3DXRA

Crystal structure of the yeast inter-membrane space chaperone assembly tim9.10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
b'FQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM9
publication title Structural and functional requirements for activity of the Tim9-Tim10 complex in mitochondrial protein import
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 26
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3dxrA00
2BSKA 3CJHA 3DXRB 2BSKB 3DXRA 3CJHB
chains in the Genus database with same CATH superfamily
2K9PA 2FMLA 4YY3B 4RAIA 4UCOA 3KCXA 3AG3B 5F2VO 2P06A 5CB4A 1US6A 4U3JA 4DR4O 4DV6B 3AK1A 4MTFA 1GAXA 2UXXA 2VRZA 2W6JG 4AHCA 4GLXA 4X65O 4PHZA 2BTQA 5LOVB 2EZPA 1YSCA 5LMNO 4FPPA 3OFNG 3TXQA 3ABTA 2IBZH 1HDJA 5KAFZ 1VEWA 1K34A 5IYZB 4U7NA 1IXMA 3BVOA 3CC4V 3BHPA 3ETQA 5EK0A 4DXWA 4B3MO 4LWSB 2Q68A 4IYIA 1OCCB 5CN0A 4FLTA 1V54C 4JF3A 1A32A 1YVWA 4B7EA 5JH7B 2ZXWB 1GN4A 1Q3EA 2PYLA 4MVUA 2L35A 4UCTA 1XREA 4B08A 4DV0B 4FLUA 5BR8O 3CPWU 2JGUA 4XBFA 2PI4A 2LGWA 4HNAB 2W6IG 1KECA 1RPOA 1H2NA 1E79G 2AGAA 4H44B 4FLZA 3ZHQA 2VQEO 1TUBA 3RYIB 1H8HG 4QE7A 2ZE5A 1S5HC 4JI6B 4JV5O 3L72H 2LJ2A 1SQVH 1FKAO 1F4MA 2DYSC 3ZRWA 2BOCC 2IW5A 4B3SB 1IBMO 3JCZA 1WJZA 3SYCA 4BWAA 1HP8A 4ZHQA 2ZNIA 4DR7O 2Q9LA 3L74H 1LNQA 3O65A 4MVSA 1AI5A 2JIZG 3K5OA 2Q6AA 2XNDG 2WLLB 1UFIA 2AZ2A 3IC7A 4P2ZA 2OTJV 3OM3B 2B5UA 1KU9A 1D2DA 3T4DA 1U96A 2B1IA 3R66A 2LW7A 1SRYA 3CMAV 1XMOB 1GN6A 4O4LA 1XMQB 4MVRA 1BCCH 4NXMB 2A06H 3FX7A 1R6TA 3D36C 4X1KB 2F66C 2YEVA 2WLIB 2GTAA 1YJ9V 1KUQA 1R3KC 2H3OA 2OCHA 4BW5A 3SGIA 3ZMSA 4JI4O 4X64O 3H9VA 4MSWC 2Y69B 3SPJA 2QJ1A 3CCUV 1KBHA 4TQFA 5GONB 3P32A 2JEUA 3JAKB 3P3NA 5IWAO 1OCRC 2D3OW 3RGBA 3ML0A 2F4VO 3SDLA 1N0NA 2HHHB 4YJ3B 3SJQC 1DF5A 1P49A 3R65A 3CCRV 4X20A 1G6UA 1QHTA 1DK1A 2KB1A 3UQ8A 3ZRVA 2KQXA 2ZM6B 4X65B 3ABLC 1WAZA 5KHIA 4B3RB 5EIBD 1R1BA 2ARHA 4Z1VA 1Q82W 1Y4MA 4GT1A 3GB7C 4XDJA 3RYFA 3L9DA 3S3XA 3OR7C 2KSDA 3DXRB 2PI5A 4LF6O 3SYPA 4FFBB 4DR1B 2BSKA 2HVKC 1R3JC 2HG5C 5EZYB 2QWPB 1Q43A 2ZDIC 3RW0A 2EIJB 4KP4A 1VP7A 3HKDA 1I0HA 3IJ4A 4EEQA 4DV7O 4ABMA 2DE0X 1PL0A 2VQEB 5JJNB 1SKVA 2EJRA 5EIBC 4WFAV 3AG2C 4HYOA 5J2TA 1M4UA 4UUJC 1MG1A 4JI0B 2M6YA 1VF5B 2Q7HA 4YIPA 1IBMB 5K1XA 4H33A 4OX9B 1J95A 5EBLC 2OWOA 2NR5A 3CCJV 4DR7B 2JRIA 1QU7A 1V55B 5LBQA 4TT3G 1KP3A 2QA4V 4JI1O 3AG4B 4ZIBA 4L8JA 3WB1A 2QEXV 2A3QA 1XEQA 3KCYA 4O4IA 3ZS8C 3HKCA 4DV2O 3NR7A 3J7AU 5L3GA 4CH3A 2AHYA 3OEEG 2V4DA 5LXTA 1THZA 1FJGB 3C3SA 2CAZC 2Q69A 5LA6A 4NR1A 1AR4A 3ASNC 4CC6A 1OV9A 2H94A 1J5EO 4H37A 1N33B 2JDIG 1N32B 2YI9A 3AG3C 4DUYO 2XUMA 2CTPA 1XHXA 5LGTA 3ASOB 1BSMA 3G67A 4GX5A 4DV3O 1TVKA 4DUZO 1G8MA 5IE9A 5EC2C 1BE3H 2WLNA 3IFXA 3IAYA 3JASB 4K8XA 1HNXO 1K8AW 4UCSA 5CBFA 5C8YB 1OCZB 2XAFA 1GN2A 3FB7C 2ITDC 3ZX6A 5ITZB 2C2AA 3CXHF 5LHHA 2P5OA 5IWAB 5CA0B 3A0RA 4YHHO 2OIGA 4UFZA 2HP8A 3B2EE 3GVMA 4LCUC 3OGIB 1OCCC 5H6RA 4G28B 4IIJB 4DR6O 2ZXWC 4O2BB 4U3FH 1IZ3A 3WB2A 4TOIA 3RYCB 1RFYA 4UV9A 3H1JH 2Q7GA 4LNUB 2YXLA 1T5EA 5JJEB 5CA1A 1IDSA 4P9PA 3FB5C 3WG7B 1FPOA 2EX3A 2WAMA 3HKBA 3JD3A 1JA8A 5CA3A 4NYKA 1D5NA 1VQNV 3CX5F 1V9PA 3L70H 3C3TA 2HVJC 1NTMH 1KP2A 4ZKIA 4DV1O 3OTOB 1B6QA 3CRQA 2QTSA 1XUQA 3E22A 1S5JA 1KQSU 1SQBH 4DV0O 3N2GA 2X6AA 4UCRA 4I50A 2PY5A 4YY3O 2Q4PA 2Y4TA 5KLVH 4JI5B 2HLDG 4DV6O 3UT5A 1MOFA 3APOA 1WPBA 3AK3A 3Q4HA 2GUZB 2ZT9B 5L3BA 4TV8A 3JAWA 2JS5A 4PA6A 2AHZA 4JAUA 3HKEA 1ZAUA 5KUMA 2EULA 3CMEV 2P90A 5IJ9B 1X59A 1R3LC 2UXBO 1WA8B 5D5PA 5KAIZ 2CE4A 4JI1B 3G80A 1O9HA 3KZIZ 4UVAA 3CCQV 4ZI7A 1YXBA 3BEHA 2AW9A 4EB6B 4JYAB 4J7ZA 1JFFA 3NXSA 3X2QB 4ZOLA 2PF4E 1AVMA 1GK9A 1MSWD 3CCMV 1M5IA 3TJTA 2Y69C 3A2FA 4N21A 3H1HH 4EFEA 2RCVA 4X88A 3ICXA 4OPAA 4JPRA 2KG7A 4W4KA 2OT5A 2WPDG 