3DXRB

Crystal structure of the yeast inter-membrane space chaperone assembly tim9.10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
b'SQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM9
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural and functional requirements for activity of the Tim9-Tim10 complex in mitochondrial protein import
pubmed doi rcsb
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3dxrB00
3DXRA 2BSKA 3DXRB 3CJHA 2BSKB 3CJHB
chains in the Genus database with same CATH superfamily
4FLXA 2ETNA 3L70H 2FYUH 2IW5A 3B77A 3OMAB 1K4CC 2RCVA 4DV3B 4EB6B 2GTAA 1CPYA 1FS0G 1H2SB 1WPBA 1XILA 4JAAA 2QKSA 2Y0PA 5AG2A 2BSKB 2PY5A 2DN9A 1Y74A 2ZDIC 1VIBA 1JFFA 1KMIZ 2EJRA 3H1JH 2F23A 3IJ4A 2XTAA 2UUAO 4LP8A 1NTMH 3RT3C 4BAYA 4IL6Z 1TUBB 2DQ0A 5FNVB 3RYFA 3ZJZA 5GW7A 2UUCB 3T1HO 2HG5C 1V55B 2E5LB 4D7SA 1DK1A 4CH6A 4ZOLB 2QM4A 4X1YB 3E8GA 1S76D 5KHJA 4TUYA 1AJNA 1BMFG 1MZEA 1P7BA 1W0KG 3AK3A 4CH5A 3AG3C 2XASA 2P4KA 1GN3A 4BIUA 3CEIA 1N32B 5KHGA 3E22A 1YJ9V 3UO2A 2JEUA 2QTSA 5JVDB 2LQTA 2Q73A 1YJNV 4X65B 1THZA 2ADQB 4Z1MG 2NR5A 3RFRA 5H2FZ 3GB7C 1DTOA 1LNQA 4X62O 3OMIB 3ZIAG 2RQ6A 2N74A 4PDVA 5KMGB 5E1AC 5LP6B 4DR7B 4JI4B 4UVCA 1MA1A 3DC6A 2ZM6B 4LF6B 4K35A 1ZAUA 4JI5O 1P84F 2DW4A 1DF5A 2M6YA 4F6RA 1SA0A 2QSAA 4UVAA 1I7FA 2RMKB 5J2UA 3HKBB 5H6RA 3CCVV 4NXMB 4F6EA 2PYJA 2FL4A 5IYDO 2VS0A 1JVMA 3EFFK 2F66C 3HKCB 3JASB 2UXNA 3JAWB 1JR9A 1JA8A 1HNZB 3L72H 5FLXN 1AB3A 2EIJC 5LHIA 1V54C 4G2KA 4HZ3A 3CCMV 3HKEB 4O4HB 4DV2B 1Q6UA 5FNVA 3CC2V 4K0KB 2XAHA 5JJEB 1OJHA 4MTGA 4CH3A 5LMUO 3DXRA 1FPOA 3SYQA 4IIJA 4X1IB 5L3GA 2YIBD 3AG2C 4JI8B 1FFXB 3N2GB 2YEVA 1V55C 1S72V 1K5QA 4JI1B 2ADPA 3UKMA 5KAIZ 3T1YO 2VQEO 3G6BA 3VQYA 2NNUA 5IY5C 4YHHB 5CA0B 4B7KA 2OIEA 4LWSB 4LF6O 2WSSG 1XEQA 4YHHO 3TK1A 1W2BU 3I55V 1EFRG 4CC6A 4LF4B 1KP2A 3L71H 2A06H 2ZIOA 3MDSA 4B3RO 1FKAO 1IDSA 5H9CA 5LA6B 5LMUB 1Q3EA 2DJVA 4QGPA 3WU2Z 1OCZB 2X6AA 5B1BB 4J9YB 5IJ0B 2WLHA 2N05A 4W4KA 5BR8O 2ZE8A 4LFAB 3A0HZ 2V7QG 4BIZA 2DOSA 2A9HA 1PNMA 2E5LO 2YXHA 1YVWA 1GTOA 3B8MA 3ZMZA 4QE9A 4GKKB 3EXAA 1MABG 4W4LA 4NXMO 1H2MA 3MAQA 1YITV 4N23A 1ZL8A 4I0XB 3STZC 2WLJA 1NR1A 1SQGA 3ABKC 3OEHG 2Z0AA 5KAFZ 2FKXA 1IBMB 2ZM6O 5FPRA 1VEWA 2CH7A 2XAFA 4F4LA 1FXVA 2BE3A 3OUFA 2CAZC 3FB7C 1Q81W 4IGGA 2L35A 2X7RB 1VQNV 3OT7A 3W7SA 1I94O 4TV8A 1Z5WA 2DYSB 2ITCC 1TUEB 4DRXA 2JS5A 4B3MB 1N32O 3L73H 4PA7A 4LF5B 4K8ZA 4R7CA 1VF6A 2PGGA 2ZNJA 1PNKA 3CRRA 2JRIA 2Q68A 5C8YB 2X6BA 1QR9A 3DC5A 4JI0O 3RVZA 2XNDG 3T4ZA 1SQBH 1JPXA 4OPAA 1F7YA 4ZBMA 1GH6A 3Q4HB 2QGNA 5B5EZ 3D3QA 4JYAB 3LSSA 4JPRA 3QO8A 2QWOB 4KP4A 3GVMA 3G4SV 4NVPA 1CEZA 2FMLA 5LBQA 1A32A 4DUZB 4FK5C 2ARHA 4JASA 2DWEC 1FXKC 1AJPA 1S5JA 1F4MA 4GKJO 3OTOO 1ZUQA 1K34A 4JI2O 1Y67A 2CTQA 4DV5O 2F4VO 4FZ0A 4B3TB 1JFFB 3STLC 1Q6IA 4K0KO 1R6KA 2CTRA 3DGEA 3VQVA 3ZRSA 4JAUA 2Z5UA 3E8FA 3O9OA 4DR6O 5LYJA 3R65A 1HNZO 4P30A 3MHHC 4ABMA 4PD4F 3CE2A 4LFCO 2YEVB 3QTCA 3P30A 3ZHQA 1XHZA 3CD6V 5KUMA 4X66B 3LSQA 1VQOV 4DK0A 1XMQO 5J2UB 4B7EA 5D5PA 4MVOA 5L3DA 3CMAV 3AG7A 4DR6B 2VWKA 1LUVA 2HVKC 5BMVA 3TJTA 1AR5A 3UT5B 4JI7O 4TV9A 3OFNG 2ZCEA 3D8CA 3UT5A 2Y0IA 4WBNA 1R3IC 4PDRA 3ZCCA 2CUGA 4DR7O 5C8YA 4WBNB 2RJZA 3E35A 4B3TO 1BGYH 4FM1A 2QWPB 4X62B 4DV7B 3M8AA 5B1BC 1R6NA 3L75H 1WB8A 4C7UA 3RVYA 3CRCA 3VQXA 1OCOB 4JI2B 3BA9A 4UV8A 1VQ6V 2YXLA 2P22C 1S0VA 3TCUA 2E75B 2IJIA 4J42A 4EFEA 2YUAA 3WB0A 3OAAG 1SA0B 1HR0B 3ZMSA 5H6QA 1M57B 4FLUA 4GCZA 2R9IA 5C93A 2UXCO 2ZR3A 1X59A 1WA8A 5KA5A 2UXBB 1JJOA 4PI2A 1W59A 2UXXA 3TXQA 3CWBH 1VQKV 4YJ2A 3ZBHA 3K0DA 1N34B 4ASUG 1K3EA 3ABTA 4B08A 2X6CA 3T1HB 4YJ2B 3ABMC 5LA6A 1AI6A 5JVDA 4J41A 3WG7B 1GO3F 5CA3A 3AG2B 2K1EA 2UUAB 3JARA 2PI4A 1QQCA 3T4DA 3JALB 1R3LC 2UXBO 