3DXRB

Crystal structure of the yeast inter-membrane space chaperone assembly tim9.10
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
b'SQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial import inner membrane translocase subunit TIM9
publication title Structural and functional requirements for activity of the Tim9-Tim10 complex in mitochondrial protein import
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.810 Mainly Alpha Orthogonal Bundle Helix Hairpins Mitochondrial import inner membrane translocase subunit tim13 like domains 3dxrB00
3CJHA 2BSKB 3DXRB 2BSKA 3DXRA 3CJHB
chains in the Genus database with same CATH superfamily
4JPRA 3TCUA 2RDCA 4IGGA 3CYOA 1OCOB 2JVDA 4MSWC 3SJAC 1ENVA 4TV9B 4HZ3A 2CGNA 2XOKG 4LH7A 2GV9A 1PPJH 1GM8A 3ZRWA 4FFBB 1P7BA 2OIEA 3E8GA 2LFSA 5B1BC 3CCSV 2A0LA 2WLLA 3CSXA 2PI4A 1KBHA 4MVOA 4F6RB 3OMAB 2AXTZ 2IW5A 3HKBB 5JH7B 1WN7A 5KUKA 4OX9O 2GTAA 1AR1B 1GH6A 4JAVA 2UU9O 1F51A 2Q7EA 1NS1A 3JD4A 4G28B 5FLXN 2UUCB 4X1KB 3QNEA 2YIBD 3CXCU 2IM9A 3K3WA 3IAYA 1GM9A 4JI5O 3T1YB 4LF6O 4IYIA 4U7OA 2ZD9A 1MZFA 1K33A 4L87A 1KYOF 2W0XA 2BSKB 1LUVA 1EZVH 5F2VO 2Q68A 2UXBB 1MA1A 2XASA 4X62O 4DUZB 1DF5A 5IWAB 4X65B 2VS0A 1XEQA 1NVPB 1ZSPA 4DV1B 1ZAUA 2EIMC 1M57C 3K9SA 2NN4A 4JZ2A 3JD0A 2IBZH 1B06A 3H1HH 3F5TA 3WU2Z 2XNDG 4MW8A 5LMNB 1MOFA 3L75H 2QWQB 4CS2A 4NYKA 4N21A 3Q4HA 4H13B 5EBMC 1DK1A 4IHJB 3RW0A 1KD1W 2NR5A 1SRYA 1UJWB 4B7KA 3SYQA 5J2TB 2E76B 2HHHB 5JCOC 1XQ8A 1JMKC 4DR4O 3WB2A 1KB9F 3E8HA 3B8MA 4ZI7A 1BGYH 1MSDA 5CBHA 1VP7A 2V4DA 4LF5O 3G80A 4R6ZA 1Y6XA 3CEIA 4U3JA 1R3LC 4J80A 1MNGA 2JJ2G 4O4IA 2DYRC 5IJ0B 5GW7A 1M56B 1OCCC 2C2AA 4X89A 5BY1A 4AHCA 1TGOA 1JA8A 4B7EA 4YIOA 2NLJC 2OCCB 2WA3A 1QVGU 4JI6O 1SKVA 4PJ0Z 3RYFA 4DW0A 3X2QB 4P30A 2Q67A 5K1XA 2BTOA 1BMFG 2QGNA 1JPXA 4YXWG 5IY5C 1TA8A 5L3DA 2DN9A 3PJSK 3SPJA 4Q20A 3ETQA 5IDJA 2BTQA 5KHIA 3OAAG 2V1DA 2IJHA 5EZYB 3MHHC 5CBFA 4BW9A 4LF8O 1GTOA 2QKSA 1Z2GA 1BT8A 2EIKC 2P5OA 1HDJA 1G1XB 1SA0B 4D7TA 4JYAO 1N8RW 4JYCA 1K5QA 2GTSA 3ABLC 3OR6C 3G6BA 3MDSA 4ZBMA 4IL6Z 4UUJC 4WF9V 1EBOA 5C8YB 3CCRV 4DR6B 2UXNA 1PNMA 5LHHA 1ORQC 2A06H 3OTOO 3K5NA 4RQEA 1RSOB 3B4SA 3D36A 3QF7A 3TETA 5LMUB 3D3QA 2L6LA 4TV9A 3ML0A 2QA4V 4WFGA 1VQMV 3HKCA 2QWNB 3ZRXA 2AHYA 3DC5A 4JYBA 3CCMV 4FFBA 2EINC 2Q8VA 1NTKH 1QU7A 4EB6B 3ETEA 4MVZA 1XNQB 3RYCA 1SETA 4GLXA 5H2FZ 5GONB 3UQ8A 4WFFA 2PYLA 2MK3A 4I9QA 3G67A 3HKBA 5JH7A 5LP6C 4X1YB 3CCQV 4U7NA 4DV6O 1S5JA 2AZ0A 1QBZA 2JK5C 4FLYA 1RFYA 2EJ7A 1VQ5V 4OPHA 3CHXA 4QE7A 3K57A 4KFMA 3CRMA 4ZHQB 4TOIA 1N33O 1IBKB 4FPPA 2NNUA 2ZIMA 4LBEC 1N34O 1N32O 3CCLV 2LGWA 2Q7HA 2XAJA 1YI2V 1K34A 1XMQB 1P7GA 2EULA 1PP9H 1Q43A 3KG2A 3TXSA 1YDXA 5B66Z 4I4TB 3JAKB 3E83A 5B1OA 1PKXA 2KB1A 2CDYA 3CE2A 2EZOA 3KKYA 1EZJA 4LFCB 4PA4A 4B3SB 4NR1A 4PDRA 4E4EA 3G71V 1AJPA 3WG7C 4MS2A 4JI7B 1IBLB 1WA8B 4DV5O 1XL4A 4B3TB 3UO3A 2QE7G 2QKAA 3ABKB 5IJ0A 4LF7B 4IT5A 1H2MA 2OTLV 4UFZA 4X20A 3BABA 3T1HB 2X7RB 1FD9A 4JZGA 1PM9A 4UVCA 1OCZC 4CS4A 1HW7A 3EFFK 2IH1C 4UV9A 4QNHB 1FXHA 3H01A 4JI4O 4JV5B 5JJEB 1R3JC 2JS5A 3SYOA 3K5LA 5KAIZ 3STZC 1GAXA 2HJDA 4DR2O 2Y0IA 2ZM6B 1ROPA 5EZYA 3CPWU 2EILB 1GM7A 3LDCA 2ARHA 2JJ1G 1XMOO 3P32A 1H38A 1SA0A 4C7UA 1RPRA 2A7WA 3VQVA 1GRJA 3ZBHA 3D36C 1P84F 1V9PA 1NR7A 1W0JG 3L74H 1OCOC 1R6TA 1PD3A 3LNMB 2B5UA 2H8PC 2HKOA 4I50B 5KA6A 2HEPA 3E35A 1X4TA 1HNWB 2JGUA 1IVSA 1NH2B 3BY6A 1RSOA 1TVKB 2CTPA 3OW2U 1I08A 5BMVA 4MVSA 4I9WA 4WFBV 2F95B 3K79A 3W7XA 1VF5B 1FS0G 1CP9A 3RVYA 4PELA 1Q81W 3K58A 5JQGB 2YXYA 4DUYB 