3E89A 4JZ2A 1S72V 4X1IB 4LF8B 1KB9F 4FFKA 2HJFC 1K4CC 5CBHA 4DUYB 1M56B 1VF6C 5A9GA 1Q8IA 4B3SO 3JALB 3K06A 1PM9A 2JK5C 3UO2A 1HNXB 1QBZA 4LC1A 4AQYB 3D36A 4GCZA 4QJFB 4RO2A 1FYJA 2ZE6A 3EFFK 4YHHB 4U3JB 4LF7B 2OIEA 1Z5WA 1S76D 5LYJA 5KHGA 2FYUH 4ZBMA 4CS2A 1YDXA 4DR6B 1P84F 4MVMA 2CK3G 2R9RB 3RFRA 2K1EA 2GV9A 2A7WA 1XOUA 1JR9A 2DOSA 3RT3C 4LF9O 2R9IA 2YIBD 2Y48A 2EIJC 1XMQO 1IX9A 1MMMA 3CS5A 4NXMO 4BIOA 1BHBA 3LSSA 3OE7G 2IJJA 2RMKB 5LP6B 1VQ8V 5KA5A 4A5UB 2CH7A 5B1NA 4FZ0A 3G6BA 4WCEV 5B1OA 2IH3C 2QWNB 4RQEA 2DYRB 4I55A 4MTOA 3E8GA 3APQA 4DRXA 1WP8A 5KHHA 1N34B 1V55C 4U7OA 3K04A 1K5SA 2Q5ZA 1P7GA 3OMAB 3L73H 1SZXA 1GKFA 3AG4C 2IJHA 3JARA 2HHHO 1SS3A 2JS3A 3CWBH 1GM9A 2WLMA 1XL4A 2DN9A 4I9WA 3ZRWB 1SERA 2ZM6O 4PDLA 4X1YA 1SQFA 5FNVA 4PA7A 3VQYA 2UXNA 3CB2A 1JPXA 5EYPA 2XHBA 1HR0O 4B3RO 3VQWA 1MZFA 3AEIA 1R73A 2ODMA 3ZRSA 4MVOA 3ZN0A 4X9QA 2UXBB 4JI7O 3CC7V 1S5LZ 4DV4O 5L3FA 1NVPB 3ASOC 5JVDB 2V1DA 4TUYA 1SQGA 4X89A 1VQ6V 4DR1O 2XAHA 1B3QA 2BE3A 2X7RB 2UXDB 2GHYA 3RWRD 4I5SA 4CH6A 3UM7A 1TAEA 2CUGA 1OCZC 3RN4A 1Q86W 4UB8Z 1B04A 1K97A 3S3WA 1NI8A 4O4LB 1ZTEA 3BPZA 2YICA 4WFGA 4FZ1A 3LDCA 4PELA 1NTZH 1VARA 3JD1A 2YEVB 4P9OA 1JMKC 2L6LA 3FAVB 5IT9N 3ZMUA 2W0XA 3LDDA 4JI0O 3B8MA 3RBZA 3MAQA 4DR5B 4QE9A 1KKCA 1AP6A 4OX9O 1LUWA 4BIUA 4BAYA 2DJVA 2ZQMA 1PNKA 4JYCA 2ATKC 5KUKA 3OMIB 2ZR3A 2UUBO 2DW4A 3HR0A 3ZEDA 4I9QA 5D5QA 4EFBA 1JX9A 3WG7C 2ILMA 1NT2B 2N74A 2Y4UA 2IM9A 5LOVA 3ZIAG 3CJHB 3SJCC 4KHPB 1EN4A 1K4DC 3CRRA 1AILA 4L87A 1FJGO 2QWOB 1EBOA 2N05A 5IYZA 2JGDB 4LF9B 1GO3F 1RPRA 4LWSA 3ZHVA 1N33O 1H2KA 1NQTA 5DM6V 2WLKA 1N32O 5JH7A 4JGSA 2ITCC 5KHKA 5KA6A 3B77A 1VMGA 5CMUA 3M8AA 3N2KB 2BTOA 1WNSA 2QKCA 4DV5B 4DR2O 3CRCA 1Q6HA 1Q6UA 1WN7A 4PA4A 3SJAC 3CHXA 1GTOA 1ORQC 5L3CA 2LQTA 2AXTZ 4E2LA 3QNEA 4DW0A 3U0ZA 2DQ0A 3TGUH 1XHZA 4AI8A 3RYIA 2B9ZA 4NTXA 5BMVA 4E4EA 4O4JB 4I4TA 5EC1C 3J81N 3JD4A 4FM2A 5J2TB 4LFBB 1YI2V 3AG1B 2UUCO 5L3EA 3ABMB 2Z0AA 3X2QC 4UVBA 2ADQB 4NTYA 1COWG 3EVKA 2WA4A 4JI3B 2HR3A 1HR0B 3E2EA 2EIMB 1KYOF 1XNRB 4YJ2B 2ZINA 3CE2A 4JI7B 2YIDA 4DV4B 4O4IB 3HKCB 1M56C 4EKWA 1ZLZA 4MVQA 1VIBA 2AZ0A 1BGYH 3GWKC 2Y0IA 4H0LB 2XASA 4BR6A 4J9ZB 3W7SA 5LMUB 3OTOO 2ZIMA 2IJKA 4NXNB 1YCIA 1Y6XA 5H5NA 3E8FA 4X1KA 1G1XB 2QGNA 4GKKB 1W59A 5CBGA 4WBNB 1XNQB 2WLIA 4JI5O 1M9NA 1ZUQA 2EBOA 3LUTB 2IJIA 2QM8A 5E79Z 4LFAO 1JCHA 2D2CB 4FLYA 3G6EV 5FPRA 1P7BA 2YI8A 3E8HA 3L75H 3F5WC 1SZTA 4IT5A 3DC5A 5GONA 5H6QA 1QVGU 3JAKA 3ETDA 4HZ3A 5FPOA 4K0KB 3OGCC 3UO3A 1K3EA 1VF6A 3BCCH 1D5AA 4YJ3A 1AI4A 3W7UA 4RUFA 2UUBB 5LP6C 3JYCA 3C90A 3T1CA 3K0DA 3MDSA 5JCOC 4NVPA 4JYAO 3F7VC 1NH2B 3OD4A 3I56V 3UCSC 3JSLA 4QPJA 1YJNV 1YITV 1XQ8A 4JTDB 1Y66A 2DYRC 3FB6C 3ETGA 2P4VA 3A0BZ 3BA8A 1S0VA 3HB3B 4JAVA 5DECA 2EINB 4JI2B 1NVPD 5KX5B 1FXVA 1M90W 2R9AA 1R6NA 4O4HA 4LF8O 3DXRA 4RUEA 2PGGA 1WP7A 1FFXB 3BRCA 2FL4A 3SYOA 2GBOA 2E74B 5EZYA 1BZKA 1I08A 1YF2A 4PI0A 4DR2B 2PYJA 1FS0G 4KFMA 1VQ7V 4GX1A 4FIPC 1E1QG 4AQYO 3LSUA 3E22B 4PI2A 1PP9H 4LF5B 4GKJO 4J7KA 4HBNA 4TV9B 2G38A 3OTFA 1BT8A 5B1AB 4DR3B 2RDCA 5JQGB 2YUAA 4I7ZB 4LF7O 4GX2A 2JVDA 3FYEB 4O2AB 4BIZA 3UT5B 3D8CA 1NU1H 5IJ0A 3Q4HB 3D3IA 4WF9V 2UUCB 1BHAA 4TSFG 1ZL8B 3JAWB 2IH1C 2F43G 2Q67A 1FXKB 4Q20A 2NN4A 2CDYA 1F7YA 2MW2B 1Q81W 5IYDO 1HNWB 1NR1A 1NZ6A 2BCCH 1VQMV 3DGEA 2E75B 2YS8A 4ZI7B 1YIJV 3MHSC 4MW3A 4F4LA 1Z5VA 1L1FA 1HNZB 1JFFB 1URFA 3H1KH 1O9GA 5H9CA 4XDKA 3O9OA 2ZD9A 2ZNJA 4LBEC 1N34O 1OCOB 1CXZB 4PA3A 3JATA 4OGQB 2LGQA 3FD9A 1F23A 2QKAA 1L8DA 5JJJB 3B09A 4LFAB 3JASA 3IGAC 3LDEA 3JD0A 4PV1B 4QPKA 1Y76A 5B3SB 5FLXN 2QR4A 1RSOA 1FD9A 4R7CA 2E5LB 4PDVA 4YIOA 1R6KA 4I0XA 4Z2WA 1N8RW 2EIKB 5CA0A 4D7SA 2UU9B 1PNMA 1I7FA 5LGUA 1VQKV 3THOA 1MZEA 4IIJA 3RYHB 5K1PA 3K5NA 3QO8A 