2YS8A 3BA8A 1SS3A 3K06A 2LFSA 2Y4UA 3ABUA 2ZT9B 1LUWA 2HP8A 4DR2O 4DRXB 1BCCH 3QO5A 4B3MO 4RQEA 4RAIA 1N33O 3HKBA 3CMEV 1KKCA 5GONA 4D6TH 3RYCA 1EZVH 3N27A 4LNUB 4NB5A 4IHJB 1PL0A 1XUQA 1GN2A 3G80A 1D2DA 2UUBB 3UM7A 4FMTA 4G28B 4MTFA 3CHXA 4DYLA 4KHPO 4UCVA 1AJQA 3CRMA 4QIWF 3CCRV 3ZHUA 4JI3O 3FB8C 3CJHA 4JF3A 4PHZA 1SERA 5LYJB 5LHHA 4H33A 4YJ3B 1HNXB 4I55B 1QR8A 4LF8B 3N2KA 1BHAA 4CS2A 2LFRA 1AVMA 1OZ0A 1OCRC 3H1KH 1EZJA 1ZSPA 2OCCC 2O57A 2Q0OC 5CBFA 1R6TA 2WWWA 5IWAB 2ITDC 4GX2A 1OCRB 2BSKA 5B1AC 1YTFD 4H0LB 1QHTA 5LMNB 3A8TA 4FLVA 3JD3A 2JEXA 4OXSA 2YIBA 2UXDB 3CRAA 2OTLV 4DUYB 4LF4O 1SKVA 1PV0A 4DUZO 4TV8B 5EK0A 3E8HA 5L3FA 3ZMTA 3BABA 3DTUB 4JYAO 1BT8A 1Y76A 5LGNA 1Q5OA 3CCEV 3CRQA 4X1KA 1RFYA 4DV6O 2V1DA 1Q8IA 2H3OA 5BMVB 2BCCH 1IURA 1NBMG 2HJFC 1FXKB 2JDIG 1VQ9V 1OCOC 3B40A 1TAEA 3CPWU 1VF6C 2QA4V 5IE9A 3HKDB 2H8PC 1HW7A 1FYJA 4PELA 4QE7A 3A0RA 1OCZC 2PZSA 4TUYB 1FFXA 2GSMB 4DV4B 3SYPA 4KL1A 3L9DA 1I08A 4LF7B 4R8CA 2H94A 2HJDA 2QM8A 2ZR2A 3APOA 2Q5ZA 1T5EA 4GX0A 4OX9B 2QKAA 2EJ7A 1K7DA 3J80N 4JI4O 3ETGA 2HVJC 4ICGA 2EIKC 2ZXWC 1GN4A 2EIKB 2ZXWB 2YI9A 1MMMA 1Y74B 3CC7V 1RM1C 3OGCC 4O2BA 1V9PA 3MHSC 2DYSC 1E1RG 4QNHB 4FLYA 2JGUA 1VQLV 2BTQA 4JV5O 1J5EO 1K5SA 4CZZA 3WFVA 1WPXA 2DYRB 4NXNB 1KUQA 4E2LA 1PPJH 1R73A 4I9QA 3RYHA 3FX7A 5ITZA 4AQYB 2R70A 4X1KB 2GTSA 4LCUC 5GTIZ 2MK3A 5F2VO 4EKWA 2UUCO 4PDMA 2Q67A 2Q6AA 1XNRB 1XOUA 1N0NA 3BEHA 4DR3O 4CS4A 4TV9B 1WAZA 4H44B 1JOYA 2AZ2A 4RUFA 4MTXA 1IBKO 1WN7A 4ZI7A 2JS3A 1Q86W 2IJJA 4NTXA 3ZN0A 1QU7A 2IH3C 2W0XA 3ASNB 3P3NA 4MVRA 4X20A 3CJHB 2VQFO 3E86A 3I56V 4MS2A 1B6QA 1NTZH 4NTYA 5IDJA 1NTKH 3CP1A 3JCZA 2P7TC 4EFBA 1YTFB 2E74B 4F6RB 4JI1O 4JI6B 3B4SA 1CXZB 4UUJC 4ZKIA 5H5NA 2Z3YA 4GYCB 4I9WA 2EIMC 5CB4B 4UCRA 4DR5B 4K3AA 1XREA 2EZPA 2XAJA 1M57C 3OEEG 3OR6C 4JYBA 1VP7A 4MVUA 4YY3O 5B3SB 1VQ5V 1Q90D 4NR1A 1WP7A 2VQFB 5DEDA 3OW2U 4ZHQA 2W6IG 3LDCA 5IYCO 3QVNA 3CSXA 2DYRC 1SQFA 1H2LA 3H1LH 2M7WA 5IJ0A 3AG3B 1BE3H 3SPIA 2XAGA 3WB1A 1Q43A 1FJGB 5EYPA 4UCTA 2N04A 1S5HC 5B1NA 3JAKB 3RYIB 3NXSA 2HLDG 4AQYO 2P6JA 3CCJV 1IXMA 5CN0A 4I7ZB 1IBLB 2QJ1A 3FAVB 3IGAC 4IHJA 3K0GA 4DV1B 4LF8O 3JAMN 3SJCC 4JAVA 3ML0A 4FVMA 2F1MA 4I4TA 1IZ3A 1J5EB 2HHHB 1MOFA 4WCEV 3F7YC 4MVMA 4D7TA 2ZNIA 5KHKA 2A0LA 3JD1A 2EILC 4GUNA 1N4CA 4JGSA 4TSFG 3S3XA 3FKSG 3ZMVA 1YZBA 1S3JA 3OE7G 3ZHVA 1Y66A 4MW8A 2LW7A 3BPZA 1AP6A 3ASNC 2KKWA 3K04A 4O2BB 4WFAV 3M7MX 1XQ8A 4PI0A 1AI4A 4X1IA 2RNBA 4X88A 3IC7A 2F43G 5LL6Y 4FLZA 3N2GA 2WPDG 4J7JA 4DO2A 5JH7B 2LP7A 1F4NA 5L3CA 1EN4A 4O4LA 1G1XB 3ABMB 1IXBA 4IYHA 4LFBB 4HBNA 2OCCB 3RGBA 1N33B 1O9HA 2WLMA 3WG7C 4DV4O 1HNWB 1RM1B 4L8JA 2Q8VA 2BOBC 3AEIA 4J11A 4UCUA 3AG4C 2JGDB 1YCIA 4TT3G 3F7VC 2MW2B 4FLTA 1BHBA 2JGDA 3JATA 5J2TA 4X20B 4TQFA 3JALA 5IYZB 4WF9V 1H2GA 4DV0B 3OMNB 3QNEA 1KKDA 3DXRB 5FL7G 3SR2C 5KHIA 3ASOB 2Y4TA 2NN4A 3K58A 1S77D 1Q82W 2ODMA 1YI2V 3CB2A 2LO1A 3FAVA 4FPPA 4J10A 2F93B 2PF4E 1YF2A 1I0HA 4OGQB 4DR1O 1XI1A 3JD4A 1NH2D 2PYLA 2ZD9A 4KUMA 1GM9A 1XNQO 5CB4A 2YIDA 2AGAA 2B5UA 2BOCC 1KECA 1HR0O 1XMOB 3HPLC 3CCSV 5L3EA 2Y69B 4P9OA 2IU3A 3B8NA 4LR3A 4DW1A 4CBCA 4MTOA 1NH2B 5CBHA 4I5SA 2HHHO 2CTWA 1W0JG 1SRYA 1UPGA 4XDJA 5TISZ 4NTWA 4PA3A 1VMGA 4DV1O 4UFZA 2ZE6A 2AXTZ 1EN6A 2V4DA 2JK5C 1RSOA 4JYCA 2YICA 2IH1C 5JCOC 4JI7B 3T1CA 2P67A 5EZYA 3KG2A 2OYQA 4UXNA 1SZXA 4X64B 1YIJV 2CK3G 3O65A 5IT9N 3DSQA 4PA4A 2XOKG 5EBLC 5BXZA 4E4EA 2P5OA 3U0ZA 1OHHG 2OIGA 3GWKC 4U7OA 4EB6A 1D5AA 4RWUA 5KX5A 2ZINA 1QLEB 3QG5A 4BIOA 3F5WC 5EIBD 4XDKA 3JATB 1N8RW 5EBMC 1SETA 4I50A 1M5IA 4KXRA 1K9MW 3W7XA 4JTDB 3K5NA 1GMGA 2GUZB 1VQPV 1F23A 3RN4A 4IIJB 3H1HH 3JD0A 4DK1A 3E2EA 4JYYA 4BR6A 4ZOLA 3AG1B 2F95B 4DR5O 3AG4B 3CC4V 4B3SB 3AK2A 4L87A 1N0JA 1H2KA 2ZQMA 5KA6A 