3DXOA

Crystal structure of a putative isomerase of the snoal-like family (atu_0744) from agrobacterium tumefaciens str. c58 at 2.70 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
117
structure length
117
Chain Sequence
MTQHLTIAQTYLAAWNEEDNERRRHLVGQAWAENTRYVDPLMQGEGQQGIAAMIEAARQKFPGYRFVLAGTPDGHGNFTRFSWRLISPDGDDVAGGTDVVSLNTEGRIDNVVGFLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized SnoaL-like Protein
publication title Crystal structure of SnoaL-like Protein with Unknown Function (17739112) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 2.70 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Isomerase
total genus 32
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3dxoA00
4L8PA 5IF6A 4FCMA 3RGAA 3GZRA 3FF2A 2B1XB 2CHCA 1UUWB 3CPOA 5EVHA 1CQSA 5HGRA 4HJLB 2HMMB 3GZBA 3FZWA 2QIYA 1JB5A 5CK6A 4LMIA 2INXA 4HKVB 3B4PA 3NHXA 1OF5B 4MJDA 5FW5A 3T8UA 1EG9B 5IEPA 5G2GA 2OWPA 1Z1SA 3F9SA 1OF5A 3BB9A 3DZLA 3FSDA 4XBTA 2RCDA 5JPUA 2BMRB 3GWRA 7STDA 1OPYA 3HX8A 4XBXA 3NV0B 3OX9A 4WWUC 2W2CA 2BMQB 3HK4A 3ECFA 5KP3A 4RZMA 3MHEA 1GYBA 4KVHA 1IDPA 3NV0A 1HKXA 3STDA 4X2OA 3ER7A 4HVNA 3OWYA 3B8LA 4LEHA 1C7HA 3MSOA 4K1UA 4CDLA 4HM3B 1OHPA 1O7PB 3JUQA 1ULJB 1OUNA 5IG5A 3NM2A 5CXOA 1NU3A 1ZO2A 3FH1A 2YFIB 3EN1B 3DXOA 1DMQA 1OH0A 3SOYA 1SJWA 2YFJB 3DUKA 1Q40A 3G16A 1JN5B 3F14A 2GXFA 4X2HA 3K0ZA 4LGQA 5D82A 1E3VA 5AI1A 3EJVA 3BLZA 4XDWA 4IIAA 8CHOA 1JN5A 3G0KA 1WQLB 3KKGA 4HZ9B 3G8ZA 3H51A 1O7HB 3JUOA 1OGZA 2A15A 1VZZA 1STDA 2XRXB 4N3VA 2BNGA 2F98A 3EX9A 5JPPA 4HM8B 3KSPA 1OHOA 3K7CA 1NDOB 3D9RA 1O7MB 2YFLB 3FLJA 5CLKA 1TP6A 1OGXA 3VSYA 3M8CA 2RGQA 4L8OA 2B24B 3JUMA 1U5OA 1S5AA 4XM4A 4ORLA 1GS3A 3LYGA 3EF8A 2GBWB 3I0YA 5AIGA 2XSHB 4OVMA 2I9WA 5AIHA 2BMOB 4FCJA 2UX0A 2Z77A 4K1VA 3RGRA 2F99A 1ISKA 3F7SA 2Z76A 1O7NB 1TUHA 3MG3A 2F86B 4I4KA 3OWSA 3VGNA 1DMNA 3Q90A 5AEUB 1JB2A 4HM4B 2HMNB 3FKAA 3MG1A 1E3RA 3H3HA 2XSOB 5BVBA 5STDA 4HM1B 2R4IA 1W6YA 1Q40B 5CF2A 5AEWB 3MG2A 1O7GB 5IEOA 1GY6A 1OCVA 4XDVA 5IENA 4XBYA 1K41A 2K54A 5D81A 3GRDA 5DRVA 3WMDA 2IMJA 3NBRA 1JB4A 2XR8B 5IG4A 5AIIA 1QMAA 4Q53A 1E97A 3EC9A 6STDA 2GEXA 1W01A 3F7XA 3JUNA 3B7CA 2HMLB 5IG3A 3CNXA 3EBTA 3JUPA 5AIFA 3MKIA 1NWWA 2GEYA 3A76A 3CNMA 4H3UA 3IPTA 3T8NA 1ASKA 4HZBB 4R9LA 1JKGB 3GZXB 2HMOB 3FF0A 4J8TA 3CU3A 1Q42A 1JKGA 4HM6B 3UJMA 3FGYA 3EN8A 4OUQA 5BXQA 2RFRA 4HM7B 3OXAA 3DMCA 5TGNA 2GBXB 3EHCA 4HM2B 3SOAA 2HMKB 3MYTA 1GY7A 1ZX2A 3KE7A 5KP1A 3ROBA 2Z7AA 1UUVB 1EA2A 1O7WB 5KP4A 3E99A 1GY5A 4R1KA 1W00A 5CF1A 5IERA 3GZYB 3NUVA 4STDA 4U13A 2QGUA 3KZTA 4WP5A 3S5CA 3LZAA 1ULIB 3OV4A 4GB5A 3B4OA 3NXJA 3OWUA 5D83A 1QJGA 3F40A 3F8XA 2PZVA 1AR0A 4R9KA 3SEDA 4HM5B 3HZPA 4WYKB 1BUQA 2STDA 3DM8A 5DREA 1W02A 2CKFB 2JQ5A 3UNLA 4PEJA 1OHSA 3EBYA 1A2KA 3EQQB 4XB5A 4HM0B 5IG0A 4WYKA 1DMMA 3F8HA 2HMJB 4J9AA 4L7KA
chains in the Genus database with same CATH superfamily
3BNDA 3ZFZA 4L8PA 3IJEB 3N9HA 4JF8A 2MF7A 5IF6A 4FCMA 4HAAA 3K63A 3RGAA 1D6UA 3SVAA 2K0MA 3NBBA 1MWUA 3WA3A 3GZRA 3FF2A 2B1XB 3HOHA 3DGLA 2CHCA 3G4S3 1S723 3KN4A 1UUWB 3CPOA 3PCSA 5EVHA 2WGQA 3U1WA 3BNBA 1QALA 3DH2A 3AGOA 1EKMA 2KAAA 1CQSA 1JZOA 1RMSA 1N5PA 5HGRA 1VQ53 4HJLB 2HMMB 1FYSA 1DYUA 1UI7A 1GMPA 3GZBA 1BSBA 1GOYA 3FZWA 2QIYA 2GSPA 1G0TA 1JB5A 3SYUA 5CK6A 1T2IA 4LMIA 3CCE3 5G1KA 7GSPA 1I2GA 3A5EA 2XGLA 2INXA 4HKVB 1JBRA 3B4PA 1B2MA 3LTDA 3NHXA 1N8QA 1MGWA 1OF5B 4MJDA 3ZG5A 1TFKA 5FW5A 4L7KA 1W7CA 1BSEA 1UGHI 3T8UA 1A90A 1B2ZA 1EG9B 1PY3A 2ZL8A 3X42A 5IEPA 5G2GA 2OWPA 1VQ83 3FCSB 1RGHA 4GL6A 1W2ZA 1I70A 1UUGB 2WOHA 1FA3A 3KSED 1NNVA 3EE1A 1Z1SA 3F9SA 3CCS3 1OF5A 4AKZA 3BB9A 3MWZA 4EW5A 3X3YA 3DZLA 1MWRA 2W04A 2XFSA 4EXRA 4AKYA 3FSDA 4XBTA 3S27A 2UGIA 1EQKA 2RCDA 1VQL3 4KFFA 5JPUA 2BMRB 1IQ8A 3GWRA 7STDA 1LRAA 1UW1A 1OPYA 4IT7A 3HX8A 4XBXA 1C54A 1BGSA 2CX0A 5LC6A 3NV0B 4O8SA 1VQN3 2OQEC 3PXMA 3OX9A 4WWUC 1LQMB 3WA2X 2C11A 2W2CA 1B2XA 2BMQB 1I8VA 3SLUA 1BRGA 1KD14 3HK4A 3ECFA 3SX1A 2GU1A 5KP3A 4RZMA 5M19A 1EUIC 2JDIH 3MHEA 1GYBA 1GSPA 4KVHA 4KFEA 2O9UX 1IDPA 2E2UA 3NV0A 4N6TA 1FGTA 1VQK3 1HKXA 3AHSA 3STDA 4ZM8A 4X2OA 3ER7A 4HVNA 3OWYA 3CME3 1YGWA 1Q7Y4 4LSOA 1YVBI 3B8LA 3D5GA 4LEHA 2AAEA 1C7HA 1PYLA 1T5YA 3LTAA 3DGNA 3MSOA 4K1UA 6RNTA 1Q864 4CDLA 4HM3B 2CWTA 3EB8A 1YJ93 1YJW3 2SBLA 1A2PA 1QAKA 1LVNA 1OHPA 1O7PB 