4O2BA 3KG2A 5LYJB 5IY5B 1S77D 1SA0B 2DWEC 3TXSA 2B1GA 1EN6A 4LNUA 2EZOA 4CBCA 2UXDO 1GN3A 1OZ0A 1Y74B 1Y67A 2ZCEA 5HFLA 1GH6A 4PDMA 2KKWA 1GRJA 1EN5A 1GM8A 5BXZA 2RN9A 3QO5A 3RVZA 4F6RB 2WWWA 4J80A 4JZGA 4QGPA 1P4RA 1VQOV 4DR5O 3T4ZA 3AG1C 2OCCB 1WB8A 3ABMC 4I55B 2JEXA 1M57B 4JTCB 4DRXB 3LNNA 4MT8A 4B3TB 1AJNA 3CCVV 1XILA 2UUAO 3CRAA 1PD3A 4GKJB 3MHHC 1L0LH 1F4NA 2EIMC 3WFVA 3OW2U 4IHJA 2GUZA 1Q5OA 5CB4B 4DK0A 4W4LA 1OJHA 2ZR2A 1DF4A 4KHPO 1Q6IA 1W0KG 1TUEB 1JQ0A 2ZKOA 2F95B 5IJ9A 2N04A 3ZCCA 3QVNA 2BTQB 5EBWC 1EM1A 1Q90D 1BS3A 3SPGA 5EYPB 4J9YB 3SYQA 2GSMB 1PKXA 2QDOA 3K59A 4EB6A 2QE7G 1YJWV 1JJOA 1WPXA 1NH2D 1UPGA 4PDRA 4R50A 4DV5O 4LFCB 2EILB 4TUYB 1GM7A 3FFQA 2CTWA 3WB0A 2LFRA 5J2UA 3VQVA 1I94B 4X62O 4K35A 3WU2Z 2XAQA 1N36B 2UXCB 3H1IH 1R3IC 4DW1A 1B06A 1TUBB 3JALA 2VWJA 1MABG 3SR2C 3ZMZA 1YHQV 4LFBO 5GTIZ 1JJ2U 5B1BB 1NS1A 1H2LA 2ZDIA 1AI7A 4GYCB 1GMGA 4UV8A 4UCVA 3JCUZ 3P3PA 4MVZA 4CS3A 1SETA 3TCUA 4MTXA 1QR9A 4JI3O 4ZHQB 3AG7A 3GWOA 3OUFA 3H1LH 5A2QN 3A0HZ 1NR7A 1CPYA 2EINC 1XNRO 3STLC 4Z1MG 5LHIA 1QR8A 1NTKH 2QKSA 2CGNA 3LSQA 5LHGA 2A9HA 1NKDA 1AP5A 1DLBA 5LMUO 1AI6A 1M93A 4G2KA 4NXNO 5J9PC 5LGNA 5LP6A 4GKKO 1XNQO 1YTFB 1NBMG 3U11A 5JCOA 4J10A 5C93A 3CSXA 5B1AC 4PD4F 4IL6Z 1G4YB 1QLEB 1AROP 4K8ZA 3CXCU 5KMGA 1AR1B 5KHJA 2Z5UA 4JI8B 4QIWF 1AJPA 3RVYA 2XOKG 3E86A 1FXKC 4K0KO 2HJDA 4OXSA 2VQFO 1QCEA 1XL6A 1DGSA 2UUAB 5BMVB 4IYHA 4I4TB 3QF7A 1RM1B 2WSSG 2F1MA 2LFSA 4UVCA 1VQ9V 1SQXH 3DTUB 3CC2V 2HFEC 1IURA 2P7TC 4X20B 1YEWA 2WLJA 4X66O 2BOBC 4FJCC 4C7UA 4FLXA 1K73W 1EFRG 3SPIA 4JI2O 1HW7A 1OCOC 2YSUB 5JVDA 3T1HB 1ENVA 4H13B 4LP8A 2PTMA 3G71V 4CH4A 4XDLA 2EJ7A 1PNLA 2CTRA 1EZVH 4LF4O 3RYFB 4HNAA 4FLWA 1WLEA 4RWUA 5B3SC 3F5TA 3OMNB 3W7TA 2IU3A 2BSKB 3ZJZA 2Y0PA 4LF5O 2F93B 2EIKC 4X62B 3B40A 3SPCA 4GUNA 3HKDB 3ABKB 1RP3B 3CEIA 1H8EG 3FAVA 3W7XA 4DR3O 2E3CA 3VOUA 2WA3A 1H38A 1FXHA 3ZHRA 1E1RG 1TGOA 4KL1A 3K03A 2GTSA 2Q0AA 5IY5C 1JOYA 1IBLB 1AR5A 3CCSV 4J42A 3J80N 2QM7A 4NB5A 3JSNA 2M7WA 3N27A 1YZBA 2CTQA 1SF9A 5FL7G 5LL6Y 2HEPA 1HNWO 2WLLA 2A0LA 4DR4B 4D6TH 4DO2A 4B7KA 1N0JA 3CJHA 1XDCA 3T1YO 4QNHB 1VF7A 3HPLC 2OYQA 1IBKO 3ETEA 2QWRB 2JJ1G 3LNMB 1HNZO 2YIAA 5LMNB 1S3JA 2OCCC 2JGDA 3K0GA 5LXTB 4N23A 2LW1A 3K58A 4NTWA 5JWPA 1M57C 1FFTB 5LA6B 4GZRB 4LH7A 3W7WA 3QTCA 2ZIOA 3N2KA 4WFBV 4PJ0Z 2GDSA 4B3MB 3ZHUA 3TETA 3KKYA 4IGGA 2O57A 4O4HB 3M99B 3T2MA 3JAMN 3STZC 1X4TA 5AG2A 3MD0A 4R6ZA 3CP1A 2YXHA 1TVKB 5BR8B 2FB5A 3OEHG 2E5LO 3QO7A 4G27B 1FAFA 2JJ2G 4O4JA 3K5LA 2UU9O 1QQCA 3K08A 3SPHA 5EBMC 1WB7A 1SQPH 4JV5B 2VQFB 2P67A 5L3DA 4FM0A 1EZJA 1L0NH 4JASA 1Z2GA 4JYYA 2NLJC 4JYBA 1LR1A 1UJWB 1QLNA 2EILC 5IJ0B 2Q0OC 4MS2A 2LP7A 4X66B 3B4SA 4DK1A 3E35A 1W0JG 3QG5A 2X6BA 4YJ2A 4FM1A 1H2GA 4ASUG 5CA1B 3D3QA 2RJZA 3E8BA 3K5MA 1VQ5V 3CCLV 4CZZA 1I5YA 4FFBA 3HKBB 3TK1A 1Q7YW 1MA1A 4LF4B 4WFEA 3ZRXA 1AJQA 1HWYA 5B1BC 2ADPA 4FVMA 4WBNA 1YTFD 4LR3A 4OPHA 3OAAG 4B3TO 3PN1A 5B66Z 4R8CA 3N2GB 4I50B 3AK2A 1V54B 1ROPA 3JATB 2X0LA 1DTOA 3BY6A 4J11A 3ABUA 1LUVA 3CYOA 1BMFG 2ETNA 4NKGB 1PL4A 1IVSA 2QWQB 5IYBO 1H2SB 2YC0A 4FMTA 1BQ0A 4JI4B 1Y76B 2QSAA 4X64B 4PA9A 1RSOB 1KKDA 4TV8B 3BABA 5E1AC 5GTHZ 4I0XB 1CEZA 5BY1A 3HKEB 1QNMA 2YIBA 3ZN1A 4P30A 3P30A 3G4SV 2F4VB 3K9AA 5TISZ 2HKOA 2Q73A 2DYSB 3SJBC 1F51A 3T1YB 3EHBB 4X8AA 1QLEC 4F6EA 4LFCO 3ZHSA 1KD1W 4CC5A 1CP9A 2NNUA 4AILC 1IBKB 1ZX3A 1XI1A 3A8TA 2XT9A 2Z3YA 2PUSA 1M1KW 1SQQH 4DYLA 1PPJH 1N4CA 4K3AA 1ZSPA 4ZOLB 5KX5A 3ZMVA 2RQ6A 4LH6A 1I94O 1N36O 3L71H 3DC6A 2UXCO 1H2MA 1FFXA 3VQXA 1BL8A 2QTOA 5HFMA 1IXBA 2KG7B 1RM1C 2LO1A 4BW9A 3M7MX 4LF6B 1OHHG 4GX0A 4WFFA 2ZE8A 1VQLV 5C8YA 2VS0A 3CD6V 1KC8W 4TV9A 5ITZA 4DV7B 3FYIB 4RQFA 5B5EZ 5DN6G 3SYAA 3B8NA 5JQGA 2XAJA 4JTAB 4O2AA 5H2FZ 