 3D9RA 2INXA 3HX8A 3F40A 4WWUC 3JUMA 3H51A 5G2GA 3B4OA 5CF1A 2XSOB 4HM8B 4H3UA 4L8OA 2RFRA 1CQSA 1O7MB 2A15A 3FF0A 3ROBA 2HMMB 5KP4A 3FSDA 3H3HA 4U13A 3FF2A 2Z77A 2XR8B 4HM4B 1STDA 3FH1A 3GZYB 2STDA 3RGAA 5CLKA 3GZBA 1JKGB 5AEUB 3EN1B 1NWWA 3GWRA 3ECFA 1W02A 5STDA 1OHSA 4LGQA 3VGNA 3FZWA 1W00A 1Q42A 1TUHA 3LYGA 3F14A 4R1KA 1DMNA 1NU3A 3G8ZA 2JQ5A 3GRDA 1UUWB 4PEJA 2F98A 4KVHA 3M8CA 3MG1A 3MSOA 1ULJB 3JUOA 5CK6A 3HK4A 3SOAA 1E97A 1OF5A 3EC9A 4HM5B 5AIFA 5IG0A 5FW5A 3F9SA 1DMQA 2K54A 3K7CA 3EBTA 2UX0A 4HM3B 3CNMA 1BUQA 4K1UA 4I4KA 1OHPA 3ER7A 4X2OA 3OXAA 1O7PB 3OWYA 3MKIA 1UUVB 3I0YA 5IENA 4XBYA 2BNGA 3DUKA 4STDA 3B8LA 4X2HA 2HMLB 5D82A 1OH0A 4MJDA 2RGQA 2GBWB 3FGYA 1Q40A 3NXJA 3T8UA 3JUPA 3F7SA 1O7WB 1O7GB 3EX9A 1OHOA 3NM2A 3BLZA 7STDA 4J9AA 5KP3A 3NV0A 5IG3A 3F7XA 2F86B 3F8XA 5KP1A 1OPYA 4FCMA 2Z7AA 1TP6A 2GBXB 2BMOB 5CXOA 1C7HA 3G0KA 3Q90A 1OGZA 2IMJA 1JKGA 2Z76A 5D81A 1OGXA 3MG2A 1JN5B 1DMMA 3OWSA 3UNLA 4XM4A 4WYKA 3GZRA 2HMJB 2HMOB 3A76A 5IERA 1QJGA 1QMAA 3OV4A 3IPTA 1IDPA 3NUVA 4XB5A 5JPPA 3E99A 5TGNA 1VZZA 4HM6B 4R9LA 1JB4A 5DRVA 3SOYA 3FKAA 2YFLB 3JUQA 3CU3A 1S5AA 2R4IA 2QGUA 1GS3A 3VSYA 3GZXB 2RCDA 3EN8A 5AIHA 1E3VA 4Q53A 4GB5A 2XSHB 4OUQA 3MHEA 2W2CA 1GY5A 2PZVA 4XDVA 3EJVA 3KE7A 1E3RA 3WMDA 4WP5A 8CHOA 5IEOA 4R9KA 3EQQB
chains in the Genus database with same CATH superfamily
1N5HA 5AIGA 3MG3A 3DGLA 3DMCA 4J5KA 1BSEA 1BUJA 1N8QA 1RN1A 1DYUA 3CCE3 3DZLA 1K41A 1HYFA 4HM2B 3CCR3 2HMNB 4HM1B 3N8BA 1RSNA 3HZPA 5IG5A 3NBRA 3DXOA 4EW5A 3CME3 1QVF2 1LXEA 2R41A 1JB5A 3EE1A 3A5EA 4N6MA 1RLSA 2B24B 3OX9A 5AEWB 1IQ8A 1UCLA 1I8VA 4LZIA 2GEXA 3B4PA 1ISKA 1R4CA 2WGQA 1BSDA 8RNTA 1EKMA 3K0ZA 2FGTA 4HKVB 4NHFA 3CD63 4EBGA 2BMQB 1MWRA 1KSIA 4XBTA 2YFJB 1VQQA 2OWPA 2W56A 2GU3A 1QAKA 1B3SA 2B1XB 3DGNA 3UL5A 5DREA 2IYJA 1S723 1LQGC 2C11A 4O02B 1IV7A 2CX1A 1AY7A 4LMIA 1W6CA 3G16A 1YGEA 1RN7A 4MMXB 2F5WA 3BNDA 2CW9A 1V58A 1IK3A 2GXFA 5JPUA 3EBYA 1BRNL 1GYBA 3WOEB 4BL3A 1G0TA 4N6TA 1MNLA 3B7CA 5IEPA 4IPBA 1Q40B 3LZAA 1W01A 1RNBA 2E2VA 1BSCA 2FXTA 3FLJA 3K5TA 4L8PA 4O8SA 1A2KA 1ULIB 1GSPA 3FG1A 4RNYA 1AVLA 3NV0B 1O7HB 2M7OA 1QVG2 1RDSA 1TIJA 1YVBI 1YI23 3KZTA 3LT8A 1MWTA 2QIYA 1CEWI 4OVMA 1SIIA 5BXQA 3LTAA 1OCVA 1BNEA 2OQEC 1L5GB 2CG1A 1Q7Y4 5EVHA 1IU7A 5ELJA 2F99A 3UJMA 5GSPA 2CC3A 4FMCA 1WQLB 1ASKA 1MGWA 1RRLA 1VQO3 1EG9B 2OCTA 4NREA 2GEYA 2Q07A 4CCVA 2CFGA 3EF8A 1FW7A 2Y74A 2I9WA 1B2UA 1ZX2A 3GAXA 5HGRA 1NNVA 1Q814 2KF5A 1VQ63 1JN5A 4IT7A 3DM8A 1I0VA 3RGRA 1I0XA 3AHWA 1AR0A 4IIAA 1UCKA 2F5MA 4XDWA 1FUTA 2XH9A 5IG4A 1FYSA 2P0XA 2XRXB 3D5IA 3QK9A 4WYKB 4LEHA 3RNTA 3CPOA 1VQ73 5M19A 2KAAA 3GSPA 5CF2A 1BGSA 1WMNA 2P38A 2HMKB 2PNCA 3V98A 3D3LA 1EA2A 3WODG 3OW22 5AYRB 3FG4A 1SJWA 1Y4KA 2OOVC 3T8NA 4ORLA 4L7KA 1RGCA 3X3XA 4CDLA 1GY6A 4FMAA 6STDA 1PFPA 4EV5A 1K28A 1BIRA 5D83A 3SEDA 1K8A4 2KF3A 1W6YA 3MPHA 3NHXA 1B20A 1UI7A 2F4YA 3KKGA 1KC84 3FG3A 4G1MB 3KSED 3PYJA 5AIIA 1VQ83 2UUGC 1BAOA 3JUNA 1LNIA 3AMOB 5EEOA 3AGNA 3STDA 1ZO2A 1OUNA 5BVBA 1CYUA 4JF8A 2CHCA 4HVNA 3AHSA 3PZWA 1FUSA 3U97A 1O7NB 4HM7B 4N6UA 2P0MA 1X1WA 1U5OA 2H0GA 3KSPA 1G02A 5ELUA 1X1UA 2BMRB 1VQ53 3TDGA 4HM0B 1RJOA 1B2ZA 1OF5B 3OWUA 4FMDA 4FCJA 3S5CA 1D6ZA 3F8HA 4HZBB 1MWSA 3N9HA 1IVUA 5AI1A 1GMPA 3Q3FA 1EQKA 4J8TA 1BNRA 1R4YA 1AV4A 3DGMA 2L1SA 2IUJA 2YFIB 3BB9A 2CX0A 3MYTA 4N3VA 1OACA 3FCSB 2YX9A 1BSAA 1ROAA 4AKYA 4XBXA 1MWUA 2MF7A 1RGFA 3N54B 1YJW3 1NJI4 1JV2B 1JB2A 1HU9A 5LC6A 4HJLB 1HKXA 1K734 3SYUA 3WOFB 1BNGA 1RKYA 1YIT3 2WGOA 4CPKA 3X40A 3G6E3 5IF6A 3LMLA 1TRQA 3CNXA 2CK3H 1NDOB 2BU4A 5FGOA 3Q1CA 3AGOA 1FGQA 1JZOA 1Z1SA 2BIRA 2IY2A 4HZ9B 3EHCA 2WO0A 3DY5A 1JJ22 3S67A 3S29A 4RZMA 3X3ZA 1GY7A 1NB5I 1GD3A 1RRHA 2P05A 4K1VA 1I70A 3S28A 1C54A 3D5GA 3KCHA 1U8CB 2CKFB 1SIHA 2SARA 3D9RA 1Q864 1LOXA 3CCJ3 2INXA 5IW9A 3LOYA 2XF3A 3HX8A 3F40A 4WWUC 1IT7A 3JUMA 3CCQ3 2XFTA 3H51A 3HOHA 1LNHA 4BTXA 1YGWA 5G2GA 3VF1A 2CH9A 1TFKA 4N6NB 3B4OA 1D6YA 5EQLA 2XSOB 4EV2A 2KF4A 3T0UA 5CF1A 1BSBA 4HM8B 1BNFA 1YIJ3 2CG0A 1DE3A 4H3UA 4L8OA 2RFRA 4O3VA 1IVVA 4H61A 1CQSA 1RGKA 5I97A 2RBIA 1O7MB 4AEQA 1YHQ3 1LOVA 2A15A 1IVWA 