1RRLA 3BNEA 1ULJB 3JUQA 1OUNA 3Q1CA 2LYXA 5IG5A 2BU4A 1RCKA 1STFI 3NM2A 1BNRA 3BU4A 4GSPA 5CXOA 1DVCA 3HIIA 3KCHA 2M7OA 1NU3A 4N6OB 5HOHA 1WNHA 1ZO2A 1W6GA 1SIHA 1X1XA 1VQO3 3FH1A 1LOWA 1RCLA 1TIJA 4FCZA 1RGAA 2KF6A 2YFIB 2BHMA 4ILFA 3CCU3 4N6V0 3EN1B 3QRDA 2KF3A 5EQLA 3DXOA 1KSIA 4EYCA 2OOVC 2Y73A 1DMQA 1RJOA 3NQYA 3LT9A 1OH0A 3WR2A 1K734 3SOYA 3DGMA 3WODG 1SJWA 3FG4A 2YFJB 4N6MA 4FMBA 1X1YA 3DUKA 1WMNA 1Q40A 1Y4KA 3UL6A 4FR9A 3G16A 1JN5B 3F14A 5GSPA 5RNTA 1M9GA 3NX0A 4RNYA 2GXFA 4X2HA 1W5ZA 1ZS7A 2AADA 3K0ZA 3S28A 3WHOA 5JBSA 1YIT3 4LGQA 2OTL3 5D82A 1E3VA 5AI1A 3V98A 3EJVA 1LQGC 3BLZA 4XDWA 1Q814 4IIAA 8CHOA 1BNIA 1JN5A 3G0KA 1WQLB 5G1LA 7RNTA 1VQ63 1A67A 3KKGA 2XH9A 1BAOA 4HZ9B 1YVSA 3G8ZA 3H51A 1O7HB 4AEQA 3JUOA 1OGZA 2A15A 1VZZA 1BVIA 1STDA 2K3DA 2XRXB 4N3VA 1YIJ3 1WMOA 2BNGA 4EV5A 2F98A 3D79A 1FGOA 1JRQA 3EX9A 5JPPA 4HM8B 4BU4A 2ML6A 3CCM3 1MOLA 3L0RA 1W2B2 1UI8A 1MNLA 3KSPA 1BUJA 2FXTA 3LTBA 2QA43 2L1SA 1OHOA 3K7CA 3ALAA 1NDOB 3I563 3D9RA 1O7MB 2YFLB 4NREA 3FLJA 2CFLA 4J5GA 4CCVA 1RGKA 1RSNA 3GSPA 1RN4A 1BU4A 1CYVA 1RLSA 3LXUX 1CYUA 5CLKA 1TP6A 1IT7A 3CMA3 3HIGA 1OGXA 3QK9A 3VSYA 1X1UA 3M8CA 3KIIA 3LTCA 2RGQA 3DGOA 5ELJA 4BL2A 1HYFA 2C10A 2W03A 2KXGA 3MPHA 4L8OA 2ZHXB 1GOVA 3LT8A 2B24B 5ELUA 2E2TA 4FMAA 4K61A 3LH4A 3JUMA 4K90B 1BSAA 1N8R4 1U5OA 1S5AA 1WMPA 1GOUA 2RSXA 3AHWA 3O8YA 1GS3A 3PCRA 4ORLA 4XM4A 1FUWA 1IT8A 1JZDA 2V1LA 3FG1A 1I3FA 3LYGA 4BL3A 3EF8A 2GBWB 1RGGA 3I0YA 5AIGA 2CFKA 2XSHB 2I9WA 3NM7A 4OVMA 5AIHA 3CC73 4R4KA 2L4VA 2ZA4A 3IMAB 2BMOB 2WO0A 1GD3A 1ZGXA 2UX0A 4FCJA 5A0OB 1KC84 2Z77A 4GHOA 4K1VA 1FGRA 1K9M4 4BTXA 5AYRB 3RGRA 2CG1A 4G1MB 3WDGB 1UDII 4EBGA 5BU4A 1T3BA 4FMCA 4WHAA 2F99A 4NPBA 1W6CA 1B2UA 2WOFA 3X41A 8RNTA 1ISKA 3V92A 1RGCA 1GMRA 3F7SA 2Z76A 1TFOA 1IK3A 4EC6A 2W6JH 1IVXA 2IA7A 2XF3A 1O7NB 1TUHA 1L5GB 3MG3A 3CCJ3 1FUTA 3NQZA 1LOVA 1SIIA 2F86B 1GD4A 4I4KA 1CH0A 3OWSA 3VGNA 1DMNA 3Q90A 6GSPA 1NB3I 4N6UA 5AEUB 1JB2A 4HM4B 2HMNB 1RN1A 3FKAA 1UCJA 4JRFA 2CG0A 2CFGA 1RKYA 1VQM3 2Q07A 1E3RA 3MG1A 4EV2A 4R80A 3H3HA 4HBRA 2Z6BA 1LNIA 2IYJA 2XSOB 2P05A 1SPUA 1U8CB 3CCL3 3TDGA 5BVBA 3CCR3 3N54B 1JBSA 1J2BA 1PU4A 1IVVA 5STDA 1BNEA 4BTWA 1HZ1A 4HM1B 1NB5I 1T2HA 1SQWA 3T0UA 1GMQA 1US1A 2R4IA 2RBIA 2D1WA 2CC3A 3OW22 1LOYA 1W6YA 2LQVA 1BRSA 1Q40B 5CF2A 3CC43 5AEWB 4MMXB 3CPW2 1M904 1X1WA 3Q3FA 2J8XB 3MG2A 3CC23 1O7GB 3ZG0A 5IEOA 3UL5A 1A2VA 4MMYB 1AVKA 1FZUA 1GY6A 1OCVA 2BO9B 4XDVA 5IENA 1ROAA 2FGTA 1IQXA 1K41A 1IU7A 4XBYA 3RDEA 1Q7HA 1I0VA 4FMDA 2Y74A 2F56A 2K54A 5D81A 3CD63 5M1AA 3GRDA 5DRVA 3VF1A 3WMDA 2F5MA 2CW9A 2IMJA 2KCDA 3Q2PA 3NBRA 1FGMA 1JB4A 2KF4A 1YJN3 1RGFA 1TRQA 3AMOA 1F8NA 2XR8B 4RNTA 5AIIA 5IG4A 2OTJ3 4MEIA 4N6NB 3WOFB 1JJ22 1QMAA 4Q53A 3AGNA 1E97A 3RNTA 3EC9A 6STDA 2GEXA 9RNTA 1CEWI 1VQ73 1JV2B 4NHFA 3KFQC 1B2SA 1B20A 1W01A 2IUKA 3F7XA 2RNTA 3U97A 3V99A 4CPKA 1NJI4 3JUNA 3CCV3 1W4NA 1OACA 4H61A 3B7CA 1RHLA 1LNHA 2HMLB 5IG3A 2MC8A 1I2FA 1I2EA 1YNVX 2UUGC 3CNXA 3EBTA 5FGOA 4KFDA 1BNSA 3JUPA 1Q9EA 5AIFA 3MKIA 1N9JA 1NWWA 5EEOA 3PYJA 1BSCA 4LZIA 1VQQA 2GEYA 4RNZA 3A76A 5I97A 1YHQ3 1RGLA 2ML5A 2P0MA 5AYSC 4DKIA 1LXEA 2P38A 3CNMA 3IPTA 3LMLA 4H3UA 1ASKA 1LOXA 1V58A 3T8NA 3CXC2 1B27A 2W0QA 4HZBB 1ROVA 1K28A 2CK3H 1BANA 4R9LA 1KQS2 2OQEA 1WTHA 3JVCA 4QWTA 1JKGB 3GZXB 1RNTA 2HMOB 2W56B 1R4YA 1AY7A 4N6LA 1YI23 1QVG2 3D5IA 2BT3A 2E2VA 2W9QA 1BRHA 1JNQA 2P0XA 3G713 1V57A 3FF0A 1VQP3 3D3LA 4J8TA 3CU3A 1Q42A 1AV4A 3DY5A 2CFDA 3DGYA 1TJDA 1B3SA 1RDSA 3BIRA 1QAFA 1JKGA 4HM6B 2PNCA 2R41A 2OCTA 2W56A 2H0IA 3FGYA 3UJMA 5BIRA 1BNJA 3EN8A 4LYLB 4OUQA 2RFRA 5BXQA 2F5WA 2CIUA 4HM7B 1D6YA 1RNBA 4J5KA 3CCQ3 3D4AA 1FGQA 1N5HA 3OXAA 4O3VA 4I5QA 2W9PA 3DMCA 1G96A 5TGNA 1M1XB 2GBXB 3EHCA 5LC7A 1K8A4 4BTYA 4HM2B 1UCIA 2HMKB 3SOAA 3MYTA 2XGNA 4IPBA 5IW9A 1GY7A 1ZX2A 3PGBA 3KE7A 3HI7A 1VQ93 5KP1A 1IVUA 3X3ZA 4WFOA 3ROBA 4OK0A 3WOEB 2IUJA 1KWIA 1EEJA 1MWTA 2Z7AA 1QVF2 4HYZA 2H0HA 2ZDJA 3GAXA 1BIRA 3S29A 2BIRA 2KF5A 1UUVB 2XEPA 1EA2A 1HU9A 3URPA 2OOVA 1O7WB 5KP4A 4RBNA 3E99A 3UB1A 1IYYA 3FG3A 1GY5A 1FUSA 4R1KA 1BNGA 1W00A 5CF1A 3X3XA 1BRNL 1IVWA 2IY2A 3K9MC 1BRIA 5IERA 1FW7A 1RTUA 3GZYB 3NUVA 1Q824 2H0GA 2P09A 1RN7A 3SXXA 4STDA 3LOYA 4U13A 2QGUA 4BIRA 1AVLA 1B21A 1I3IA 1TTOA 2YX9A 2D42A 3KZTA 4WP5A 3S5CA 3I553 4KZ1A 1UGIA 3LZAA 