2FTKA 1NJIW 3K57A 3DSQA 3FKSG 2MK3A 4IHJB 2R70A 3OUSA 1SESA 2FKXA 1ZL8A 3RYCA 3UKMA 1VQ4V 1FXKA 1ZWIC 4UCUA 2P4KA 2R72A 2VWKA 1W2BU 4MTGA 2PZSA 4UXNA 4HAMA 3E83A 1BQZA 2DMXA 3K3WA 1OCRB 1QVFU 4JAAA 1U97A 1MSDA 3ABKC 4FLVA 2A79B 5IYCO 2DWDC 2H8PC 4DV2B 3CCEV 1MNGA 3ABLB 2CH7B 4JI8O 4D7TA 4KUMA 2E76B 4UB6Z 4MW8A 2QM4A 1TA8A 3ZBHA 2F23A 5J2UB 1J5EB 3BA9A 4JI6O 1K92A 3BAAA 3K9SA 3H01A 4TWKA 4DV3B 4DUZB 4CS4A 3IC9A 2XTAA 2OTLV 3JARB 3BFRA 3FB8C 1I5XA 2YXYA 3F7YC 1JVMA 2X6CA 5DEDA 4Q6GA 1PV0A 3U10A 2Q8VA 4X1YB 5FNVB 2P6JA 2WLHA 1WA8A 3RYHA 2P22C 1KMIZ 2IU0A 3T1HO 3AG2B 3I55V 1AB3A 2ZE7A 1SA0A 5GW7A 4CH5A 2RNBA 1K5QA 1K9MW 3OR6C 1Y74A 4YXWG 1XMOO 2DQ3A 4WFHA 4FK5C 4J41A 3ZHTA 3ZMTA 4KXRA 2CGOA 1SC5B 2Q7EA 3VBBA 4F6RA 5BZBA 4TQDA 4X1IA 3CRMA 2YDEA 2W0FC 3OT7A 3I5DA 2XAGA 3JD2A 1XBLA 1K33A 2V7QG 3PJSK 1IBLO 5KMGB 4J7JA 4DV1B 3K79A 5IDJA 3ASNB 4ICGA 1VQPV 3EXAA 1K7DA
chains in the Genus database with same CATH topology
2BSKA 3CJHA 3DXRB 2BSKB 3DXRA 3CJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BSK A;  3CJH A;  3DXR B;  2BSK B;  3DXR A;  3CJH B; 
#chains in the Genus database with same CATH topology
 2K9P A;  2FML A;  4YY3 B;  4RAI A;  4UCO A;  3KCX A;  3AG3 B;  5F2V O;  2P06 A;  5CB4 A;  1US6 A;  4U3J A;  4DR4 O;  4DV6 B;  3AK1 A;  4MTF A;  1GAX A;  2UXX A;  2VRZ A;  2W6J G;  4AHC A;  4GLX A;  4X65 O;  4PHZ A;  2BTQ A;  5LOV B;  2EZP A;  1YSC A;  5LMN O;  4FPP A;  3OFN G;  3TXQ A;  3ABT A;  2IBZ H;  1HDJ A;  5KAF Z;  1VEW A;  1K34 A;  5IYZ B;  4U7N A;  1IXM A;  3BVO A;  3CC4 V;  3BHP A;  3ETQ A;  5EK0 A;  4DXW A;  4B3M O;  4LWS B;  2Q68 A;  4IYI A;  1OCC B;  5CN0 A;  4FLT A;  1V54 C;  4JF3 A;  1A32 A;  1YVW A;  4B7E A;  5JH7 B;  2ZXW B;  1GN4 A;  1Q3E A;  2PYL A;  4MVU A;  2L35 A;  4UCT A;  1XRE A;  4B08 A;  4DV0 B;  4FLU A;  5BR8 O;  3CPW U;  2JGU A;  4XBF A;  2PI4 A;  2LGW A;  4HNA B;  2W6I G;  1KEC A;  1RPO A;  1H2N A;  1E79 G;  2AGA A;  4H44 B;  4FLZ A;  3ZHQ A;  2VQE O;  1TUB A;  3RYI B;  1H8H G;  4QE7 A;  2ZE5 A;  1S5H C;  4JI6 B;  4JV5 O;  3L72 H;  2LJ2 A;  1SQV H;  1FKA O;  1F4M A;  2DYS C;  3ZRW A;  2BOC C;  2IW5 A;  4B3S B;  1IBM O;  3JCZ A;  1WJZ A;  3SYC A;  4BWA A;  1HP8 A;  4ZHQ A;  2ZNI A;  4DR7 O;  2Q9L A;  3L74 H;  1LNQ A;  3O65 A;  4MVS A;  1AI5 A;  2JIZ G;  3K5O A;  2Q6A A;  2XND G;  2WLL B;  1UFI A;  2AZ2 A;  3IC7 A;  4P2Z A;  2OTJ V;  3OM3 B;  2B5U A;  1KU9 A;  1D2D A;  3T4D A;  1U96 A;  2B1I A;  3R66 A;  2LW7 A;  1SRY A;  3CMA V;  1XMO B;  1GN6 A;  4O4L A;  1XMQ B;  4MVR A;  1BCC H;  4NXM B;  2A06 H;  3FX7 A;  1R6T A;  3D36 C;  4X1K B;  2F66 C;  2YEV A;  2WLI B;  2GTA A;  1YJ9 V;  1KUQ A;  1R3K C;  2H3O A;  2OCH A;  4BW5 A;  3SGI A;  3ZMS A;  4JI4 O;  4X64 O;  3H9V A;  4MSW C;  2Y69 B;  3SPJ A;  2QJ1 A;  3CCU V;  1KBH A;  4TQF A;  5GON B;  3P32 A;  2JEU A;  3JAK B;  3P3N A;  5IWA O;  1OCR C;  2D3O W;  3RGB A;  3ML0 A;  2F4V O;  3SDL A;  1N0N A;  2HHH B;  4YJ3 B;  3SJQ C;  1DF5 A;  1P49 A;  3R65 A;  3CCR V;  4X20 A;  1G6U A;  1QHT A;  1DK1 A;  2KB1 A;  3UQ8 A;  3ZRV A;  2KQX A;  2ZM6 B;  4X65 B;  3ABL C;  1WAZ A;  5KHI A;  4B3R B;  5EIB D;  1R1B A;  2ARH A;  4Z1V A;  1Q82 W;  1Y4M A;  4GT1 A;  3GB7 C;  4XDJ A;  3RYF A;  3L9D A;  3S3X A;  3OR7 C;  2KSD A;  3DXR B;  2PI5 A;  4LF6 O;  3SYP A;  4FFB B;  4DR1 B;  2BSK A;  2HVK C;  1R3J C;  2HG5 C;  5EZY B;  2QWP B;  1Q43 A;  2ZDI C;  3RW0 A;  2EIJ B;  4KP4 A;  1VP7 A;  3HKD A;  1I0H A;  3IJ4 A;  4EEQ A;  4DV7 O;  4ABM A;  2DE0 X;  1PL0 A;  2VQE B;  5JJN B;  1SKV A;  2EJR A;  5EIB C;  4WFA V;  3AG2 C;  4HYO A;  5J2T A;  1M4U A;  4UUJ C;  1MG1 A;  4JI0 B;  2M6Y A;  1VF5 B;  2Q7H A;  4YIP A;  1IBM B;  5K1X A;  4H33 A;  4OX9 B;  1J95 