3FF0A 4HOHA 2OOVA 3ROBA 3UL6A 2HMMB 2K0MA 1US1A 1Q7HA 1FGMA 2MC8A 3LTBA 2GSPA 5KP4A 3FSDA 3BNBA 3CPW2 3H3HA 1FGTA 3DGOA 3ZG0A 4EC6A 1QAFA 4U13A 3FF2A 2Z77A 3LTCA 1NO3A 1T5YA 1WMPA 2XR8B 4HM4B 1STDA 2O3OA 3FH1A 3DGYA 3GZYB 1T3BA 2HOHA 1DETA 4GSPA 4KFDA 3CCS3 2STDA 3RGAA 3X3YA 1X1XA 2W0QA 1WNHA 1LRAA 1A90A 1B27A 2RSXA 1YNVX 3IMAB 5CLKA 1UGHI 1SARA 3GZBA 1JKGB 5AEUB 3EN1B 1GMQA 1RCKA 1NWWA 2C10A 2XEPA 2CFKA 5M1AA 3SXXA 3V99A 3GWRA 3ECFA 7RNTA 3I553 4R4KA 1W02A 4GHOA 1SQWA 2D1WA 5STDA 1UCJA 1OHSA 2JDIH 3NX0A 2O9UX 1GMRA 1TFOA 3LXUX 4LGQA 2FNQA 3VGNA 3FZWA 1M1K4 3ZFZA 1BRGA 1W00A 5BIRA 1EUIC 5G1LA 4WFOA 1RCLA 1AQZA 1Q42A 3KFQC 1TUHA 1JNQA 3WA2X 1BNIA 2E2UA 2IUKA 3F14A 3LYGA 1VQL3 4R1KA 1DMNA 3D79A 4LSOA 3WHOA 1BRSA 5G1KA 1NU3A 2P09A 3G8ZA 2JQ5A 1LOWA 5AYSC 4EXRA 1VQN3 3BU4A 3GRDA 1YJN3 1UUWB 1RGAA 1GD4A 3EB8A 1UW1A 4PEJA 1W2ZA 4R9KA 1YVSA 3X42A 1VQK3 3Q2PA 5LC7A 1M904 3CCU3 1BRIA 1A2VA 2F98A 7GSPA 4KVHA 3M8CA 3PXMA 4N6OB 1V57A 2BT3A 3NBJA 1B2MA 2C4BA 4KZ1A 3MG1A 3MSOA 1ULJB 1TU5A 1DVDA 2L4VA 3JUOA 1T2HA 5CK6A 3WR2A 3HK4A 3SOAA 1I3IA 1E97A 4BU4A 1OF5A 3EC9A 3NQZA 1STFI 4FCZA 4HM5B 2CWVA 5AIFA 5IG0A 3HIGA 2KF6A 1LOYA 5FW5A 3URPA 4TX4A 1UUGB 4HBRA 3F9SA 1GOVA 2LYXA 4KT3B 1DMQA 4LYLB 4J5GA 2K54A 3K7CA 4FMBA 5A0OB 3EBTA 2CWUA 1UI8A 2AAEA 1JZDA 2H0IA 1IVXA 1JRQA 2UX0A 3KIIA 4K61A 4HM3B 1UCIA 2KCDA 3HIIA 1FUWA 3CNMA 3CCV3 3QRDA 1BUQA 4K1UA 4I4KA 1IYYA 1OHPA 1ROVA 2OQEA 3PGBA 3ER7A 4I5QA 5M18A 2W03A 4X2OA 3OXAA 1VQP3 1TJDA 4WHAA 1BNJA 1RGHA 1PYLA 1O7PB 1BRHA 1G96A 2UGIA 3K63A 2KRTA 3BIRA 3PCSA 3SX1A 1RGLA 2BO9B 5HOHA 3CCL3 3OWYA 4RBNA 1M9GA 3SLUA 1BANA 1I2FA 1UUVB 3MKIA 4FR9A 3S27A 1N5PA 3I0YA 2GU1A 2RNTA 4XBYA 4BIRA 1AVKA 5IENA 1RNTA 1JBRA 1GOYA 1W6GA 2BNGA 3DUKA 1SPUA 2W9PA 3CC73 2W56B 3O8YA 1JBTA 4STDA 3B8LA 2W9QA 4ILFA 4X2HA 2HMLB 4NPBA 3G4S3 1FGRA 1IQYA 2ML6A 2ZDJA 1OH0A 5D82A 1MOLA 3L0RA 4MJDA 3JVCA 2RGQA 4KFFA 2GBWB 2LQVA 3FGYA 1MGRA 1Q40A 2WOHA 3NXJA 3MWZA 4O2HA 3JUPA 3F7SA 3T8UA 4MMYB 1O7WB 1O7GB 1NB3I 1OHOA 2W6JH 3EX9A 1I2EA 1W5ZA 1B21A 3HI7A 3NM2A 1PY3A 3BLZA 7STDA 1GOUA 2CFDA 4J9AA 5KP3A 5RNTA 3NV0A 2F56A 1N8R4 5IG3A 1IV9A 3KN4A 3F7XA 3WDGB 3G713 1LVNA 4KFEA 2F86B 1BNSA 2Y73A 3F8XA 5KP1A 1BRJA 1TRPA 4HYZA 1OPYA 4FCMA 1RN4A 1BOXA 4OK0A 4R80A 3J7Yd 2Z7AA 1TP6A 2GBXB 3CCM3 1DVCA 1WMOA 3PS8A 3IJEB 4K90B 1ZS7A 2BMOB 3CC43 2CFLA 3UB1A 3ZG5A 4DKIA 1KQS2 1HZ1A 3PCRA 2J8XB 2ZA4A 5CXOA 1ZGXA 2BHMA 1BRKA 2ML5A 1C7HA 2XFSA 2ZL8A 3G0KA 1OGZA 3Q90A 1EEJA 3NBBA 2CFWA 2IMJA 1JKGA 3LH4A 1N9JA 1RMSA 2Z76A 5D81A 1OGXA 3WA3A 1QALA 1Q9EA 3MG2A 4BTYA 2WOFA 1JN5B 1DMMA 1YJ93 3CXC2 1M1XB 3OWSA 1JBSA 3UNLA 4XM4A 4WYKA 3GZRA 3NQYA 2HMJB 3V92A 5IEOA 5BU4A 2HMOB 3A76A 5IERA 1VQ43 1B2SA 1BVIA 4MEIA 1QJGA 1QMAA 1KD14 4BTWA 1D6UA 4N6V0 3OV4A 3ALAA 1T2IA 2W04A 2H0HA 1CYVA 1CH0A 4N6LA 4RNTA 3BNCA 1A2PA 1I2GA 3IPTA 1IDPA 3NUVA 6RNTA 4XB5A 1VQM3 1W2B2 5JPPA 1A67A 1VQ93 3CC23 4MMZB 2CIUA 2CWTA 3E99A 4CJNA 3X41A 1F8NA 1I3FA 5TGNA 2K3DA 1VZZA 1RGEA 4HM6B 4R9LA 1Q824 2OTJ3 1JB4A 2V1LA 3AMOA 3K9MC 1LQMB 1W4NA 1WTHA 2QA43 3I563 5DRVA 3SOYA 4BL2A 4HAAA 3FKAA 2YFLB 2ZHXB 1TTOA 1IT8A 3JUQA 2OTL3 3CU3A 1UDII 1KWIA 2SBLA 1S5AA 2E2TA 2R4IA 4JRFA 3SVAA 2QGUA 4AKZA 1FA3A 1W7CA 1GS3A 3VSYA 3U1WA 5JBSA 3GZXB 2RCDA 3EN8A 3RDEA 3LTDA 1K9M4 5AIHA 1E3VA 4EYCA 3CMA3 4Q53A 4GL6A 4QWTA 1RHLA 3LT9A 1X1YA 2Z6BA 1RGGA 1V74A 2D42A 2XSHB 3DH2A 1PU4A 1J2BA 1FZUA 1BU4A 2QEX3 1N9EA 4OUQA 3MHEA 1B2XA 1IQXA 2IA7A 2W2CA 1RTUA 3BNEA 6GSPA 4ZM8A 9RNTA 1GY5A 2PZVA 3D4AA 1UGIA 2KXGA 2AADA 3EJVA 3NM7A 4XDVA 3KE7A 4RNZA 1E3RA 3WMDA 4WP5A 8CHOA 1FGOA 4GB5A 3EQQB 2XGNA 2XGLA
chains in the Genus database with same CATH topology