4DV0B 1ZWIC 3ZRSA 4EB6A 3MD0A 3E86A 2L35A 2QTSA 3CWBH 4J9YB 3DXRA 3FFQA 4MW3A 3WB0A 2N74A 1U96A 5LBQA 3JD2A 4A5UB 2D3OW 4I0XB 3E2EA 4X1YA 1R6KA 4O4LB 3BPZA 2QWRB 5LGUA 3SPCA 1IURA 1AJQA 1SERA 4UB8Z 4ICGA 2ADPA 1AROP 5EIBD 2F66C 1IBMO 2WA4A 4WCEV 2IH3C 1DF4A 2RMKB 3FB5C 3AG2B 4HBNA 4IYHA 4ZHQA 2GUZA 2ATKC 3JALB 3JYCA 4K0KB 4JTDB 4O4HB 3BRCA 3L9DA 3CC7V 1RPOA 1XHZA 2FL4A 1HR0O 2LJ2A 2E74B 4LFAB 1WB8A 2BE3A 5H6RA 1GN3A 2XT9A 4GKJO 3GVMA 4I55B 4FMTA 1VIBA 5HFMA 1VF7A 5LOVB 5JCOA 2ZT9B 3FYIB 4I4TA 1YTFB 2EIJB 3NR7A 4HNAA 3U0ZA 4MVUA 2N04A 5FNVB 4O4JB 1Q5OA 3A2FA 4J42A 1AILA 2HG5C 2R70A 4J7JA 1FXVA 3ASOB 2K1EA 4CH4A 5D5QA 1US6A 1TUBA 4N23A 2P4VA 5KX5B 1FAFA 1Q3EA 4BIZA 4K35A 3RN4A 2CK3G 4I7ZB 1NR1A 4H37A 1DTOA 1ZLZA 3K0GA 4LC1A 2OCCC 4PD4F 1WP8A 5KMGB 3X2QC 4G27B 4RUFA 1XHXA 1PV0A 4FM2A 2LW7A 4JI8B 3K5MA 1KMIZ 4OX9B 2N05A 1AR4A 3WB1A 3GWKC 2UU9B 3K59A 5IYZB 3CCUV 2ZDIA 1IXMA 2VWKA 4JI5B 4LF6B 4O2BB 3ETGA 5JVDB 2JEUA 1D2DA 2P90A 2LW1A 3CRRA 3K0DA 2DQ3A 2GBOA 4O2AB 5IE9A 3ZX6A 4CH6A 2RCVA 3W7TA 2YEVB 4TSFG 1L1FA 2MW2B 2GSMB 1OCRB 1NTMH 4ZOLB 3JARA 1V55B 4Z1VA 1WNSA 3IGAC 4F4LA 2LP7A 2Q9LA 1P49A 2OTJV 4B3MO 1FJGO 3I5DA 4I50A 1M5IA 2AGAA 1BE3H 4UCSA 1YVWA 4IIJB 1TVKA 3HKDB 3M7MX 1KKCA 1DGSA 5EBLC 1B04A 2R9RB 1E79G 4DK1A 2P22C 3E8BA 3SPGA 3ZHVA 3N27A 1VQOV 3OE7G 4DR4B 1YEWA 4Q6GA 5JQGA 5LP6A 1IZ3A 3C90A 4DXWA 3IC9A 3ZEDA 3HKEB 3AK2A 5H6QA 3CMEV 4JI3O 4LF5B 1HP8A 4DRXA 1K9MW 2PY5A 1R73A 3ZN0A 3SYPA 2IU0A 1SZXA 1W2BU 1RP3B 4O4LA 1VQ8V 4QPJA 3ZHTA 3I56V 1PNKA 4D6TH 1J95A 4JI6B 2YC0A 2AHZA 1XOUA 1WAZA 2KG7B 2ZR3A 5CB4A 2P4KA 1NT2B 3TK1A 2BOBC 4O4HA 4MTFA 1N0NA 4F6EA 2OIGA 2FKXA 4LF8B 2EJRA 1QVFU 2B1GA 3MHSC 1S76D 3P30A 1I94O 2Y48A 4X88A 3E8FA 3KCXA 3QO7A 3A0BZ 4RAIA 4JYAB 5LOVA 4DV7O 1PL4A 1F23A 1NQTA 3JD3A 2XAQA 2FTKA 1JVMA 1W59A 5ITZB 2UUBB 4WFEA 3CC2V 3JAMN 2UUCO 5E1AC 1VQLV 1YZBA 3SJQC 4O4JA 2BOCC 4EFBA 3T1YO 2ZE7A 1N4CA 4BIOA 3E22B 2X0LA 3OEHG 3HPLC 2Q69A 1VQ4V 3BCCH 5EIBC 4X66O 3LSQA 5E79Z 1NKDA 1YJ9V 2VQFB 2EZPA 2UUAO 3ABKC 2WAMA 1FFTB 1VEWA 4CC5A 3UT5B 1XNRB 3ICXA 1GN6A 1ZL8A 5BR8B 4YJ2B 3H1JH 3ZHQA 3ZS8C 5KMGA 3S3XA 4TQFA 3A8TA 1YCIA 2JGDB 3H1IH 4LWSB 4YHHO 3BAAA 3A0HZ 5L3CA 4RQFA 4FLTA 4JAAA 1KU9A 1R1BA 2FB5A 1K8AW 2ZDIC 3OT7A 1K4DC 2F4VB 3JSLA 2WPDG 2EILC 1AI4A 2CTQA 3N2KB 4QGPA 1AR5A 1U97A 2ZXWB 1HNZB 1YF2A 1Q8IA 4GUNA 3W7WA 3ABMB 4FK5C 3ZMUA 1FXKB 2IU3A 2ZNIA 1KP2A 4PA6A 1OZ0A 5JVDA 1WP7A 3TJTA 2B1IA 1NVPD 4DR7O 4O2AA 1BQ0A 1G4YB 4X1IB 4WFAV 1SQXH 4J41A 1N34B 1N32B 1VARA 3WFVA 2E5LB 1BCCH 1H2GA 4ZOLA 1S5LZ 1NI8A 1BS3A 4GCZA 3F7YC 3L70H 4F6RA 3OGCC 4YIPA 1G6UA 2R72A 4IIJA 3JATB 3HKDA 1WPBA 1EN6A 5EC2C 2HJFC 5LXTB 2LFRA 1VF6C 4K8ZA 2E75B 1MG1A 4TQDA 4X1KA 1H2SB 4NB5A 1QR9A 4FVMA 4PDVA 1FFXB 2ITCC 4LF9O 1IDSA 1D5NA 3BEHA 2BSKA 2DE0X 4DV5B 4PV1B 2RJZA 4DR3O 3QVNA 4LR3A 5LL6Y 1Y67A 3CRQA 3UCSC 3AG2C 3DTUB 2Q4PA 4X9QA 3LUTB 1VQ9V 1B3QA 4FZ1A 5B5EZ 5FL7G 5EYPB 1M1KW 4YJ3B 3L73H 2Z5UA 5CA0B 1AI6A 2WLJA 3AG3B 1COWG 4JI4B 3DC6A 3LSSA 5LGNA 2KG7A 4IHJA 4MTGA 4P9OA 2CAZC 5J2TA 3B40A 3RGBA 5A9GA 2EIJC 3TGUH 1YJWV 1S3JA 4YY3O 1XMOB 2F1MA 1R3KC 4QJFB 2WSSG 3ZCCA 3AG1B 3CJHB 2ZINA 2F23A 2QSAA 3ABTA 3AEIA 3ASOC 3FD9A 2Y4TA 3SYCA 5JJJB 3JD1A 2UXDO 4CH3A 3JAWB 3P3PA 4B3RO 2CTWA 1Z5VA 4R8CA 3ZMSA 4Z2WA 5CA3A 3H9VA 3E22A 2VQEB 2PGGA 3QO5A 1J5EO 2PZSA 3J7AU 5EK0A 1FYJA 2YIAA 3B2EE 2YICA 2WLMA 5EC1C 2PF4E 4QE9A 1EFRG 3UO2A 2HVJC 4FJCC 3UT5A 4X64O 2YXLA 3U11A 1F7YA 1IXBA 4G2KA 2CE4A 4TUYB 1SESA 4H0LB 4AILC 1HNXO 2JGDA 4LWSA 3J80N 1KC8W 2WLIB 