A;  5EBL C;  2OWO A;  2NR5 A;  3CCJ V;  4DR7 B;  2JRI A;  1QU7 A;  1V55 B;  5LBQ A;  4TT3 G;  1KP3 A;  2QA4 V;  4JI1 O;  3AG4 B;  4ZIB A;  4L8J A;  3WB1 A;  2QEX V;  2A3Q A;  1XEQ A;  3KCY A;  4O4I A;  3ZS8 C;  3HKC A;  4DV2 O;  3NR7 A;  3J7A U;  5L3G A;  4CH3 A;  2AHY A;  3OEE G;  2V4D A;  5LXT A;  1THZ A;  1FJG B;  3C3S A;  2CAZ C;  2Q69 A;  5LA6 A;  4NR1 A;  1AR4 A;  3ASN C;  4CC6 A;  1OV9 A;  2H94 A;  1J5E O;  4H37 A;  1N33 B;  2JDI G;  1N32 B;  2YI9 A;  3AG3 C;  4DUY O;  2XUM A;  2CTP A;  1XHX A;  5LGT A;  3ASO B;  1BSM A;  3G67 A;  4GX5 A;  4DV3 O;  1TVK A;  4DUZ O;  1G8M A;  5IE9 A;  5EC2 C;  1BE3 H;  2WLN A;  3IFX A;  3IAY A;  3JAS B;  4K8X A;  1HNX O;  1K8A W;  4UCS A;  5CBF A;  5C8Y B;  1OCZ B;  2XAF A;  1GN2 A;  3FB7 C;  2ITD C;  3ZX6 A;  5ITZ B;  2C2A A;  3CXH F;  5LHH A;  2P5O A;  5IWA B;  5CA0 B;  3A0R A;  4YHH O;  2OIG A;  4UFZ A;  2HP8 A;  3B2E E;  3GVM A;  4LCU C;  3OGI B;  1OCC C;  5H6R A;  4G28 B;  4IIJ B;  4DR6 O;  2ZXW C;  4O2B B;  4U3F H;  1IZ3 A;  3WB2 A;  4TOI A;  3RYC B;  1RFY A;  4UV9 A;  3H1J H;  2Q7G A;  4LNU B;  2YXL A;  1T5E A;  5JJE B;  5CA1 A;  1IDS A;  4P9P A;  3FB5 C;  3WG7 B;  1FPO A;  2EX3 A;  2WAM A;  3HKB A;  3JD3 A;  1JA8 A;  5CA3 A;  4NYK A;  1D5N A;  1VQN V;  3CX5 F;  1V9P A;  3L70 H;  3C3T A;  2HVJ C;  1NTM H;  1KP2 A;  4ZKI A;  4DV1 O;  3OTO B;  1B6Q A;  3CRQ A;  2QTS A;  1XUQ A;  3E22 A;  1S5J A;  1KQS U;  1SQB H;  4DV0 O;  3N2G A;  2X6A A;  4UCR A;  4I50 A;  2PY5 A;  4YY3 O;  2Q4P A;  2Y4T A;  5KLV H;  4JI5 B;  2HLD G;  4DV6 O;  3UT5 A;  1MOF A;  3APO A;  1WPB A;  3AK3 A;  3Q4H A;  2GUZ B;  2ZT9 B;  5L3B A;  4TV8 A;  3JAW A;  2JS5 A;  4PA6 A;  2AHZ A;  4JAU A;  3HKE A;  1ZAU A;  5KUM A;  2EUL A;  3CME V;  2P90 A;  5IJ9 B;  1X59 A;  1R3L C;  2UXB O;  1WA8 B;  5D5P A;  5KAI Z;  2CE4 A;  4JI1 B;  3G80 A;  1O9H A;  3KZI Z;  4UVA A;  3CCQ V;  4ZI7 A;  1YXB A;  3BEH A;  2AW9 A;  4EB6 B;  4JYA B;  4J7Z A;  1JFF A;  3NXS A;  3X2Q B;  4ZOL A;  2PF4 E;  1AVM A;  1GK9 A;  1MSW D;  3CCM V;  1M5I A;  3TJT A;  2Y69 C;  3A2F A;  4N21 A;  3H1H H;  4EFE A;  2RCV A;  4X88 A;  3ICX A;  4OPA A;  4JPR A;  2KG7 A;  4W4K A;  2OT5 A;  2WPD G;  3E89 A;  4JZ2 A;  1S72 V;  4X1I B;  4LF8 B;  1KB9 F;  4FFK A;  2HJF C;  1K4C C;  5CBH A;  4DUY B;  1M56 B;  1VF6 C;  5A9G A;  1Q8I A;  4B3S O;  3JAL B;  3K06 A;  1PM9 A;  2JK5 C;  3UO2 A;  1HNX B;  1QBZ A;  4LC1 A;  4AQY B;  3D36 A;  4GCZ A;  4QJF B;  4RO2 A;  1FYJ A;  2ZE6 A;  3EFF K;  4YHH B;  4U3J B;  4LF7 B;  2OIE A;  1Z5W A;  1S76 D;  5LYJ A;  5KHG A;  2FYU H;  4ZBM A;  4CS2 A;  1YDX A;  4DR6 B;  1P84 F;  4MVM A;  2CK3 G;  2R9R B;  3RFR A;  2K1E A;  2GV9 A;  2A7W A;  1XOU A;  1JR9 A;  2DOS A;  3RT3 C;  4LF9 O;  2R9I A;  2YIB D;  2Y48 A;  2EIJ C;  1XMQ O;  1IX9 A;  1MMM A;  3CS5 A;  4NXM O;  4BIO A;  1BHB A;  3LSS A;  3OE7 G;  2IJJ A;  2RMK B;  5LP6 B;  1VQ8 V;  5KA5 A;  4A5U B;  2CH7 A;  5B1N A;  4FZ0 A;  3G6B A;  4WCE V;  5B1O A;  2IH3 C;  2QWN B;  4RQE A;  2DYR B;  4I55 A;  4MTO A;  3E8G A;  3APQ A;  4DRX A;  1WP8 A;  5KHH A;  1N34 B;  1V55 C;  4U7O A;  3K04 A;  1K5S A;  2Q5Z A;  1P7G A;  3OMA B;  3L73 H;  1SZX A;  1GKF A;  3AG4 C;  2IJH A;  3JAR A;  2HHH O;  1SS3 A;  2JS3 A;  3CWB H;  1GM9 A;  2WLM A;  1XL4 A;  2DN9 A;  4I9W A;  3ZRW B;  1SER A;  2ZM6 O;  4PDL A;  4X1Y A;  1SQF A;  5FNV A;  4PA7 A;  3VQY A;  2UXN A;  3CB2 A;  1JPX A;  5EYP A;  2XHB A;  1HR0 O;  4B3R O;  3VQW A;  1MZF A;  3AEI A;  1R73 A;  2ODM A;  3ZRS A;  4MVO A;  3ZN0 A;  4X9Q A;  2UXB B;  4JI7 O;  3CC7 V;  1S5L Z;  4DV4 O;  5L3F A;  1NVP B;  3ASO C;  5JVD B;  2V1D A;  4TUY A;  1SQG A;  4X89 A;  1VQ6 V;  4DR1 O;  2XAH A;  1B3Q A;  2BE3 A;  2X7R B;  2UXD B;  2GHY