4A5UB 5GONB 1TGOA 2XHBA 5BY1A 2FB5A 3BAAA 4DR2B 4MVZA 1VQ4V 4LC1A 5CMUA 4FFBA 2QWRB 4CS3A 1BZKA 2QDOA 4GZRB 1WLEA 1PKXA 1O9GA 5LGTA 4HNAB 5CA1B 3H1IH 1RPRA 1V54B 1BL8A 1M56B 2D2CB 1RPOA 3H01A 4OPHA 2CDYA 3JSNA 3S3WA 2WLNA 2EX3A 3D36A 3SPGA 1HNWO 4K8XA 1VQ7V 2YDEA 5IYZA 1SQVH 3HKDA 3E89A 4FJCC 4AI8A 1BQZA 2OCHA 2EULA 2BTOA 3M99B 2B1GA 3OTFA 4UCOA 4DXWA 2P4VA 1UJWB 2EINB 3B09A 1UFIA 4JZ2A 1YDXA 4Q20A 3SJQC 3CCUV 4O4IA 1HDJA 2QE7G 2IJKA 2LGQA 3G71V 3RW0A 1YJWV 3ETEA 3RWRD 3RYIA 3THOA 2YSUB 4LBEC 2Q7HA 3P3PA 5B3SC 5IY5B 3ZRVA 2JJ1G 3ZMUA 1G6UA 2GUZA 3ETQA 5KHHA 4BWAA 4DV0O 4J9ZB 3A2FA 3AG1C 3C90A 4J7KA 1VARA 3NR7A 2QWQB 4LF9O 3U10A 5LGUA 4TWKA 1R3JC 4XDLA 3VQWA 1H8EG 1M9NA 1J95A 5BZBA 1EBOA 5LOVA 1DF4A 5HFMA 2XUMA 4LF7O 4GKKO 3ZEDA 5GTHZ 3X2QC 2IM9A 4UCSA 1ZL8B 4I0XA 4B3SO 2B9ZA 2A3QA 1IVSA 4QJFB 5EC2C 4WFGA 4FM0A 2X0LA 5BR8B 2NLJC 2GV9A 1XHXA 5JWPA 5A9GA 1P7GA 5A2QN 3C3TA 3CCLV 1P4RA 2EIMB 1JMKC 1ZLZA 4DW0A 3KKYA 2UU9B 1KD1W 1KQSU 5E79Z 1AROP 3C3SA 3PN1A 3JARB 1QCEA 3T2MA 4Q6GA 2YI8A 3OM3B 4U3JB 4DV6B 4UVBA 3B2EE 5EBWC 1EN5A 4X1YA 1K8AW 4B3RB 5IJ9B 3SPCA 3KCXA 3FD9A 3OTOB 2K9PA 3JAKA 5LOVB 4MVQA 5HFLA 1SF9A 2W0FC 5LHGA 1D5NA 1SQXH 2B1IA 4J80A 1VF7A 4RQFA 1Q7YW 2ZDIA 4KFMA 1NU1H 3K5LA 3IAYA 2EZOA 1FFTB 2VQEB 1MNGA 3EHBB 1WA8B 3E22B 1N36O 1YHQV 2PTMA 1FD9A 3JASA 1M1KW 1QLNA 4BW5A 2QEXV 1Z5VA 1M93A 1K33A 3GWOA 3OUSA 1B3QA 3K5OA 1NKDA 2RN9A 2ZE7A 4DR3B 1IX9A 2Q69A 3LNMB 4ZIBA 2Q7GA 3Q4HA 2JVDA 4UV9A 1N36B 4QPKA 3K3WA 1XL6A 3ASOC 3K57A 4LH7A 5B1OA 4FFKA 1GRJA 4BW9A 3TETA 4YY3B 1L8DA 3K03A 1Y4MA 5FPOA 3E83A 3CX5F 5DECA 3H9VA 1E79G 3EVKA 1KB9F 3LNNA 3RYCB 4NXNO 2P90A 2CGNA 1QVGU 2KQXA 4WFHA 4JV5B 3ZS8C 3W7UA 3SYAA 4Z2WA 4PA6A 1XDCA 2AW9A 2PI5A 2KG7B 3CXHF 1K73W 1TVKB 4JI3B 3VOUA 1AR4A 4HNAA 4ZHQB 2UU9O 4JI5B 4G27B 4YXWG 4KHPB 3PJSK 5J2TB 1DLBA 3APQA 4WFEA 1IBMO 1PNLA 1QBZA 2UUBO 4HAMA 1IBKB 2YIAA 1GM8A 4X65O 2YC0A 3G6EV 2GHYA 2EIJB 2HFEC 5K1PA 5JJNB 5EZYB 4DR4O 1PD3A 4GX5A 5EYPB 3ZHSA 1US6A 1G8MA 1QLEC 4DR4B 5ITZB 4LFBO 1NR7A 4MW3A 3BVOA 2RDCA 2EINC 1WJZA 1AI5A 1NI8A 4CC5A 4GLXA 4I55A 1P49A 3IFXA 4NKGB 4UB6Z 1WB7A 3ZN1A 4PA9A 4HYOA 1I5YA 3SJBC 3SJAC 1I5XA 2PUSA 2R72A 5CA1A 2DWDC 4I50B 3CCQV 5EIBC 3BRCA 5K1XA 3W7WA 2OWOA 2E3CA 1N34O 4O2AA 3SYOA 4MSWC 4WFBV 1TUBA 3D36C 2GBOA 3K5MA 4X89A 4H37A 3BHPA 4TOIA 3UQ8A 1JCHA 4DV3O 5LP6C 3K59A 4NYKA 1GKFA 1MSWD 4OX9O 1GK9A 3JCUZ 4MVSA 4LNUA 1QVFU 3WB2A 1COWG 3K9SA 3K9AA 1PP9H 3LDEA 3T1YB 3D3IA 4PDLA 1K92A 3R66A 3J7AU 5CA0A 1K4DC 1FJGO 4DUYO 4O4JA 5JQGA 4JI8O 1SC5B 2WLLA 3J81N 5JQGB 5LMNO 1FXHA 1FAFA 5JJJB 4J7ZA 5IWAO 4YIPA 4GT1A 5LP6A 1NQTA 4FM2A 4P2ZA 1NS1A 4DV2O 2DQ3A 4PJ0Z 3W7TA 1WP8A 4P9PA 1JQ0A 1L0LH 1XMQB 1M90W 2Q9LA 2Q7EA 1NVPD 4O4IB 1H38A 3SGIA 3ICXA 2QWNB 5CBGA 1Y76B 3P32A 3SPJA 1VQ8V 1NJIW 3CYOA 4JI6O 1XL4A 1BQ0A 1DGSA 1XBLA 1URFA 5DN6G 2D3OW 4MT8A 1SESA 2HKOA 2WLLB 1WNSA 4R50A 2WAMA 3TXSA 4EEQA 3ZRXA 4U3FH 1MSDA 1ZX3A 2UXDO 2FTKA 1VF5B 1R3KC 4FZ1A 5IJ9A 3JYCA 3I5DA 2L6LA 5KLVH 3RBZA 1XNRO 5LXTA 3LDDA 1OCCB 1OCCC 4X64O 2ILMA 4AILC 1X4TA 3RYHB 3BY6A 1HP8A 4LF9B 2LGWA 1AR1B 3KCYA 1JJ2U 2E76B 3IC9A 3HKCA 1GM7A 2WLKA 2AHYA 2OT5A 1NT2B 1RP3B 4RO2A 3ZHTA 4JTAB 1YEWA 1OV9A 3ZHRA 3OR7C 1GAXA 3FYIB 4JI0B 1FXKA 1YXBA 5D5QA 3HR0A 4LH6A 1KC8W 4WFFA 4IYIA 4XBFA 3BFRA 2R9AA 2VRZA 3JD2A 3QF7A 4X9QA 3LSUA 1S5LZ 3RYFB 4QPJA 1Y6XA 3F5TA 1GN6A 3MD0A 2UXCB 1AP5A 1MZFA 4TQDA 4O4LB 4YIOA 3N2KB 5EC1C 5B1AB 1RSOB 2WA3A 3VBBA 2XT9A 3L74H 3SPHA 2KB1A 3JAWA 1BSMA 4JZGA 2QM7A 2W6JG 1AILA 1R1BA 2LW1A 1I94B 3U11A 1ENVA 1NZ6A 3UO3A 4DV7O 1B06A 2DE0X 1F51A 2YXYA 4CH4A 3K79A 1TVKA 5KX5B 2EILB 3K08A 4PV1B 2R9RB 4IT5A 3HKEA 5KUKA 4RUEA 2XAQA 1SZTA 2HEPA 2JJ2G 1KP3A 1ORQC 5LXTB 2ZE5A 2WLIA 3ETDA 