1ULIB 4O02B 4O2HA 1IQYA 2CWVA 2F4YA 3OV4A 1MWSA 4KT3B 1M1K4 1BSDA 3B4OA 3NXJA 3OWUA 4GB5A 5D83A 1G02A 3AMOB 1QJGA 3F40A 3F8XA 1TU5A 1SARA 1YGEA 2O3OA 1DE3A 1UCKA 1BNFA 2PZVA 2WGOA 1AR0A 1MGRA 4R9KA 1DVDA 3SEDA 4HM5B 1R4CA 1BOXA 2GU3A 3N8BA 1IV7A 3HZPA 3NBJA 1PFPA 3S67A 4TX4A 1TRPA 4WYKB 1BUQA 3PZWA 2STDA 3DM8A 5DREA 2CX1A 1W02A 2CKFB 2SARA 1RRHA 2JQ5A 2CWUA 3UNLA 2CFWA 4PEJA 1BRKA 1OHSA 3EBYA 1A2KA 1BRJA 2C4BA 1I0XA 3EQQB 4XB5A 3J7Yd 1VQ43 3BNCA 3G6E3 2CH9A 4HM0B 1AQZA 4WYKA 5IG0A 1V74A 1DMMA 1UCLA 3F8HA 1IV9A 2KRTA 2QEX3 3PS8A 2HOHA 1JBTA 1RGEA 1N9EA 1D6ZA 2HMJB 3K5TA 4J9AA 5M18A 4HOHA 2FNQA 4CJNA 4MMZB 3X40A 1NO3A 1DETA 2XFTA
chains in the Genus database with same CATH topology
3BNDA 4L8PA 3IJEB 3N9HA 4JF8A 2MF7A 5IF6A 4FCMA 3K63A 3RGAA 1D6UA 3SVAA 2K0MA 3NBBA 3WA3A 3GZRA 3FF2A 2B1XB 3DGLA 2CHCA 3G4S3 1S723 3KN4A 1UUWB 3CPOA 3PCSA 5EVHA 2WGQA 3U1WA 3BNBA 1QALA 1EKMA 1CQSA 1N5PA 5HGRA 1VQ53 4HJLB 2HMMB 1DYUA 1UI7A 3GZBA 3FZWA 2QIYA 1JB5A 5CK6A 4LMIA 3CCE3 2XGLA 2INXA 4HKVB 3B4PA 3LTDA 3NHXA 1N8QA 1OF5B 4MJDA 1TFKA 5FW5A 4L7KA 1W7CA 3T8UA 1A90A 1EG9B 2ZL8A 3X42A 5IEPA 5G2GA 2OWPA 1VQ83 3FCSB 4GL6A 1W2ZA 2WOHA 1FA3A 3KSED 3EE1A 1Z1SA 3F9SA 3CCS3 1OF5A 4AKZA 3BB9A 3MWZA 3X3YA 3DZLA 2W04A 2XFSA 4EXRA 4AKYA 3FSDA 4XBTA 3S27A 1EQKA 2RCDA 1VQL3 4KFFA 5JPUA 2BMRB 1IQ8A 3GWRA 7STDA 1UW1A 1OPYA 4IT7A 3HX8A 4XBXA 1VQN3 5LC6A 3NV0B 4O8SA 2OQEC 3PXMA 3OX9A 4WWUC 3WA2X 2C11A 2W2CA 2BMQB 3SLUA 1KD14 3HK4A 3ECFA 3SX1A 2GU1A 5KP3A 4RZMA 2JDIH 3MHEA 1GYBA 4KVHA 4KFEA 2O9UX 1IDPA 2E2UA 3NV0A 4N6TA 1FGTA 1VQK3 1HKXA 3STDA 4ZM8A 4X2OA 3ER7A 4HVNA 3OWYA 3CME3 1Q7Y4 4LSOA 1YVBI 3B8LA 4LEHA 1C7HA 1T5YA 3LTAA 3DGNA 3MSOA 4K1UA 1Q864 4CDLA 4HM3B 2CWTA 1YJW3 1YJ93 2SBLA 1QAKA 1LVNA 1OHPA 1O7PB 1RRLA 3BNEA 1ULJB 3JUQA 1OUNA 3Q1CA 2LYXA 5IG5A 3NM2A 1STFI 5CXOA 1DVCA 3HIIA 2M7OA 1NU3A 4N6OB 1WNHA 1ZO2A 1W6GA 1SIHA 1VQO3 3FH1A 1TIJA 4FCZA 2YFIB 2BHMA 3CCU3 4N6V0 3EN1B 3QRDA 5EQLA 3DXOA 1KSIA 4EYCA 2OOVC 2Y73A 1DMQA 1RJOA 3NQYA 3LT9A 1OH0A 1K734 3SOYA 3DGMA 3WODG 1SJWA 3FG4A 2YFJB 4N6MA 4FMBA 3DUKA 1WMNA 1Q40A 1Y4KA 3UL6A 4FR9A 3G16A 1JN5B 3F14A 1M9GA 3NX0A 4RNYA 2GXFA 4X2HA 1W5ZA 3S28A 3K0ZA 5JBSA 1YIT3 4LGQA 2OTL3 5D82A 1E3VA 5AI1A 3V98A 3EJVA 3BLZA 4XDWA 1Q814 4IIAA 8CHOA 1JN5A 3G0KA 1WQLB 1VQ63 1A67A 3KKGA 2XH9A 4HZ9B 3G8ZA 3H51A 1O7HB 4AEQA 3JUOA 1OGZA 2A15A 1VZZA 1STDA 2XRXB 4N3VA 1YIJ3 1WMOA 2BNGA 4EV5A 2F98A 1FGOA 1JRQA 3EX9A 5JPPA 4HM8B 2ML6A 3CCM3 1MOLA 3L0RA 1W2B2 1UI8A 1MNLA 3KSPA 2FXTA 3LTBA 2QA43 1OHOA 3K7CA 3ALAA 1NDOB 3I563 3D9RA 1O7MB 2YFLB 4NREA 3FLJA 2CFLA 4CCVA 1CYVA 3LXUX 1CYUA 5CLKA 1TP6A 1IT7A 3CMA3 3HIGA 1OGXA 3QK9A 3VSYA 3M8CA 3KIIA 3LTCA 2RGQA 3DGOA 5ELJA 2W03A 2C10A 3MPHA 2KXGA 4L8OA 3LT8A 2B24B 5ELUA 2E2TA 4FMAA 4K61A 3LH4A 3JUMA 4K90B 1N8R4 1U5OA 1S5AA 1WMPA 2RSXA 3O8YA 3PCRA 4ORLA 1GS3A 4XM4A 1FUWA 1IT8A 2V1LA 3FG1A 3LYGA 3EF8A 2GBWB 3I0YA 5AIGA 2CFKA 2XSHB 2I9WA 3NM7A 4OVMA 5AIHA 3CC73 4R4KA 2L4VA 3IMAB 2BMOB 2WO0A 1GD3A 4FCJA 2UX0A 5A0OB 1KC84 2Z77A 4K1VA 1FGRA 1K9M4 4BTXA 5AYRB 3RGRA 2CG1A 4G1MB 3WDGB 4EBGA 4FMCA 4WHAA 2F99A 2WOFA 1W6CA 3X41A 1ISKA 3V92A 3F7SA 2Z76A 1TFOA 1IK3A 4EC6A 2W6JH 1IVXA 2IA7A 2XF3A 1O7NB 1TUHA 1L5GB 3MG3A 3CCJ3 3NQZA 1SIIA 2F86B 1GD4A 4I4KA 3OWSA 3VGNA 1DMNA 3Q90A 1NB3I 4N6UA 5AEUB 1JB2A 4HM4B 2HMNB 4JRFA 3FKAA 1RKYA 1VQM3 2CG0A 2CFGA 2Q07A 1E3RA 3MG1A 4EV2A 4R80A 3H3HA 4HBRA 2Z6BA 2XSOB 2P05A 1SPUA 1U8CB 3CCL3 3TDGA 5BVBA 3CCR3 3N54B 1J2BA 1PU4A 1IVVA 5STDA 4BTWA 4HM1B 1NB5I 1SQWA 3T0UA 1US1A 2R4IA 2D1WA 2CC3A 3OW22 1W6YA 2LQVA 1Q40B 5CF2A 3CC43 5AEWB 4MMXB 3CPW2 1M904 3MG2A 3CC23 1O7GB 5IEOA 3UL5A 1A2VA 4MMYB 1AVKA 1GY6A 1OCVA 2BO9B 4XDVA 5IENA 1ROAA 2FGTA 1IQXA 1K41A 1IU7A 4XBYA 3RDEA 4FMDA 2Y74A 2K54A 5D81A 3CD63 3GRDA 5DRVA 3VF1A 3WMDA 2CW9A 2IMJA 2KCDA 3Q2PA 3NBRA 1FGMA 1JB4A 1YJN3 3AMOA 1F8NA 2XR8B 5IG4A 5AIIA 2OTJ3 4MEIA 4N6NB 3WOFB 1JJ22 1QMAA 4Q53A 1E97A 3EC9A 6STDA 2GEXA 1CEWI 1VQ73 1JV2B 4NHFA 3KFQC 2IUKA 1W01A 3V99A 3F7XA 3U97A 1NJI4 3JUNA 3CCV3 1W4NA 1OACA 4H61A 3B7CA 1LNHA 2HMLB 5IG3A 2MC8A 3CNXA 3EBTA 5FGOA 4KFDA 3JUPA 5AIFA 3MKIA 1N9JA 1NWWA 5EEOA 3PYJA 4LZIA 2GEYA 4RNZA 3A76A 5I97A 1YHQ3 2ML5A 2P0MA 5AYSC 1LXEA 2P38A 3CNMA 3IPTA 3LMLA 4H3UA 1ASKA 1LOXA 3T8NA 3CXC2 2W0QA 4HZBB 1ROVA 1K28A 