1N5HA 5AIGA 3MG3A 3DGLA 3DMCA 1N8QA 1DYUA 3CCE3 3DZLA 1K41A 4HM2B 3CCR3 2HMNB 4HM1B 3N8BA 3HZPA 5IG5A 3NBRA 3DXOA 3CME3 1QVF2 1LXEA 1JB5A 3EE1A 4N6MA 2B24B 3OX9A 5AEWB 1IQ8A 4LZIA 2GEXA 3B4PA 1ISKA 1R4CA 2WGQA 1EKMA 3K0ZA 2FGTA 4HKVB 4NHFA 3CD63 4EBGA 2BMQB 4XBTA 1KSIA 2YFJB 2OWPA 2W56A 2GU3A 1QAKA 2B1XB 3DGNA 3UL5A 5DREA 1S723 2C11A 4O02B 1IV7A 4LMIA 1W6CA 3G16A 1YGEA 1RN7A 4MMXB 3BNDA 2CW9A 1IK3A 2GXFA 5JPUA 3EBYA 1GYBA 3WOEB 4N6TA 1MNLA 3B7CA 5IEPA 1Q40B 3LZAA 1W01A 2E2VA 2FXTA 3FLJA 3K5TA 4L8PA 4O8SA 1A2KA 1ULIB 3FG1A 4RNYA 1AVLA 3NV0B 1O7HB 2M7OA 1QVG2 1TIJA 1YVBI 1YI23 3KZTA 3LT8A 2QIYA 1CEWI 4OVMA 1SIIA 5BXQA 3LTAA 1OCVA 2OQEC 1L5GB 2CG1A 1Q7Y4 5EVHA 1IU7A 5ELJA 2F99A 3UJMA 2CC3A 4FMCA 1WQLB 1ASKA 1RRLA 1VQO3 1EG9B 2OCTA 4NREA 2GEYA 2Q07A 4CCVA 2CFGA 3EF8A 2Y74A 2I9WA 1ZX2A 5HGRA 3GAXA 1Q814 1VQ63 1JN5A 4IT7A 3DM8A 3RGRA 1AR0A 4IIAA 4XDWA 2XH9A 5IG4A 2P0XA 2XRXB 3QK9A 4WYKB 4LEHA 3CPOA 1VQ73 5CF2A 1WMNA 2P38A 2HMKB 2PNCA 3V98A 3D3LA 1EA2A 3WODG 3OW22 5AYRB 3FG4A 1SJWA 1Y4KA 2OOVC 3T8NA 4ORLA 4L7KA 3X3XA 4CDLA 1GY6A 4FMAA 6STDA 1PFPA 4EV5A 1K28A 5D83A 3SEDA 1K8A4 3MPHA 1W6YA 3NHXA 1UI7A 3KKGA 1KC84 3FG3A 4G1MB 3KSED 3PYJA 5AIIA 1VQ83 3JUNA 3AMOB 5EEOA 3STDA 1ZO2A 1OUNA 5BVBA 1CYUA 4JF8A 2CHCA 4HVNA 3PZWA 3U97A 1O7NB 4HM7B 4N6UA 2P0MA 1U5OA 3KSPA 5ELUA 2BMRB 1VQ53 3TDGA 4HM0B 1RJOA 1OF5B 3OWUA 4FMDA 4FCJA 3S5CA 1D6ZA 3F8HA 4HZBB 3N9HA 5AI1A 1IVUA 1EQKA 4J8TA 2IUJA 1AV4A 3DGMA 2YFIB 3BB9A 3MYTA 4N3VA 1OACA 3FCSB 2YX9A 1ROAA 4AKYA 4XBXA 2MF7A 3N54B 1YJW3 1NJI4 1JV2B 1JB2A 1HU9A 5LC6A 4HJLB 1HKXA 1K734 3WOFB 1RKYA 1YIT3 2WGOA 3X40A 3G6E3 5IF6A 3LMLA 3CNXA 2CK3H 1NDOB 5FGOA 3Q1CA 1FGQA 1Z1SA 4HZ9B 3EHCA 2WO0A 3DY5A 1JJ22 3S67A 3S29A 4RZMA 3X3ZA 1GY7A 1NB5I 1GD3A 1RRHA 2P05A 4K1VA 3S28A 1U8CB 2CKFB 1SIHA 3D9RA 1Q864 1LOXA 3CCJ3 2INXA 5IW9A 3LOYA 2XF3A 3HX8A 3F40A 4WWUC 1IT7A 3JUMA 3CCQ3 2XFTA 3H51A 4BTXA 1LNHA 5G2GA 3VF1A 2CH9A 1TFKA 4N6NB 3B4OA 1D6YA 5EQLA 2XSOB 4EV2A 3T0UA 5CF1A 4HM8B 1YIJ3 2CG0A 4H3UA 4L8OA 2RFRA 4O3VA 1IVVA 4H61A 1CQSA 5I97A 1O7MB 4AEQA 1YHQ3 2A15A 1IVWA 3FF0A 2OOVA 3ROBA 3UL6A 2HMMB 2K0MA 1US1A 1FGMA 2MC8A 3LTBA 5KP4A 3FSDA 3BNBA 3CPW2 3H3HA 1FGTA 3DGOA 1QAFA 4U13A 3FF2A 2Z77A 3LTCA 1NO3A 1T5YA 1WMPA 2XR8B 4HM4B 1STDA 2O3OA 3FH1A 3GZYB 4KFDA 3CCS3 2STDA 3RGAA 3X3YA 2W0QA 1WNHA 1A90A 2RSXA 3IMAB 5CLKA 3GZBA 1JKGB 5AEUB 3EN1B 1NWWA 2C10A 2XEPA 2CFKA 3SXXA 3V99A 3GWRA 3ECFA 4R4KA 1W02A 1SQWA 2D1WA 5STDA 1OHSA 2JDIH 3NX0A 2O9UX 1TFOA 3LXUX 4LGQA 2FNQA 3VGNA 3FZWA 1M1K4 1W00A 4WFOA 1Q42A 3KFQC 1TUHA 1JNQA 3WA2X 2E2UA 2IUKA 3F14A 3LYGA 1VQL3 4R1KA 1DMNA 4LSOA 1NU3A 2P09A 3G8ZA 2JQ5A 5AYSC 4EXRA 1VQN3 1YJN3 3GRDA 1UUWB 1GD4A 3EB8A 1UW1A 4PEJA 1W2ZA 4R9KA 3X42A 1VQK3 3Q2PA 5LC7A 1M904 3CCU3 2F98A 1A2VA 4KVHA 3M8CA 3PXMA 4N6OB 2BT3A 3NBJA 4KZ1A 3MG1A 3MSOA 1ULJB 1TU5A 1DVDA 2L4VA 3JUOA 5CK6A 3HK4A 3SOAA 1E97A 1OF5A 3EC9A 3NQZA 1STFI 4FCZA 4HM5B 2CWVA 5AIFA 5IG0A 3HIGA 5FW5A 4TX4A 4HBRA 3F9SA 2LYXA 1DMQA 2K54A 3K7CA 4FMBA 5A0OB 3EBTA 2CWUA 1UI8A 1IVXA 1JRQA 2UX0A 3KIIA 4K61A 4HM3B 2KCDA 3HIIA 1FUWA 3CNMA 3CCV3 3QRDA 1BUQA 4K1UA 4I4KA 1OHPA 1ROVA 2OQEA 3PGBA 3ER7A 2W03A 4X2OA 3OXAA 1VQP3 4WHAA 1O7PB 1G96A 3K63A 2KRTA 3PCSA 3SX1A 2BO9B 3CCL3 3OWYA 4RBNA 1M9GA 3SLUA 3MKIA 1UUVB 4FR9A 3CCM3 3S27A 1N5PA 3I0YA 2GU1A 4XBYA 5IENA 1AVKA 2BNGA 1W6GA 3DUKA 1SPUA 2W9PA 3CC73 2W56B 3O8YA 4STDA 3B8LA 2W9QA 4X2HA 2HMLB 3G4S3 1IQYA 1FGRA 2ZDJA 2ML6A 1OH0A 5D82A 1MOLA 3L0RA 4MJDA 3JVCA 2RGQA 4KFFA 2GBWB 2LQVA 3FGYA 1Q40A 3NXJA 2WOHA 4O2HA 3MWZA 3T8UA 3JUPA 3F7SA 3I553 4MMYB 1O7WB 1O7GB 1NB3I 1OHOA 2W6JH 3EX9A 3NM2A 1W5ZA 4IPBA 3HI7A 4MMZB 3BLZA 4EC6A 7STDA 1J2BA 2CFDA 4J9AA 5KP3A 3NV0A 1N8R4 5IG3A 1IV9A 3KN4A 3F7XA 3WDGB 3G713 1LVNA 4KFEA 2F86B 2Y73A 3F8XA 5KP1A 4HYZA 1OPYA 4FCMA 4OK0A 4R80A 3J7Yd 2Z7AA 1TP6A 2GBXB 1DVCA 1WMOA 3PS8A 3IJEB 4K90B 2BMOB 3CC43 2CFLA 3UB1A 1KQS2 3PCRA 5CXOA 2BHMA 2ML5A 2XFSA 1C7HA 3G0KA 2ZL8A 3Q90A 1OGZA 3NBBA 2CFWA 2IMJA 1JKGA 3LH4A 1N9JA 2Z76A 5D81A 1OGXA 3WA3A 1QALA 3MG2A 4BTYA 2WOFA 1JN5B 1DMMA 1YJ93 3CXC2 1M1XB 3OWSA 3UNLA 4XM4A 4WYKA 3GZRA 3NQYA 2HMJB 3V92A 5IEOA 2HMOB 3A76A 5IERA 1VQ43 4MEIA 1QJGA 1QMAA 1KD14 4BTWA 1D6UA 4N6V0 3OV4A 3ALAA 2W04A 4N6LA 1CYVA 3BNCA 3IPTA 1IDPA 3NUVA 1VQM3 4XB5A 1W2B2 5JPPA 1A67A 1VQ93 3CC23 2CIUA 2CWTA 3E99A 3X41A 1F8NA 5TGNA 1VZZA 4HM6B 4R9LA 1Q824 2OTJ3 1JB4A 2V1LA 3AMOA 3K9MC 1W4NA 1WTHA 2QA43 3I563 5DRVA 3SOYA 3FKAA 2YFLB 3JUQA 2OTL3 1IT8A 3CU3A 1KWIA 2SBLA 1S5AA 2E2TA 2R4IA 4JRFA 3SVAA 