A;  3RWR D;  4I5S A;  4CH6 A;  3UM7 A;  1TAE A;  2CUG A;  1OCZ C;  3RN4 A;  1Q86 W;  4UB8 Z;  1B04 A;  1K97 A;  3S3W A;  1NI8 A;  4O4L B;  1ZTE A;  3BPZ A;  2YIC A;  4WFG A;  4FZ1 A;  3LDC A;  4PEL A;  1NTZ H;  1VAR A;  3JD1 A;  2YEV B;  4P9O A;  1JMK C;  2L6L A;  3FAV B;  5IT9 N;  3ZMU A;  2W0X A;  3LDD A;  4JI0 O;  3B8M A;  3RBZ A;  3MAQ A;  4DR5 B;  4QE9 A;  1KKC A;  1AP6 A;  4OX9 O;  1LUW A;  4BIU A;  4BAY A;  2DJV A;  2ZQM A;  1PNK A;  4JYC A;  2ATK C;  5KUK A;  3OMI B;  2ZR3 A;  2UUB O;  2DW4 A;  3HR0 A;  3ZED A;  4I9Q A;  5D5Q A;  4EFB A;  1JX9 A;  3WG7 C;  2ILM A;  1NT2 B;  2N74 A;  2Y4U A;  2IM9 A;  5LOV A;  3ZIA G;  3CJH B;  3SJC C;  4KHP B;  1EN4 A;  1K4D C;  3CRR A;  1AIL A;  4L87 A;  1FJG O;  2QWO B;  1EBO A;  2N05 A;  5IYZ A;  2JGD B;  4LF9 B;  1GO3 F;  1RPR A;  4LWS A;  3ZHV A;  1N33 O;  1H2K A;  1NQT A;  5DM6 V;  2WLK A;  1N32 O;  5JH7 A;  4JGS A;  2ITC C;  5KHK A;  5KA6 A;  3B77 A;  1VMG A;  5CMU A;  3M8A A;  3N2K B;  2BTO A;  1WNS A;  2QKC A;  4DV5 B;  4DR2 O;  3CRC A;  1Q6H A;  1Q6U A;  1WN7 A;  4PA4 A;  3SJA C;  3CHX A;  1GTO A;  1ORQ C;  5L3C A;  2LQT A;  2AXT Z;  4E2L A;  3QNE A;  4DW0 A;  3U0Z A;  2DQ0 A;  3TGU H;  1XHZ A;  4AI8 A;  3RYI A;  2B9Z A;  4NTX A;  5BMV A;  4E4E A;  4O4J B;  4I4T A;  5EC1 C;  3J81 N;  3JD4 A;  4FM2 A;  5J2T B;  4LFB B;  1YI2 V;  3AG1 B;  2UUC O;  5L3E A;  3ABM B;  2Z0A A;  3X2Q C;  4UVB A;  2ADQ B;  4NTY A;  1COW G;  3EVK A;  2WA4 A;  4JI3 B;  2HR3 A;  1HR0 B;  3E2E A;  2EIM B;  1KYO F;  1XNR B;  4YJ2 B;  2ZIN A;  3CE2 A;  4JI7 B;  2YID A;  4DV4 B;  4O4I B;  3HKC B;  1M56 C;  4EKW A;  1ZLZ A;  4MVQ A;  1VIB A;  2AZ0 A;  1BGY H;  3GWK C;  2Y0I A;  4H0L B;  2XAS A;  4BR6 A;  4J9Z B;  3W7S A;  5LMU B;  3OTO O;  2ZIM A;  2IJK A;  4NXN B;  1YCI A;  1Y6X A;  5H5N A;  3E8F A;  4X1K A;  1G1X B;  2QGN A;  4GKK B;  1W59 A;  5CBG A;  4WBN B;  1XNQ B;  2WLI A;  4JI5 O;  1M9N A;  1ZUQ A;  2EBO A;  3LUT B;  2IJI A;  2QM8 A;  5E79 Z;  4LFA O;  1JCH A;  2D2C B;  4FLY A;  3G6E V;  5FPR A;  1P7B A;  2YI8 A;  3E8H A;  3L75 H;  3F5W C;  1SZT A;  4IT5 A;  3DC5 A;  5GON A;  5H6Q A;  1QVG U;  3JAK A;  3ETD A;  4HZ3 A;  5FPO A;  4K0K B;  3OGC C;  3UO3 A;  1K3E A;  1VF6 A;  3BCC H;  1D5A A;  4YJ3 A;  1AI4 A;  3W7U A;  4RUF A;  2UUB B;  5LP6 C;  3JYC A;  3C90 A;  3T1C A;  3K0D A;  3MDS A;  5JCO C;  4NVP A;  4JYA O;  3F7V C;  1NH2 B;  3OD4 A;  3I56 V;  3UCS C;  3JSL A;  4QPJ A;  1YJN V;  1YIT V;  1XQ8 A;  4JTD B;  1Y66 A;  2DYR C;  3FB6 C;  3ETG A;  2P4V A;  3A0B Z;  3BA8 A;  1S0V A;  3HB3 B;  4JAV A;  5DEC A;  2EIN B;  4JI2 B;  1NVP D;  5KX5 B;  1FXV A;  1M90 W;  2R9A A;  1R6N A;  4O4H A;  4LF8 O;  3DXR A;  4RUE A;  2PGG A;  1WP7 A;  1FFX B;  3BRC A;  2FL4 A;  3SYO A;  2GBO A;  2E74 B;  5EZY A;  1BZK A;  1I08 A;  1YF2 A;  4PI0 A;  4DR2 B;  2PYJ A;  1FS0 G;  4KFM A;  1VQ7 V;  4GX1 A;  4FIP C;  1E1Q G;  4AQY O;  3LSU A;  3E22 B;  4PI2 A;  1PP9 H;  4LF5 B;  4GKJ O;  4J7K A;  4HBN A;  4TV9 B;  2G38 A;  3OTF A;  1BT8 A;  5B1A B;  4DR3 B;  2RDC A;  5JQG B;  2YUA A;  4I7Z B;  4LF7 O;  4GX2 A;  2JVD A;  3FYE B;  4O2A B;  4BIZ A;  3UT5 B;  3D8C A;  1NU1 H;  5IJ0 A;  3Q4H B;  3D3I A;  4WF9 V;  2UUC B;  1BHA A;  4TSF G;  1ZL8 B;  3JAW B;  2IH1 C;  2F43 G;  2Q67 A;  1FXK B;  4Q20 A;  2NN4 A;  2CDY A;  1F7Y A;  2MW2 B;  1Q81 W;  5IYD O;  1HNW B;  1NR1 A;  1NZ6 A;  2BCC H;  1VQM V;  3DGE A;  2E75 B;  2YS8 A;  4ZI7 B;  1YIJ V;  3MHS C;  4MW3 A;  4F4L A;  1Z5V A;  1L1F A;  1HNZ B;  1JFF B;  1URF A;  3H1K H;  1O9G A;  5H9C A;  4XDK A;  3O9O A;  2ZD9 A;  2ZNJ A;  4LBE C;  1N34 O;  1OCO B;  1CXZ B;  4PA3 A;  3JAT A;  4OGQ B;  2LGQ A;  3FD9 A;  1F23 A;  2QKA A;  1L8D A;  5JJJ B;  3B09 A;  4LFA