3DXRA

Crystal structure of the yeast inter-membrane space chaperone assembly tim9.10
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
69
structure length
69
Chain Sequence
FQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM9
publication title Structural and functional requirements for activity of the Tim9-Tim10 complex in mitochondrial protein import
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 26
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3dxrA00
3CJHA 3DXRB 2BSKA 2BSKB 3CJHB 3DXRA
chains in the Genus database with same CATH superfamily
4TV9A 4E4EA 2P7TC 3RN4A 1N33O 4TQDA 1XQ8A 1S3JA 3ASOB 4B3MO 2GTAA 5JJNB 3LDEA 3LUTB 1G1XB 1OCOC 3CCLV 1B06A 2A7WA 2QEXV 1Q90D 3RFRA 2ADPA 1JFFB 3P30A 4L8JA 3UT5A 2RNBA 5K1XA 1VARA 3CCSV 2QE7G 3I5DA 5CA0A 1COWG 3E83A 3VQVA 2F1MA 1AROP 4E2LA 1AI4A 1YHQV 4GX5A 2IU0A 4X1IA 2YIBA 2P4KA 3RVZA 4OX9O 2HHHB 2Y4UA 3H9VA 3ZMVA 3BPZA 4H37A 4WFBV 3L73H 1NH2D 2P90A 1IBKB 1VEWA 1EZVH 3AG1C 2JVDA 2ZE6A 1NTMH 4QNHB 4UCRA 1PKXA 2CE4A 3AG4B 3E22B 3OMNB 3U0ZA 2W6IG 4I9QA 1VQ5V 4ZOLA 5AG2A 4KUMA 1R6NA 2CH7B 4Z2WA 2DWEC 2F93B 5D5PA 5LMUB 2ZIMA 1J5EB 3SPCA 2QTOA 4DV7O 2VRZA 4NXNB 4K3AA 3JAMN 1JPXA 1UPGA 5KMGA 4XBFA 1MMMA 1NTKH 4YHHO 3UKMA 2HFEC 3OAAG 1Q81W 2UXDB 3JSLA 3THOA 1TA8A 3JD2A 5LHGA 4FFBA 2YI9A 3VBBA 1Q6IA 3APOA 2ZM6O 1YEWA 3W7UA 1SQFA 1BHAA 4MTOA 4MVQA 4PA6A 3CJHB 3E8FA 1KC8W 5JVDB 4HYOA 4OPAA 1VQ9V 1YDXA 3K5MA 4GX2A 1IXMA 2GUZA 2HKOA 5BMVA 4GX1A 4DR6B 3K57A 3BAAA 4DV2O 3E86A 4O4IB 4HAMA 1WA8A 1X4TA 1WPXA 3CD6V 3H1IH 1I94O 2QWPB 4JAAA 3RYHB 4GUNA 1LUVA 1H8HG 1HW7A 3BCCH 2EIMB 5DN6G 4LF7B 4LF4B 1M57C 3JARB 1YTFB 3GWOA 4X65B 3OM3B 1QBZA 4NXMB 1SERA 2GV9A 4GCZA 4TT3G 4P30A 2F4VB 3ZHUA 3CC2V 1BZKA 4ASUG 2UXBB 4PA3A 1CP9A 3LDCA 1P4RA 4GLXA 1ZAUA 2CUGA 1OJHA 4JI0O 4CS3A 3P3NA 4K0KB 4YJ2A 4CS2A 4LF5B 2UXCO 1FJGO 2ZXWB 2EINB 2ITCC 1VQMV 4UXNA 5BR8O 2WLHA 2P4VA 4J10A 3ZRSA 4JI8B 4B3RB 2OCHA 3SPGA 4FLUA 3G71V 2PUSA 1F7YA 3R66A 4FLWA 4JI5O 2A79B 3B8NA 3WB2A 1MG1A 1V55C 1OCCC 5LMNB 5LGTA 2GSMB 2QWNB 4CC6A 3JATA 2YEVA 4MVUA 2YS8A 3SJQC 1VF5B 3ETEA 4LBEC 1ZWIC 3KG2A 4P9OA 1N32O 2NLJC 1Q7YW 3UO3A 3SYAA 2HG5C 3Q4HB 4DRXB 2WLIB 2QM7A 5IYZA 5LP6B 1VMGA 3K58A 2QGNA 3JAWA 3ZEDA 4FFKA 4DV6O 5DM6V 4JI6O 5CA3A 4DUZO 4LF9O 2BTQA 3M7MX 2JJ1G 4IIJA 3B09A 2JGDA 1I5YA 1OCRC 4NVPA 4I55A 3EXAA 5CB4B 4LNUA 1XOUA 2YXHA 2DYRB 3PJSK 1PP9H 1WB8A 3AK2A 1VF7A 1HNWB 3JAKA 1IDSA 1BT8A 2OIEA 3ZN0A 4B3SB 3HKBA 1XMOO 5EC1C 3LSSA 1RP3B 2ZCEA 5CN0A 1IBMO 5FNVA 1VQ6V 3QVNA 3J80N 1NQTA 1TVKB 2OCCC 2QKSA 2X6AA 4WFAV 3BA9A 4O2BA 3ABMB 3TK1A 3P32A 2N04A 1YSCA 4CH4A 1TUBB 1NVPB 2LGQA 3HKDA 1EM1A 4XDLA 4O2AA 1OHHG 3IGAC 3QTCA 3GVMA 3CMEV 3W7SA 2IJKA 1L8DA 2A0LA 2Q67A 5KHKA 5KUKA 3E35A 4QE7A 5JWPA 1AI5A 4LFBO 2WA4A 4C7UA 4MW8A 4MS2A 1JR9A 3ABLB 1Q8IA 3E8GA 3A8TA 5DEDA 1N36O 4KHPB 1Y74B 2DQ0A 2XASA 3NXSA 1NI8A 3CE2A 3OMAB 4NKGB 4BR6A 4DV1O 3STLC 4W4KA 5LOVA 5LYJB 2YIDA 2M7WA 4PHZA 1HR0B 2VWJA 4DR3O 4U3FH 3BVOA 1KP2A 1S77D 3K06A 1SRYA 1XL4A 1H8EG 3T1HO 2DJVA 2LFSA 2Q9LA 4K8ZA 3LSQA 3HKEB 4X20B 2DWDC 1IX9A 2CDYA 1FFXA 2WSSG 4ABMA 2V4DA 3J81N 5FL7G 1GH6A 3A2FA 1F23A 4DV3B 3I56V 1YI2V 2WLLB 4DUYO 1BHBA 3F5TA 4HNAA 1XUQA 2UU9O 4DW1A 3G67A 4TV8A 2BSKA 3ZRVA 2DMXA 1D5NA 2ARHA 3A0RA 3K04A 5IYDO 4TV9B 2JK5C 1F51A 5B1AB 4CC5A 2XUMA 3CHXA 1HNZB 4UCVA 1SS3A 1OCOB 3CRMA 1GMGA 3T1YB 2QM8A 2QA4V 5EYPB 4MVSA 3RYFB 1EFRG 5CA0B 2GBOA 4O4LB 1P84F 3F7VC 4MTFA 4JI3B 5B1NA 1SQQH 1QCEA 1XEQA 3ZJZA 2XHBA 1PNKA 4WFHA 1KKDA 4PD4F 4LH6A 2Q73A 2C2AA 2HHHO 2OIGA 5L3EA 1XMQO 3JALA 4QGPA 2QDOA 2QWOB 3TCUA 3E2EA 4CS4A 4YJ3A 3JASB 3W7XA 3MAQA 3PN1A 1K9MW 5EBLC 1PL4A 2WLJA 1DGSA 5L3CA 3ZRXA 1HDJA 2G38A 3LNNA 4I4TB 1R3IC 2XAGA 4J7ZA 3EFFK 