1Q6HA 3K06A 3T2MA 3N2GB 3W7SA 1MMMA 2YIDA 3H1LH 2DJVA 1O9HA 1PNLA 4B3SO 5C8YA 2XTAA 3N2KA 1LUWA 2DYSB 5L3FA 1SQPH 1IBMB 2CUGA 1WLEA 1YITV 2FYUH 4RO2A 2QDOA 3CRAA 1AI5A 5B3SB 1OCRC 4PA3A 4JI0O 4NXMB 3FB8C 1IBLO 3R66A 1V55C 3KZIZ 3O65A 3K03A 5B1AB 4B3TO 3BFRA 4NTWA 2HVKC 4X1IA 1Q6IA 4LF7O 1K97A 3BVOA 1HR0B 4GYCB 4B08A 4DR5O 3KCYA 1YXBA 1K7DA 5IYCO 4OPAA 2QM7A 4U3FH 1H8EG 5HFLA 2DOSA 3OR7C 1ZUQA 5GONA 2YUAA 3H1KH 1Q86W 4FZ0A 1N36B 3K5OA 2IJKA 4FLWA 3IC7A 5LHIA 4LF4O 1XL6A 2QR4A 2KQXA 1H2KA 2WLKA 1O9GA 1PL0A 2ZNJA 4FM1A 1LR1A 3K9AA 4NXNO 3RT3C 5KHHA 3OTFA 1XI1A 5KHKA 1BQZA 1F4NA 2QTOA 1FFXA 1H8HG 5H5NA 5JWPA 2OYQA 2QWPB 1VQPV 1EN5A 1L8DA 3CS5A 3OMIB 1E1QG 3QG5A 2EX3A 3JCUZ 2OWOA 4XBFA 2R9AA 1YJNV 4MT8A 4H33A 4KUMA 4DV3B 2CH7B 4DV2B 5EYPA 1NBMG 3AG4B 4YJ3A 3JAKA 5CA0A 4DO2A 1CXZB 2ITDC 4LFBO 2BCCH 4BW5A 1LNQA 2XUMA 2JEXA 1WJZA 4Z1MG 2F93B 4DV4O 1I5YA 3LDDA 4JASA 1KQSU 4JI2O 1UFIA 2Y69B 3OMNB 4FLXA 4O4IB 4JI1O 1AP5A 3THOA 1M56C 1AB3A 1Q7YW 2ETNA 1NH2D 3HR0A 1OJHA 5L3BA 2WLNA 1XREA 1WA8A 4WBNB 3VOUA 5D5PA 3RVZA 4GKKO 1M4UA 2QM8A 4KL1A 4B3MB 3RYFB 1IX9A 1FJGB 1SC5B 2XAFA 3CMAV 3AK1A 2YI8A 5L3GA 4KHPO 3L72H 2CGOA 4NVPA 5K1PA 3A0RA 3M99B 3RYIB 2DW4A 1EN4A 2GDSA 2DWDC 3S3WA 4NKGB 3OD4A 4PI2A 4OGQB 2Q0AA 1K92A 3FB7C 3JSNA 5CMUA 3VQWA 4DYLA 2IJJA 3SGIA 4JTAB 1AJNA 1H2LA 4JI3B 4ZKIA 1Q90D 1S5HC 4K3AA 2ZCEA 3CCVV 4GZRB 3ABUA 2WLIA 1GN4A 4DR1O 2ZXWC 4AQYO 3QO8A 4TT3G 4X62B 2ZQMA 3N2GA 5BXZA 3ABMC 2UXCO 1FXKC 1FPOA 3EXAA 2YDEA 3VQXA 1R3IC 3RYHB 4P2ZA 2P7TC 4JAUA 4CBCA 4PI0A 2Z3YA 1V54B 3SDLA 4UCVA 3HKCB 2ZE5A 1GO3F 1CEZA 3EVKA 5CA1B 1QHTA 1WPXA 5IT9N 2X6BA 3RYCB 2Q6AA 2PUSA 4UB6Z 1WB7A 1JFFB 3ZHSA 1YTFD 2ODMA 4UV8A 2UXXA 1I94B 3P3NA 4JI8O 4X8AA 1VF6A 4GT1A 4DV7B 1Y74B 2AW9A 4HAMA 4CC6A 3C3SA 3CX5F 4QIWF 3FX7A 2H94A 2M7WA 3DSQA 1QQCA 3LNNA 4PDMA 4I0XA 1XUQA 3OM3B 1URFA 2HR3A 2K9PA 5IYDO 2Y0PA 3APQA 2HFEC 1Q82W 4EKWA 2QWOB 4NTYA 1JJ2U 5DECA 2DMXA 4X66B 4NTXA 2UUAB 1QNMA 3LSUA 1S77D 1GKFA 3JALA 4BR6A 5J9PC 2XAHA 2YXHA 4UCOA 3E89A 3RFRA 4MTOA 1JQ0A 4YHHB 3AG3C 4I55A 4XDLA 5CN0A 1QCEA 1R6NA 3I55V 5DM6V 3AG7A 3R65A 5KUMA 1S72V 1BHBA 1GN2A 1OV9A 2CH7A 4DW1A 2QM4A 4DK0A 1VMGA 5GTIZ 5H9CA 4WFHA 5FNVA 3ZJZA 1YIJV 3J81N 3OTOB 4HYOA 4W4LA 1HWYA 4BIUA 3MAQA 1RM1B 3OUSA 3AG1C 5EBWC 3CCEV 2YIBA 2YI9A 3ASNB 5KX5A 1NU1H 4DR7B 2R9IA 1K73W 2UXBO 4DUZO 1THZA 2H3OA 2QJ1A 5IWAO 4X65O 4KP4A 1TUEB 1QLEB 3O9OA 4X20B 4DV1O 4CS3A 3JASB 1OHHG 4WBNA 3JCZA 3OFNG 5LGTA 5FPRA 5LMNO 4PHZA 2GHYA 3FB6C 2PYJA 5KHJA 4RWUA 5CBGA 4UCTA 3DGEA 4DV6B 3RYIA 4AI8A 3RWRD 3GWOA 2HHHO 2KSDA 5IYZA 2X6CA 5KHGA 1K4CC 3AK3A 4GX2A 3C3TA 2E3CA 4EEQA 2VRZA 2QKCA 4O2BA 2KKWA 1N33B 2W0FC 4LF9B 3ZN1A 5BZBA 2AZ2A 2UUBO 3ZRVA 3BA9A 1KUQA 5LYJB 2CTRA 2YEVA 2DYSC 4DR3B 3VBBA 5IYBO 3T4ZA 4OXSA 5LHGA 5LA6B 2O57A 3RYHA 5B3SC 5B1BB 3BA8A 2WWWA 5BMVB 3B09A 2RNBA 4BWAA 4JF3A 5B1AC 4MVMA 2VQFO 2ZE6A 4LP8A 4R50A 3CD6V 3IJ4A 1Q6UA 2IJIA 3EHBB 1XNRO 5CA1A 5IJ9B 2JDIG 5BR8O 3FYEB 3OGIB 2ILMA 4JYYA 3FKSG 2LGQA 4H44B 3CCJV 3T4DA 2F43G 3DXRB 1JFFA 3CRCA 1MABG 4ABMA 4YY3B 2P06A 1SQQH 3HKEA 1Y74A 4FIPC 2F4VO 3G4SV 4DR6O 1FKAO 1I7FA 3ZMVA 1NZ6A 1HNZO 2UXDB 4B3RB 2WLHA 1BHAA 3FAVB 1X59A 4K8XA 2EIMB 3D8CA 3PN1A 1M57B 5DEDA 1MZEA 5LMUO 1Y76B 2GUZB 1M93A 3W7UA 3B8NA 4J9ZB 4BAYA 1SQBH 1J5EB 3ZMZA 1K5SA 5KA5A 2A9HA 1D5AA 2ADQB 2E5LO 4X64B 1XNQO 2ZR2A 4E2LA 2YS8A 4DR2B 4GX0A 4J11A 1T5EA 3AG4C 4J10A 1HNXB 1VQ6V 4HNAB 3ZIAG 3IFXA 4L8JA 1DLBA 3CB2A 1M9NA 2XAGA 5GTHZ 2JIZG 4CZZA 2X6AA 4UVAA 5A2QN 2VWJA 4LNUB 5ITZA 1NJIW 1TUBB 3VQYA 1A32A 2DYRB 2Y69C 2B9ZA 5AG2A 4PA9A 1OCCB 4UXNA 1SF9A 4TV8B 2P67A 1N0JA 2RQ6A 3B77A 1UPGA 1IBKO 4JI0B 1YSCA 5KAFZ 2Z0AA 2W6IG 4CH5A 2A3QA 4QPKA 3OEEG 5J2UB 1XMQO 5IY5B 4DR5B 1ZX3A 1QLNA 2JS3A 2HLDG 1JJOA 3JASA 2LQTA 1NTZH 4YJ2A 3T1CA 4D7SA 4FLZA 4JTCB 3ZHUA 2YSUB 3SPHA 1VQ7V 2EIKB 4LF4B 1AVMA 3ABLB 3M8AA 2OT5A 3U10A 4LFCO 2JRIA 1QR8A 3HB3B 3OUFA 5KLVH 4NXNB 1FXKA 1Z5WA 3APOA 1JR9A 3ZRWB 4JI7O 3JARB 3SPIA 2WLLB 4ZIBA 1XILA 1AP6A 1SZTA 1K3EA 1V54C 5B1NA 5LYJA 1VQNV 1JOYA 4ASUG 4UCUA 4XDJA 2EINB 5LA6A 4MTXA 3T1HO 4GKJB 1JCHA 2VQEO 4PA7A 3F7VC 2V7QG 3ZHRA 1ZTEA 2FMLA 4EFEA 1B6QA 3K04A 1F4MA 2HP8A 2A79B 4J7KA 3TXQA 1GK9A 3L71H 4FLUA 2D2CB 1S0VA 4JV5O 1SQGA 3JATA 1BSMA 2EBOA 4LFBB 5LP6B 4XDKA 2W6JG 5IJ9A 5LXTA 5JJNB 2DWEC 1KECA 1Y4MA 2ZM6O 1L0NH 1JX9A 1P4RA 4DRXB 4DV4B 5TISZ 1MSWD 1Y66A 2PI5A 5FPOA 4JI2B 4P9PA 4JGSA 4TWKA 4UCRA 4JI1B 4R7CA 4RUEA 5C93A 3UM7A 4J7ZA 2Q7GA 3RBZA 4GKKB 1VQKV 1HNWO 4UVBA 1G8MA 3QTCA 3ZMTA 2XHBA 4MVRA 3FAVA 4KHPB 1BZKA 3Q4HB 4MVQA 4NXMO 2ZKOA 5CB4B 1Y76A 2Q5ZA 3K08A 2Y4UA 3CC4V 4I5SA 2M6YA 3CXHF 3LDEA 4DUYO 4DV0O 4ZI7B 3SJBC 1KP3A 1SQVH 1XBLA 4FFKA 1N36O 1SS3A 4FM0A 1E1RG 3ETDA 4U3JB 2Q73A 2P6JA 3UKMA 3NXSA 4KXRA 4DR1B 1AI7A 2RN9A 1TAEA 4AQYB 2Q0OC 3WG7B 1KKDA 4FLVA 5DN6G 3CJHA 3CP1A 2UXCB 2LO1A 1RM1C 1XDCA 2ZE8A 4LNUA 4LH6A 2ZIOA 2G38A 2OCHA 3SR2C 3JAWA 3ASNC 1M90W 3D3IA 4GX5A 4LCUC 5L3EA 4TV8A 4W4KA 1QLEC 3STLC 1CPYA 2QEXV 4K0KO 2BTQB 1OCZB 1ZL8B 1EM1A 3BHPA 5J2UA 3F5WC 4LFAO 1YHQV 3SYAA 1I0HA 2DQ0A 1GMGA 1H2NA 1BL8A 2PTMA 1L0LH 4DV3O 1SQFA 3GB7C 1W0KG 4DV2O 4TUYA 3G6EV 1I5XA 3SJCC 4GX1A 4PDLA
chains in the Genus database with same CATH topology
3CJHA 2BSKB 3DXRB 2BSKA 3DXRA 3CJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJH A;  2BSK B;  3DXR B;  2BSK A;  3DXR A;  3CJH B; 
#chains in the Genus database with same CATH topology
 4JPR A;  3TCU A;  2RDC A;  4IGG A;  3CYO A;  1OCO B;  2JVD A;  4MSW C;  3SJA C;  1ENV A;  4TV9 B;  4HZ3 A;  2CGN A;  2XOK G;  4LH7 A;  2GV9 A;  1PPJ H;  1GM8 A;  3ZRW A;  4FFB B;  1P7B A;  2OIE A;  3E8G A;  2LFS A;  5B1B C;  3CCS V;  2A0L A;  2WLL A;  3CSX A;  2PI4 A;  1KBH A;  4MVO A;  4F6R B;  3OMA B;  2AXT Z;  2IW5 A;  3HKB B;  5JH7 B;  1WN7 A;  5KUK A;  4OX9 O;  2GTA A;  1AR1 B;  1GH6 A;  4JAV A;  2UU9 O;  1F51 A;  2Q7E A;  1NS1 A;  3JD4 A;  4G28 B;  5FLX N;  2UUC B;  4X1K B;  3QNE A;  2YIB D;  3CXC U;  2IM9 A;  3K3W A;  3IAY A;  1GM9 A;  4JI5 O;  3T1Y B;  4LF6 O;  4IYI A;  4U7O A;  2ZD9 A;  1MZF A;  1K33 A;  4L87 A;  1KYO F;  2W0X A;  2BSK B;  1LUV A;  1EZV H;  5F2V O;  2Q68 A;  2UXB B;  1MA1 A;  2XAS A;  4X62 O;  4DUZ B;  1DF5 A;  5IWA B;  4X65 B;  2VS0 A;  1XEQ A;  1NVP B;  1ZSP A;  4DV1 B;  1ZAU A;  2EIM C;  1M57 C;  3K9S A;  2NN4 A;  4JZ2 A;  3JD0 A;  2IBZ H;  1B06 A;  3H1H H;  3F5T A;  3WU2 Z;  2XND G;  4MW8 A;  5LMN B;  1MOF A;  3L75 H;  2QWQ B;  4CS2 A;  4NYK A;  4N21 A;  3Q4H A;  4H13 B;  5EBM C;  1DK1 A;  4IHJ B;  3RW0 A;  1KD1 W;  2NR5 A;  1SRY A;  1UJW B;  4B7K A;  3SYQ A;  5J2T B;  2E76 B;  2HHH B;  5JCO C;  1XQ8 A;  1JMK C;  4DR4 O;  3WB2 A;  1KB9 F;  3E8H A;  3B8M A;  4ZI7 A;  1BGY H;  1MSD A;  5CBH A;  1VP7 A;  2V4D A;  4LF5 O;  3G80 A;  4R6Z A;  1Y6X A;  3CEI A;  4U3J A;  1R3L C;  4J80 A;  1MNG A;  2JJ2 G;  4O4I A;  2DYR C;  5IJ0 B;  5GW7 A;  1M56 B;  1OCC C;  2C2A A;  4X89 A;  5BY1 A;  4AHC A;  1TGO A;  1JA8 A;  4B7E A;  4YIO A;  2NLJ C;  2OCC B;  2WA3 A;  1QVG U;  4JI6 O;  1SKV A;  4PJ0 Z;  3RYF A;  4DW0 A;  3X2Q B;  4P30 