B;  3JAS A;  3IGA C;  3LDE A;  3JD0 A;  4PV1 B;  4QPK A;  1Y76 A;  5B3S B;  5FLX N;  2QR4 A;  1RSO A;  1FD9 A;  4R7C A;  2E5L B;  4PDV A;  4YIO A;  1R6K A;  4I0X A;  4Z2W A;  1N8R W;  2EIK B;  5CA0 A;  4D7S A;  2UU9 B;  1PNM A;  1I7F A;  5LGU A;  1VQK V;  3THO A;  1MZE A;  4IIJ A;  3RYH B;  5K1P A;  3K5N A;  3QO8 A;  4O2B A;  3KG2 A;  5LYJ B;  5IY5 B;  1S77 D;  1SA0 B;  2DWE C;  3TXS A;  2B1G A;  1EN6 A;  4LNU A;  2EZO A;  4CBC A;  2UXD O;  1GN3 A;  1OZ0 A;  1Y74 B;  1Y67 A;  2ZCE A;  5HFL A;  1GH6 A;  4PDM A;  2KKW A;  1GRJ A;  1EN5 A;  1GM8 A;  5BXZ A;  2RN9 A;  3QO5 A;  3RVZ A;  4F6R B;  2WWW A;  4J80 A;  4JZG A;  4QGP A;  1P4R A;  1VQO V;  4DR5 O;  3T4Z A;  3AG1 C;  2OCC B;  1WB8 A;  3ABM C;  4I55 B;  2JEX A;  1M57 B;  4JTC B;  4DRX B;  3LNN A;  4MT8 A;  4B3T B;  1AJN A;  3CCV V;  1XIL A;  2UUA O;  3CRA A;  1PD3 A;  4GKJ B;  3MHH C;  1L0L H;  1F4N A;  2EIM C;  3WFV A;  3OW2 U;  4IHJ A;  2GUZ A;  1Q5O A;  5CB4 B;  4DK0 A;  4W4L A;  1OJH A;  2ZR2 A;  1DF4 A;  4KHP O;  1Q6I A;  1W0K G;  1TUE B;  1JQ0 A;  2ZKO A;  2F95 B;  5IJ9 A;  2N04 A;  3ZCC A;  3QVN A;  2BTQ B;  5EBW C;  1EM1 A;  1Q90 D;  1BS3 A;  3SPG A;  5EYP B;  4J9Y B;  3SYQ A;  2GSM B;  1PKX A;  2QDO A;  3K59 A;  4EB6 A;  2QE7 G;  1YJW V;  1JJO A;  1WPX A;  1NH2 D;  1UPG A;  4PDR A;  4R50 A;  4DV5 O;  4LFC B;  2EIL B;  4TUY B;  1GM7 A;  3FFQ A;  2CTW A;  3WB0 A;  2LFR A;  5J2U A;  3VQV A;  1I94 B;  4X62 O;  4K35 A;  3WU2 Z;  2XAQ A;  1N36 B;  2UXC B;  3H1I H;  1R3I C;  4DW1 A;  1B06 A;  1TUB B;  3JAL A;  2VWJ A;  1MAB G;  3SR2 C;  3ZMZ A;  1YHQ V;  4LFB O;  5GTI Z;  1JJ2 U;  5B1B B;  1NS1 A;  1H2L A;  2ZDI A;  1AI7 A;  4GYC B;  1GMG A;  4UV8 A;  4UCV A;  3JCU Z;  3P3P A;  4MVZ A;  4CS3 A;  1SET A;  3TCU A;  4MTX A;  1QR9 A;  4JI3 O;  4ZHQ B;  3AG7 A;  3GWO A;  3OUF A;  3H1L H;  5A2Q N;  3A0H Z;  1NR7 A;  1CPY A;  2EIN C;  1XNR O;  3STL C;  4Z1M G;  5LHI A;  1QR8 A;  1NTK H;  2QKS A;  2CGN A;  3LSQ A;  5LHG A;  2A9H A;  1NKD A;  1AP5 A;  1DLB A;  5LMU O;  1AI6 A;  1M93 A;  4G2K A;  4NXN O;  5J9P C;  5LGN A;  5LP6 A;  4GKK O;  1XNQ O;  1YTF B;  1NBM G;  3U11 A;  5JCO A;  4J10 A;  5C93 A;  3CSX A;  5B1A C;  4PD4 F;  4IL6 Z;  1G4Y B;  1QLE B;  1ARO P;  4K8Z A;  3CXC U;  5KMG A;  1AR1 B;  5KHJ A;  2Z5U A;  4JI8 B;  4QIW F;  1AJP A;  3RVY A;  2XOK G;  3E86 A;  1FXK C;  4K0K O;  2HJD A;  4OXS A;  2VQF O;  1QCE A;  1XL6 A;  1DGS A;  2UUA B;  5BMV B;  4IYH A;  4I4T B;  3QF7 A;  1RM1 B;  2WSS G;  2F1M A;  2LFS A;  4UVC A;  1VQ9 V;  1SQX H;  3DTU B;  3CC2 V;  2HFE C;  1IUR A;  2P7T C;  4X20 B;  1YEW A;  2WLJ A;  4X66 O;  2BOB C;  4FJC C;  4C7U A;  4FLX A;  1K73 W;  1EFR G;  3SPI A;  4JI2 O;  1HW7 A;  1OCO C;  2YSU B;  5JVD A;  3T1H B;  1ENV A;  4H13 B;  4LP8 A;  2PTM A;  3G71 V;  4CH4 A;  4XDL A;  2EJ7 A;  1PNL A;  2CTR A;  1EZV H;  4LF4 O;  3RYF B;  4HNA A;  4FLW A;  1WLE A;  4RWU A;  5B3S C;  3F5T A;  3OMN B;  3W7T A;  2IU3 A;  2BSK B;  3ZJZ A;  2Y0P A;  4LF5 O;  2F93 B;  2EIK C;  4X62 B;  3B40 A;  3SPC A;  4GUN A;  3HKD B;  3ABK B;  1RP3 B;  3CEI A;  1H8E G;  3FAV A;  3W7X A;  4DR3 O;  2E3C A;  3VOU A;  2WA3 A;  1H38 A;  1FXH A;  3ZHR A;  1E1R G;  1TGO A;  4KL1 A;  3K03 A;  2GTS A;  2Q0A A;  5IY5 C;  1JOY A;  1IBL B;  1AR5 A;  3CCS V;  4J42 A;  3J80 N;  2QM7 A;  4NB5 A;  3JSN A;  2M7W A;  3N27 A;  1YZB A;  2CTQ A;  1SF9 A;  5FL7 G;  5LL6 Y;  2HEP A;  1HNW O;  2WLL A;  2A0L A;  4DR4 B;  4D6T H;  4DO2 A;  4B7K A;  1N0J A;  3CJH A;  1XDC A;  3T1Y O;  4QNH B;  1VF7 A;  3HPL C;  2OYQ A;  1IBK O;  3ETE A;  2QWR B;  2JJ1 G;  3LNM B;  1HNZ O;  2YIA A;  5LMN B;  1S3J A;  2OCC C;  2JGD A;  3K0G A;  5LXT B;  4N23 A;  2LW1 A;  3K58 A;  4NTW A;  5JWP A;  1M57 