2CK3H 4R9LA 2OQEA 1WTHA 3JVCA 4QWTA 1JKGB 3GZXB 1QVG2 2HMOB 2W56B 1YI23 4N6LA 2BT3A 2E2VA 2W9QA 1JNQA 2P0XA 3G713 3FF0A 1VQP3 3D3LA 4J8TA 3CU3A 1Q42A 1AV4A 3DY5A 2CFDA 1QAFA 1JKGA 4HM6B 2PNCA 2W56A 2OCTA 3FGYA 3UJMA 3EN8A 4OUQA 5BXQA 2RFRA 2CIUA 4HM7B 1D6YA 3CCQ3 1FGQA 1N5HA 3OXAA 4O3VA 2W9PA 3DMCA 1G96A 5TGNA 1M1XB 2GBXB 3EHCA 5LC7A 1K8A4 4BTYA 4HM2B 3SOAA 2HMKB 3MYTA 2XGNA 4IPBA 5IW9A 1GY7A 1ZX2A 3PGBA 3KE7A 3HI7A 1VQ93 5KP1A 1IVUA 3X3ZA 4WFOA 3ROBA 4OK0A 3WOEB 2IUJA 1KWIA 1QVF2 2Z7AA 4HYZA 2ZDJA 3GAXA 3S29A 1UUVB 2XEPA 1EA2A 1HU9A 2OOVA 1O7WB 5KP4A 4RBNA 3E99A 3UB1A 3FG3A 1GY5A 4R1KA 1W00A 5CF1A 3X3XA 1IVWA 3K9MC 5IERA 3GZYB 3NUVA 1Q824 2P09A 1RN7A 3SXXA 4STDA 3LOYA 4U13A 2QGUA 1AVLA 3KZTA 2YX9A 3I553 2D42A 4WP5A 3S5CA 4KZ1A 3LZAA 1ULIB 4O02B 4O2HA 1IQYA 2CWVA 3OV4A 1M1K4 1KQS2 4GB5A 3B4OA 3NXJA 3OWUA 5D83A 3AMOB 1QJGA 3F40A 3F8XA 1TU5A 1YGEA 2O3OA 2PZVA 2WGOA 1AR0A 4R9KA 1DVDA 3SEDA 4HM5B 1R4CA 2GU3A 3N8BA 1IV7A 3HZPA 3NBJA 1PFPA 3S67A 4TX4A 4WYKB 1BUQA 3PZWA 2STDA 3DM8A 5DREA 1W02A 2CKFB 1RRHA 2JQ5A 2CWUA 3UNLA 2CFWA 4PEJA 1OHSA 3EBYA 1A2KA 3EQQB 4XB5A 3J7Yd 1VQ43 3BNCA 3G6E3 2CH9A 4HM0B 5IG0A 4WYKA 1V74A 1DMMA 3F8HA 1IV9A 2KRTA 2QEX3 3PS8A 1N9EA 1D6ZA 2HMJB 3K5TA 4J9AA 2FNQA 4MMZB 3X40A 1NO3A 3EB8A 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8P A;  5IF6 A;  4FCM A;  3RGA A;  3GZR A;  3FF2 A;  2B1X B;  2CHC A;  1UUW B;  3CPO A;  5EVH A;  1CQS A;  5HGR A;  4HJL B;  2HMM B;  3GZB A;  3FZW A;  2QIY A;  1JB5 A;  5CK6 A;  4LMI A;  2INX A;  4HKV B;  3B4P A;  3NHX A;  1OF5 B;  4MJD A;  5FW5 A;  3T8U A;  1EG9 B;  5IEP A;  5G2G A;  2OWP A;  1Z1S A;  3F9S A;  1OF5 A;  3BB9 A;  3DZL A;  3FSD A;  4XBT A;  2RCD A;  5JPU A;  2BMR B;  3GWR A;  7STD A;  1OPY A;  3HX8 A;  4XBX A;  3NV0 B;  3OX9 A;  4WWU C;  2W2C A;  2BMQ B;  3HK4 A;  3ECF A;  5KP3 A;  4RZM A;  3MHE A;  1GYB A;  4KVH A;  1IDP A;  3NV0 A;  1HKX A;  3STD A;  4X2O A;  3ER7 A;  4HVN A;  3OWY A;  3B8L A;  4LEH A;  1C7H A;  3MSO A;  4K1U A;  4CDL A;  4HM3 B;  1OHP A;  1O7P B;  3JUQ A;  1ULJ B;  1OUN A;  5IG5 A;  3NM2 A;  5CXO A;  1NU3 A;  1ZO2 A;  3FH1 A;  2YFI B;  3EN1 B;  3DXO A;  1DMQ A;  1OH0 A;  3SOY A;  1SJW A;  2YFJ B;  3DUK A;  1Q40 A;  3G16 A;  1JN5 B;  3F14 A;  2GXF A;  4X2H A;  3K0Z A;  4LGQ A;  5D82 A;  1E3V A;  5AI1 A;  3EJV A;  3BLZ A;  4XDW A;  4IIA A;  8CHO A;  1JN5 A;  3G0K A;  1WQL B;  3KKG A;  4HZ9 B;  3G8Z A;  3H51 A;  1O7H B;  3JUO A;  1OGZ A;  2A15 A;  1VZZ A;  1STD A;  2XRX B;  4N3V A;  2BNG A;  2F98 A;  3EX9 A;  5JPP A;  4HM8 B;  3KSP A;  1OHO A;  3K7C A;  1NDO B;  3D9R A;  1O7M B;  2YFL B;  3FLJ A;  5CLK A;  1TP6 A;  1OGX A;  3VSY A;  3M8C A;  2RGQ A;  4L8O A;  2B24 B;  3JUM A;  1U5O A;  1S5A A;  4XM4 A;  4ORL A;  1GS3 A;  3LYG A;  3EF8 A;  2GBW B;  3I0Y A;  5AIG A;  2XSH B;  4OVM A;  2I9W A;  5AIH A;  2BMO B;  4FCJ A;  2UX0 A;  2Z77 A;  4K1V A;  3RGR A;  2F99 A;  1ISK A;  3F7S A;  2Z76 A;  1O7N B;  1TUH A;  3MG3 A;  2F86 B;  4I4K A;  3OWS A;  3VGN A;  1DMN A;  3Q90 A;  5AEU B;  1JB2 A;  4HM4 B;  2HMN B;  3FKA A;  3MG1 A;  1E3R A;  3H3H A;  2XSO B;  5BVB A;  5STD A;  4HM1 B;  2R4I A;  1W6Y A;  1Q40 B;  5CF2 A;  5AEW B;  3MG2 A;  1O7G B;  5IEO A;  1GY6 A;  1OCV A;  4XDV A;  5IEN A;  4XBY A;  1K41 A;  2K54 A;  5D81 A;  3GRD A;  5DRV A;  3WMD A;  2IMJ A;  3NBR A;  1JB4 A;  2XR8 B;  5IG4 A;  5AII A;  1QMA A;  4Q53 A;  1E97 A;  3EC9 A;  6STD A;  2GEX A;  1W01 A;  3F7X A;  3JUN A;  3B7C A;  2HML B;  5IG3 A;  3CNX A;  3EBT A;  3JUP A;  5AIF A;  3MKI A;  1NWW A;  2GEY A;  3A76 A;  3CNM A;  4H3U A;  3IPT A;  3T8N A;  1ASK A;  4HZB B;  4R9L A;  1JKG B;  3GZX B;  2HMO B;  3FF0 A;  4J8T A;  3CU3 A;  1Q42 A;  1JKG A;  4HM6 B;  3UJM A;  3FGY A;  3EN8 A;  4OUQ A;  5BXQ A;  2RFR A;  4HM7 B;  3OXA A;  3DMC A;  5TGN A;  2GBX B;  3EHC A;  4HM2 B;  3SOA A;  2HMK B;  3MYT A;  1GY7 A;  1ZX2 A;  3KE7 A;  5KP1 A;  3ROB A;  2Z7A A;  1UUV B;  1EA2 A;  1O7W B;  5KP4 A;  3E99 A;  1GY5 A;  4R1K A;  1W00 A;  5CF1 A;  5IER A;  3GZY B;  3NUV A;  4STD A;  4U13 A;  2QGU A;  3KZT A;  4WP5 A;  3S5C A;  3LZA A;  1ULI B;  3OV4 A;  4GB5 A;  3B4O A;  3NXJ A;  3OWU A;  5D83 A;  1QJG A;  3F40 A;  3F8X A;  2PZV A;  1AR0 A;  4R9K A;  3SED A;  4HM5 B;  3HZP A;  4WYK B;  1BUQ A;  2STD A;  3DM8 A;  5DRE A;  1W02 A;  2CKF B;  2JQ5 A;  3UNL A;  4PEJ A;  1OHS A;  3EBY A;  1A2K A;  3EQQ B;  4XB5 A;  4HM0 B;  5IG0 A;  4WYK A;  1DMM A;  3F8H A;  2HMJ B;  4J9A A;  4L7K A; 