A;  2Q67 A;  5K1X A;  2BTO A;  1BMF G;  2QGN A;  1JPX A;  4YXW G;  5IY5 C;  1TA8 A;  5L3D A;  2DN9 A;  3PJS K;  3SPJ A;  4Q20 A;  3ETQ A;  5IDJ A;  2BTQ A;  5KHI A;  3OAA G;  2V1D A;  2IJH A;  5EZY B;  3MHH C;  5CBF A;  4BW9 A;  4LF8 O;  1GTO A;  2QKS A;  1Z2G A;  1BT8 A;  2EIK C;  2P5O A;  1HDJ A;  1G1X B;  1SA0 B;  4D7T A;  4JYA O;  1N8R W;  4JYC A;  1K5Q A;  2GTS A;  3ABL C;  3OR6 C;  3G6B A;  3MDS A;  4ZBM A;  4IL6 Z;  4UUJ C;  4WF9 V;  1EBO A;  5C8Y B;  3CCR V;  4DR6 B;  2UXN A;  1PNM A;  5LHH A;  1ORQ C;  2A06 H;  3OTO O;  3K5N A;  4RQE A;  1RSO B;  3B4S A;  3D36 A;  3QF7 A;  3TET A;  5LMU B;  3D3Q A;  2L6L A;  4TV9 A;  3ML0 A;  2QA4 V;  4WFG A;  1VQM V;  3HKC A;  2QWN B;  3ZRX A;  2AHY A;  3DC5 A;  4JYB A;  3CCM V;  4FFB A;  2EIN C;  2Q8V A;  1NTK H;  1QU7 A;  4EB6 B;  3ETE A;  4MVZ A;  1XNQ B;  3RYC A;  1SET A;  4GLX A;  5H2F Z;  5GON B;  3UQ8 A;  4WFF A;  2PYL A;  2MK3 A;  4I9Q A;  3G67 A;  3HKB A;  5JH7 A;  5LP6 C;  4X1Y B;  3CCQ V;  4U7N A;  4DV6 O;  1S5J A;  2AZ0 A;  1QBZ A;  2JK5 C;  4FLY A;  1RFY A;  2EJ7 A;  1VQ5 V;  4OPH A;  3CHX A;  4QE7 A;  3K57 A;  4KFM A;  3CRM A;  4ZHQ B;  4TOI A;  1N33 O;  1IBK B;  4FPP A;  2NNU A;  2ZIM A;  4LBE C;  1N34 O;  1N32 O;  3CCL V;  2LGW A;  2Q7H A;  2XAJ A;  1YI2 V;  1K34 A;  1XMQ B;  1P7G A;  2EUL A;  1PP9 H;  1Q43 A;  3KG2 A;  3TXS A;  1YDX A;  5B66 Z;  4I4T B;  3JAK B;  3E83 A;  5B1O A;  1PKX A;  2KB1 A;  2CDY A;  3CE2 A;  2EZO A;  3KKY A;  1EZJ A;  4LFC B;  4PA4 A;  4B3S B;  4NR1 A;  4PDR A;  4E4E A;  3G71 V;  1AJP A;  3WG7 C;  4MS2 A;  4JI7 B;  1IBL B;  1WA8 B;  4DV5 O;  1XL4 A;  4B3T B;  3UO3 A;  2QE7 G;  2QKA A;  3ABK B;  5IJ0 A;  4LF7 B;  4IT5 A;  1H2M A;  2OTL V;  4UFZ A;  4X20 A;  3BAB A;  3T1H B;  2X7R B;  1FD9 A;  4JZG A;  1PM9 A;  4UVC A;  1OCZ C;  4CS4 A;  1HW7 A;  3EFF K;  2IH1 C;  4UV9 A;  4QNH B;  1FXH A;  3H01 A;  4JI4 O;  4JV5 B;  5JJE B;  1R3J C;  2JS5 A;  3SYO A;  3K5L A;  5KAI Z;  3STZ C;  1GAX A;  2HJD A;  4DR2 O;  2Y0I A;  2ZM6 B;  1ROP A;  5EZY A;  3CPW U;  2EIL B;  1GM7 A;  3LDC A;  2ARH A;  2JJ1 G;  1XMO O;  3P32 A;  1H38 A;  1SA0 A;  4C7U A;  1RPR A;  2A7W A;  3VQV A;  1GRJ A;  3ZBH A;  3D36 C;  1P84 F;  1V9P A;  1NR7 A;  1W0J G;  3L74 H;  1OCO C;  1R6T A;  1PD3 A;  3LNM B;  2B5U A;  2H8P C;  2HKO A;  4I50 B;  5KA6 A;  2HEP A;  3E35 A;  1X4T A;  1HNW B;  2JGU A;  1IVS A;  1NH2 B;  3BY6 A;  1RSO A;  1TVK B;  2CTP A;  3OW2 U;  1I08 A;  5BMV A;  4MVS A;  4I9W A;  4WFB V;  2F95 B;  3K79 A;  3W7X A;  1VF5 B;  1FS0 G;  1CP9 A;  3RVY A;  4PEL A;  1Q81 W;  3K58 A;  5JQG B;  2YXY A;  4DUY B;  4DV0 B;  1ZWI C;  3ZRS A;  4EB6 A;  3MD0 A;  3E86 A;  2L35 A;  2QTS A;  3CWB H;  4J9Y B;  3DXR A;  3FFQ A;  4MW3 A;  3WB0 A;  2N74 A;  1U96 A;  5LBQ A;  3JD2 A;  4A5U B;  2D3O W;  4I0X B;  3E2E A;  4X1Y A;  1R6K A;  4O4L B;  3BPZ A;  2QWR B;  5LGU A;  3SPC A;  1IUR A;  1AJQ A;  1SER A;  4UB8 Z;  4ICG A;  2ADP A;  1ARO P;  5EIB D;  2F66 C;  1IBM O;  2WA4 A;  4WCE V;  2IH3 C;  1DF4 A;  2RMK B;  3FB5 C;  3AG2 B;  4HBN A;  4IYH A;  4ZHQ A;  2GUZ A;  2ATK C;  3JAL B;  3JYC A;  4K0K B;  4JTD B;  4O4H B;  3BRC A;  3L9D A;  3CC7 V;  1RPO A;  1XHZ A;  2FL4 A;  1HR0 O;  2LJ2 A;  2E74 B;  4LFA B;  1WB8 A;  2BE3 A;  5H6R A;  1GN3 A;  2XT9 A;  4GKJ O;  3GVM A;  4I55 B;  4FMT A;  1VIB A;  5HFM A;  1VF7 A;  5LOV B;  5JCO A;  2ZT9 B;  3FYI B;  4I4T A;  1YTF B;  2EIJ B;  3NR7 A;  4HNA A;  3U0Z A;  4MVU A;  2N04 A;  5FNV B;  4O4J B;  1Q5O A;  3A2F A;  4J42 A;  1AIL A;  