2QGUA 4AKZA 1FA3A 1W7CA 1GS3A 3VSYA 3U1WA 5JBSA 3GZXB 2RCDA 3EN8A 3RDEA 3LTDA 1K9M4 5AIHA 1E3VA 4EYCA 3CMA3 4Q53A 4GL6A 4QWTA 3LT9A 2Z6BA 1V74A 2D42A 2XSHB 1PU4A 2QEX3 1N9EA 4OUQA 3MHEA 1IQXA 2IA7A 2W2CA 3BNEA 4ZM8A 1GY5A 2PZVA 4XDVA 2KXGA 3NM7A 3EJVA 3KE7A 4RNZA 1E3RA 3WMDA 4WP5A 8CHOA 1FGOA 4GB5A 3EQQB 2XGNA 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIG A;  3MG3 A;  3DMC A;  3DZL A;  1K41 A;  4HM2 B;  2HMN B;  4HM1 B;  3HZP A;  5IG5 A;  3NBR A;  3DXO A;  1JB5 A;  2B24 B;  3OX9 A;  5AEW B;  2GEX A;  3B4P A;  1ISK A;  3K0Z A;  4HKV B;  2BMQ B;  4XBT A;  2YFJ B;  2OWP A;  2B1X B;  5DRE A;  4LMI A;  3G16 A;  2GXF A;  5JPU A;  3EBY A;  1GYB A;  5IEP A;  3B7C A;  1Q40 B;  3LZA A;  1W01 A;  3FLJ A;  4L8P A;  1A2K A;  1ULI B;  3NV0 B;  1O7H B;  3KZT A;  2QIY A;  4OVM A;  5BXQ A;  1OCV A;  5EVH A;  2F99 A;  3UJM A;  1WQL B;  1ASK A;  1EG9 B;  2GEY A;  3EF8 A;  2I9W A;  1ZX2 A;  5HGR A;  1JN5 A;  3DM8 A;  3RGR A;  1AR0 A;  4IIA A;  4XDW A;  5IG4 A;  2XRX B;  4WYK B;  4LEH A;  3CPO A;  5CF2 A;  2HMK B;  1EA2 A;  1SJW A;  3T8N A;  4ORL A;  4L7K A;  4CDL A;  1GY6 A;  6STD A;  5D83 A;  3SED A;  1W6Y A;  3NHX A;  3KKG A;  5AII A;  3JUN A;  3STD A;  1ZO2 A;  1OUN A;  5BVB A;  2CHC A;  4HVN A;  1O7N B;  4HM7 B;  1U5O A;  3KSP A;  2BMR B;  4HM0 B;  1OF5 B;  3OWU A;  3S5C A;  4FCJ A;  3F8H A;  4HZB B;  5AI1 A;  4J8T A;  2YFI B;  3BB9 A;  3MYT A;  4N3V A;  4XBX A;  1JB2 A;  4HJL B;  1HKX A;  5IF6 A;  3CNX A;  1NDO B;  1Z1S A;  4HZ9 B;  3EHC A;  4RZM A;  1GY7 A;  4K1V A;  2CKF B;  3D9R A;  2INX A;  3HX8 A;  3F40 A;  4WWU C;  3JUM A;  3H51 A;  5G2G A;  3B4O A;  5CF1 A;  2XSO B;  4HM8 B;  4H3U A;  4L8O A;  2RFR A;  1CQS A;  1O7M B;  2A15 A;  3FF0 A;  3ROB A;  2HMM B;  5KP4 A;  3FSD A;  3H3H A;  4U13 A;  3FF2 A;  2Z77 A;  2XR8 B;  4HM4 B;  1STD A;  3FH1 A;  3GZY B;  2STD A;  3RGA A;  5CLK A;  3GZB A;  1JKG B;  5AEU B;  3EN1 B;  1NWW A;  3GWR A;  3ECF A;  1W02 A;  5STD A;  1OHS A;  4LGQ A;  3VGN A;  3FZW A;  1W00 A;  1Q42 A;  1TUH A;  3LYG A;  3F14 A;  4R1K A;  1DMN A;  1NU3 A;  3G8Z A;  2JQ5 A;  3GRD A;  1UUW B;  4PEJ A;  2F98 A;  4KVH A;  3M8C A;  3MG1 A;  3MSO A;  1ULJ B;  3JUO A;  5CK6 A;  3HK4 A;  3SOA A;  1E97 A;  1OF5 A;  3EC9 A;  4HM5 B;  5AIF A;  5IG0 A;  5FW5 A;  3F9S A;  1DMQ A;  2K54 A;  3K7C A;  3EBT A;  2UX0 A;  4HM3 B;  3CNM A;  1BUQ A;  4K1U A;  4I4K A;  1OHP A;  3ER7 A;  4X2O A;  3OXA A;  1O7P B;  3OWY A;  3MKI A;  1UUV B;  3I0Y A;  5IEN A;  4XBY A;  2BNG A;  3DUK A;  4STD A;  3B8L A;  4X2H A;  2HML B;  5D82 A;  1OH0 A;  4MJD A;  2RGQ A;  2GBW B;  3FGY A;  1Q40 A;  3NXJ A;  3T8U A;  3JUP A;  3F7S A;  1O7W B;  1O7G B;  3EX9 A;  1OHO A;  3NM2 A;  3BLZ A;  7STD A;  4J9A A;  5KP3 A;  3NV0 A;  5IG3 A;  3F7X A;  2F86 B;  3F8X A;  5KP1 A;  1OPY A;  4FCM A;  2Z7A A;  1TP6 A;  2GBX B;  2BMO B;  5CXO A;  1C7H A;  3G0K A;  3Q90 A;  1OGZ A;  2IMJ A;  1JKG A;  2Z76 A;  5D81 A;  1OGX A;  3MG2 A;  1JN5 B;  1DMM A;  3OWS A;  3UNL A;  4XM4 A;  4WYK A;  3GZR A;  2HMJ B;  2HMO B;  3A76 A;  5IER A;  1QJG A;  1QMA A;  3OV4 A;  3IPT A;  1IDP A;  3NUV A;  4XB5 A;  5JPP A;  3E99 A;  5TGN A;  1VZZ A;  4HM6 B;  4R9L A;  1JB4 A;  5DRV A;  3SOY A;  3FKA A;  2YFL B;  3JUQ A;  3CU3 A;  1S5A A;  2R4I A;  2QGU A;  1GS3 A;  3VSY A;  3GZX B;  2RCD A;  3EN8 A;  5AIH A;  1E3V A;  4Q53 A;  4GB5 A;  2XSH B;  4OUQ A;  3MHE A;  2W2C A;  1GY5 A;  2PZV A;  4XDV A;  3EJV A;  3KE7 A;  1E3R A;  3WMD A;  4WP5 A;  8CHO A;  5IEO A;  4R9K A;  3EQQ B; 
#chains in the Genus database with same CATH topology