#chains in the Genus database with same CATH topology
 3BND A;  3ZFZ A;  4L8P A;  3IJE B;  3N9H A;  4JF8 A;  2MF7 A;  5IF6 A;  4FCM A;  4HAA A;  3K63 A;  3RGA A;  1D6U A;  3SVA A;  2K0M A;  3NBB A;  1MWU A;  3WA3 A;  3GZR A;  3FF2 A;  2B1X B;  3HOH A;  3DGL A;  2CHC A;  3G4S 3;  1S72 3;  3KN4 A;  1UUW B;  3CPO A;  3PCS A;  5EVH A;  2WGQ A;  3U1W A;  3BNB A;  1QAL A;  3DH2 A;  3AGO A;  1EKM A;  2KAA A;  1CQS A;  1JZO A;  1RMS A;  1N5P A;  5HGR A;  1VQ5 3;  4HJL B;  2HMM B;  1FYS A;  1DYU A;  1UI7 A;  1GMP A;  3GZB A;  1BSB A;  1GOY A;  3FZW A;  2QIY A;  2GSP A;  1G0T A;  1JB5 A;  3SYU A;  5CK6 A;  1T2I A;  4LMI A;  3CCE 3;  5G1K A;  7GSP A;  1I2G A;  3A5E A;  2XGL A;  2INX A;  4HKV B;  1JBR A;  3B4P A;  1B2M A;  3LTD A;  3NHX A;  1N8Q A;  1MGW A;  1OF5 B;  4MJD A;  3ZG5 A;  1TFK A;  5FW5 A;  4L7K A;  1W7C A;  1BSE A;  1UGH I;  3T8U A;  1A90 A;  1B2Z A;  1EG9 B;  1PY3 A;  2ZL8 A;  3X42 A;  5IEP A;  5G2G A;  2OWP A;  1VQ8 3;  3FCS B;  1RGH A;  4GL6 A;  1W2Z A;  1I70 A;  1UUG B;  2WOH A;  1FA3 A;  3KSE D;  1NNV A;  3EE1 A;  1Z1S A;  3F9S A;  3CCS 3;  1OF5 A;  4AKZ A;  3BB9 A;  3MWZ A;  4EW5 A;  3X3Y A;  3DZL A;  1MWR A;  2W04 A;  2XFS A;  4EXR A;  4AKY A;  3FSD A;  4XBT A;  3S27 A;  2UGI A;  1EQK A;  2RCD A;  1VQL 3;  4KFF A;  5JPU A;  2BMR B;  1IQ8 A;  3GWR A;  7STD A;  1LRA A;  1UW1 A;  1OPY A;  4IT7 A;  3HX8 A;  4XBX A;  1C54 A;  1BGS A;  2CX0 A;  5LC6 A;  3NV0 B;  4O8S A;  1VQN 3;  2OQE C;  3PXM A;  3OX9 A;  4WWU C;  1LQM B;  3WA2 X;  2C11 A;  2W2C A;  1B2X A;  2BMQ B;  1I8V A;  3SLU A;  1BRG A;  1KD1 4;  3HK4 A;  3ECF A;  3SX1 A;  2GU1 A;  5KP3 A;  4RZM A;  5M19 A;  1EUI C;  2JDI H;  3MHE A;  1GYB A;  1GSP A;  4KVH A;  4KFE A;  2O9U X;  1IDP A;  2E2U A;  3NV0 A;  4N6T A;  1FGT A;  1VQK 3;  1HKX A;  3AHS A;  3STD A;  4ZM8 A;  4X2O A;  3ER7 A;  4HVN A;  3OWY A;  3CME 3;  1YGW A;  1Q7Y 4;  4LSO A;  1YVB I;  3B8L A;  3D5G A;  4LEH A;  2AAE A;  1C7H A;  1PYL A;  1T5Y A;  3LTA A;  3DGN A;  3MSO A;  4K1U A;  6RNT A;  1Q86 4;  4CDL A;  4HM3 B;  2CWT A;  3EB8 A;  1YJ9 3;  1YJW 3;  2SBL A;  1A2P A;  1QAK A;  1LVN A;  1OHP A;  1O7P B;  1RRL A;  3BNE A;  1ULJ B;  3JUQ A;  1OUN A;  3Q1C A;  2LYX A;  5IG5 A;  2BU4 A;  1RCK A;  1STF I;  3NM2 A;  1BNR A;  3BU4 A;  4GSP A;  5CXO A;  1DVC A;  3HII A;  3KCH A;  2M7O A;  1NU3 A;  4N6O B;  5HOH A;  1WNH A;  1ZO2 A;  1W6G A;  1SIH A;  1X1X A;  1VQO 3;  3FH1 A;  1LOW A;  1RCL A;  1TIJ A;  4FCZ A;  1RGA A;  2KF6 A;  2YFI B;  2BHM A;  4ILF A;  3CCU 3;  4N6V 0;  3EN1 B;  3QRD A;  2KF3 A;  5EQL A;  3DXO A;  1KSI A;  4EYC A;  2OOV C;  2Y73 A;  1DMQ A;  1RJO A;  3NQY A;  3LT9 A;  1OH0 A;  3WR2 A;  1K73 4;  3SOY A;  3DGM A;  3WOD G;  1SJW A;  3FG4 A;  2YFJ B;  4N6M A;  4FMB A;  1X1Y A;  3DUK A;  1WMN A;  1Q40 A;  1Y4K A;  3UL6 A;  4FR9 A;  3G16 A;  1JN5 B;  3F14 A;  5GSP A;  5RNT A;  1M9G A;  3NX0 A;  4RNY A;  2GXF A;  4X2H A;  1W5Z A;  1ZS7 A;  2AAD A;  3K0Z A;  3S28 A;  3WHO A;  5JBS A;  1YIT 3;  4LGQ A;  2OTL 3;  5D82 A;  1E3V A;  5AI1 A;  3V98 A;  3EJV A;  1LQG C;  3BLZ A;  4XDW A;  1Q81 4;  4IIA A;  8CHO A;  1BNI A;  1JN5 A;  3G0K A;  1WQL B;  5G1L A;  7RNT A;  1VQ6 3;  1A67 A;  3KKG A;  2XH9 A;  1BAO A;  4HZ9 B;  1YVS A;  3G8Z A;  3H51 A;  1O7H B;  4AEQ A;  3JUO A;  1OGZ A;  2A15 A;  1VZZ A;  1BVI A;  1STD A;  2K3D A;  2XRX B;  4N3V A;  1YIJ 3;  1WMO A;  2BNG A;  4EV5 A;  2F98 A;  3D79 A;  1FGO A;  1JRQ A;  3EX9 A;  5JPP A;  4HM8 B;  4BU4 A;  2ML6 A;  3CCM 3;  1MOL A;  3L0R A;  1W2B 2;  1UI8 A;  1MNL A;  3KSP A;  1BUJ A;  2FXT A;  3LTB A;  2QA4 3;  2L1S A;  1OHO A;  3K7C A;  3ALA A;  1NDO B;  3I56 3;  3D9R A;  1O7M B;  2YFL B;  4NRE A;  3FLJ A;  2CFL A;  4J5G A;  4CCV A;  1RGK A;  1RSN A;  3GSP A;  1RN4 A;  1BU4 A;  1CYV A;  1RLS A;  3LXU X;  1CYU A;  5CLK A;  1TP6 A;  1IT7 A;  3CMA 3;  3HIG A;  1OGX A;  3QK9 A;  3VSY A;  1X1U A;  3M8C A;  3KII A;  3LTC A;  2RGQ A;  3DGO A;  5ELJ A;  4BL2 A;  1HYF A;  2C10 A;  2W03 A;  2KXG A;  3MPH A;  4L8O A;  2ZHX B;  1GOV A;  3LT8 A;  2B24 B;  5ELU A;  2E2T A;  4FMA A;  4K61 A;  3LH4 A;  3JUM