3FB8C 1J5EO 4GX0A 5KMGB 3N2GB 5FPOA 1XI1A 1OZ0A 1SQXH 2DOSA 1NH2B 4FFBB 2EIKC 2ZE5A 1ENVA 3IC9A 1WN7A 3FB7C 4NB5A 4PDLA 3EHBB 1PNLA 1KD1W 2PYLA 2EZPA 1I5XA 5KA6A 1Y4MA 1VF6A 1GM7A 1AI7A 1VF6C 3RVYA 3SDLA 2H8PC 2EIJB 4NTWA 2LW1A 3ABKC 1FPOA 4ICGA 1NR1A 3F5WC 4LR3A 2KQXA 4JGSA 2GUZB 3AK1A 3WG7C 4OGQB 4LH7A 4DR6O 3BA8A 4DR5B 5IE9A 3KCXA 4H13B 4DK0A 4B3TO 1K7DA 1WA8B 3OEEG 1B6QA 3CRRA 2FL4A 4UVAA 4W4LA 3WU2Z 5EZYB 5TISZ 2Q0OC 3IC7A 2YDEA 4IHJA 4JAVA 4X64O 4DV0B 4LF7O 1S72V 1YIJV 1JMKC 1GN6A 4NXMO 4PDVA 3OUFA 1T5EA 1NKDA 2IW5A 2RDCA 4UVCA 2LJ2A 4UCOA 4JV5O 2YUAA 2ZQMA 2X6BA 4RUFA 3IAYA 2ZNIA 3JSNA 2UXBO 3CCRV 3BFRA 4YJ2B 1IBLO 2YIBD 1L1FA 4DR7B 3AG7A 1SF9A 1NJIW 4K0KO 3CEIA 2ZIOA 3HPLC 3SPJA 4X9QA 1PL0A 5E1AC 4JI7O 4Z1VA 1VQOV 2VQEB 4TSFG 4ZKIA 1V55B 1WP8A 1OCCB 3OTFA 4JZGA 3MDSA 3TJTA 3JATB 2YEVB 1RM1B 4P2ZA 4LWSA 4TWKA 1US6A 1HNXB 2EZOA 3K03A 1P7BA 3RYIA 1XDCA 2GDSA 3EVKA 5C8YA 1Z5VA 2P6JA 3ZX6A 2Y69C 1SQBH 2OYQA 1BQZA 1J95A 3LDDA 2ZDIA 1M1KW 2ZDIC 2QWQB 1Q43A 4YY3B 4X66O 3W7WA 1OCRB 3GWKC 4R50A 3BABA 2Q68A 2GTSA 2E5LO 1EBOA 3ETGA 5B5EZ 4AQYO 1XBLA 1PM9A 2E74B 2YXLA 4J80A 4DV4O 3TXSA 1NZ6A 4LC1A 4LNUB 4ZHQA 4EB6A 3U11A 1Q5OA 3JAKB 5J9PC 1K34A 1HNWO 3LNMB 3K0GA 5IJ0A 2AW9A 1QU7A 3D36A 2NNUA 1FXHA 3D36C 5FNVB 4IYIA 2YXYA 4LFAO 5CA1A 2F66C 1FD9A 4X1KA 5J2UA 3CXHF 3DGEA 2CTPA 2FB5A 3FAVA 1MSDA 5GW7A 2ADQB 1GM8A 1KECA 4OXSA 5HFLA 5BZBA 3CS5A 3E8BA 3T4ZA 1R73A 3OD4A 3RT3C 1NT2B 3OMIB 1H2GA 1DLBA 4PJ0Z 3FFQA 4WBNB 2UUAB 2P22C 4DV5B 2WLMA 4A5UB 4O4JA 2E3CA 1W0JG 3SJAC 2ATKC 3OTOB 3ICXA 3TGUH 1K97A 4JI4B 2WA3A 4FM2A 1OCZB 3ZRWB 4X88A 4RQFA 5IDJA 4DR1O 5BY1A 3N27A 5B3SC 2HEPA 3OEHG 1XNQB 3K59A 5KX5B 3CXCU 2LGWA 1QR8A 5JCOA 2V7QG 3JD0A 1TUEB 1NU1H 1TGOA 1WLEA 3ASNC 5FPRA 5JCOC 1AJPA 3X2QC 2OTLV 4JI2O 4LF6B 5IYBO 4EEQA 4FM1A 4J7KA 4G28B 4U7OA 3G6EV 1QQCA 1SA0B 3SGIA 3B77A 3JCZA 4O4HA 2PI5A 3UQ8A 4H33A 4CH3A 5LA6A 1GTOA 1KUQA 4GKKO 1H2MA 3K08A 2ITDC 4GKJO 4DR2O 2PTMA 1V54C 2CK3G 1BE3H 3DTUB 4LFCB 3H01A 1SQPH 2K9PA 2AXTZ 4DO2A 4TV8B 5IWAB 2BSKB 3K0DA 2A9HA 2ZKOA 5KHHA 1ZL8A 3SYCA 3SYOA 4N23A 4JYAO 1DTOA 1U97A 4TOIA 3G4SV 4UB8Z 4KP4A 2VQFO 2UXXA 4X89A 1N33B 2JS5A 4JYCA 4LCUC 1YJNV 4B3MB 4H0LB 4DR4B 2EX3A 3ETQA 4PELA 4D7SA 3ZMTA 4JYYA 2JS3A 1N0JA 2X0LA 1GRJA 3N2KA 4JTCB 2XAFA 2NN4A 3MHSC 5L3BA 3CSXA 3APQA 1Q86W 1PD3A 3H1KH 3IFXA 1JOYA 3CC7V 3ABUA 2CTRA 1GAXA 4JYBA 3JALB 4OX9B 3HB3B 2XT9A 3K5NA 3K9AA 1N0NA 4AHCA 5L3FA 1N34O 2F95B 4FLXA 1RPRA 4KL1A 1I7FA 1YZBA 3SR2C 3ZIAG 1K4CC 4I5SA 3QF7A 3DC6A 1UFIA 4F4LA 3C90A 3E22A 1QLNA 3CCVV 4L87A 4PA4A 4DV7B 3KZIZ 2EIKB 1G6UA 3H1JH 4LF8B 5LGNA 4AILC 5LL6Y 4MT8A 3C3SA 2R70A 4NR1A 3JCUZ 4YHHB 5KHJA 2P67A 1K5QA 3RYCB 3D3IA 1OV9A 5KLVH 3P3PA 3UCSC 2A3QA 2ZM6B 1YTFD 5EK0A 2RQ6A 3WG7B 3J7AU 4TUYA 1RSOB 2FKXA 4FMTA 4HZ3A 1AR4A 4XDKA 2IU3A 3CJHA 3WB0A 4B7KA 2XNDG 4U7NA 5JVDA 1ZLZA 1VQNV 1AR1B 1K4DC 2P5OA 2LP7A 1YITV 5A9GA 1K5SA 2DN9A 4MVZA 4DV2B 2ZT9B 1DF5A 1SZTA 1S5JA 2HJDA 4O4IA 1YJ9V 3FD9A 1GN4A 2DYSC 5BXZA 1I94B 4QE9A 3B8MA 5B1BC 4FM0A 3RYHA 1MSWD 3JARA 4NYKA 2ILMA 3SJBC 2ZR2A 1FXKA 4PDRA 2A06H 2UUBO 1JVMA 1FXKC 1K33A 2R72A 3G6BA 4WFEA 5IJ9A 3C3TA 3H1HH 1H2KA 1R1BA 2ZE8A 2WAMA 4I0XA 4YIOA 5EBWC 1BMFG 3AEIA 1R3KC 3ZHTA 1YVWA 1Z5WA 4UUJC 1D2DA 1R6TA 4DXWA 5BR8B 1WPBA 3L70H 4PA7A 2ZXWC 2EINC 2XAQA 4FLYA 2R9AA 2IH1C 2JGUA 4K35A 5ITZA 4JI1B 4LWSB 3FB6C 4JI5B 1JQ0A 5D5QA 3UT5B 1XNRB 1IXBA 5HFMA 1SZXA 1HNXO 1NBMG 3A0HZ 3NR7A 4X1IB 3JYCA 1CPYA 4IT5A 1N32B 2ZNJA 3B4SA 1M9NA 4XDJA 1P49A 4UV9A 5KHGA 2JEXA 1E1QG 3AG1B 3CCEV 3Q4HA 1IBKO 3VOUA 5JJJB 5LGUA 4DV6B 4JI6B 2LW7A 2CTQA 4LF9B 4ZHQB 4U3JA 4BIZA 3OT7A 1GO3F 4PI0A 1M93A 2EULA 4ZOLB 2W0FC 5DECA 3T2MA 2N74A 5CB4A 5C93A 5A2QN 5LMUO 1URFA 3OUSA 5IY5C 