 1N5H A;  5AIG A;  3MG3 A;  3DGL A;  3DMC A;  4J5K A;  1BSE A;  1BUJ A;  1N8Q A;  1RN1 A;  1DYU A;  3CCE 3;  3DZL A;  1K41 A;  1HYF A;  4HM2 B;  3CCR 3;  2HMN B;  4HM1 B;  3N8B A;  1RSN A;  3HZP A;  5IG5 A;  3NBR A;  3DXO A;  4EW5 A;  3CME 3;  1QVF 2;  1LXE A;  2R41 A;  1JB5 A;  3EE1 A;  3A5E A;  4N6M A;  1RLS A;  2B24 B;  3OX9 A;  5AEW B;  1IQ8 A;  1UCL A;  1I8V A;  4LZI A;  2GEX A;  3B4P A;  1ISK A;  1R4C A;  2WGQ A;  1BSD A;  8RNT A;  1EKM A;  3K0Z A;  2FGT A;  4HKV B;  4NHF A;  3CD6 3;  4EBG A;  2BMQ B;  1MWR A;  1KSI A;  4XBT A;  2YFJ B;  1VQQ A;  2OWP A;  2W56 A;  2GU3 A;  1QAK A;  1B3S A;  2B1X B;  3DGN A;  3UL5 A;  5DRE A;  2IYJ A;  1S72 3;  1LQG C;  2C11 A;  4O02 B;  1IV7 A;  2CX1 A;  1AY7 A;  4LMI A;  1W6C A;  3G16 A;  1YGE A;  1RN7 A;  4MMX B;  2F5W A;  3BND A;  2CW9 A;  1V58 A;  1IK3 A;  2GXF A;  5JPU A;  3EBY A;  1BRN L;  1GYB A;  3WOE B;  4BL3 A;  1G0T A;  4N6T A;  1MNL A;  3B7C A;  5IEP A;  4IPB A;  1Q40 B;  3LZA A;  1W01 A;  1RNB A;  2E2V A;  1BSC A;  2FXT A;  3FLJ A;  3K5T A;  4L8P A;  4O8S A;  1A2K A;  1ULI B;  1GSP A;  3FG1 A;  4RNY A;  1AVL A;  3NV0 B;  1O7H B;  2M7O A;  1QVG 2;  1RDS A;  1TIJ A;  1YVB I;  1YI2 3;  3KZT A;  3LT8 A;  1MWT A;  2QIY A;  1CEW I;  4OVM A;  1SII A;  5BXQ A;  3LTA A;  1OCV A;  1BNE A;  2OQE C;  1L5G B;  2CG1 A;  1Q7Y 4;  5EVH A;  1IU7 A;  5ELJ A;  2F99 A;  3UJM A;  5GSP A;  2CC3 A;  4FMC A;  1WQL B;  1ASK A;  1MGW A;  1RRL A;  1VQO 3;  1EG9 B;  2OCT A;  4NRE A;  2GEY A;  2Q07 A;  4CCV A;  2CFG A;  3EF8 A;  1FW7 A;  2Y74 A;  2I9W A;  1B2U A;  1ZX2 A;  3GAX A;  5HGR A;  1NNV A;  1Q81 4;  2KF5 A;  1VQ6 3;  1JN5 A;  4IT7 A;  3DM8 A;  1I0V A;  3RGR A;  1I0X A;  3AHW A;  1AR0 A;  4IIA A;  1UCK A;  2F5M A;  4XDW A;  1FUT A;  2XH9 A;  5IG4 A;  1FYS A;  2P0X A;  2XRX B;  3D5I A;  3QK9 A;  4WYK B;  4LEH A;  3RNT A;  3CPO A;  1VQ7 3;  5M19 A;  2KAA A;  3GSP A;  5CF2 A;  1BGS A;  1WMN A;  2P38 A;  2HMK B;  2PNC A;  3V98 A;  3D3L A;  1EA2 A;  3WOD G;  3OW2 2;  5AYR B;  3FG4 A;  1SJW A;  1Y4K A;  2OOV C;  3T8N A;  4ORL A;  4L7K A;  1RGC A;  3X3X A;  4CDL A;  1GY6 A;  4FMA A;  6STD A;  1PFP A;  4EV5 A;  1K28 A;  1BIR A;  5D83 A;  3SED A;  1K8A 4;  2KF3 A;  1W6Y A;  3MPH A;  3NHX A;  1B20 A;  1UI7 A;  2F4Y A;  3KKG A;  1KC8 4;  3FG3 A;  4G1M B;  3KSE D;  3PYJ A;  5AII A;  1VQ8 3;  2UUG C;  1BAO A;  3JUN A;  1LNI A;  3AMO B;  5EEO A;  3AGN A;  3STD A;  1ZO2 A;  1OUN A;  5BVB A;  1CYU A;  4JF8 A;  2CHC A;  4HVN A;  3AHS A;  3PZW A;  1FUS A;  3U97 A;  1O7N B;  4HM7 B;  4N6U A;  2P0M A;  1X1W A;  1U5O A;  2H0G A;  3KSP A;  1G02 A;  5ELU A;  1X1U A;  2BMR B;  1VQ5 3;  3TDG A;  4HM0 B;  1RJO A;  1B2Z A;  1OF5 B;  3OWU A;  4FMD A;  4FCJ A;  3S5C A;  1D6Z A;  3F8H A;  4HZB B;  1MWS A;  3N9H A;  1IVU A;  5AI1 A;  1GMP A;  3Q3F A;  1EQK A;  4J8T A;  1BNR A;  1R4Y A;  1AV4 A;  3DGM A;  2L1S A;  2IUJ A;  2YFI B;  3BB9 A;  2CX0 A;  3MYT A;  4N3V A;  1OAC A;  3FCS B;  2YX9 A;  1BSA A;  1ROA A;  4AKY A;  4XBX A;  1MWU A;  2MF7 A;  1RGF A;  3N54 B;  1YJW 3;  1NJI 4;  1JV2 B;  1JB2 A;  1HU9 A;  5LC6 A;  4HJL B;  1HKX A;  1K73 4;  3SYU A;  3WOF B;  1BNG A;  1RKY A;  1YIT 3;  2WGO A;  4CPK A;  3X40 A;  3G6E 3;  5IF6 A;  3LML A;  1TRQ A;  3CNX A;  2CK3 H;  1NDO B;  2BU4 A;  5FGO A;  3Q1C A;  3AGO A;  1FGQ A;  1JZO A;  1Z1S A;  2BIR A;  2IY2 A;  4HZ9 B;  3EHC A;  2WO0 A;  3DY5 A;  1JJ2 2;  3S67 A;  3S29 A;  4RZM A;  3X3Z A;  1GY7 A;  1NB5 I;  1GD3 A;  1RRH A;  2P05 A;  4K1V A;  1I70 A;  3S28 A;  1C54 A;  3D5G A;  3KCH A;  1U8C B;  2CKF B;  1SIH A;  2SAR A;  3D9R A;  1Q86 4;  1LOX A;  3CCJ 3;  2INX A;  5IW9 A;  3LOY A;  2XF3 A;  3HX8 A;  3F40 A;  4WWU C;  1IT7 A;  3JUM A;  3CCQ 3;  2XFT A;  3H51 A;  3HOH A;  1LNH A;  4BTX A;  1YGW A;  5G2G A;  3VF1 A;  2CH9 A;  1TFK A;  4N6N B;  3B4O A;  1D6Y A;  5EQL A;  2XSO B;  4EV2 A;  2KF4 A;  3T0U A;  5CF1 A;  1BSB A;  4HM8 B;  1BNF A;  1YIJ 3;  2CG0 A;  1DE3 A;  4H3U A;  4L8O A;  2RFR A;  4O3V A;  1IVV A;  4H61 A;  1CQS A;  1RGK A;  5I97 A;  2RBI A;  1O7M B;  4AEQ A;  1YHQ 3;  1LOV A;  2A15 A;  1IVW A;  3FF0 A;  4HOH A;  2OOV A;  3ROB A;  3UL6 A;  2HMM B;  2K0M A;  1US1 A;  1Q7H A;  1FGM A;  2MC8 A;  3LTB A;  2GSP A;  5KP4 A;  3FSD A;  3BNB A;  3CPW 2;  3H3H A;  1FGT A;  3DGO A;  3ZG0 A;  4EC6 A;  1QAF A;  4U13 A;  3FF2 A;  2Z77 A;  3LTC A;  1NO3 A;  1T5Y A;  1WMP A;  2XR8 B;  4HM4 B;  1STD A;  2O3O A;  3FH1 A;  3DGY A;  3GZY B;  1T3B A;  2HOH A;  1DET A;  4GSP A;  4KFD A;  3CCS 3;  2STD A;  3RGA A;  3X3Y A;  1X1X A;  2W0Q A;  1WNH A;  1LRA A;  1A90 A;  1B27 A;  2RSX A;  1YNV X;  3IMA B;  5CLK