A;  4K90 B;  1BSA A;  1N8R 4;  1U5O A;  1S5A A;  1WMP A;  1GOU A;  2RSX A;  3AHW A;  3O8Y A;  1GS3 A;  3PCR A;  4ORL A;  4XM4 A;  1FUW A;  1IT8 A;  1JZD A;  2V1L A;  3FG1 A;  1I3F A;  3LYG A;  4BL3 A;  3EF8 A;  2GBW B;  1RGG A;  3I0Y A;  5AIG A;  2CFK A;  2XSH B;  2I9W A;  3NM7 A;  4OVM A;  5AIH A;  3CC7 3;  4R4K A;  2L4V A;  2ZA4 A;  3IMA B;  2BMO B;  2WO0 A;  1GD3 A;  1ZGX A;  2UX0 A;  4FCJ A;  5A0O B;  1KC8 4;  2Z77 A;  4GHO A;  4K1V A;  1FGR A;  1K9M 4;  4BTX A;  5AYR B;  3RGR A;  2CG1 A;  4G1M B;  3WDG B;  1UDI I;  4EBG A;  5BU4 A;  1T3B A;  4FMC A;  4WHA A;  2F99 A;  4NPB A;  1W6C A;  1B2U A;  2WOF A;  3X41 A;  8RNT A;  1ISK A;  3V92 A;  1RGC A;  1GMR A;  3F7S A;  2Z76 A;  1TFO A;  1IK3 A;  4EC6 A;  2W6J H;  1IVX A;  2IA7 A;  2XF3 A;  1O7N B;  1TUH A;  1L5G B;  3MG3 A;  3CCJ 3;  1FUT A;  3NQZ A;  1LOV A;  1SII A;  2F86 B;  1GD4 A;  4I4K A;  1CH0 A;  3OWS A;  3VGN A;  1DMN A;  3Q90 A;  6GSP A;  1NB3 I;  4N6U A;  5AEU B;  1JB2 A;  4HM4 B;  2HMN B;  1RN1 A;  3FKA A;  1UCJ A;  4JRF A;  2CG0 A;  2CFG A;  1RKY A;  1VQM 3;  2Q07 A;  1E3R A;  3MG1 A;  4EV2 A;  4R80 A;  3H3H A;  4HBR A;  2Z6B A;  1LNI A;  2IYJ A;  2XSO B;  2P05 A;  1SPU A;  1U8C B;  3CCL 3;  3TDG A;  5BVB A;  3CCR 3;  3N54 B;  1JBS A;  1J2B A;  1PU4 A;  1IVV A;  5STD A;  1BNE A;  4BTW A;  1HZ1 A;  4HM1 B;  1NB5 I;  1T2H A;  1SQW A;  3T0U A;  1GMQ A;  1US1 A;  2R4I A;  2RBI A;  2D1W A;  2CC3 A;  3OW2 2;  1LOY A;  1W6Y A;  2LQV A;  1BRS A;  1Q40 B;  5CF2 A;  3CC4 3;  5AEW B;  4MMX B;  3CPW 2;  1M90 4;  1X1W A;  3Q3F A;  2J8X B;  3MG2 A;  3CC2 3;  1O7G B;  3ZG0 A;  5IEO A;  3UL5 A;  1A2V A;  4MMY B;  1AVK A;  1FZU A;  1GY6 A;  1OCV A;  2BO9 B;  4XDV A;  5IEN A;  1ROA A;  2FGT A;  1IQX A;  1K41 A;  1IU7 A;  4XBY A;  3RDE A;  1Q7H A;  1I0V A;  4FMD A;  2Y74 A;  2F56 A;  2K54 A;  5D81 A;  3CD6 3;  5M1A A;  3GRD A;  5DRV A;  3VF1 A;  3WMD A;  2F5M A;  2CW9 A;  2IMJ A;  2KCD A;  3Q2P A;  3NBR A;  1FGM A;  1JB4 A;  2KF4 A;  1YJN 3;  1RGF A;  1TRQ A;  3AMO A;  1F8N A;  2XR8 B;  4RNT A;  5AII A;  5IG4 A;  2OTJ 3;  4MEI A;  4N6N B;  3WOF B;  1JJ2 2;  1QMA A;  4Q53 A;  3AGN A;  1E97 A;  3RNT A;  3EC9 A;  6STD A;  2GEX A;  9RNT A;  1CEW I;  1VQ7 3;  1JV2 B;  4NHF A;  3KFQ C;  1B2S A;  1B20 A;  1W01 A;  2IUK A;  3F7X A;  2RNT A;  3U97 A;  3V99 A;  4CPK A;  1NJI 4;  3JUN A;  3CCV 3;  1W4N A;  1OAC A;  4H61 A;  3B7C A;  1RHL A;  1LNH A;  2HML B;  5IG3 A;  2MC8 A;  1I2F A;  1I2E A;  1YNV X;  2UUG C;  3CNX A;  3EBT A;  5FGO A;  4KFD A;  1BNS A;  3JUP A;  1Q9E A;  5AIF A;  3MKI A;  1N9J A;  1NWW A;  5EEO A;  3PYJ A;  1BSC A;  4LZI A;  1VQQ A;  2GEY A;  4RNZ A;  3A76 A;  5I97 A;  1YHQ 3;  1RGL A;  2ML5 A;  2P0M A;  5AYS C;  4DKI A;  1LXE A;  2P38 A;  3CNM A;  3IPT A;  3LML A;  4H3U A;  1ASK A;  1LOX A;  1V58 A;  3T8N A;  3CXC 2;  1B27 A;  2W0Q A;  4HZB B;  1ROV A;  1K28 A;  2CK3 H;  1BAN A;  4R9L A;  1KQS 2;  2OQE A;  1WTH A;  3JVC A;  4QWT A;  1JKG B;  3GZX B;  1RNT A;  2HMO B;  2W56 B;  1R4Y A;  1AY7 A;  4N6L A;  1YI2 3;  1QVG 2;  3D5I A;  2BT3 A;  2E2V A;  2W9Q A;  1BRH A;  1JNQ A;  2P0X A;  3G71 3;  1V57 A;  3FF0 A;  1VQP 3;  3D3L A;  4J8T A;  3CU3 A;  1Q42 A;  1AV4 A;  3DY5 A;  2CFD A;  3DGY A;  1TJD A;  1B3S A;  1RDS A;  3BIR A;  1QAF A;  1JKG A;  4HM6 B;  2PNC A;  2R41 A;  2OCT A;  2W56 A;  2H0I A;  3FGY A;  3UJM A;  5BIR A;  1BNJ A;  3EN8 A;  4LYL B;  4OUQ A;  2RFR A;  5BXQ A;  2F5W A;  2CIU A;  4HM7 B;  1D6Y A;  1RNB A;  4J5K A;  3CCQ 3;  3D4A A;  1FGQ A;  1N5H A;  3OXA A;  4O3V A;  4I5Q A;  2W9P A;  3DMC A;  1G96 A;  5TGN A;  1M1X B;  2GBX B;  3EHC A;  5LC7 A;  1K8A 4;  4BTY A;  4HM2 B;  1UCI A;  2HMK B;  3SOA A;  3MYT A;  2XGN A;  4IPB A;  5IW9 A;  1GY7 A;  1ZX2 A;  3PGB A;  3KE7 A;  3HI7 A;  1VQ9 3;  5KP1 A;  1IVU A;  3X3Z A;  4WFO A;  3ROB A;  4OK0 A;  3WOE B;  2IUJ A;  1KWI A;  1EEJ A;  1MWT A;  2Z7A A;  1QVF 2;  4HYZ A;  2H0H A;  2ZDJ A;  3GAX A;  1BIR A;  3S29 A;  2BIR A;  2KF5 A;  1UUV B;  2XEP A;  1EA2 A;  1HU9 A;  3URP A;  2OOV A;  1O7W B;  5KP4 A;  4RBN A;  3E99 A;  3UB1 A;  1IYY A;  3FG3 A;  1GY5 A;  1FUS A;  4R1K A;  1BNG A;  1W00 A;  5CF1 A;  3X3X A;  1BRN L;  1IVW A;  2IY2 A;  3K9M C;  1BRI A;  5IER A;  1FW7 A;  1RTU A;  3GZY B;  3NUV A;  1Q82 4;  2H0G A;  2P09 