2ZIMA 1SQQH 4FLWA 1U97A 3FYEB 3FB5C 4LFAO 3CS5A 4GX1A 2G38A 3UCSC 3FFQA 1E1QG 2AHZA 2DMXA 1LR1A 3X2QB 1ROPA 2KG7A 2P06A 2QR4A 1JX9A 1M56C 4FFBB 1Z2GA 1G4YB 3TGUH 1NVPB 3ABLC 2A79B 3LUTB 2Y69C 2QTOA 3OGIB 2LJ2A 2OTJV 1U96A 4UB8Z 4H13B 4N21A 2F4VB 4JTCB 2VWJA 2CH7B 1PM9A 5J9PC 2CGOA 1QNMA 1SQPH 4GKJB 5L3BA 1Q6HA 1KBHA 1BS3A 3SDLA 4X8AA 1IBLO 3ZX6A 1EM1A 2IJHA 5JCOA 3E8BA 5JH7A 2BTQB 4U7NA 4YJ3A 2C2AA 3ZRWB 1K97A 3KZIZ 2Q4PA 3FB6C 1M4UA 2CE4A 1VQMV 2Q0AA 2WA4A 3ZRWA 1H8HG 3AK1A 3SYCA 4AHCA 4O4JB 3OD4A 2IBZH 5B66Z 1KU9A 2A7WA 1HNXO 4X66O 3A0BZ 4LFCB 4FIPC 3CXCU 2KSDA 1L0NH 4I4TB 1H2NA 1PL4A 3HB3B 4ZI7B 4O4HA 1YSCA 1XMOO 2QKCA 2ZKOA 4R6ZA 2HR3A 3QO7A 2Y48A 5KMGA 1XNQB 4U3JA 1L1FA 4O2AB 2WLIB 1ZTEA 4Z1VA 1TA8A 2IU0A 4DR1B 1CP9A 4LF5O 1AI7A 3JSLA 3G67A 4DV5B 5IYBO 1KYOF 2JIZG 2CTPA 2EBOA 2AZ0A 2ATKC 1ZWIC 3BCCH 5DM6V 1HWYA 2GDSA 1B04A 1MG1A 3ABLB 4LWSA 3ABKB
chains in the Genus database with same CATH topology
3DXRA 2BSKA 3DXRB 3CJHA 2BSKB 3CJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXR A;  2BSK A;  3DXR B;  3CJH A;  2BSK B;  3CJH B; 
#chains in the Genus database with same CATH topology
 4FLX A;  2ETN A;  3L70 H;  2FYU H;  2IW5 A;  3B77 A;  3OMA B;  1K4C C;  2RCV A;  4DV3 B;  4EB6 B;  2GTA A;  1CPY A;  1FS0 G;  1H2S B;  1WPB A;  1XIL A;  4JAA A;  2QKS A;  2Y0P A;  5AG2 A;  2BSK B;  2PY5 A;  2DN9 A;  1Y74 A;  2ZDI C;  1VIB A;  1JFF A;  1KMI Z;  2EJR A;  3H1J H;  2F23 A;  3IJ4 A;  2XTA A;  2UUA O;  4LP8 A;  1NTM H;  3RT3 C;  4BAY A;  4IL6 Z;  1TUB B;  2DQ0 A;  5FNV B;  3RYF A;  3ZJZ A;  5GW7 A;  2UUC B;  3T1H O;  2HG5 C;  1V55 B;  2E5L B;  4D7S A;  1DK1 A;  4CH6 A;  4ZOL B;  2QM4 A;  4X1Y B;  3E8G A;  1S76 D;  5KHJ A;  4TUY A;  1AJN A;  1BMF G;  1MZE A;  1P7B A;  1W0K G;  3AK3 A;  4CH5 A;  3AG3 C;  2XAS A;  2P4K A;  1GN3 A;  4BIU A;  3CEI A;  1N32 B;  5KHG A;  3E22 A;  1YJ9 V;  3UO2 A;  2JEU A;  2QTS A;  5JVD B;  2LQT A;  2Q73 A;  1YJN V;  4X65 B;  1THZ A;  2ADQ B;  4Z1M G;  2NR5 A;  3RFR A;  5H2F Z;  3GB7 C;  1DTO A;  1LNQ A;  4X62 O;  3OMI B;  3ZIA G;  2RQ6 A;  2N74 A;  4PDV A;  5KMG B;  5E1A C;  5LP6 B;  4DR7 B;  4JI4 B;  4UVC A;  1MA1 A;  3DC6 A;  2ZM6 B;  4LF6 B;  4K35 A;  1ZAU A;  4JI5 O;  1P84 F;  2DW4 A;  1DF5 A;  2M6Y A;  4F6R A;  1SA0 A;  2QSA A;  4UVA A;  1I7F A;  2RMK B;  5J2U A;  3HKB B;  5H6R A;  3CCV V;  4NXM B;  4F6E A;  2PYJ A;  2FL4 A;  5IYD O;  2VS0 A;  1JVM A;  3EFF K;  2F66 C;  3HKC B;  3JAS B;  2UXN A;  3JAW B;  1JR9 A;  1JA8 A;  1HNZ B;  3L72 H;  5FLX N;  1AB3 A;  2EIJ C;  5LHI A;  1V54 C;  4G2K A;  4HZ3 A;  3CCM V;  3HKE B;  4O4H B;  4DV2 B;  1Q6U A;  5FNV A;  3CC2 V;  4K0K B;  2XAH A;  5JJE B;  1OJH A;  4MTG A;  4CH3 A;  5LMU O;  3DXR A;  1FPO A;  3SYQ A;  4IIJ A;  4X1I B;  5L3G A;  2YIB D;  3AG2 C;  4JI8 B;  1FFX B;  3N2G B;  2YEV A;  1V55 C;  1S72 V;  1K5Q A;  4JI1 B;  2ADP A;  3UKM A;  5KAI Z;  3T1Y O;  2VQE O;  3G6B A;  3VQY A;  2NNU A;  5IY5 C;  4YHH B;  5CA0 B;  4B7K A;  2OIE A;  4LWS B;  4LF6 O;  2WSS G;  1XEQ A;  4YHH O;  3TK1 A;  1W2B U;  3I55 V;  1EFR G;  4CC6 A;  4LF4 B;  1KP2 A;  3L71 H;  2A06 H;  2ZIO A;  3MDS A;  4B3R O;  1FKA O;  1IDS A;  5H9C A;  5LA6 B;  5LMU B;  1Q3E A;  2DJV A;  4QGP A;  3WU2 Z;  1OCZ B;  2X6A A;  5B1B B;  4J9Y B;  5IJ0 B;  2WLH A;  2N05 A;  4W4K A;  5BR8 O;  2ZE8 A;  4LFA B;  3A0H Z;  2V7Q G;  4BIZ A;  2DOS A;  2A9H A;  1PNM A;  2E5L O;  2YXH A;  1YVW A;  1GTO A;  3B8M A;  3ZMZ A;  4QE9 A;  4GKK B;  3EXA A;  1MAB G;  4W4L A;  4NXM O;  1H2M A;  3MAQ A;  1YIT V;  4N23 A;  1ZL8 A;  4I0X B;  3STZ C;  2WLJ A;  1NR1 A;  1SQG A;  3ABK C;  3OEH G;  2Z0A A;  5KAF Z;  2FKX A;  1IBM B;  2ZM6 O;  5FPR A;  1VEW A;  2CH7 A;  2XAF A;  4F4L A;  1FXV