A;  1UGH I;  1SAR A;  3GZB A;  1JKG B;  5AEU B;  3EN1 B;  1GMQ A;  1RCK A;  1NWW A;  2C10 A;  2XEP A;  2CFK A;  5M1A A;  3SXX A;  3V99 A;  3GWR A;  3ECF A;  7RNT A;  3I55 3;  4R4K A;  1W02 A;  4GHO A;  1SQW A;  2D1W A;  5STD A;  1UCJ A;  1OHS A;  2JDI H;  3NX0 A;  2O9U X;  1GMR A;  1TFO A;  3LXU X;  4LGQ A;  2FNQ A;  3VGN A;  3FZW A;  1M1K 4;  3ZFZ A;  1BRG A;  1W00 A;  5BIR A;  1EUI C;  5G1L A;  4WFO A;  1RCL A;  1AQZ A;  1Q42 A;  3KFQ C;  1TUH A;  1JNQ A;  3WA2 X;  1BNI A;  2E2U A;  2IUK A;  3F14 A;  3LYG A;  1VQL 3;  4R1K A;  1DMN A;  3D79 A;  4LSO A;  3WHO A;  1BRS A;  5G1K A;  1NU3 A;  2P09 A;  3G8Z A;  2JQ5 A;  1LOW A;  5AYS C;  4EXR A;  1VQN 3;  3BU4 A;  3GRD A;  1YJN 3;  1UUW B;  1RGA A;  1GD4 A;  3EB8 A;  1UW1 A;  4PEJ A;  1W2Z A;  4R9K A;  1YVS A;  3X42 A;  1VQK 3;  3Q2P A;  5LC7 A;  1M90 4;  3CCU 3;  1BRI A;  1A2V A;  2F98 A;  7GSP A;  4KVH A;  3M8C A;  3PXM A;  4N6O B;  1V57 A;  2BT3 A;  3NBJ A;  1B2M A;  2C4B A;  4KZ1 A;  3MG1 A;  3MSO A;  1ULJ B;  1TU5 A;  1DVD A;  2L4V A;  3JUO A;  1T2H A;  5CK6 A;  3WR2 A;  3HK4 A;  3SOA A;  1I3I A;  1E97 A;  4BU4 A;  1OF5 A;  3EC9 A;  3NQZ A;  1STF I;  4FCZ A;  4HM5 B;  2CWV A;  5AIF A;  5IG0 A;  3HIG A;  2KF6 A;  1LOY A;  5FW5 A;  3URP A;  4TX4 A;  1UUG B;  4HBR A;  3F9S A;  1GOV A;  2LYX A;  4KT3 B;  1DMQ A;  4LYL B;  4J5G A;  2K54 A;  3K7C A;  4FMB A;  5A0O B;  3EBT A;  2CWU A;  1UI8 A;  2AAE A;  1JZD A;  2H0I A;  1IVX A;  1JRQ A;  2UX0 A;  3KII A;  4K61 A;  4HM3 B;  1UCI A;  2KCD A;  3HII A;  1FUW A;  3CNM A;  3CCV 3;  3QRD A;  1BUQ A;  4K1U A;  4I4K A;  1IYY A;  1OHP A;  1ROV A;  2OQE A;  3PGB A;  3ER7 A;  4I5Q A;  5M18 A;  2W03 A;  4X2O A;  3OXA A;  1VQP 3;  1TJD A;  4WHA A;  1BNJ A;  1RGH A;  1PYL A;  1O7P B;  1BRH A;  1G96 A;  2UGI A;  3K63 A;  2KRT A;  3BIR A;  3PCS A;  3SX1 A;  1RGL A;  2BO9 B;  5HOH A;  3CCL 3;  3OWY A;  4RBN A;  1M9G A;  3SLU A;  1BAN A;  1I2F A;  1UUV B;  3MKI A;  4FR9 A;  3S27 A;  1N5P A;  3I0Y A;  2GU1 A;  2RNT A;  4XBY A;  4BIR A;  1AVK A;  5IEN A;  1RNT A;  1JBR A;  1GOY A;  1W6G A;  2BNG A;  3DUK A;  1SPU A;  2W9P A;  3CC7 3;  2W56 B;  3O8Y A;  1JBT A;  4STD A;  3B8L A;  2W9Q A;  4ILF A;  4X2H A;  2HML B;  4NPB A;  3G4S 3;  1FGR A;  1IQY A;  2ML6 A;  2ZDJ A;  1OH0 A;  5D82 A;  1MOL A;  3L0R A;  4MJD A;  3JVC A;  2RGQ A;  4KFF A;  2GBW B;  2LQV A;  3FGY A;  1MGR A;  1Q40 A;  2WOH A;  3NXJ A;  3MWZ A;  4O2H A;  3JUP A;  3F7S A;  3T8U A;  4MMY B;  1O7W B;  1O7G B;  1NB3 I;  1OHO A;  2W6J H;  3EX9 A;  1I2E A;  1W5Z A;  1B21 A;  3HI7 A;  3NM2 A;  1PY3 A;  3BLZ A;  7STD A;  1GOU A;  2CFD A;  4J9A A;  5KP3 A;  5RNT A;  3NV0 A;  2F56 A;  1N8R 4;  5IG3 A;  1IV9 A;  3KN4 A;  3F7X A;  3WDG B;  3G71 3;  1LVN A;  4KFE A;  2F86 B;  1BNS A;  2Y73 A;  3F8X A;  5KP1 A;  1BRJ A;  1TRP A;  4HYZ A;  1OPY A;  4FCM A;  1RN4 A;  1BOX A;  4OK0 A;  4R80 A;  3J7Y d;  2Z7A A;  1TP6 A;  2GBX B;  3CCM 3;  1DVC A;  1WMO A;  3PS8 A;  3IJE B;  4K90 B;  1ZS7 A;  2BMO B;  3CC4 3;  2CFL A;  3UB1 A;  3ZG5 A;  4DKI A;  1KQS 2;  1HZ1 A;  3PCR A;  2J8X B;  2ZA4 A;  5CXO A;  1ZGX A;  2BHM A;  1BRK A;  2ML5 A;  1C7H A;  2XFS A;  2ZL8 A;  3G0K A;  1OGZ A;  3Q90 A;  1EEJ A;  3NBB A;  2CFW A;  2IMJ A;  1JKG A;  3LH4 A;  1N9J A;  1RMS A;  2Z76 A;  5D81 A;  1OGX A;  3WA3 A;  1QAL A;  1Q9E A;  3MG2 A;  4BTY A;  2WOF A;  1JN5 B;  1DMM A;  1YJ9 3;  3CXC 2;  1M1X B;  3OWS A;  1JBS A;  3UNL A;  4XM4 A;  4WYK A;  3GZR A;  3NQY A;  2HMJ B;  3V92 A;  5IEO A;  5BU4 A;  2HMO B;  3A76 A;  5IER A;  1VQ4 3;  1B2S A;  1BVI A;  4MEI A;  1QJG A;  1QMA A;  1KD1 4;  4BTW A;  1D6U A;  4N6V 0;  3OV4 A;  3ALA A;  1T2I A;  2W04 A;  2H0H A;  1CYV A;  1CH0 A;  4N6L A;  4RNT A;  3BNC A;  1A2P A;  1I2G A;  3IPT A;  1IDP A;  3NUV A;  6RNT A;  4XB5 A;  1VQM 3;  1W2B 2;  5JPP A;  1A67 A;  1VQ9 3;  3CC2 3;  4MMZ B;  2CIU A;  2CWT A;  3E99 A;  4CJN A;  3X41 A;  1F8N A;  1I3F A;  5TGN A;  2K3D A;  1VZZ A;  1RGE A;  4HM6 B;  4R9L A;  1Q82 4;  2OTJ 3;  1JB4 A;  2V1L A;  3AMO A;  3K9M C;  1LQM B;  1W4N A;  1WTH A;  2QA4 3;  3I56 3;  5DRV A;  3SOY