3WB1A 4FLZA 4NXNO 4X1KB 5J2UB 3FAVB 2EBOA 2O57A 1SQVH 3ABTA 1WNSA 3M8AA 4EKWA 3QG5A 1KU9A 2Q7HA 3DXRA 5KHIA 1IBMB 2UXDO 3SYPA 1XL6A 1E79G 4J7JA 2XTAA 3ZS8C 2PY5A 2Y4TA 1BGYH 1THZA 2Z0AA 4ZI7A 2Q7EA 3AG2C 3ABMC 4X1YA 1DK1A 1Y76A 1EN6A 4O4JB 3OR7C 2HVJC 5BMVB 1AILA 4P9PA 5JQGA 1D5AA 2NR5A 1FXVA 1PPJH 4JI4O 2PGGA 2UXNA 4LFBB 1SKVA 1O9HA 3S3XA 1XNQO 3OE7G 1R6KA 3ASNB 1M56C 1M57B 3MD0A 3ABLC 3OR6C 4I50A 3AK3A 3U10A 4LF4O 4BW5A 4DV1B 4JF3A 4X65O 1F4NA 3ML0A 4O4HB 2F4VO 4R7CA 5E79Z 1S76D 4WFFA 4H44B 4MSWC 1AVMA 2M6YA 4I7ZB 2X7RB 1G8MA 3CMAV 2Q8VA 3K5OA 4CH6A 1ZTEA 1VQPV 1QVGU 1MABG 3CCUV 4MVRA 1V54B 1I08A 3BEHA 1Q82W 3HKEA 3O9OA 1B3QA 4LF5O 4WFGA 1BQ0A 5LHIA 4LFCO 1KMIZ 2PZSA 4JI8O 4KFMA 1QLEC 4B3RO 2F43G 1GN2A 2QWRB 2YICA 1GM9A 5IWAO 1ZL8B 2QTSA 2WLLA 3K3WA 3HR0A 2Q0AA 3DSQA 1O9GA 5LMNO 2AGAA 1FAFA 1GKFA 2AZ0A 3ZBHA 2GHYA 4Q20A 4DK1A 1W59A 2P06A 2XOKG 3WFVA 3L74H 5KUMA 1FYJA 5B1AC 5B1OA 3ZN1A 4DR4O 4EFBA 5IYZB 3N2KB 2E76B 3HKCA 3JAWB 1WJZA 4DW0A 5EYPA 4B7EA 2CAZC 4UCTA 1KQSU 2BTQB 4RUEA 3RYFA 4IIJB 5H2FZ 2JGDB 4F6RA 3CRQA 1S0VA 4O4LA 3S3WA 1WB7A 2EILC 2R9IA 1BSMA 3L72H 4RAIA 4I55B 4QPJA 3SPHA 1QHTA 2QSAA 1XHZA 4FZ0A 3MHHC 3AG3C 1XMQB 2X6CA 3H1LH 3VQWA 2YIAA 2CTWA 1SC5B 1W0KG 5GONA 2JIZG 3HKBB 2PYJA 4JPRA 4B3SO 4JZ2A 4WF9V 2MK3A 3JASA 2OCCB 1M5IA 3RWRD 1FS0G 5LHHA 4O2BB 4RO2A 5EC2C 1YF2A 4JTDB 4X62B 4I4TA 2YSUB 2OWOA 3HKDB 1IURA 3RBZA 5LXTA 4O2AB 4IGGA 1Q6HA 2WLNA 4FJCC 2WLKA 1Y66A 3CX5F 4LF8O 3TXQA 3RW0A 4OPHA 3N2GA 5KAIZ 3FYEB 3IJ4A 4FLTA 3T4DA 2OTJV 4FK5C 2JEUA 4CH5A 2Q4PA 5KA5A 5J2TA 2KG7A 4TUYB 3SYQA 3I55V 1YCIA 5CMUA 4KHPO 1RPOA 2EIJC 5LOVB 5H6QA 4PV1B 4UVBA 1PV0A 1S5HC 2B1IA 1LUWA 1N4CA 4B3TB 1HR0O 3SPIA 2DYSB 3ZCCA 3CPWU 1LNQA 1VQ7V 5B1BB 1SQGA 4J9ZB 5EZYA 1H2LA 1FFXB 5CBFA 1YJWV 4NTYA 4G2KA 4X64B 4Z1MG 1GK9A 4CBCA 2H3OA 3L9DA 3OGCC 3ETDA 3JD3A 1FXKB 1RFYA 3G80A 1M4UA 2L35A 5JH7A 4JV5B 5IJ9B 4DV3O 2ZD9A 4DYLA 4EFEA 4HNAB 1MZFA 1JA8A 2VS0A 1HP8A 2IM9A 4I0XB 2ZINA 4J9YB 1UJWB 5GTHZ 1IBLB 1LR1A 2R9RB 2Z5UA 2ZR3A 1JCHA 3STZC 2UUCB 2LFRA 3A0BZ 3B2EE 3W7TA 1ROPA 1K3EA 4QIWF 1I0HA 1WP7A 3K9SA 2RN9A 4JI7B 3OW2U 1HNZO 4BWAA 5L3GA 5ITZB 2B1GA 4F6EA 3B40A 4D7TA 2K1EA 3FKSG 4JI1O 3T1YO 1NS1A 5IYCO 3ASOC 3RGBA 1XNRO 2BTOA 2FTKA 4J41A 2HJFC 1E1RG 2RMKB 1RM1C 2IJIA 1VQ4V 4JI3O 1JFFA 1H2SB 2HR3A 1MOFA 1JX9A 1PNMA 4X8AA 1R3LC 4J11A 4FLVA 1X59A 2W6JG 1AP6A 1L0NH 1HWYA 1H2NA 4FVMA 1B04A 4YJ3B 3LSUA 2QKCA 4U3JB 2KB1A 1AP5A 1P7GA 3R65A 4X66B 4FPPA 1Y67A 3BHPA 1EN4A 2IH3C 2CGNA 2E5LB 4AQYB 4FZ1A 4J42A 1Z2GA 1AR5A 1VQKV 4DV4B 5JJEB 3O65A 2Z3YA 1SESA 1R3JC 1TAEA 2IJJA 5IY5B 1QNMA 3AG4C 3FYIB 4R8CA 4CZZA 1S5LZ 1U96A 1AJQA 1KB9F 1KBHA 2CH7A 1EZJA 4TQFA 3DXRB 4N21A 1Q6UA 4LFAB 5H5NA 3L75H 4PDMA 2QR4A 1Y6XA 5IT9N 1XREA 4ZI7B 3AG2B 4NTXA 2ODMA 2JJ2G 2OT5A 2AHYA 1MA1A 4X1YB 3QO5A 3ABKB 1Y76B 3FB5C 2F23A 3ZHSA 4D6TH 2BE3A 3CCMV 3CYOA 1K8AW 3CC4V 5JQGB 2HP8A 1ZUQA 3KKYA 3JD1A 2HVKC 1A32A 4WBNA 2D2CB 4PA9A 2LO1A 4DR5O 1YXBA 2PI4A 4ZBMA 1BL8A 1GN3A 4MTGA 4YXWG 3K5LA 3QNEA 4ZIBA 1KYOF 2CGOA 4UCSA 1M56B 4IHJB 1JJOA 4DR1B 3ZRWA 2LQTA 1OCZC 1QR9A 4RWUA 5CBHA 1VIBA 3JD4A 4I50B 1IZ3A 2Y48A 2FYUH 4IYHA 2YC0A 4DV0O 3UO2A 5CBGA 3ZMUA 3K79A 4KXRA 5KX5A 3QO8A 2QJ1A 4JI2B 1CXZB 2EIMC 2ETNA 2KKWA 2PF4E 2WWWA 1VQLV 5B66Z 1SA0A 3FX7A 4JTAB 2DE0X 3GB7C 2L6LA 5H9CA 4DR7O 4B08A 2Q7GA 4JI0B 4GKKB 3CWBH 5EBMC 5FLXN 4GKJB 4LP8A 1QLEB 4DR2B 4JASA 3CB2A 4WCEV 2UXCB 1FJGB 4BIOA 3QO7A 2VQEO 5K1PA 1QVFU 5L3DA 1MZEA 4PI2A 4MW3A 1MNGA 1VQ8V 3E89A 4JYAB 3DC5A 3ZHVA 3RYIB 2E75B 2B5UA 5C8YB 2YI8A 2VQFB 2Y69B 1KKCA 4RQEA 1NR7A 3ZMZA 2JDIG 1L0LH 3HKCB 5EIBD 3OGIB 4GT1A 5KAFZ 4R6ZA 4MVOA 1XHXA 4DRXA 4F6RB 2EILB 2WLIA 4BAYA 1EN5A 4YY3O 1AI6A 2AHZA 5LP6A 3BRCA 2AZ2A 5LP6C 