A;  2BE3 A;  3OUF A;  2CAZ C;  3FB7 C;  1Q81 W;  4IGG A;  2L35 A;  2X7R B;  1VQN V;  3OT7 A;  3W7S A;  1I94 O;  4TV8 A;  1Z5W A;  2DYS B;  2ITC C;  1TUE B;  4DRX A;  2JS5 A;  4B3M B;  1N32 O;  3L73 H;  4PA7 A;  4LF5 B;  4K8Z A;  4R7C A;  1VF6 A;  2PGG A;  2ZNJ A;  1PNK A;  3CRR A;  2JRI A;  2Q68 A;  5C8Y B;  2X6B A;  1QR9 A;  3DC5 A;  4JI0 O;  3RVZ A;  2XND G;  3T4Z A;  1SQB H;  1JPX A;  4OPA A;  1F7Y A;  4ZBM A;  1GH6 A;  3Q4H B;  2QGN A;  5B5E Z;  3D3Q A;  4JYA B;  3LSS A;  4JPR A;  3QO8 A;  2QWO B;  4KP4 A;  3GVM A;  3G4S V;  4NVP A;  1CEZ A;  2FML A;  5LBQ A;  1A32 A;  4DUZ B;  4FK5 C;  2ARH A;  4JAS A;  2DWE C;  1FXK C;  1AJP A;  1S5J A;  1F4M A;  4GKJ O;  3OTO O;  1ZUQ A;  1K34 A;  4JI2 O;  1Y67 A;  2CTQ A;  4DV5 O;  2F4V O;  4FZ0 A;  4B3T B;  1JFF B;  3STL C;  1Q6I A;  4K0K O;  1R6K A;  2CTR A;  3DGE A;  3VQV A;  3ZRS A;  4JAU A;  2Z5U A;  3E8F A;  3O9O A;  4DR6 O;  5LYJ A;  3R65 A;  1HNZ O;  4P30 A;  3MHH C;  4ABM A;  4PD4 F;  3CE2 A;  4LFC O;  2YEV B;  3QTC A;  3P30 A;  3ZHQ A;  1XHZ A;  3CD6 V;  5KUM A;  4X66 B;  3LSQ A;  1VQO V;  4DK0 A;  1XMQ O;  5J2U B;  4B7E A;  5D5P A;  4MVO A;  5L3D A;  3CMA V;  3AG7 A;  4DR6 B;  2VWK A;  1LUV A;  2HVK C;  5BMV A;  3TJT A;  1AR5 A;  3UT5 B;  4JI7 O;  4TV9 A;  3OFN G;  2ZCE A;  3D8C A;  3UT5 A;  2Y0I A;  4WBN A;  1R3I C;  4PDR A;  3ZCC A;  2CUG A;  4DR7 O;  5C8Y A;  4WBN B;  2RJZ A;  3E35 A;  4B3T O;  1BGY H;  4FM1 A;  2QWP B;  4X62 B;  4DV7 B;  3M8A A;  5B1B C;  1R6N A;  3L75 H;  1WB8 A;  4C7U A;  3RVY A;  3CRC A;  3VQX A;  1OCO B;  4JI2 B;  3BA9 A;  4UV8 A;  1VQ6 V;  2YXL A;  2P22 C;  1S0V A;  3TCU A;  2E75 B;  2IJI A;  4J42 A;  4EFE A;  2YUA A;  3WB0 A;  3OAA G;  1SA0 B;  1HR0 B;  3ZMS A;  5H6Q A;  1M57 B;  4FLU A;  4GCZ A;  2R9I A;  5C93 A;  2UXC O;  2ZR3 A;  1X59 A;  1WA8 A;  5KA5 A;  2UXB B;  1JJO A;  4PI2 A;  1W59 A;  2UXX A;  3TXQ A;  3CWB H;  1VQK V;  4YJ2 A;  3ZBH A;  3K0D A;  1N34 B;  4ASU G;  1K3E A;  3ABT A;  4B08 A;  2X6C A;  3T1H B;  4YJ2 B;  3ABM C;  5LA6 A;  1AI6 A;  5JVD A;  4J41 A;  3WG7 B;  1GO3 F;  5CA3 A;  3AG2 B;  2K1E A;  2UUA B;  3JAR A;  2PI4 A;  1QQC A;  3T4D A;  3JAL B;  1R3L C;  2UXB O;  2YS8 A;  3BA8 A;  1SS3 A;  3K06 A;  2LFS A;  2Y4U A;  3ABU A;  2ZT9 B;  1LUW A;  2HP8 A;  4DR2 O;  4DRX B;  1BCC H;  3QO5 A;  4B3M O;  4RQE A;  4RAI A;  1N33 O;  3HKB A;  3CME V;  1KKC A;  5GON A;  4D6T H;  3RYC A;  1EZV H;  3N27 A;  4LNU B;  4NB5 A;  4IHJ B;  1PL0 A;  1XUQ A;  1GN2 A;  3G80 A;  1D2D A;  2UUB B;  3UM7 A;  4FMT A;  4G28 B;  4MTF A;  3CHX A;  4DYL A;  4KHP O;  4UCV A;  1AJQ A;  3CRM A;  4QIW F;  3CCR V;  3ZHU A;  4JI3 O;  3FB8 C;  3CJH A;  4JF3 A;  4PHZ A;  1SER A;  5LYJ B;  5LHH A;  4H33 A;  4YJ3 B;  1HNX B;  4I55 B;  1QR8 A;  4LF8 B;  3N2K A;  1BHA A;  4CS2 A;  2LFR A;  1AVM A;  1OZ0 A;  1OCR C;  3H1K H;  1EZJ A;  1ZSP A;  2OCC C;  2O57 A;  2Q0O C;  5CBF A;  1R6T A;  2WWW A;  5IWA B;  2ITD C;  4GX2 A;  1OCR B;  2BSK A;  5B1A C;  1YTF D;  4H0L B;  1QHT A;  5LMN B;  3A8T A;  4FLV A;  3JD3 A;  2JEX A;  4OXS A;  2YIB A;  2UXD B;  3CRA A;  2OTL V;  4DUY B;  4LF4 O;  1SKV A;  1PV0 A;  4DUZ O;  4TV8 B;  5EK0 A;  3E8H A;  5L3F A;  3ZMT A;  3BAB A;  3DTU B;  4JYA O;  1BT8 A;  1Y76 A;  5LGN A;  1Q5O A;  3CCE V;  3CRQ A;  4X1K A;  1RFY A;  4DV6 O;  2V1D A;  1Q8I A;  2H3O A;  5BMV B;  2BCC H;  1IUR A;  1NBM G;  2HJF C;  1FXK B;  2JDI G;  1VQ9 V;  1OCO C;  3B40 A;  1TAE A;  3CPW U;  1VF6 C;  2QA4 V;  5IE9 A;  3HKD B;  2H8P C;  1HW7 A;  1FYJ A;  4PEL A;  4QE7 A;  3A0R A;  1OCZ C;  2PZS A;  4TUY B;  1FFX A;  2GSM B;  4DV4 B;  3SYP A;  4KL1 A;  3L9D A;  1I08 A;  4LF7 B;  4R8C A;  2H94 A;  2HJD A;  2QM8 A;  2ZR2 A;  3APO A;  2Q5Z A;  