2HG5 C;  2R70 A;  4J7J A;  1FXV A;  3ASO B;  2K1E A;  4CH4 A;  5D5Q A;  1US6 A;  1TUB A;  4N23 A;  2P4V A;  5KX5 B;  1FAF A;  1Q3E A;  4BIZ A;  4K35 A;  3RN4 A;  2CK3 G;  4I7Z B;  1NR1 A;  4H37 A;  1DTO A;  1ZLZ A;  3K0G A;  4LC1 A;  2OCC C;  4PD4 F;  1WP8 A;  5KMG B;  3X2Q C;  4G27 B;  4RUF A;  1XHX A;  1PV0 A;  4FM2 A;  2LW7 A;  4JI8 B;  3K5M A;  1KMI Z;  4OX9 B;  2N05 A;  1AR4 A;  3WB1 A;  3GWK C;  2UU9 B;  3K59 A;  5IYZ B;  3CCU V;  2ZDI A;  1IXM A;  2VWK A;  4JI5 B;  4LF6 B;  4O2B B;  3ETG A;  5JVD B;  2JEU A;  1D2D A;  2P90 A;  2LW1 A;  3CRR A;  3K0D A;  2DQ3 A;  2GBO A;  4O2A B;  5IE9 A;  3ZX6 A;  4CH6 A;  2RCV A;  3W7T A;  2YEV B;  4TSF G;  1L1F A;  2MW2 B;  2GSM B;  1OCR B;  1NTM H;  4ZOL B;  3JAR A;  1V55 B;  4Z1V A;  1WNS A;  3IGA C;  4F4L A;  2LP7 A;  2Q9L A;  1P49 A;  2OTJ V;  4B3M O;  1FJG O;  3I5D A;  4I50 A;  1M5I A;  2AGA A;  1BE3 H;  4UCS A;  1YVW A;  4IIJ B;  1TVK A;  3HKD B;  3M7M X;  1KKC A;  1DGS A;  5EBL C;  1B04 A;  2R9R B;  1E79 G;  4DK1 A;  2P22 C;  3E8B A;  3SPG A;  3ZHV A;  3N27 A;  1VQO V;  3OE7 G;  4DR4 B;  1YEW A;  4Q6G A;  5JQG A;  5LP6 A;  1IZ3 A;  3C90 A;  4DXW A;  3IC9 A;  3ZED A;  3HKE B;  3AK2 A;  5H6Q A;  3CME V;  4JI3 O;  4LF5 B;  1HP8 A;  4DRX A;  1K9M W;  2PY5 A;  1R73 A;  3ZN0 A;  3SYP A;  2IU0 A;  1SZX A;  1W2B U;  1RP3 B;  4O4L A;  1VQ8 V;  4QPJ A;  3ZHT A;  3I56 V;  1PNK A;  4D6T H;  1J95 A;  4JI6 B;  2YC0 A;  2AHZ A;  1XOU A;  1WAZ A;  2KG7 B;  2ZR3 A;  5CB4 A;  2P4K A;  1NT2 B;  3TK1 A;  2BOB C;  4O4H A;  4MTF A;  1N0N A;  4F6E A;  2OIG A;  2FKX A;  4LF8 B;  2EJR A;  1QVF U;  2B1G A;  3MHS C;  1S76 D;  3P30 A;  1I94 O;  2Y48 A;  4X88 A;  3E8F A;  3KCX A;  3QO7 A;  3A0B Z;  4RAI A;  4JYA B;  5LOV A;  4DV7 O;  1PL4 A;  1F23 A;  1NQT A;  3JD3 A;  2XAQ A;  2FTK A;  1JVM A;  1W59 A;  5ITZ B;  2UUB B;  4WFE A;  3CC2 V;  3JAM N;  2UUC O;  5E1A C;  1VQL V;  1YZB A;  3SJQ C;  4O4J A;  2BOC C;  4EFB A;  3T1Y O;  2ZE7 A;  1N4C A;  4BIO A;  3E22 B;  2X0L A;  3OEH G;  3HPL C;  2Q69 A;  1VQ4 V;  3BCC H;  5EIB C;  4X66 O;  3LSQ A;  5E79 Z;  1NKD A;  1YJ9 V;  2VQF B;  2EZP A;  2UUA O;  3ABK C;  2WAM A;  1FFT B;  1VEW A;  4CC5 A;  3UT5 B;  1XNR B;  3ICX A;  1GN6 A;  1ZL8 A;  5BR8 B;  4YJ2 B;  3H1J H;  3ZHQ A;  3ZS8 C;  5KMG A;  3S3X A;  4TQF A;  3A8T A;  1YCI A;  2JGD B;  3H1I H;  4LWS B;  4YHH O;  3BAA A;  3A0H Z;  5L3C A;  4RQF A;  4FLT A;  4JAA A;  1KU9 A;  1R1B A;  2FB5 A;  1K8A W;  2ZDI C;  3OT7 A;  1K4D C;  2F4V B;  3JSL A;  2WPD G;  2EIL C;  1AI4 A;  2CTQ A;  3N2K B;  4QGP A;  1AR5 A;  1U97 A;  2ZXW B;  1HNZ B;  1YF2 A;  1Q8I A;  4GUN A;  3W7W A;  3ABM B;  4FK5 C;  3ZMU A;  1FXK B;  2IU3 A;  2ZNI A;  1KP2 A;  4PA6 A;  1OZ0 A;  5JVD A;  1WP7 A;  3TJT A;  2B1I A;  1NVP D;  4DR7 O;  4O2A A;  1BQ0 A;  1G4Y B;  4X1I B;  4WFA V;  1SQX H;  4J41 A;  1N34 B;  1N32 B;  1VAR A;  3WFV A;  2E5L B;  1BCC H;  1H2G A;  4ZOL A;  1S5L Z;  1NI8 A;  1BS3 A;  4GCZ A;  3F7Y C;  3L70 H;  4F6R A;  3OGC C;  4YIP A;  1G6U A;  2R72 A;  4IIJ A;  3JAT B;  3HKD A;  1WPB A;  1EN6 A;  5EC2 C;  2HJF C;  5LXT B;  2LFR A;  1VF6 C;  4K8Z A;  2E75 B;  1MG1 A;  4TQD A;  4X1K A;  1H2S B;  4NB5 A;  1QR9 A;  4FVM A;  4PDV A;  1FFX B;  2ITC C;  4LF9 O;  1IDS A;  1D5N A;  3BEH A;  2BSK A;  2DE0 X;  4DV5 B;  4PV1 B;  2RJZ A;  4DR3 O;  3QVN A;  4LR3 A;  5LL6 Y;  1Y67 A;  3CRQ A;  3UCS C;  3AG2 C;  3DTU B;  2Q4P A;  4X9Q A;  3LUT B;  1VQ9 V;  1B3Q A;  4FZ1 A;  5B5E Z;  5FL7 G;  5EYP B;  1M1K W;  4YJ3 B;  3L73 H;  2Z5U A;  