4IL6Z 3BY6A 1NTZH 4DUZB 1AJNA 1JJ2U 4EB6B 3AG3B 1V9PA 1NVPD 3SJCC 3CRAA 2XAJA 2JRIA 4I9WA 4AI8A 1XILA 5GONB 1FFTB 2N05A 5IJ0B 1BCCH 1W2BU 1Q3EA 1VP7A 1IVSA 3ZHRA 1ORQC 5CA1B 2DYRC 1N34B 4MVMA 4UFZA 1XMOB 4QPKA 2Q6AA 3M99B 4Q6GA 3OFNG 5EIBC 4QJFB 2ZE7A 5LXTB 4X62O 5H6RA 2MW2B 1TVKA 2DW4A 2HLDG 3ZHQA 2WPDG 1M90W 1CEZA 1TUBA 2UUAO 2QM4A 1FKAO 2RJZA 4DV5O 3E8HA 2Y0IA 5J2TB 2QKAA 3OTOO 2KG7B 2IBZH 2H94A 4MTXA 3CRCA 3RYCA 5F2VO 2Q69A 5B3SB 1DF4A 2BCCH 3D8CA 1K92A 3VQXA 1SETA 2D3OW 2XAHA 2W0XA 1G4YB 1N36B 2KSDA 4G27B 3KCYA 3CCQV 3ZMSA 1RSOA 3X2QB 4YIPA 1Y74A 3TETA 4UB6Z 1AB3A 1KP3A 4LF6O 3L71H 1ZX3A 4GYCB 5LYJA 4JAUA 4DR3B 4FIPC 2V1DA 1K73W 5LA6B 3T1HB 2EJ7A 3UM7A 5LBQA 2IJHA 4GZRB 4BIUA 5JH7B 3T1CA 2Y0PA 2FMLA 2B9ZA 2EJRA 2Q5ZA 4X20A 1F4MA 4HBNA 2RCVA 2UUBB 1H38A 2DQ3A 5GTIZ 3F7YC 3CP1A 4UCUA 4K8XA 4UV8A 1BS3A 4DUYB 3D3QA 1WAZA 1ZSPA 3CCJV 2UU9B 2UUCO 1N8RW 4BW9A 2BOBC 2BOCC 3VQYA 2VWKA
chains in the Genus database with same CATH topology
3CJHA 3DXRB 2BSKA 2BSKB 3CJHB 3DXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH A;  3DXR B;  2BSK A;  2BSK B;  3CJH B;  3DXR A; 
#chains in the Genus database with same CATH topology
 4TV9 A;  4E4E A;  2P7T C;  3RN4 A;  1N33 O;  4TQD A;  1XQ8 A;  1S3J A;  3ASO B;  4B3M O;  2GTA A;  5JJN B;  3LDE A;  3LUT B;  1G1X B;  1OCO C;  3CCL V;  1B06 A;  2A7W A;  2QEX V;  1Q90 D;  3RFR A;  2ADP A;  1JFF B;  3P30 A;  4L8J A;  3UT5 A;  2RNB A;  5K1X A;  1VAR A;  3CCS V;  2QE7 G;  3I5D A;  5CA0 A;  1COW G;  3E83 A;  3VQV A;  2F1M A;  1ARO P;  4E2L A;  1AI4 A;  1YHQ V;  4GX5 A;  2IU0 A;  4X1I A;  2YIB A;  2P4K A;  3RVZ A;  4OX9 O;  2HHH B;  2Y4U A;  3H9V A;  3ZMV A;  3BPZ A;  4H37 A;  4WFB V;  3L73 H;  1NH2 D;  2P90 A;  1IBK B;  1VEW A;  1EZV H;  3AG1 C;  2JVD A;  2ZE6 A;  1NTM H;  4QNH B;  4UCR A;  1PKX A;  2CE4 A;  3AG4 B;  3E22 B;  3OMN B;  3U0Z A;  2W6I G;  4I9Q A;  1VQ5 V;  4ZOL A;  5AG2 A;  4KUM A;  1R6N A;  2CH7 B;  4Z2W A;  2DWE C;  2F93 B;  5D5P A;  5LMU B;  2ZIM A;  1J5E B;  3SPC A;  2QTO A;  4DV7 O;  2VRZ A;  4NXN B;  4K3A A;  3JAM N;  1JPX A;  1UPG A;  5KMG A;  4XBF A;  1MMM A;  1NTK H;  4YHH O;  3UKM A;  2HFE C;  3OAA G;  1Q81 W;  2UXD B;  3JSL A;  3THO A;  1TA8 A;  3JD2 A;  5LHG A;  4FFB A;  2YI9 A;  3VBB A;  1Q6I A;  3APO A;  2ZM6 O;  1YEW A;  3W7U A;  1SQF A;  1BHA A;  4MTO A;  4MVQ A;  4PA6 A;  3CJH B;  3E8F A;  1KC8 W;  5JVD B;  4HYO A;  4OPA A;  1VQ9 V;  1YDX A;  3K5M A;  4GX2 A;  1IXM A;  2GUZ A;  2HKO A;  5BMV A;  4GX1 A;  4DR6 B;  3K57 A;  3BAA A;  4DV2 O;  3E86 A;  4O4I B;  4HAM A;  1WA8 A;  1X4T A;  1WPX A;  3CD6 V;  3H1I H;  1I94 O;  2QWP B;  4JAA A;  3RYH B;  4GUN A;  1LUV A;  1H8H G;  1HW7 A;  3BCC H;  2EIM B;  5DN6 G;  4LF7 B;  4LF4 B;  1M57 C;  3JAR B;  1YTF B;  3GWO A;  4X65 B;  3OM3 B;  1QBZ A;  4NXM B;  1SER A;  2GV9 A;  4GCZ A;  4TT3 G;  4P30 A;  2F4V B;  3ZHU A;  3CC2 V;  1BZK A;  4ASU G;  2UXB B;  4PA3 A;  1CP9 A;  3LDC A;  1P4R A;  4GLX A;  1ZAU A;  2CUG A;  1OJH A;  4JI0 O;  4CS3 A;  3P3N A;  4K0K B;  4YJ2 A;  4CS2 A;  4LF5 B;  2UXC O;  1FJG O;  2ZXW B;  2EIN B;  2ITC C;  1VQM V;  4UXN A;  5BR8 O;  2WLH A;  2P4V A;  4J10 A;  3ZRS A;  4JI8 B;  4B3R B;  2OCH A;  3SPG A;  4FLU A;  3G71 V;  2PUS A;  1F7Y A;  3R66 A;  4FLW A;  4JI5 O;  2A79 B;  3B8N A;  3WB2 A;  1MG1 A;  1V55 C;  1OCC C;  5LMN B;  5LGT A;  2GSM B;  2QWN B;  4CC6 A;  3JAT A;  2YEV A;  4MVU A;  2YS8 A;  3SJQ C;  1VF5 B;  3ETE A;  4LBE C;  1ZWI C;  3KG2 A;  4P9O A;  1N32 O;  2NLJ C;  1Q7Y W;  3UO3 A;  3SYA A;  2HG5 C;  3Q4H B;  4DRX B;  2WLI B;  2QM7 A;  5IYZ A;  5LP6 B;  1VMG A;  3K58 A;  2QGN A;  3JAW A;  3ZED A;  4FFK A;  4DV6 O;  5DM6 V;  4JI6 O;  5CA3 A;  4DUZ O;  4LF9 O;  2BTQ A;  3M7M X;  2JJ1 G;  4IIJ A;  3B09 A;  2JGD A;  1I5Y A;  1OCR C;  4NVP A;  4I55 A;  3EXA A;  5CB4 B;  4LNU A;  1XOU A;  2YXH A;  2DYR B;  3PJS K;  1PP9 H;  1WB8 A;  3AK2 A;  1VF7 A;  1HNW B;  3JAK A;  1IDS A;  1BT8 A;  2OIE A;  3ZN0 A;  4B3S B;  3HKB A;  1XMO O;  5EC1 C;  3LSS A;  1RP3 B;  2ZCE A;  5CN0 A;  1IBM O;  5FNV A;  1VQ6 V;  3QVN A;  3J80 N;  1NQT A;  1TVK B;  2OCC C;  2QKS A;  2X6A A;  4WFA V;  3BA9 A;  4O2B A;  3ABM B;  3TK1 A;  3P32 A;  2N04 A;  1YSC A;  4CH4 A;  1TUB B;  1NVP B;  2LGQ A;  3HKD A;  1EM1 A;  4XDL A;  4O2A A;  1OHH G;  3IGA C;  3QTC A;  3GVM A;  3CME V;  3W7S A;  2IJK A;  1L8D A;  2A0L A;  2Q67 A;  5KHK A;  5KUK A;  3E35 A;  4QE7 A;  5JWP A;  1AI5 A;  4LFB O;  2WA4 A;  4C7U A;  4MW8 A;  4MS2 A;  1JR9 A;  3ABL B;  1Q8I A;  3E8G A;  3A8T A;  5DED A;  1N36 O;  4KHP B;  1Y74 B;  2DQ0 A;  2XAS A;  3NXS A;  1NI8 A;  3CE2 A;  3OMA B;  4NKG B;  4BR6 A;  4DV1 O;  3STL C;  4W4K A;  5LOV A;  5LYJ B;  2YID A;  2M7W A;  4PHZ A;  1HR0 B;  2VWJ A;  4DR3 O;  4U3F H;  3BVO A;  1KP2 A;  1S77 D;  3K06 A;  1SRY A;  1XL4 A;  1H8E G;  3T1H O;  2DJV A;  2LFS A;  2Q9L A;  4K8Z A;  3LSQ A;  3HKE B;  4X20 B;  2DWD C;  1IX9 A;  2CDY A;  1FFX A;  2WSS G;  4ABM A;  2V4D A;  3J81 N;  5FL7 G;  1GH6 A;  3A2F A;  1F23 A;  4DV3 B;  3I56 V;  1YI2 V;  2WLL B;  4DUY O;  1BHB A;  3F5T A;  4HNA A;  1XUQ A;  2UU9 O;  4DW1 A;  3G67 A;  4TV8 A;  2BSK A;  3ZRV A;  2DMX A;  1D5N A;  2ARH A;  3A0R A;  3K04 A;  5IYD O;  4TV9 B;  2JK5 C;  1F51 A;  5B1A B;  4CC5 A;  2XUM A;  3CHX A;  1HNZ B;  4UCV A;  1SS3 A;  1OCO B;  3CRM A;  1GMG A;  3T1Y B;  2QM8 A;  2QA4 V;  5EYP B;  4MVS A;  3RYF B;  1EFR G;  5CA0 B;  2GBO A;  4O4L B;  1P84 F;  3F7V C;  4MTF A;  4JI3 B;  5B1N A;  1SQQ H;  1QCE A;  1XEQ A;  3ZJZ A;  2XHB A;  1PNK A;  4WFH A;  1KKD A;  4PD4 F;  4LH6 A;  2Q73 A;  2C2A A;  2HHH O;  2OIG A;  5L3E A;  1XMQ O;  3JAL A;  4QGP A;  2QDO A;  2QWO B;  3TCU A;  3E2E A;  4CS4 A;  4YJ3 A;  3JAS B;  3W7X A;  3MAQ A;  3PN1 A;  1K9M W;  5EBL C;  1PL4 A;  2WLJ A;  1DGS A;  5L3C A;  3ZRX A;  1HDJ A;  2G38 A;  3LNN A;  4I4T B;  1R3I C;  2XAG A;  4J7Z A;  3EFF K;  3FB8 C;  1J5E O;  4GX0 A;  5KMG B;  3N2G B;  5FPO A;  1XI1 A;  1OZ0 A;  1SQX H;  2DOS A;  1NH2 B;  4FFB B;  2EIK C;  2ZE5 A;  1ENV A;  3IC9 A;  1WN7 A;  3FB7 C;  4NB5 A;  4PDL A;  3EHB B;  1PNL A;  1KD1 W;  2PYL A;  2EZP A;  1I5X A;  5KA6 A;  1Y4M A;  1VF6 A;  1GM7 A;  1AI7 A;  1VF6 C;  3RVY A;  3SDL A;  2H8P C;  2EIJ B;  4NTW A;  2LW1 A;  3ABK C;  1FPO A;  4ICG A;  1NR1 A;  3F5W C;  4LR3 A;  2KQX A;  4JGS A;  2GUZ B;  3AK1 A;  3WG7 C;  4OGQ B;  4LH7 A;  4DR6 O;  3BA8 A;  4DR5 B;  5IE9 A;  3KCX A;  4H13 B;  4DK0 A;  4B3T O;  1K7D A;  1WA8 B;  3OEE G;  1B6Q A;  3CRR A;  2FL4 A;  4UVA A;  4W4L A;  3WU2 Z;  5EZY B;  5TIS Z;  2Q0O C;  3IC7 A;  2YDE A;  4IHJ A;  4JAV A;  4X64 O;  4DV0 B;  4LF7 O;  1S72 V;  1YIJ V;  1JMK C;  1GN6 A;  4NXM O;  4PDV A;  3OUF A;  1T5E A;  1NKD A;  2IW5 A;  2RDC A;  4UVC A;  2LJ2 A;  4UCO A;  4JV5 O;  2YUA A;  2ZQM A;  2X6B A;  4RUF A;  3IAY A;  2ZNI A;  3JSN A;  2UXB O;  3CCR V;  3BFR A;  4YJ2 B;  1IBL O;  2YIB D;  1L1F A;  4DR7 B;  3AG7 A;  1SF9 A;  1NJI W;  4K0K O;  3CEI A;  2ZIO A;  3HPL C;  3SPJ A;  4X9Q A;  1PL0 A;  5E1A C;  4JI7 O;  4Z1V A;  1VQO V;  2VQE B;  4TSF G;  4ZKI A;  1V55 B;  1WP8 A;  1OCC B;  3OTF A;  4JZG A;  3MDS A;  3TJT A;  3JAT B;  2YEV B;  1RM1 B;  4P2Z A;  4LWS A;  4TWK A;  1US6 A;  1HNX B;  2EZO A;  3K03 A;  1P7B A;  3RYI A;  1XDC A;  2GDS A;  3EVK A;  5C8Y A;  1Z5V A;  2P6J A;  3ZX6 A;  2Y69 C;  1SQB H;  2OYQ A;  1BQZ A;  1J95 A;  3LDD A;  2ZDI A;  1M1K W;  2ZDI C;  2QWQ B;  1Q43 A;  4YY3 B;  4X66 O;  3W7W A;  1OCR B;  3GWK C;  