1T5E A;  4GX0 A;  4OX9 B;  2QKA A;  2EJ7 A;  1K7D A;  3J80 N;  4JI4 O;  3ETG A;  2HVJ C;  4ICG A;  2EIK C;  2ZXW C;  1GN4 A;  2EIK B;  2ZXW B;  2YI9 A;  1MMM A;  1Y74 B;  3CC7 V;  1RM1 C;  3OGC C;  4O2B A;  1V9P A;  3MHS C;  2DYS C;  1E1R G;  4QNH B;  4FLY A;  2JGU A;  1VQL V;  2BTQ A;  4JV5 O;  1J5E O;  1K5S A;  4CZZ A;  3WFV A;  1WPX A;  2DYR B;  4NXN B;  1KUQ A;  4E2L A;  1PPJ H;  1R73 A;  4I9Q A;  3RYH A;  3FX7 A;  5ITZ A;  4AQY B;  2R70 A;  4X1K B;  2GTS A;  4LCU C;  5GTI Z;  2MK3 A;  5F2V O;  4EKW A;  2UUC O;  4PDM A;  2Q67 A;  2Q6A A;  1XNR B;  1XOU A;  1N0N A;  3BEH A;  4DR3 O;  4CS4 A;  4TV9 B;  1WAZ A;  4H44 B;  1JOY A;  2AZ2 A;  4RUF A;  4MTX A;  1IBK O;  1WN7 A;  4ZI7 A;  2JS3 A;  1Q86 W;  2IJJ A;  4NTX A;  3ZN0 A;  1QU7 A;  2IH3 C;  2W0X A;  3ASN B;  3P3N A;  4MVR A;  4X20 A;  3CJH B;  2VQF O;  3E86 A;  3I56 V;  4MS2 A;  1B6Q A;  1NTZ H;  4NTY A;  5IDJ A;  1NTK H;  3CP1 A;  3JCZ A;  2P7T C;  4EFB A;  1YTF B;  2E74 B;  4F6R B;  4JI1 O;  4JI6 B;  3B4S A;  1CXZ B;  4UUJ C;  4ZKI A;  5H5N A;  2Z3Y A;  4GYC B;  4I9W A;  2EIM C;  5CB4 B;  4UCR A;  4DR5 B;  4K3A A;  1XRE A;  2EZP A;  2XAJ A;  1M57 C;  3OEE G;  3OR6 C;  4JYB A;  1VP7 A;  4MVU A;  4YY3 O;  5B3S B;  1VQ5 V;  1Q90 D;  4NR1 A;  1WP7 A;  2VQF B;  5DED A;  3OW2 U;  4ZHQ A;  2W6I G;  3LDC A;  5IYC O;  3QVN A;  3CSX A;  2DYR C;  1SQF A;  1H2L A;  3H1L H;  2M7W A;  5IJ0 A;  3AG3 B;  1BE3 H;  3SPI A;  2XAG A;  3WB1 A;  1Q43 A;  1FJG B;  5EYP A;  4UCT A;  2N04 A;  1S5H C;  5B1N A;  3JAK B;  3RYI B;  3NXS A;  2HLD G;  4AQY O;  2P6J A;  3CCJ V;  1IXM A;  5CN0 A;  4I7Z B;  1IBL B;  2QJ1 A;  3FAV B;  3IGA C;  4IHJ A;  3K0G A;  4DV1 B;  4LF8 O;  3JAM N;  3SJC C;  4JAV A;  3ML0 A;  4FVM A;  2F1M A;  4I4T A;  1IZ3 A;  1J5E B;  2HHH B;  1MOF A;  4WCE V;  3F7Y C;  4MVM A;  4D7T A;  2ZNI A;  5KHK A;  2A0L A;  3JD1 A;  2EIL C;  4GUN A;  1N4C A;  4JGS A;  4TSF G;  3S3X A;  3FKS G;  3ZMV A;  1YZB A;  1S3J A;  3OE7 G;  3ZHV A;  1Y66 A;  4MW8 A;  2LW7 A;  3BPZ A;  1AP6 A;  3ASN C;  2KKW A;  3K04 A;  4O2B B;  4WFA V;  3M7M X;  1XQ8 A;  4PI0 A;  1AI4 A;  4X1I A;  2RNB A;  4X88 A;  3IC7 A;  2F43 G;  5LL6 Y;  4FLZ A;  3N2G A;  2WPD G;  4J7J A;  4DO2 A;  5JH7 B;  2LP7 A;  1F4N A;  5L3C A;  1EN4 A;  4O4L A;  1G1X B;  3ABM B;  1IXB A;  4IYH A;  4LFB B;  4HBN A;  2OCC B;  3RGB A;  1N33 B;  1O9H A;  2WLM A;  3WG7 C;  4DV4 O;  1HNW B;  1RM1 B;  4L8J A;  2Q8V A;  2BOB C;  3AEI A;  4J11 A;  4UCU A;  3AG4 C;  2JGD B;  1YCI A;  4TT3 G;  3F7V C;  2MW2 B;  4FLT A;  1BHB A;  2JGD A;  3JAT A;  5J2T A;  4X20 B;  4TQF A;  3JAL A;  5IYZ B;  4WF9 V;  1H2G A;  4DV0 B;  3OMN B;  3QNE A;  1KKD A;  3DXR B;  5FL7 G;  3SR2 C;  5KHI A;  3ASO B;  2Y4T A;  2NN4 A;  3K58 A;  1S77 D;  1Q82 W;  2ODM A;  1YI2 V;  3CB2 A;  2LO1 A;  3FAV A;  4FPP A;  4J10 A;  2F93 B;  2PF4 E;  1YF2 A;  1I0H A;  4OGQ B;  4DR1 O;  1XI1 A;  3JD4 A;  1NH2 D;  2PYL A;  2ZD9 A;  4KUM A;  1GM9 A;  1XNQ O;  5CB4 A;  2YID A;  2AGA A;  2B5U A;  2BOC C;  1KEC A;  1HR0 O;  1XMO B;  3HPL C;  3CCS V;  5L3E A;  2Y69 B;  4P9O A;  2IU3 A;  3B8N A;  4LR3 A;  4DW1 A;  4CBC A;  4MTO A;  1NH2 B;  5CBH A;  4I5S A;  2HHH O;  2CTW A;  1W0J G;  1SRY A;  1UPG A;  4XDJ A;  5TIS Z;  4NTW A;  4PA3 A;  1VMG A;  4DV1 O;  4UFZ A;  2ZE6 A;  2AXT Z;  1EN6 A;  2V4D A;  2JK5 C;  1RSO A;  4JYC A;  2YIC A;  2IH1 C;  5JCO C;  4JI7 B;  3T1C A;  2P67 A;  5EZY A;  3KG2 A;  2OYQ A;  4UXN A;  1SZX A;  4X64 B;  1YIJ V;  2CK3 G;  3O65 A;  5IT9 N;  3DSQ A;  4PA4 A;  2XOK G;  5EBL C;  5BXZ A;  4E4E A;  2P5O A;  3U0Z A;  1OHH G;  2OIG A;  3GWK C;  4U7O A;  4EB6 A;  1D5A A;  4RWU A;  5KX5 A;  2ZIN A;  1QLE B;  3QG5 A;  4BIO A;  3F5W C;  5EIB D;  4XDK A;  