5CA0 B;  1AI6 A;  2WLJ A;  3AG3 B;  1COW G;  4JI4 B;  3DC6 A;  3LSS A;  5LGN A;  2KG7 A;  4IHJ A;  4MTG A;  4P9O A;  2CAZ C;  5J2T A;  3B40 A;  3RGB A;  5A9G A;  2EIJ C;  3TGU H;  1YJW V;  1S3J A;  4YY3 O;  1XMO B;  2F1M A;  1R3K C;  4QJF B;  2WSS G;  3ZCC A;  3AG1 B;  3CJH B;  2ZIN A;  2F23 A;  2QSA A;  3ABT A;  3AEI A;  3ASO C;  3FD9 A;  2Y4T A;  3SYC A;  5JJJ B;  3JD1 A;  2UXD O;  4CH3 A;  3JAW B;  3P3P A;  4B3R O;  2CTW A;  1Z5V A;  4R8C A;  3ZMS A;  4Z2W A;  5CA3 A;  3H9V A;  3E22 A;  2VQE B;  2PGG A;  3QO5 A;  1J5E O;  2PZS A;  3J7A U;  5EK0 A;  1FYJ A;  2YIA A;  3B2E E;  2YIC A;  2WLM A;  5EC1 C;  2PF4 E;  4QE9 A;  1EFR G;  3UO2 A;  2HVJ C;  4FJC C;  3UT5 A;  4X64 O;  2YXL A;  3U11 A;  1F7Y A;  1IXB A;  4G2K A;  2CE4 A;  4TUY B;  1SES A;  4H0L B;  4AIL C;  1HNX O;  2JGD A;  4LWS A;  3J80 N;  1KC8 W;  2WLI B;  1Q6H A;  3K06 A;  3T2M A;  3N2G B;  3W7S A;  1MMM A;  2YID A;  3H1L H;  2DJV A;  1O9H A;  1PNL A;  4B3S O;  5C8Y A;  2XTA A;  3N2K A;  1LUW A;  2DYS B;  5L3F A;  1SQP H;  1IBM B;  2CUG A;  1WLE A;  1YIT V;  2FYU H;  4RO2 A;  2QDO A;  3CRA A;  1AI5 A;  5B3S B;  1OCR C;  4PA3 A;  4JI0 O;  4NXM B;  3FB8 C;  1IBL O;  3R66 A;  1V55 C;  3KZI Z;  3O65 A;  3K03 A;  5B1A B;  4B3T O;  3BFR A;  4NTW A;  2HVK C;  4X1I A;  1Q6I A;  4LF7 O;  1K97 A;  3BVO A;  1HR0 B;  4GYC B;  4B08 A;  4DR5 O;  3KCY A;  1YXB A;  1K7D A;  5IYC O;  4OPA A;  2QM7 A;  4U3F H;  1H8E G;  5HFL A;  2DOS A;  3OR7 C;  1ZUQ A;  5GON A;  2YUA A;  3H1K H;  1Q86 W;  4FZ0 A;  1N36 B;  3K5O A;  2IJK A;  4FLW A;  3IC7 A;  5LHI A;  4LF4 O;  1XL6 A;  2QR4 A;  2KQX A;  1H2K A;  2WLK A;  1O9G A;  1PL0 A;  2ZNJ A;  4FM1 A;  1LR1 A;  3K9A A;  4NXN O;  3RT3 C;  5KHH A;  3OTF A;  1XI1 A;  5KHK A;  1BQZ A;  1F4N A;  2QTO A;  1FFX A;  1H8H G;  5H5N A;  5JWP A;  2OYQ A;  2QWP B;  1VQP V;  1EN5 A;  1L8D A;  3CS5 A;  3OMI B;  1E1Q G;  3QG5 A;  2EX3 A;  3JCU Z;  2OWO A;  4XBF A;  2R9A A;  1YJN V;  4MT8 A;  4H33 A;  4KUM A;  4DV3 B;  2CH7 B;  4DV2 B;  5EYP A;  1NBM G;  3AG4 B;  4YJ3 A;  3JAK A;  5CA0 A;  4DO2 A;  1CXZ B;  2ITD C;  4LFB O;  2BCC H;  4BW5 A;  1LNQ A;  2XUM A;  2JEX A;  1WJZ A;  4Z1M G;  2F93 B;  4DV4 O;  1I5Y A;  3LDD A;  4JAS A;  1KQS U;  4JI2 O;  1UFI A;  2Y69 B;  3OMN B;  4FLX A;  4O4I B;  4JI1 O;  1AP5 A;  3THO A;  1M56 C;  1AB3 A;  1Q7Y W;  2ETN A;  1NH2 D;  3HR0 A;  1OJH A;  5L3B A;  2WLN A;  1XRE A;  1WA8 A;  4WBN B;  3VOU A;  5D5P A;  3RVZ A;  4GKK O;  1M4U A;  2QM8 A;  4KL1 A;  4B3M B;  3RYF B;  1IX9 A;  1FJG B;  1SC5 B;  2XAF A;  3CMA V;  3AK1 A;  2YI8 A;  5L3G A;  4KHP O;  3L72 H;  2CGO A;  4NVP A;  5K1P A;  3A0R A;  3M99 B;  3RYI B;  2DW4 A;  1EN4 A;  2GDS A;  2DWD C;  3S3W A;  4NKG B;  3OD4 A;  4PI2 A;  4OGQ B;  2Q0A A;  1K92 A;  3FB7 C;  3JSN A;  5CMU A;  3VQW A;  4DYL A;  2IJJ A;  3SGI A;  4JTA B;  1AJN A;  1H2L A;  4JI3 B;  4ZKI A;  1Q90 D;  1S5H C;  4K3A A;  2ZCE A;  3CCV V;  4GZR B;  3ABU A;  2WLI A;  1GN4 A;  4DR1 O;  2ZXW C;  4AQY O;  3QO8 A;  4TT3 G;  4X62 B;  2ZQM A;  3N2G A;  5BXZ A;  3ABM C;  2UXC O;  1FXK C;  1FPO A;  3EXA A;  2YDE A;  3VQX A;  1R3I C;  3RYH B;  4P2Z A;  2P7T C;  4JAU A;  4CBC A;  4PI0 A;  2Z3Y A;  1V54 B;  3SDL A;  4UCV A;  3HKC B;  2ZE5 A;  1GO3 F;  1CEZ A;  3EVK A;  5CA1 B;  1QHT A;  1WPX A;  5IT9 N;  2X6B A;  3RYC B;  2Q6A A;  2PUS A;  4UB6 Z;  1WB7 A;  1JFF B;  3ZHS A;  1YTF D;  2ODM A;  4UV8 A;  2UXX A;  1I94 B;  3P3N A;  4JI8 O;  4X8A A;  1VF6 A;  4GT1 A;  4DV7 B;  1Y74 B;  2AW9 A;  4HAM A;  4CC6 A;  