A;  4BL2 A;  4HAA A;  3FKA A;  2YFL B;  2ZHX B;  1TTO A;  1IT8 A;  3JUQ A;  2OTL 3;  3CU3 A;  1UDI I;  1KWI A;  2SBL A;  1S5A A;  2E2T A;  2R4I A;  4JRF A;  3SVA A;  2QGU A;  4AKZ A;  1FA3 A;  1W7C A;  1GS3 A;  3VSY A;  3U1W A;  5JBS A;  3GZX B;  2RCD A;  3EN8 A;  3RDE A;  3LTD A;  1K9M 4;  5AIH A;  1E3V A;  4EYC A;  3CMA 3;  4Q53 A;  4GL6 A;  4QWT A;  1RHL A;  3LT9 A;  1X1Y A;  2Z6B A;  1RGG A;  1V74 A;  2D42 A;  2XSH B;  3DH2 A;  1PU4 A;  1J2B A;  1FZU A;  1BU4 A;  2QEX 3;  1N9E A;  4OUQ A;  3MHE A;  1B2X A;  1IQX A;  2IA7 A;  2W2C A;  1RTU A;  3BNE A;  6GSP A;  4ZM8 A;  9RNT A;  1GY5 A;  2PZV A;  3D4A A;  1UGI A;  2KXG A;  2AAD A;  3EJV A;  3NM7 A;  4XDV A;  3KE7 A;  4RNZ A;  1E3R A;  3WMD A;  4WP5 A;  8CHO A;  1FGO A;  4GB5 A;  3EQQ B;  2XGN A;  2XGL A; 
#chains in the Genus database with same CATH homology
 1N5H A;  5AIG A;  3MG3 A;  3DGL A;  3DMC A;  1N8Q A;  1DYU A;  3CCE 3;  3DZL A;  1K41 A;  4HM2 B;  3CCR 3;  2HMN B;  4HM1 B;  3N8B A;  3HZP A;  5IG5 A;  3NBR A;  3DXO A;  3CME 3;  1QVF 2;  1LXE A;  1JB5 A;  3EE1 A;  4N6M A;  2B24 B;  3OX9 A;  5AEW B;  1IQ8 A;  4LZI A;  2GEX A;  3B4P A;  1ISK A;  1R4C A;  2WGQ A;  1EKM A;  3K0Z A;  2FGT A;  4HKV B;  4NHF A;  3CD6 3;  4EBG A;  2BMQ B;  4XBT A;  1KSI A;  2YFJ B;  2OWP A;  2W56 A;  2GU3 A;  1QAK A;  2B1X B;  3DGN A;  3UL5 A;  5DRE A;  1S72 3;  2C11 A;  4O02 B;  1IV7 A;  4LMI A;  1W6C A;  3G16 A;  1YGE A;  1RN7 A;  4MMX B;  3BND A;  2CW9 A;  1IK3 A;  2GXF A;  5JPU A;  3EBY A;  1GYB A;  3WOE B;  4N6T A;  1MNL A;  3B7C A;  5IEP A;  1Q40 B;  3LZA A;  1W01 A;  2E2V A;  2FXT A;  3FLJ A;  3K5T A;  4L8P A;  4O8S A;  1A2K A;  1ULI B;  3FG1 A;  4RNY A;  1AVL A;  3NV0 B;  1O7H B;  2M7O A;  1QVG 2;  1TIJ A;  1YVB I;  1YI2 3;  3KZT A;  3LT8 A;  2QIY A;  1CEW I;  4OVM A;  1SII A;  5BXQ A;  3LTA A;  1OCV A;  2OQE C;  1L5G B;  2CG1 A;  1Q7Y 4;  5EVH A;  1IU7 A;  5ELJ A;  2F99 A;  3UJM A;  2CC3 A;  4FMC A;  1WQL B;  1ASK A;  1RRL A;  1VQO 3;  1EG9 B;  2OCT A;  4NRE A;  2GEY A;  2Q07 A;  4CCV A;  2CFG A;  3EF8 A;  2Y74 A;  2I9W A;  1ZX2 A;  5HGR A;  3GAX A;  1Q81 4;  1VQ6 3;  1JN5 A;  4IT7 A;  3DM8 A;  3RGR A;  1AR0 A;  4IIA A;  4XDW A;  2XH9 A;  5IG4 A;  2P0X A;  2XRX B;  3QK9 A;  4WYK B;  4LEH A;  3CPO A;  1VQ7 3;  5CF2 A;  1WMN A;  2P38 A;  2HMK B;  2PNC A;  3V98 A;  3D3L A;  1EA2 A;  3WOD G;  3OW2 2;  5AYR B;  3FG4 A;  1SJW A;  1Y4K A;  2OOV C;  3T8N A;  4ORL A;  4L7K A;  3X3X A;  4CDL A;  1GY6 A;  4FMA A;  6STD A;  1PFP A;  4EV5 A;  1K28 A;  5D83 A;  3SED A;  1K8A 4;  3MPH A;  1W6Y A;  3NHX A;  1UI7 A;  3KKG A;  1KC8 4;  3FG3 A;  4G1M B;  3KSE D;  3PYJ A;  5AII A;  1VQ8 3;  3JUN A;  3AMO B;  5EEO A;  3STD A;  1ZO2 A;  1OUN A;  5BVB A;  1CYU A;  4JF8 A;  2CHC A;  4HVN A;  3PZW A;  3U97 A;  1O7N B;  4HM7 B;  4N6U A;  2P0M A;  1U5O A;  3KSP A;  5ELU A;  2BMR B;  1VQ5 3;  3TDG A;  4HM0 B;  1RJO A;  1OF5 B;  3OWU A;  4FMD A;  4FCJ A;  3S5C A;  1D6Z A;  3F8H A;  4HZB B;  3N9H A;  5AI1 A;  1IVU A;  1EQK A;  4J8T A;  2IUJ A;  1AV4 A;  3DGM A;  2YFI B;  3BB9 A;  3MYT A;  4N3V A;  1OAC A;  3FCS B;  2YX9 A;  1ROA A;  4AKY A;  4XBX A;  2MF7 A;  3N54 B;  1YJW 3;  1NJI 4;  1JV2 B;  1JB2 A;  1HU9 A;  5LC6 A;  4HJL B;  1HKX A;  1K73 4;  3WOF B;  1RKY A;  1YIT 3;  2WGO A;  3X40 A;  3G6E 3;  5IF6 A;  3LML A;  3CNX A;  2CK3 H;  1NDO B;  5FGO A;  3Q1C A;  1FGQ A;  1Z1S A;  4HZ9 B;  3EHC A;  2WO0 A;  3DY5 A;  1JJ2 2;  3S67 A;  3S29 A;  4RZM A;  3X3Z A;  1GY7 A;  1NB5 I;  1GD3 A;  1RRH A;  2P05 A;  4K1V A;  3S28 A;  1U8C B;  2CKF B;  1SIH A;  3D9R A;  1Q86 4;  1LOX A;  3CCJ 3;  2INX A;  5IW9 A;  3LOY A;  2XF3 A;  3HX8 A;  3F40 A;  4WWU C;  1IT7 A;  3JUM A;  3CCQ 3;  2XFT A;  3H51 A;  4BTX A;  1LNH A;  5G2G A;  3VF1 A;  2CH9 A;  1TFK A;  4N6N B;  3B4O A;  1D6Y A;  5EQL A;  2XSO B;  4EV2 A;  3T0U A;  5CF1 A;  4HM8 B;  1YIJ 3;  2CG0 A;  4H3U A;  4L8O A;  2RFR A;  4O3V A;  1IVV A;  4H61 A;  1CQS A;  5I97 A;  1O7M B;  4AEQ A;  1YHQ 3;  2A15 A;  1IVW A;  3FF0 A;  2OOV A;  3ROB A;  3UL6 A;  2HMM B;  2K0M A;  1US1 A;  1FGM A;  2MC8 A;  