3JAT B;  1N8R W;  5EBM C;  1SET A;  4I50 A;  1M5I A;  4KXR A;  1K9M W;  3W7X A;  4JTD B;  3K5N A;  1GMG A;  2GUZ B;  1VQP V;  1F23 A;  3RN4 A;  4IIJ B;  3H1H H;  3JD0 A;  4DK1 A;  3E2E A;  4JYY A;  4BR6 A;  4ZOL A;  3AG1 B;  2F95 B;  4DR5 O;  3AG4 B;  3CC4 V;  4B3S B;  3AK2 A;  4L87 A;  1N0J A;  1H2K A;  2ZQM A;  5KA6 A;  4A5U B;  5GON B;  1TGO A;  2XHB A;  5BY1 A;  2FB5 A;  3BAA A;  4DR2 B;  4MVZ A;  1VQ4 V;  4LC1 A;  5CMU A;  4FFB A;  2QWR B;  4CS3 A;  1BZK A;  2QDO A;  4GZR B;  1WLE A;  1PKX A;  1O9G A;  5LGT A;  4HNA B;  5CA1 B;  3H1I H;  1RPR A;  1V54 B;  1BL8 A;  1M56 B;  2D2C B;  1RPO A;  3H01 A;  4OPH A;  2CDY A;  3JSN A;  3S3W A;  2WLN A;  2EX3 A;  3D36 A;  3SPG A;  1HNW O;  4K8X A;  1VQ7 V;  2YDE A;  5IYZ A;  1SQV H;  3HKD A;  3E89 A;  4FJC C;  4AI8 A;  1BQZ A;  2OCH A;  2EUL A;  2BTO A;  3M99 B;  2B1G A;  3OTF A;  4UCO A;  4DXW A;  2P4V A;  1UJW B;  2EIN B;  3B09 A;  1UFI A;  4JZ2 A;  1YDX A;  4Q20 A;  3SJQ C;  3CCU V;  4O4I A;  1HDJ A;  2QE7 G;  2IJK A;  2LGQ A;  3G71 V;  3RW0 A;  1YJW V;  3ETE A;  3RWR D;  3RYI A;  3THO A;  2YSU B;  4LBE C;  2Q7H A;  3P3P A;  5B3S C;  5IY5 B;  3ZRV A;  2JJ1 G;  3ZMU A;  1G6U A;  2GUZ A;  3ETQ A;  5KHH A;  4BWA A;  4DV0 O;  4J9Z B;  3A2F A;  3AG1 C;  3C90 A;  4J7K A;  1VAR A;  3NR7 A;  2QWQ B;  4LF9 O;  3U10 A;  5LGU A;  4TWK A;  1R3J C;  4XDL A;  3VQW A;  1H8E G;  1M9N A;  1J95 A;  5BZB A;  1EBO A;  5LOV A;  1DF4 A;  5HFM A;  2XUM A;  4LF7 O;  4GKK O;  3ZED A;  5GTH Z;  3X2Q C;  2IM9 A;  4UCS A;  1ZL8 B;  4I0X A;  4B3S O;  2B9Z A;  2A3Q A;  1IVS A;  4QJF B;  5EC2 C;  4WFG A;  4FM0 A;  2X0L A;  5BR8 B;  2NLJ C;  2GV9 A;  1XHX A;  5JWP A;  5A9G A;  1P7G A;  5A2Q N;  3C3T A;  3CCL V;  1P4R A;  2EIM B;  1JMK C;  1ZLZ A;  4DW0 A;  3KKY A;  2UU9 B;  1KD1 W;  1KQS U;  5E79 Z;  1ARO P;  3C3S A;  3PN1 A;  3JAR B;  1QCE A;  3T2M A;  4Q6G A;  2YI8 A;  3OM3 B;  4U3J B;  4DV6 B;  4UVB A;  3B2E E;  5EBW C;  1EN5 A;  4X1Y A;  1K8A W;  4B3R B;  5IJ9 B;  3SPC A;  3KCX A;  3FD9 A;  3OTO B;  2K9P A;  3JAK A;  5LOV B;  4MVQ A;  5HFL A;  1SF9 A;  2W0F C;  5LHG A;  1D5N A;  1SQX H;  2B1I A;  4J80 A;  1VF7 A;  4RQF A;  1Q7Y W;  2ZDI A;  4KFM A;  1NU1 H;  3K5L A;  3IAY A;  2EZO A;  1FFT B;  2VQE B;  1MNG A;  3EHB B;  1WA8 B;  3E22 B;  1N36 O;  1YHQ V;  2PTM A;  1FD9 A;  3JAS A;  1M1K W;  1QLN A;  4BW5 A;  2QEX V;  1Z5V A;  1M93 A;  1K33 A;  3GWO A;  3OUS A;  1B3Q A;  3K5O A;  1NKD A;  2RN9 A;  2ZE7 A;  4DR3 B;  1IX9 A;  2Q69 A;  3LNM B;  4ZIB A;  2Q7G A;  3Q4H A;  2JVD A;  4UV9 A;  1N36 B;  4QPK A;  3K3W A;  1XL6 A;  3ASO C;  3K57 A;  4LH7 A;  5B1O A;  4FFK A;  1GRJ A;  4BW9 A;  3TET A;  4YY3 B;  1L8D A;  3K03 A;  1Y4M A;  5FPO A;  3E83 A;  3CX5 F;  5DEC A;  3H9V A;  1E79 G;  3EVK A;  1KB9 F;  3LNN A;  3RYC B;  4NXN O;  2P90 A;  2CGN A;  1QVG U;  2KQX A;  4WFH A;  4JV5 B;  3ZS8 C;  3W7U A;  3SYA A;  4Z2W A;  4PA6 A;  1XDC A;  2AW9 A;  2PI5 A;  2KG7 B;  3CXH F;  1K73 W;  1TVK B;  4JI3 B;  3VOU A;  1AR4 A;  4HNA A;  4ZHQ B;  2UU9 O;  4JI5 B;  4G27 B;  4YXW G;  4KHP B;  3PJS K;  5J2T B;  1DLB A;  3APQ A;  4WFE A;  1IBM O;  1PNL A;  1QBZ A;  2UUB O;  4HAM A;  1IBK B;  2YIA A;  1GM8 A;  4X65 O;  2YC0 A;  3G6E V;  2GHY A;  2EIJ B;  2HFE C;  5K1P A;  5JJN B;  5EZY B;  4DR4 O;  1PD3 A;  4GX5 A;  5EYP B;  3ZHS A;  1US6 A;  1G8M A;  1QLE C;  4DR4 B;  5ITZ B;  4LFB O;  1NR7 A;  4MW3 A;  3BVO A;  2RDC A;  2EIN C;  1WJZ A;  1AI5 A;  1NI8 A;  4CC5 A;  4GLX A;  4I55 A;  1P49 A;  3IFX A;  4NKG B;  4UB6 Z;  1WB7 A;  3ZN1 A;  4PA9 A;  4HYO A;  1I5Y A;  3SJB C;  3SJA C;  1I5X A;  2PUS A;  2R72 A;  5CA1 A;  2DWD C;  4I50 B;  3CCQ V;  5EIB C;  3BRC A;  5K1X A;  3W7W A;  2OWO A;  2E3C A;  1N34 O;  