C;  1FFT B;  5LA6 B;  4GZR B;  4LH7 A;  3W7W A;  3QTC A;  2ZIO A;  3N2K A;  4WFB V;  4PJ0 Z;  2GDS A;  4B3M B;  3ZHU A;  3TET A;  3KKY A;  4IGG A;  2O57 A;  4O4H B;  3M99 B;  3T2M A;  3JAM N;  3STZ C;  1X4T A;  5AG2 A;  3MD0 A;  4R6Z A;  3CP1 A;  2YXH A;  1TVK B;  5BR8 B;  2FB5 A;  3OEH G;  2E5L O;  3QO7 A;  4G27 B;  1FAF A;  2JJ2 G;  4O4J A;  3K5L A;  2UU9 O;  1QQC A;  3K08 A;  3SPH A;  5EBM C;  1WB7 A;  1SQP H;  4JV5 B;  2VQF B;  2P67 A;  5L3D A;  4FM0 A;  1EZJ A;  1L0N H;  4JAS A;  1Z2G A;  4JYY A;  2NLJ C;  4JYB A;  1LR1 A;  1UJW B;  1QLN A;  2EIL C;  5IJ0 B;  2Q0O C;  4MS2 A;  2LP7 A;  4X66 B;  3B4S A;  4DK1 A;  3E35 A;  1W0J G;  3QG5 A;  2X6B A;  4YJ2 A;  4FM1 A;  1H2G A;  4ASU G;  5CA1 B;  3D3Q A;  2RJZ A;  3E8B A;  3K5M A;  1VQ5 V;  3CCL V;  4CZZ A;  1I5Y A;  4FFB A;  3HKB B;  3TK1 A;  1Q7Y W;  1MA1 A;  4LF4 B;  4WFE A;  3ZRX A;  1AJQ A;  1HWY A;  5B1B C;  2ADP A;  4FVM A;  4WBN A;  1YTF D;  4LR3 A;  4OPH A;  3OAA G;  4B3T O;  3PN1 A;  5B66 Z;  4R8C A;  3N2G B;  4I50 B;  3AK2 A;  1V54 B;  1ROP A;  3JAT B;  2X0L A;  1DTO A;  3BY6 A;  4J11 A;  3ABU A;  1LUV A;  3CYO A;  1BMF G;  2ETN A;  4NKG B;  1PL4 A;  1IVS A;  2QWQ B;  5IYB O;  1H2S B;  2YC0 A;  4FMT A;  1BQ0 A;  4JI4 B;  1Y76 B;  2QSA A;  4X64 B;  4PA9 A;  1RSO B;  1KKD A;  4TV8 B;  3BAB A;  5E1A C;  5GTH Z;  4I0X B;  1CEZ A;  5BY1 A;  3HKE B;  1QNM A;  2YIB A;  3ZN1 A;  4P30 A;  3P30 A;  3G4S V;  2F4V B;  3K9A A;  5TIS Z;  2HKO A;  2Q73 A;  2DYS B;  3SJB C;  1F51 A;  3T1Y B;  3EHB B;  4X8A A;  1QLE C;  4F6E A;  4LFC O;  3ZHS A;  1KD1 W;  4CC5 A;  1CP9 A;  2NNU A;  4AIL C;  1IBK B;  1ZX3 A;  1XI1 A;  3A8T A;  2XT9 A;  2Z3Y A;  2PUS A;  1M1K W;  1SQQ H;  4DYL A;  1PPJ H;  1N4C A;  4K3A A;  1ZSP A;  4ZOL B;  5KX5 A;  3ZMV A;  2RQ6 A;  4LH6 A;  1I94 O;  1N36 O;  3L71 H;  3DC6 A;  2UXC O;  1H2M A;  1FFX A;  3VQX A;  1BL8 A;  2QTO A;  5HFM A;  1IXB A;  2KG7 B;  1RM1 C;  2LO1 A;  4BW9 A;  3M7M X;  4LF6 B;  1OHH G;  4GX0 A;  4WFF A;  2ZE8 A;  1VQL V;  5C8Y A;  2VS0 A;  3CD6 V;  1KC8 W;  4TV9 A;  5ITZ A;  4DV7 B;  3FYI B;  4RQF A;  5B5E Z;  5DN6 G;  3SYA A;  3B8N A;  5JQG A;  2XAJ A;  4JTA B;  4O2A A;  5H2F Z;  2FTK A;  1NJI W;  3K57 A;  3DSQ A;  3FKS G;  2MK3 A;  4IHJ B;  2R70 A;  3OUS A;  1SES A;  2FKX A;  1ZL8 A;  3RYC A;  3UKM A;  1VQ4 V;  1FXK A;  1ZWI C;  4UCU A;  2P4K A;  2R72 A;  2VWK A;  1W2B U;  4MTG A;  2PZS A;  4UXN A;  4HAM A;  3E83 A;  1BQZ A;  2DMX A;  3K3W A;  1OCR B;  1QVF U;  4JAA A;  1U97 A;  1MSD A;  3ABK C;  4FLV A;  2A79 B;  5IYC O;  2DWD C;  2H8P C;  4DV2 B;  3CCE V;  1MNG A;  3ABL B;  2CH7 B;  4JI8 O;  4D7T A;  4KUM A;  2E76 B;  4UB6 Z;  4MW8 A;  2QM4 A;  1TA8 A;  3ZBH A;  2F23 A;  5J2U B;  1J5E B;  3BA9 A;  4JI6 O;  1K92 A;  3BAA A;  3K9S A;  3H01 A;  4TWK A;  4DV3 B;  4DUZ B;  4CS4 A;  3IC9 A;  2XTA A;  2OTL V;  3JAR B;  3BFR A;  3FB8 C;  1I5X A;  2YXY A;  3F7Y C;  1JVM A;  2X6C A;  5DED A;  4Q6G A;  1PV0 A;  3U10 A;  2Q8V A;  4X1Y B;  5FNV B;  2P6J A;  2WLH A;  1WA8 A;  3RYH A;  2P22 C;  1KMI Z;  2IU0 A;  3T1H O;  3AG2 B;  3I55 V;  1AB3 A;  2ZE7 A;  1SA0 A;  5GW7 A;  4CH5 A;  2RNB A;  1K5Q A;  1K9M W;  3OR6 C;  1Y74 A;  4YXW G;  1XMO O;  2DQ3 A;  4WFH A;  4FK5 C;  4J41 A;  3ZHT A;  3ZMT A;  4KXR A;  2CGO A;  1SC5 B;  2Q7E A;  3VBB A;  4F6R A;  5BZB A;  4TQD A;  4X1I A;  3CRM A;  2YDE A;  2W0F C;  3OT7 A;  3I5D A;  2XAG A;  3JD2 A;  1XBL A;  1K33 A;  2V7Q G;  3PJS K;  1IBL O;  5KMG B;  4J7J A;  4DV1 B;  3K79 A;  5IDJ A;  3ASN B;  4ICG A;  1VQP V;  3EXA A;  1K7D A; 
#chains in the Genus database with same CATH homology
 2BSK A;  3CJH A;  3DXR B;  2BSK B;  3DXR A;  3CJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...