A;  1RN7 A;  3SXX A;  4STD A;  3LOY A;  4U13 A;  2QGU A;  4BIR A;  1AVL A;  1B21 A;  1I3I A;  1TTO A;  2YX9 A;  2D42 A;  3KZT A;  4WP5 A;  3S5C A;  3I55 3;  4KZ1 A;  1UGI A;  3LZA A;  1ULI B;  4O02 B;  4O2H A;  1IQY A;  2CWV A;  2F4Y A;  3OV4 A;  1MWS A;  4KT3 B;  1M1K 4;  1BSD A;  3B4O A;  3NXJ A;  3OWU A;  4GB5 A;  5D83 A;  1G02 A;  3AMO B;  1QJG A;  3F40 A;  3F8X A;  1TU5 A;  1SAR A;  1YGE A;  2O3O A;  1DE3 A;  1UCK A;  1BNF A;  2PZV A;  2WGO A;  1AR0 A;  1MGR A;  4R9K A;  1DVD A;  3SED A;  4HM5 B;  1R4C A;  1BOX A;  2GU3 A;  3N8B A;  1IV7 A;  3HZP A;  3NBJ A;  1PFP A;  3S67 A;  4TX4 A;  1TRP A;  4WYK B;  1BUQ A;  3PZW A;  2STD A;  3DM8 A;  5DRE A;  2CX1 A;  1W02 A;  2CKF B;  2SAR A;  1RRH A;  2JQ5 A;  2CWU A;  3UNL A;  2CFW A;  4PEJ A;  1BRK A;  1OHS A;  3EBY A;  1A2K A;  1BRJ A;  2C4B A;  1I0X A;  3EQQ B;  4XB5 A;  3J7Y d;  1VQ4 3;  3BNC A;  3G6E 3;  2CH9 A;  4HM0 B;  1AQZ A;  4WYK A;  5IG0 A;  1V74 A;  1DMM A;  1UCL A;  3F8H A;  1IV9 A;  2KRT A;  2QEX 3;  3PS8 A;  2HOH A;  1JBT A;  1RGE A;  1N9E A;  1D6Z A;  2HMJ B;  3K5T A;  4J9A A;  5M18 A;  4HOH A;  2FNQ A;  4CJN A;  4MMZ B;  3X40 A;  1NO3 A;  1DET A;  2XFT A; 
#chains in the Genus database with same CATH homology
 3BND A;  4L8P A;  3IJE B;  3N9H A;  4JF8 A;  2MF7 A;  5IF6 A;  4FCM A;  3K63 A;  3RGA A;  1D6U A;  3SVA A;  2K0M A;  3NBB A;  3WA3 A;  3GZR A;  3FF2 A;  2B1X B;  3DGL A;  2CHC A;  3G4S 3;  1S72 3;  3KN4 A;  1UUW B;  3CPO A;  3PCS A;  5EVH A;  2WGQ A;  3U1W A;  3BNB A;  1QAL A;  1EKM A;  1CQS A;  1N5P A;  5HGR A;  1VQ5 3;  4HJL B;  2HMM B;  1DYU A;  1UI7 A;  3GZB A;  3FZW A;  2QIY A;  1JB5 A;  5CK6 A;  4LMI A;  3CCE 3;  2XGL A;  2INX A;  4HKV B;  3B4P A;  3LTD A;  3NHX A;  1N8Q A;  1OF5 B;  4MJD A;  1TFK A;  5FW5 A;  4L7K A;  1W7C A;  3T8U A;  1A90 A;  1EG9 B;  2ZL8 A;  3X42 A;  5IEP A;  5G2G A;  2OWP A;  1VQ8 3;  3FCS B;  4GL6 A;  1W2Z A;  2WOH A;  1FA3 A;  3KSE D;  3EE1 A;  1Z1S A;  3F9S A;  3CCS 3;  1OF5 A;  4AKZ A;  3BB9 A;  3MWZ A;  3X3Y A;  3DZL A;  2W04 A;  2XFS A;  4EXR A;  4AKY A;  3FSD A;  4XBT A;  3S27 A;  1EQK A;  2RCD A;  1VQL 3;  4KFF A;  5JPU A;  2BMR B;  1IQ8 A;  3GWR A;  7STD A;  1UW1 A;  1OPY A;  4IT7 A;  3HX8 A;  4XBX A;  1VQN 3;  5LC6 A;  3NV0 B;  4O8S A;  2OQE C;  3PXM A;  3OX9 A;  4WWU C;  3WA2 X;  2C11 A;  2W2C A;  2BMQ B;  3SLU A;  1KD1 4;  3HK4 A;  3ECF A;  3SX1 A;  2GU1 A;  5KP3 A;  4RZM A;  2JDI H;  3MHE A;  1GYB A;  4KVH A;  4KFE A;  2O9U X;  1IDP A;  2E2U A;  3NV0 A;  4N6T A;  1FGT A;  1VQK 3;  1HKX A;  3STD A;  4ZM8 A;  4X2O A;  3ER7 A;  4HVN A;  3OWY A;  3CME 3;  1Q7Y 4;  4LSO A;  1YVB I;  3B8L A;  4LEH A;  1C7H A;  1T5Y A;  3LTA A;  3DGN A;  3MSO A;  4K1U A;  1Q86 4;  4CDL A;  4HM3 B;  2CWT A;  1YJW 3;  1YJ9 3;  2SBL A;  1QAK A;  1LVN A;  1OHP A;  1O7P B;  1RRL A;  3BNE A;  1ULJ B;  3JUQ A;  1OUN A;  3Q1C A;  2LYX A;  5IG5 A;  3NM2 A;  1STF I;  5CXO A;  1DVC A;  3HII A;  2M7O A;  1NU3 A;  4N6O B;  1WNH A;  1ZO2 A;  1W6G A;  1SIH A;  1VQO 3;  3FH1 A;  1TIJ A;  4FCZ A;  2YFI B;  2BHM A;  3CCU 3;  4N6V 0;  3EN1 B;  3QRD A;  5EQL A;  3DXO A;  1KSI A;  4EYC A;  2OOV C;  2Y73 A;  1DMQ A;  1RJO A;  3NQY A;  3LT9 A;  1OH0 A;  1K73 4;  3SOY A;  3DGM A;  3WOD G;  1SJW A;  3FG4 A;  2YFJ B;  4N6M A;  4FMB A;  3DUK A;  1WMN A;  1Q40 A;  1Y4K A;  3UL6 A;  4FR9 A;  3G16 A;  1JN5 B;  3F14 A;  1M9G A;  3NX0 A;  4RNY A;  2GXF A;  4X2H A;  1W5Z A;  3S28 A;  3K0Z A;  5JBS A;  1YIT 3;  4LGQ A;  2OTL 3;  5D82 A;  1E3V A;  5AI1 A;  3V98 A;  3EJV A;  3BLZ A;  4XDW A;  1Q81 4;  4IIA A;  8CHO A;  1JN5 A;  3G0K A;  1WQL B;  1VQ6 3;  1A67 A;  3KKG A;  2XH9 A;  4HZ9 B;  3G8Z A;  3H51 A;  1O7H B;  4AEQ A;  3JUO A;  1OGZ A;  2A15 A;  1VZZ A;  1STD A;  2XRX B;  4N3V A;  1YIJ 3;  1WMO A;  2BNG A;  4EV5 A;  2F98 A;  1FGO A;  1JRQ A;  3EX9 A;  5JPP A;  4HM8 B;  2ML6 A;  3CCM 3;  1MOL A;  3L0R A;  1W2B 2;  1UI8 A;  1MNL A;  3KSP A;  2FXT A;  3LTB A;  2QA4 3;  1OHO A;  3K7C A;  3ALA A;  1NDO B;  3I56 3;  3D9R A;  1O7M B;  2YFL B;  4NRE A;  3FLJ A;  2CFL A;  4CCV A;  1CYV A;  3LXU X;  1CYU A;  5CLK A;  1TP6 A;  1IT7 A;  3CMA 3;  3HIG A;  1OGX A;  3QK9 A;  3VSY A;  3M8C A;  3KII A;  3LTC A;  2RGQ A;  3DGO A;  5ELJ A;  2W03 A;  2C10 A;  3MPH A;  2KXG A;  4L8O A;  3LT8 A;  