4O2A A;  3SYO A;  4MSW C;  4WFB V;  1TUB A;  3D36 C;  2GBO A;  3K5M A;  4X89 A;  4H37 A;  3BHP A;  4TOI A;  3UQ8 A;  1JCH A;  4DV3 O;  5LP6 C;  3K59 A;  4NYK A;  1GKF A;  1MSW D;  4OX9 O;  1GK9 A;  3JCU Z;  4MVS A;  4LNU A;  1QVF U;  3WB2 A;  1COW G;  3K9S A;  3K9A A;  1PP9 H;  3LDE A;  3T1Y B;  3D3I A;  4PDL A;  1K92 A;  3R66 A;  3J7A U;  5CA0 A;  1K4D C;  1FJG O;  4DUY O;  4O4J A;  5JQG A;  4JI8 O;  1SC5 B;  2WLL A;  3J81 N;  5JQG B;  5LMN O;  1FXH A;  1FAF A;  5JJJ B;  4J7Z A;  5IWA O;  4YIP A;  4GT1 A;  5LP6 A;  1NQT A;  4FM2 A;  4P2Z A;  1NS1 A;  4DV2 O;  2DQ3 A;  4PJ0 Z;  3W7T A;  1WP8 A;  4P9P A;  1JQ0 A;  1L0L H;  1XMQ B;  1M90 W;  2Q9L A;  2Q7E A;  1NVP D;  4O4I B;  1H38 A;  3SGI A;  3ICX A;  2QWN B;  5CBG A;  1Y76 B;  3P32 A;  3SPJ A;  1VQ8 V;  1NJI W;  3CYO A;  4JI6 O;  1XL4 A;  1BQ0 A;  1DGS A;  1XBL A;  1URF A;  5DN6 G;  2D3O W;  4MT8 A;  1SES A;  2HKO A;  2WLL B;  1WNS A;  4R50 A;  2WAM A;  3TXS A;  4EEQ A;  3ZRX A;  4U3F H;  1MSD A;  1ZX3 A;  2UXD O;  2FTK A;  1VF5 B;  1R3K C;  4FZ1 A;  5IJ9 A;  3JYC A;  3I5D A;  2L6L A;  5KLV H;  3RBZ A;  1XNR O;  5LXT A;  3LDD A;  1OCC B;  1OCC C;  4X64 O;  2ILM A;  4AIL C;  1X4T A;  3RYH B;  3BY6 A;  1HP8 A;  4LF9 B;  2LGW A;  1AR1 B;  3KCY A;  1JJ2 U;  2E76 B;  3IC9 A;  3HKC A;  1GM7 A;  2WLK A;  2AHY A;  2OT5 A;  1NT2 B;  1RP3 B;  4RO2 A;  3ZHT A;  4JTA B;  1YEW A;  1OV9 A;  3ZHR A;  3OR7 C;  1GAX A;  3FYI B;  4JI0 B;  1FXK A;  1YXB A;  5D5Q A;  3HR0 A;  4LH6 A;  1KC8 W;  4WFF A;  4IYI A;  4XBF A;  3BFR A;  2R9A A;  2VRZ A;  3JD2 A;  3QF7 A;  4X9Q A;  3LSU A;  1S5L Z;  3RYF B;  4QPJ A;  1Y6X A;  3F5T A;  1GN6 A;  3MD0 A;  2UXC B;  1AP5 A;  1MZF A;  4TQD A;  4O4L B;  4YIO A;  3N2K B;  5EC1 C;  5B1A B;  1RSO B;  2WA3 A;  3VBB A;  2XT9 A;  3L74 H;  3SPH A;  2KB1 A;  3JAW A;  1BSM A;  4JZG A;  2QM7 A;  2W6J G;  1AIL A;  1R1B A;  2LW1 A;  1I94 B;  3U11 A;  1ENV A;  1NZ6 A;  3UO3 A;  4DV7 O;  1B06 A;  2DE0 X;  1F51 A;  2YXY A;  4CH4 A;  3K79 A;  1TVK A;  5KX5 B;  2EIL B;  3K08 A;  4PV1 B;  2R9R B;  4IT5 A;  3HKE A;  5KUK A;  4RUE A;  2XAQ A;  1SZT A;  2HEP A;  2JJ2 G;  1KP3 A;  1ORQ C;  5LXT B;  2ZE5 A;  2WLI A;  3ETD A;  2ZIM A;  1SQQ H;  4FLW A;  1U97 A;  3FYE B;  3FB5 C;  4LFA O;  3CS5 A;  4GX1 A;  2G38 A;  3UCS C;  3FFQ A;  1E1Q G;  2AHZ A;  2DMX A;  1LR1 A;  3X2Q B;  1ROP A;  2KG7 A;  2P06 A;  2QR4 A;  1JX9 A;  1M56 C;  4FFB B;  1Z2G A;  1G4Y B;  3TGU H;  1NVP B;  3ABL C;  2A79 B;  3LUT B;  2Y69 C;  2QTO A;  3OGI B;  2LJ2 A;  2OTJ V;  1U96 A;  4UB8 Z;  4H13 B;  4N21 A;  2F4V B;  4JTC B;  2VWJ A;  2CH7 B;  1PM9 A;  5J9P C;  2CGO A;  1QNM A;  1SQP H;  4GKJ B;  5L3B A;  1Q6H A;  1KBH A;  1BS3 A;  3SDL A;  4X8A A;  1IBL O;  3ZX6 A;  1EM1 A;  2IJH A;  5JCO A;  3E8B A;  5JH7 A;  2BTQ B;  4U7N A;  4YJ3 A;  2C2A A;  3ZRW B;  1K97 A;  3KZI Z;  2Q4P A;  3FB6 C;  1M4U A;  2CE4 A;  1VQM V;  2Q0A A;  2WA4 A;  3ZRW A;  1H8H G;  3AK1 A;  3SYC A;  4AHC A;  4O4J B;  3OD4 A;  2IBZ H;  5B66 Z;  1KU9 A;  2A7W A;  1HNX O;  4X66 O;  3A0B Z;  4LFC B;  4FIP C;  3CXC U;  2KSD A;  1L0N H;  4I4T B;  1H2N A;  1PL4 A;  3HB3 B;  4ZI7 B;  4O4H A;  1YSC A;  1XMO O;  2QKC A;  2ZKO A;  4R6Z A;  2HR3 A;  3QO7 A;  2Y48 A;  5KMG A;  1XNQ B;  4U3J A;  1L1F A;  4O2A B;  2WLI B;  1ZTE A;  4Z1V A;  1TA8 A;  2IU0 A;  4DR1 B;  1CP9 A;  4LF5 O;  1AI7 A;  3JSL A;  3G67 A;  4DV5 B;  5IYB O;  1KYO F;  2JIZ G;  2CTP A;  2EBO A;  2AZ0 A;  2ATK C;  1ZWI C;  3BCC H;  5DM6 V;  1HWY A;  2GDS A;  1B04 A;  1MG1 A;  3ABL B;  4LWS A;  3ABK B; 
#chains in the Genus database with same CATH homology
 3DXR A;  2BSK A;  3DXR B;  3CJH A;  2BSK B;  3CJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...