4R50 A;  3BAB A;  2Q68 A;  2GTS A;  2E5L O;  1EBO A;  3ETG A;  5B5E Z;  4AQY O;  1XBL A;  1PM9 A;  2E74 B;  2YXL A;  4J80 A;  4DV4 O;  3TXS A;  1NZ6 A;  4LC1 A;  4LNU B;  4ZHQ A;  4EB6 A;  3U11 A;  1Q5O A;  3JAK B;  5J9P C;  1K34 A;  1HNW O;  3LNM B;  3K0G A;  5IJ0 A;  2AW9 A;  1QU7 A;  3D36 A;  2NNU A;  1FXH A;  3D36 C;  5FNV B;  4IYI A;  2YXY A;  4LFA O;  5CA1 A;  2F66 C;  1FD9 A;  4X1K A;  5J2U A;  3CXH F;  3DGE A;  2CTP A;  2FB5 A;  3FAV A;  1MSD A;  5GW7 A;  2ADQ B;  1GM8 A;  1KEC A;  4OXS A;  5HFL A;  5BZB A;  3CS5 A;  3E8B A;  3T4Z A;  1R73 A;  3OD4 A;  3RT3 C;  1NT2 B;  3OMI B;  1H2G A;  1DLB A;  4PJ0 Z;  3FFQ A;  4WBN B;  2UUA B;  2P22 C;  4DV5 B;  2WLM A;  4A5U B;  4O4J A;  2E3C A;  1W0J G;  3SJA C;  2ATK C;  3OTO B;  3ICX A;  3TGU H;  1K97 A;  4JI4 B;  2WA3 A;  4FM2 A;  1OCZ B;  3ZRW B;  4X88 A;  4RQF A;  5IDJ A;  4DR1 O;  5BY1 A;  3N27 A;  5B3S C;  2HEP A;  3OEH G;  1XNQ B;  3K59 A;  5KX5 B;  3CXC U;  2LGW A;  1QR8 A;  5JCO A;  2V7Q G;  3JD0 A;  1TUE B;  1NU1 H;  1TGO A;  1WLE A;  3ASN C;  5FPR A;  5JCO C;  1AJP A;  3X2Q C;  2OTL V;  4JI2 O;  4LF6 B;  5IYB O;  4EEQ A;  4FM1 A;  4J7K A;  4G28 B;  4U7O A;  3G6E V;  1QQC A;  1SA0 B;  3SGI A;  3B77 A;  3JCZ A;  4O4H A;  2PI5 A;  3UQ8 A;  4H33 A;  4CH3 A;  5LA6 A;  1GTO A;  1KUQ A;  4GKK O;  1H2M A;  3K08 A;  2ITD C;  4GKJ O;  4DR2 O;  2PTM A;  1V54 C;  2CK3 G;  1BE3 H;  3DTU B;  4LFC B;  3H01 A;  1SQP H;  2K9P A;  2AXT Z;  4DO2 A;  4TV8 B;  5IWA B;  2BSK B;  3K0D A;  2A9H A;  2ZKO A;  5KHH A;  1ZL8 A;  3SYC A;  3SYO A;  4N23 A;  4JYA O;  1DTO A;  1U97 A;  4TOI A;  3G4S V;  4UB8 Z;  4KP4 A;  2VQF O;  2UXX A;  4X89 A;  1N33 B;  2JS5 A;  4JYC A;  4LCU C;  1YJN V;  4B3M B;  4H0L B;  4DR4 B;  2EX3 A;  3ETQ A;  4PEL A;  4D7S A;  3ZMT A;  4JYY A;  2JS3 A;  1N0J A;  2X0L A;  1GRJ A;  3N2K A;  4JTC B;  2XAF A;  2NN4 A;  3MHS C;  5L3B A;  3CSX A;  3APQ A;  1Q86 W;  1PD3 A;  3H1K H;  3IFX A;  1JOY A;  3CC7 V;  3ABU A;  2CTR A;  1GAX A;  4JYB A;  3JAL B;  4OX9 B;  3HB3 B;  2XT9 A;  3K5N A;  3K9A A;  1N0N A;  4AHC A;  5L3F A;  1N34 O;  2F95 B;  4FLX A;  1RPR A;  4KL1 A;  1I7F A;  1YZB A;  3SR2 C;  3ZIA G;  1K4C C;  4I5S A;  3QF7 A;  3DC6 A;  1UFI A;  4F4L A;  3C90 A;  3E22 A;  1QLN A;  3CCV V;  4L87 A;  4PA4 A;  4DV7 B;  3KZI Z;  2EIK B;  1G6U A;  3H1J H;  4LF8 B;  5LGN A;  4AIL C;  5LL6 Y;  4MT8 A;  3C3S A;  2R70 A;  4NR1 A;  3JCU Z;  4YHH B;  5KHJ A;  2P67 A;  1K5Q A;  3RYC B;  3D3I A;  1OV9 A;  5KLV H;  3P3P A;  3UCS C;  2A3Q A;  2ZM6 B;  1YTF D;  5EK0 A;  2RQ6 A;  3WG7 B;  3J7A U;  4TUY A;  1RSO B;  2FKX A;  4FMT A;  4HZ3 A;  1AR4 A;  4XDK A;  2IU3 A;  3CJH A;  3WB0 A;  4B7K A;  2XND G;  4U7N A;  5JVD A;  1ZLZ A;  1VQN V;  1AR1 B;  1K4D C;  2P5O A;  2LP7 A;  1YIT V;  5A9G A;  1K5S A;  2DN9 A;  4MVZ A;  4DV2 B;  2ZT9 B;  1DF5 A;  1SZT A;  1S5J A;  2HJD A;  4O4I A;  1YJ9 V;  3FD9 A;  1GN4 A;  2DYS C;  5BXZ A;  1I94 B;  4QE9 A;  3B8M A;  5B1B C;  4FM0 A;  3RYH A;  1MSW D;  3JAR A;  4NYK A;  2ILM A;  3SJB C;  2ZR2 A;  1FXK A;  4PDR A;  2A06 H;  2UUB O;  1JVM A;  1FXK C;  1K33 A;  2R72 A;  3G6B A;  4WFE A;  5IJ9 A;  3C3T A;  3H1H H;  1H2K A;  1R1B A;  2ZE8 A;  2WAM A;  4I0X A;  4YIO A;  5EBW C;  1BMF G;  3AEI A;  1R3K C;  3ZHT A;  1YVW A;  1Z5W A;  4UUJ C;  1D2D A;  1R6T A;  4DXW A;  5BR8 B;  1WPB A;  3L70 H;  4PA7 A;  2ZXW C;  2EIN C;  2XAQ A;  4FLY A;  2R9A A;  2IH1 C;  2JGU A;  4K35 A;  5ITZ A;  4JI1 B;  4LWS B;  3FB6 C;  4JI5 B;  1JQ0 A;  5D5Q A;  3UT5 B;  1XNR B;  1IXB A;  5HFM A;  1SZX A;  1HNX O;  1NBM G;  3A0H Z;  3NR7 A;  4X1I B;  3JYC A;  1CPY A;  4IT5 A;  1N32 B;  2ZNJ A;  3B4S A;  1M9N A;  4XDJ A;  1P49 A;  4UV9 A;  5KHG A;  2JEX A;  1E1Q G;  3AG1 