3LTB A;  5KP4 A;  3FSD A;  3BNB A;  3CPW 2;  3H3H A;  1FGT A;  3DGO A;  1QAF A;  4U13 A;  3FF2 A;  2Z77 A;  3LTC A;  1NO3 A;  1T5Y A;  1WMP A;  2XR8 B;  4HM4 B;  1STD A;  2O3O A;  3FH1 A;  3GZY B;  4KFD A;  3CCS 3;  2STD A;  3RGA A;  3X3Y A;  2W0Q A;  1WNH A;  1A90 A;  2RSX A;  3IMA B;  5CLK A;  3GZB A;  1JKG B;  5AEU B;  3EN1 B;  1NWW A;  2C10 A;  2XEP A;  2CFK A;  3SXX A;  3V99 A;  3GWR A;  3ECF A;  4R4K A;  1W02 A;  1SQW A;  2D1W A;  5STD A;  1OHS A;  2JDI H;  3NX0 A;  2O9U X;  1TFO A;  3LXU X;  4LGQ A;  2FNQ A;  3VGN A;  3FZW A;  1M1K 4;  1W00 A;  4WFO A;  1Q42 A;  3KFQ C;  1TUH A;  1JNQ A;  3WA2 X;  2E2U A;  2IUK A;  3F14 A;  3LYG A;  1VQL 3;  4R1K A;  1DMN A;  4LSO A;  1NU3 A;  2P09 A;  3G8Z A;  2JQ5 A;  5AYS C;  4EXR A;  1VQN 3;  1YJN 3;  3GRD A;  1UUW B;  1GD4 A;  3EB8 A;  1UW1 A;  4PEJ A;  1W2Z A;  4R9K A;  3X42 A;  1VQK 3;  3Q2P A;  5LC7 A;  1M90 4;  3CCU 3;  2F98 A;  1A2V A;  4KVH A;  3M8C A;  3PXM A;  4N6O B;  2BT3 A;  3NBJ A;  4KZ1 A;  3MG1 A;  3MSO A;  1ULJ B;  1TU5 A;  1DVD A;  2L4V A;  3JUO A;  5CK6 A;  3HK4 A;  3SOA A;  1E97 A;  1OF5 A;  3EC9 A;  3NQZ A;  1STF I;  4FCZ A;  4HM5 B;  2CWV A;  5AIF A;  5IG0 A;  3HIG A;  5FW5 A;  4TX4 A;  4HBR A;  3F9S A;  2LYX A;  1DMQ A;  2K54 A;  3K7C A;  4FMB A;  5A0O B;  3EBT A;  2CWU A;  1UI8 A;  1IVX A;  1JRQ A;  2UX0 A;  3KII A;  4K61 A;  4HM3 B;  2KCD A;  3HII A;  1FUW A;  3CNM A;  3CCV 3;  3QRD A;  1BUQ A;  4K1U A;  4I4K A;  1OHP A;  1ROV A;  2OQE A;  3PGB A;  3ER7 A;  2W03 A;  4X2O A;  3OXA A;  1VQP 3;  4WHA A;  1O7P B;  1G96 A;  3K63 A;  2KRT A;  3PCS A;  3SX1 A;  2BO9 B;  3CCL 3;  3OWY A;  4RBN A;  1M9G A;  3SLU A;  3MKI A;  1UUV B;  4FR9 A;  3CCM 3;  3S27 A;  1N5P A;  3I0Y A;  2GU1 A;  4XBY A;  5IEN A;  1AVK A;  2BNG A;  1W6G A;  3DUK A;  1SPU A;  2W9P A;  3CC7 3;  2W56 B;  3O8Y A;  4STD A;  3B8L A;  2W9Q A;  4X2H A;  2HML B;  3G4S 3;  1IQY A;  1FGR A;  2ZDJ A;  2ML6 A;  1OH0 A;  5D82 A;  1MOL A;  3L0R A;  4MJD A;  3JVC A;  2RGQ A;  4KFF A;  2GBW B;  2LQV A;  3FGY A;  1Q40 A;  3NXJ A;  2WOH A;  4O2H A;  3MWZ A;  3T8U A;  3JUP A;  3F7S A;  3I55 3;  4MMY B;  1O7W B;  1O7G B;  1NB3 I;  1OHO A;  2W6J H;  3EX9 A;  3NM2 A;  1W5Z A;  4IPB A;  3HI7 A;  4MMZ B;  3BLZ A;  4EC6 A;  7STD A;  1J2B A;  2CFD A;  4J9A A;  5KP3 A;  3NV0 A;  1N8R 4;  5IG3 A;  1IV9 A;  3KN4 A;  3F7X A;  3WDG B;  3G71 3;  1LVN A;  4KFE A;  2F86 B;  2Y73 A;  3F8X A;  5KP1 A;  4HYZ A;  1OPY A;  4FCM A;  4OK0 A;  4R80 A;  3J7Y d;  2Z7A A;  1TP6 A;  2GBX B;  1DVC A;  1WMO A;  3PS8 A;  3IJE B;  4K90 B;  2BMO B;  3CC4 3;  2CFL A;  3UB1 A;  1KQS 2;  3PCR A;  5CXO A;  2BHM A;  2ML5 A;  2XFS A;  1C7H A;  3G0K A;  2ZL8 A;  3Q90 A;  1OGZ A;  3NBB A;  2CFW A;  2IMJ A;  1JKG A;  3LH4 A;  1N9J A;  2Z76 A;  5D81 A;  1OGX A;  3WA3 A;  1QAL A;  3MG2 A;  4BTY A;  2WOF A;  1JN5 B;  1DMM A;  1YJ9 3;  3CXC 2;  1M1X B;  3OWS A;  3UNL A;  4XM4 A;  4WYK A;  3GZR A;  3NQY A;  2HMJ B;  3V92 A;  5IEO A;  2HMO B;  3A76 A;  5IER A;  1VQ4 3;  4MEI A;  1QJG A;  1QMA A;  1KD1 4;  4BTW A;  1D6U A;  4N6V 0;  3OV4 A;  3ALA A;  2W04 A;  4N6L A;  1CYV A;  3BNC A;  3IPT A;  1IDP A;  3NUV A;  1VQM 3;  4XB5 A;  1W2B 2;  5JPP A;  1A67 A;  1VQ9 3;  3CC2 3;  2CIU A;  2CWT A;  3E99 A;  3X41 A;  1F8N A;  5TGN A;  1VZZ A;  4HM6 B;  4R9L A;  1Q82 4;  2OTJ 3;  1JB4 A;  2V1L A;  3AMO A;  3K9M C;  1W4N A;  1WTH A;  2QA4 3;  3I56 3;  5DRV A;  3SOY A;  3FKA A;  2YFL B;  3JUQ A;  2OTL 3;  1IT8 A;  3CU3 A;  1KWI A;  2SBL A;  1S5A A;  2E2T A;  2R4I A;  4JRF A;  3SVA A;  2QGU A;  4AKZ A;  1FA3 A;  1W7C A;  1GS3 A;  3VSY A;  3U1W A;  5JBS A;  3GZX B;  2RCD A;  3EN8 A;  3RDE A;  3LTD A;  1K9M 4;  5AIH A;  1E3V A;  4EYC A;  3CMA 3;  4Q53 A;  4GL6 A;  4QWT A;  3LT9 A;  2Z6B A;  1V74 A;  2D42 A;  2XSH B;  1PU4 A;  2QEX 3;  1N9E A;  4OUQ A;  3MHE A;  1IQX A;  2IA7 A;  2W2C A;  3BNE A;  4ZM8 A;  1GY5 A;  2PZV A;  4XDV A;  2KXG A;  3NM7 A;  3EJV A;  3KE7 A;  4RNZ A;  1E3R A;  3WMD A;  4WP5 A;  8CHO A;  1FGO A;  4GB5 A;  3EQQ B;  2XGN A;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...