2B24 B;  5ELU A;  2E2T A;  4FMA A;  4K61 A;  3LH4 A;  3JUM A;  4K90 B;  1N8R 4;  1U5O A;  1S5A A;  1WMP A;  2RSX A;  3O8Y A;  3PCR A;  4ORL A;  1GS3 A;  4XM4 A;  1FUW A;  1IT8 A;  2V1L A;  3FG1 A;  3LYG A;  3EF8 A;  2GBW B;  3I0Y A;  5AIG A;  2CFK A;  2XSH B;  2I9W A;  3NM7 A;  4OVM A;  5AIH A;  3CC7 3;  4R4K A;  2L4V A;  3IMA B;  2BMO B;  2WO0 A;  1GD3 A;  4FCJ A;  2UX0 A;  5A0O B;  1KC8 4;  2Z77 A;  4K1V A;  1FGR A;  1K9M 4;  4BTX A;  5AYR B;  3RGR A;  2CG1 A;  4G1M B;  3WDG B;  4EBG A;  4FMC A;  4WHA A;  2F99 A;  2WOF A;  1W6C A;  3X41 A;  1ISK A;  3V92 A;  3F7S A;  2Z76 A;  1TFO A;  1IK3 A;  4EC6 A;  2W6J H;  1IVX A;  2IA7 A;  2XF3 A;  1O7N B;  1TUH A;  1L5G B;  3MG3 A;  3CCJ 3;  3NQZ A;  1SII A;  2F86 B;  1GD4 A;  4I4K A;  3OWS A;  3VGN A;  1DMN A;  3Q90 A;  1NB3 I;  4N6U A;  5AEU B;  1JB2 A;  4HM4 B;  2HMN B;  4JRF A;  3FKA A;  1RKY A;  1VQM 3;  2CG0 A;  2CFG A;  2Q07 A;  1E3R A;  3MG1 A;  4EV2 A;  4R80 A;  3H3H A;  4HBR A;  2Z6B A;  2XSO B;  2P05 A;  1SPU A;  1U8C B;  3CCL 3;  3TDG A;  5BVB A;  3CCR 3;  3N54 B;  1J2B A;  1PU4 A;  1IVV A;  5STD A;  4BTW A;  4HM1 B;  1NB5 I;  1SQW A;  3T0U A;  1US1 A;  2R4I A;  2D1W A;  2CC3 A;  3OW2 2;  1W6Y A;  2LQV A;  1Q40 B;  5CF2 A;  3CC4 3;  5AEW B;  4MMX B;  3CPW 2;  1M90 4;  3MG2 A;  3CC2 3;  1O7G B;  5IEO A;  3UL5 A;  1A2V A;  4MMY B;  1AVK A;  1GY6 A;  1OCV A;  2BO9 B;  4XDV A;  5IEN A;  1ROA A;  2FGT A;  1IQX A;  1K41 A;  1IU7 A;  4XBY A;  3RDE A;  4FMD A;  2Y74 A;  2K54 A;  5D81 A;  3CD6 3;  3GRD A;  5DRV A;  3VF1 A;  3WMD A;  2CW9 A;  2IMJ A;  2KCD A;  3Q2P A;  3NBR A;  1FGM A;  1JB4 A;  1YJN 3;  3AMO A;  1F8N A;  2XR8 B;  5IG4 A;  5AII A;  2OTJ 3;  4MEI A;  4N6N B;  3WOF B;  1JJ2 2;  1QMA A;  4Q53 A;  1E97 A;  3EC9 A;  6STD A;  2GEX A;  1CEW I;  1VQ7 3;  1JV2 B;  4NHF A;  3KFQ C;  2IUK A;  1W01 A;  3V99 A;  3F7X A;  3U97 A;  1NJI 4;  3JUN A;  3CCV 3;  1W4N A;  1OAC A;  4H61 A;  3B7C A;  1LNH A;  2HML B;  5IG3 A;  2MC8 A;  3CNX A;  3EBT A;  5FGO A;  4KFD A;  3JUP A;  5AIF A;  3MKI A;  1N9J A;  1NWW A;  5EEO A;  3PYJ A;  4LZI A;  2GEY A;  4RNZ A;  3A76 A;  5I97 A;  1YHQ 3;  2ML5 A;  2P0M A;  5AYS C;  1LXE A;  2P38 A;  3CNM A;  3IPT A;  3LML A;  4H3U A;  1ASK A;  1LOX A;  3T8N A;  3CXC 2;  2W0Q A;  4HZB B;  1ROV A;  1K28 A;  2CK3 H;  4R9L A;  2OQE A;  1WTH A;  3JVC A;  4QWT A;  1JKG B;  3GZX B;  1QVG 2;  2HMO B;  2W56 B;  1YI2 3;  4N6L A;  2BT3 A;  2E2V A;  2W9Q A;  1JNQ A;  2P0X A;  3G71 3;  3FF0 A;  1VQP 3;  3D3L A;  4J8T A;  3CU3 A;  1Q42 A;  1AV4 A;  3DY5 A;  2CFD A;  1QAF A;  1JKG A;  4HM6 B;  2PNC A;  2W56 A;  2OCT A;  3FGY A;  3UJM A;  3EN8 A;  4OUQ A;  5BXQ A;  2RFR A;  2CIU A;  4HM7 B;  1D6Y A;  3CCQ 3;  1FGQ A;  1N5H A;  3OXA A;  4O3V A;  2W9P A;  3DMC A;  1G96 A;  5TGN A;  1M1X B;  2GBX B;  3EHC A;  5LC7 A;  1K8A 4;  4BTY A;  4HM2 B;  3SOA A;  2HMK B;  3MYT A;  2XGN A;  4IPB A;  5IW9 A;  1GY7 A;  1ZX2 A;  3PGB A;  3KE7 A;  3HI7 A;  1VQ9 3;  5KP1 A;  1IVU A;  3X3Z A;  4WFO A;  3ROB A;  4OK0 A;  3WOE B;  2IUJ A;  1KWI A;  1QVF 2;  2Z7A A;  4HYZ A;  2ZDJ A;  3GAX A;  3S29 A;  1UUV B;  2XEP A;  1EA2 A;  1HU9 A;  2OOV A;  1O7W B;  5KP4 A;  4RBN A;  3E99 A;  3UB1 A;  3FG3 A;  1GY5 A;  4R1K A;  1W00 A;  5CF1 A;  3X3X A;  1IVW A;  3K9M C;  5IER A;  3GZY B;  3NUV A;  1Q82 4;  2P09 A;  1RN7 A;  3SXX A;  4STD A;  3LOY A;  4U13 A;  2QGU A;  1AVL A;  3KZT A;  2YX9 A;  3I55 3;  2D42 A;  4WP5 A;  3S5C A;  4KZ1 A;  3LZA A;  1ULI B;  4O02 B;  4O2H A;  1IQY A;  2CWV A;  3OV4 A;  1M1K 4;  1KQS 2;  4GB5 A;  3B4O A;  3NXJ A;  3OWU A;  5D83 A;  3AMO B;  1QJG A;  3F40 A;  3F8X A;  1TU5 A;  1YGE A;  2O3O A;  2PZV A;  2WGO A;  1AR0 A;  4R9K A;  1DVD A;  3SED A;  4HM5 B;  1R4C A;  2GU3 A;  3N8B A;  1IV7 A;  3HZP A;  3NBJ A;  1PFP A;  3S67 A;  4TX4 A;  4WYK B;  1BUQ A;  3PZW A;  2STD A;  3DM8 A;  5DRE A;  1W02 A;  2CKF B;  1RRH A;  2JQ5 A;  2CWU A;  3UNL A;  2CFW A;  4PEJ A;  1OHS A;  3EBY A;  1A2K A;  3EQQ B;  4XB5 A;  3J7Y d;  1VQ4 3;  3BNC A;  3G6E 3;  2CH9 A;  4HM0 B;  5IG0 A;  4WYK A;  1V74 A;  1DMM A;  3F8H A;  1IV9 A;  2KRT A;  2QEX 3;  3PS8 A;  1N9E A;  1D6Z A;  2HMJ B;  3K5T A;  4J9A A;  2FNQ A;  4MMZ B;  3X40 A;  1NO3 A;  3EB8 A;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...