B;  3CCE V;  3Q4H A;  1IBK O;  3VOU A;  5JJJ B;  5LGU A;  4DV6 B;  4JI6 B;  2LW7 A;  2CTQ A;  4LF9 B;  4ZHQ B;  4U3J A;  4BIZ A;  3OT7 A;  1GO3 F;  4PI0 A;  1M93 A;  2EUL A;  4ZOL B;  2W0F C;  5DEC A;  3T2M A;  2N74 A;  5CB4 A;  5C93 A;  5A2Q N;  5LMU O;  1URF A;  3OUS A;  5IY5 C;  3WB1 A;  4FLZ A;  4NXN O;  4X1K B;  5J2U B;  3FAV B;  2EBO A;  2O57 A;  1SQV H;  3ABT A;  1WNS A;  3M8A A;  4EKW A;  3QG5 A;  1KU9 A;  2Q7H A;  3DXR A;  5KHI A;  1IBM B;  2UXD O;  3SYP A;  1XL6 A;  1E79 G;  4J7J A;  2XTA A;  3ZS8 C;  2PY5 A;  2Y4T A;  1BGY H;  1THZ A;  2Z0A A;  4ZI7 A;  2Q7E A;  3AG2 C;  3ABM C;  4X1Y A;  1DK1 A;  1Y76 A;  1EN6 A;  4O4J B;  3OR7 C;  2HVJ C;  5BMV B;  1AIL A;  4P9P A;  5JQG A;  1D5A A;  2NR5 A;  1FXV A;  1PPJ H;  4JI4 O;  2PGG A;  2UXN A;  4LFB B;  1SKV A;  1O9H A;  3S3X A;  1XNQ O;  3OE7 G;  1R6K A;  3ASN B;  1M56 C;  1M57 B;  3MD0 A;  3ABL C;  3OR6 C;  4I50 A;  3AK3 A;  3U10 A;  4LF4 O;  4BW5 A;  4DV1 B;  4JF3 A;  4X65 O;  1F4N A;  3ML0 A;  4O4H B;  2F4V O;  4R7C A;  5E79 Z;  1S76 D;  4WFF A;  4H44 B;  4MSW C;  1AVM A;  2M6Y A;  4I7Z B;  2X7R B;  1G8M A;  3CMA V;  2Q8V A;  3K5O A;  4CH6 A;  1ZTE A;  1VQP V;  1QVG U;  1MAB G;  3CCU V;  4MVR A;  1V54 B;  1I08 A;  3BEH A;  1Q82 W;  3HKE A;  3O9O A;  1B3Q A;  4LF5 O;  4WFG A;  1BQ0 A;  5LHI A;  4LFC O;  1KMI Z;  2PZS A;  4JI8 O;  4KFM A;  1QLE C;  4B3R O;  2F43 G;  1GN2 A;  2QWR B;  2YIC A;  1GM9 A;  5IWA O;  1ZL8 B;  2QTS A;  2WLL A;  3K3W A;  3HR0 A;  2Q0A A;  3DSQ A;  1O9G A;  5LMN O;  2AGA A;  1FAF A;  1GKF A;  2AZ0 A;  3ZBH A;  2GHY A;  4Q20 A;  4DK1 A;  1W59 A;  2P06 A;  2XOK G;  3WFV A;  3L74 H;  5KUM A;  1FYJ A;  5B1A C;  5B1O A;  3ZN1 A;  4DR4 O;  4EFB A;  5IYZ B;  3N2K B;  2E76 B;  3HKC A;  3JAW B;  1WJZ A;  4DW0 A;  5EYP A;  4B7E A;  2CAZ C;  4UCT A;  1KQS U;  2BTQ B;  4RUE A;  3RYF A;  4IIJ B;  5H2F Z;  2JGD B;  4F6R A;  3CRQ A;  1S0V A;  4O4L A;  3S3W A;  1WB7 A;  2EIL C;  2R9I A;  1BSM A;  3L72 H;  4RAI A;  4I55 B;  4QPJ A;  3SPH A;  1QHT A;  2QSA A;  1XHZ A;  4FZ0 A;  3MHH C;  3AG3 C;  1XMQ B;  2X6C A;  3H1L H;  3VQW A;  2YIA A;  2CTW A;  1SC5 B;  1W0K G;  5GON A;  2JIZ G;  3HKB B;  2PYJ A;  4JPR A;  4B3S O;  4JZ2 A;  4WF9 V;  2MK3 A;  3JAS A;  2OCC B;  1M5I A;  3RWR D;  1FS0 G;  5LHH A;  4O2B B;  4RO2 A;  5EC2 C;  1YF2 A;  4JTD B;  4X62 B;  4I4T A;  2YSU B;  2OWO A;  3HKD B;  1IUR A;  3RBZ A;  5LXT A;  4O2A B;  4IGG A;  1Q6H A;  2WLN A;  4FJC C;  2WLK A;  1Y66 A;  3CX5 F;  4LF8 O;  3TXQ A;  3RW0 A;  4OPH A;  3N2G A;  5KAI Z;  3FYE B;  3IJ4 A;  4FLT A;  3T4D A;  2OTJ V;  4FK5 C;  2JEU A;  4CH5 A;  2Q4P A;  5KA5 A;  5J2T A;  2KG7 A;  4TUY B;  3SYQ A;  3I55 V;  1YCI A;  5CMU A;  4KHP O;  1RPO A;  2EIJ C;  5LOV B;  5H6Q A;  4PV1 B;  4UVB A;  1PV0 A;  1S5H C;  2B1I A;  1LUW A;  1N4C A;  4B3T B;  1HR0 O;  3SPI A;  2DYS B;  3ZCC A;  3CPW U;  1LNQ A;  1VQ7 V;  5B1B B;  1SQG A;  4J9Z B;  5EZY A;  1H2L A;  1FFX B;  5CBF A;  1YJW V;  4NTY A;  4G2K A;  4X64 B;  4Z1M G;  1GK9 A;  4CBC A;  2H3O A;  3L9D A;  3OGC C;  3ETD A;  3JD3 A;  1FXK B;  1RFY A;  3G80 A;  1M4U A;  2L35 A;  5JH7 A;  4JV5 B;  5IJ9 B;  4DV3 O;  2ZD9 A;  4DYL A;  4EFE A;  4HNA B;  1MZF A;  1JA8 A;  2VS0 A;  1HP8 A;  2IM9 A;  4I0X B;  2ZIN A;  4J9Y B;  1UJW B;  5GTH Z;  1IBL B;  1LR1 A;  2R9R B;  2Z5U A;  2ZR3 A;  1JCH A;  3STZ C;  2UUC B;  2LFR A;  3A0B Z;  3B2E E;  3W7T A;  1ROP A;  1K3E A;  4QIW F;  1I0H A;  1WP7 A;  3K9S A;  2RN9 A;  4JI7 B;  3OW2 U;  1HNZ O;  4BWA A;  5L3G A;  5ITZ B;  2B1G A;  4F6E A;  3B40 A;  4D7T A;  2K1E A;  3FKS G;  4JI1 O;  3T1Y O;  1NS1 A;  5IYC O;  3ASO C;  3RGB A;  1XNR O;  2BTO A;  2FTK A;  4J41 A;  2HJF C;  1E1R G;  2RMK B;  1RM1 C;  2IJI A;  1VQ4 V;  4JI3 O;  1JFF A;  1H2S B;  2HR3 A;  1MOF A;  1JX9 A;  1PNM A;  4X8A A;  1R3L C;  4J11 A;  4FLV A;  1X59 A;  2W6J G;  1AP6 A;  1L0N H;  1HWY A;  1H2N A;  4FVM A;  1B04 A;  4YJ3 B;  3LSU A;  2QKC A;  4U3J B;  2KB1 A;  1AP5 A;  1P7G A;  3R65 A;  4X66 B;  4FPP A;  1Y67 A;  3BHP A;  1EN4 A;  2IH3 C;  2CGN A;  2E5L B;  4AQY B;  4FZ1 A;  4J42 A;  1Z2G A;  1AR5 A;  1VQK V;  4DV4 B;  5JJE B;  3O65 A;  2Z3Y A;  1SES A;  1R3J C;  1TAE A;  2IJJ A;  5IY5 B;  1QNM A;  3AG4 C;  3FYI B;  4R8C A;  4CZZ A;  1S5L Z;  1U96 A;  1AJQ A;  1KB9 F;  1KBH A;  2CH7 A;  1EZJ A;  4TQF A;  3DXR B;  4N21 A;  1Q6U A;  4LFA B;  5H5N A;  3L75 H;  4PDM A;  2QR4 A;  1Y6X A;  5IT9 N;  1XRE A;  4ZI7 B;  3AG2 B;  4NTX A;  2ODM A;  2JJ2 G;  2OT5 A;  2AHY A;  1MA1 A;  4X1Y B;  3QO5 A;  3ABK B;  1Y76 B;  3FB5 C;  2F23 A;  3ZHS A;  4D6T H;  2BE3 A;  3CCM V;  3CYO A;  1K8A W;  3CC4 V;  5JQG B;  2HP8 A;  1ZUQ A;  3KKY A;  3JD1 A;  2HVK C;  1A32 A;  4WBN A;  2D2C B;  4PA9 A;  2LO1 A;  4DR5 O;  1YXB A;  2PI4 A;  4ZBM A;  1BL8 A;  1GN3 A;  4MTG A;  4YXW G;  3K5L A;  3QNE A;  4ZIB A;  1KYO F;  2CGO A;  4UCS A;  1M56 B;  4IHJ B;  1JJO A;  4DR1 B;  3ZRW A;  2LQT A;  1OCZ C;  1QR9 A;  4RWU A;  5CBH A;  1VIB A;  3JD4 A;  4I50 B;  1IZ3 A;  2Y48 A;  2FYU H;  4IYH A;  2YC0 A;  4DV0 O;  3UO2 A;  5CBG A;  3ZMU A;  3K79 A;  4KXR A;  5KX5 A;  3QO8 A;  2QJ1 A;  4JI2 B;  1CXZ B;  2EIM C;  2ETN A;  2KKW A;  2PF4 E;  2WWW A;  1VQL V;  5B66 Z;  1SA0 A;  3FX7 A;  4JTA B;  2DE0 X;  3GB7 C;  2L6L A;  5H9C A;  4DR7 O;  4B08 A;  2Q7G A;  4JI0 B;  4GKK B;  3CWB H;  5EBM C;  5FLX N;  4GKJ B;  4LP8 A;  1QLE B;  4DR2 B;  4JAS A;  3CB2 A;  4WCE V;  2UXC B;  1FJG B;  4BIO A;  3QO7 A;  2VQE O;  5K1P A;  1QVF U;  5L3D A;  1MZE A;  4PI2 A;  4MW3 A;  1MNG A;  1VQ8 V;  3E89 A;  4JYA B;  3DC5 A;  3ZHV A;  3RYI B;  2E75 B;  2B5U A;  5C8Y B;  2YI8 A;  2VQF B;  2Y69 B;  1KKC A;  4RQE A;  1NR7 A;  3ZMZ A;  2JDI G;  1L0L H;  3HKC B;  5EIB D;  3OGI B;  4GT1 A;  5KAF Z;  4R6Z A;  4MVO A;  1XHX A;  4DRX A;  4F6R B;  2EIL B;  2WLI A;  4BAY A;  1EN5 A;  4YY3 O;  1AI6 A;  2AHZ A;  5LP6 A;  3BRC A;  2AZ2 A;  5LP6 C;  4IL6 Z;  3BY6 A;  1NTZ H;  4DUZ B;  1AJN A;  1JJ2 U;  4EB6 B;  3AG3 B;  1V9P A;  1NVP D;  3SJC C;  3CRA A;  2XAJ A;  2JRI A;  4I9W A;  4AI8 A;  1XIL A;  5GON B;  1FFT B;  2N05 A;  5IJ0 B;  1BCC H;  1W2B U;  1Q3E A;  1VP7 A;  1IVS A;  3ZHR A;  1ORQ C;  5CA1 B;  2DYR C;  1N34 B;  4MVM A;  4UFZ A;  1XMO B;  4QPK A;  2Q6A A;  3M99 B;  4Q6G A;  3OFN G;  5EIB C;  4QJF B;  2ZE7 A;  5LXT B;  4X62 O;  5H6R A;  2MW2 B;  1TVK A;  2DW4 A;  2HLD G;  3ZHQ A;  2WPD G;  1M90 W;  1CEZ A;  1TUB A;  2UUA O;  2QM4 A;  1FKA O;  2RJZ A;  4DV5 O;  3E8H A;  2Y0I A;  5J2T B;  2QKA A;  3OTO O;  2KG7 B;  2IBZ H;  2H94 A;  4MTX A;  3CRC A;  3RYC A;  5F2V O;  2Q69 A;  5B3S B;  1DF4 A;  2BCC H;  3D8C A;  1K92 A;  3VQX A;  1SET A;  2D3O W;  2XAH A;  2W0X A;  1G4Y B;  1N36 B;  2KSD A;  4G27 B;  3KCY A;  3CCQ V;  3ZMS A;  1RSO A;  3X2Q B;  4YIP A;  1Y74 A;  3TET A;  4UB6 Z;  1AB3 A;  1KP3 A;  4LF6 O;  3L71 H;  1ZX3 A;  4GYC B;  5LYJ A;  4JAU A;  4DR3 B;  4FIP C;  2V1D A;  1K73 W;  5LA6 B;  3T1H B;  2EJ7 A;  3UM7 A;  5LBQ A;  2IJH A;  4GZR B;  4BIU A;  5JH7 B;  3T1C A;  2Y0P A;  2FML A;  2B9Z A;  2EJR A;  2Q5Z A;  4X20 A;  1F4M A;  4HBN A;  2RCV A;  2UUB B;  1H38 A;  2DQ3 A;  5GTI Z;  3F7Y C;  3CP1 A;  4UCU A;  4K8X A;  4UV8 A;  1BS3 A;  4DUY B;  3D3Q A;  1WAZ A;  1ZSP A;  3CCJ V;  2UU9 B;  2UUC O;  1N8R W;  4BW9 A;  2BOB C;  2BOC C;  3VQY A;  2VWK A; 
#chains in the Genus database with same CATH homology
 3CJH A;  3DXR B;  2BSK A;  2BSK B;  3CJH B;  3DXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...