3C3S A;  3CX5 F;  4QIW F;  3FX7 A;  2H94 A;  2M7W A;  3DSQ A;  1QQC A;  3LNN A;  4PDM A;  4I0X A;  1XUQ A;  3OM3 B;  1URF A;  2HR3 A;  2K9P A;  5IYD O;  2Y0P A;  3APQ A;  2HFE C;  1Q82 W;  4EKW A;  2QWO B;  4NTY A;  1JJ2 U;  5DEC A;  2DMX A;  4X66 B;  4NTX A;  2UUA B;  1QNM A;  3LSU A;  1S77 D;  1GKF A;  3JAL A;  4BR6 A;  5J9P C;  2XAH A;  2YXH A;  4UCO A;  3E89 A;  3RFR A;  4MTO A;  1JQ0 A;  4YHH B;  3AG3 C;  4I55 A;  4XDL A;  5CN0 A;  1QCE A;  1R6N A;  3I55 V;  5DM6 V;  3AG7 A;  3R65 A;  5KUM A;  1S72 V;  1BHB A;  1GN2 A;  1OV9 A;  2CH7 A;  4DW1 A;  2QM4 A;  4DK0 A;  1VMG A;  5GTI Z;  5H9C A;  4WFH A;  5FNV A;  3ZJZ A;  1YIJ V;  3J81 N;  3OTO B;  4HYO A;  4W4L A;  1HWY A;  4BIU A;  3MAQ A;  1RM1 B;  3OUS A;  3AG1 C;  5EBW C;  3CCE V;  2YIB A;  2YI9 A;  3ASN B;  5KX5 A;  1NU1 H;  4DR7 B;  2R9I A;  1K73 W;  2UXB O;  4DUZ O;  1THZ A;  2H3O A;  2QJ1 A;  5IWA O;  4X65 O;  4KP4 A;  1TUE B;  1QLE B;  3O9O A;  4X20 B;  4DV1 O;  4CS3 A;  3JAS B;  1OHH G;  4WBN A;  3JCZ A;  3OFN G;  5LGT A;  5FPR A;  5LMN O;  4PHZ A;  2GHY A;  3FB6 C;  2PYJ A;  5KHJ A;  4RWU A;  5CBG A;  4UCT A;  3DGE A;  4DV6 B;  3RYI A;  4AI8 A;  3RWR D;  3GWO A;  2HHH O;  2KSD A;  5IYZ A;  2X6C A;  5KHG A;  1K4C C;  3AK3 A;  4GX2 A;  3C3T A;  2E3C A;  4EEQ A;  2VRZ A;  2QKC A;  4O2B A;  2KKW A;  1N33 B;  2W0F C;  4LF9 B;  3ZN1 A;  5BZB A;  2AZ2 A;  2UUB O;  3ZRV A;  3BA9 A;  1KUQ A;  5LYJ B;  2CTR A;  2YEV A;  2DYS C;  4DR3 B;  3VBB A;  5IYB O;  3T4Z A;  4OXS A;  5LHG A;  5LA6 B;  2O57 A;  3RYH A;  5B3S C;  5B1B B;  3BA8 A;  2WWW A;  5BMV B;  3B09 A;  2RNB A;  4BWA A;  4JF3 A;  5B1A C;  4MVM A;  2VQF O;  2ZE6 A;  4LP8 A;  4R50 A;  3CD6 V;  3IJ4 A;  1Q6U A;  2IJI A;  3EHB B;  1XNR O;  5CA1 A;  5IJ9 B;  2JDI G;  5BR8 O;  3FYE B;  3OGI B;  2ILM A;  4JYY A;  3FKS G;  2LGQ A;  4H44 B;  3CCJ V;  3T4D A;  2F43 G;  3DXR B;  1JFF A;  3CRC A;  1MAB G;  4ABM A;  4YY3 B;  2P06 A;  1SQQ H;  3HKE A;  1Y74 A;  4FIP C;  2F4V O;  3G4S V;  4DR6 O;  1FKA O;  1I7F A;  3ZMV A;  1NZ6 A;  1HNZ O;  2UXD B;  4B3R B;  2WLH A;  1BHA A;  3FAV B;  1X59 A;  4K8X A;  2EIM B;  3D8C A;  3PN1 A;  1M57 B;  5DED A;  1MZE A;  5LMU O;  1Y76 B;  2GUZ B;  1M93 A;  3W7U A;  3B8N A;  4J9Z B;  4BAY A;  1SQB H;  1J5E B;  3ZMZ A;  1K5S A;  5KA5 A;  2A9H A;  1D5A A;  2ADQ B;  2E5L O;  4X64 B;  1XNQ O;  2ZR2 A;  4E2L A;  2YS8 A;  4DR2 B;  4GX0 A;  4J11 A;  1T5E A;  3AG4 C;  4J10 A;  1HNX B;  1VQ6 V;  4HNA B;  3ZIA G;  3IFX A;  4L8J A;  1DLB A;  3CB2 A;  1M9N A;  2XAG A;  5GTH Z;  2JIZ G;  4CZZ A;  2X6A A;  4UVA A;  5A2Q N;  2VWJ A;  4LNU B;  5ITZ A;  1NJI W;  1TUB B;  3VQY A;  1A32 A;  2DYR B;  2Y69 C;  2B9Z A;  5AG2 A;  4PA9 A;  1OCC B;  4UXN A;  1SF9 A;  4TV8 B;  2P67 A;  1N0J A;  2RQ6 A;  3B77 A;  1UPG A;  1IBK O;  4JI0 B;  1YSC A;  5KAF Z;  2Z0A A;  2W6I G;  4CH5 A;  2A3Q A;  4QPK A;  3OEE G;  5J2U B;  1XMQ O;  5IY5 B;  4DR5 B;  1ZX3 A;  1QLN A;  2JS3 A;  2HLD G;  1JJO A;  3JAS A;  2LQT A;  1NTZ H;  4YJ2 A;  3T1C A;  4D7S A;  4FLZ A;  4JTC B;  3ZHU A;  2YSU B;  3SPH A;  1VQ7 V;  2EIK B;  4LF4 B;  1AVM A;  3ABL B;  3M8A A;  2OT5 A;  3U10 A;  4LFC O;  2JRI A;  1QR8 A;  3HB3 B;  3OUF A;  5KLV H;  4NXN B;  1FXK A;  1Z5W A;  3APO A;  1JR9 A;  3ZRW B;  4JI7 O;  3JAR B;  3SPI A;  2WLL B;  4ZIB A;  1XIL A;  1AP6 A;  1SZT A;  1K3E A;  1V54 C;  5B1N A;  5LYJ A;  1VQN V;  1JOY A;  4ASU G;  4UCU A;  4XDJ A;  2EIN B;  5LA6 A;  4MTX A;  3T1H O;  4GKJ B;  1JCH A;  2VQE O;  4PA7 A;  3F7V C;  2V7Q G;  3ZHR A;  1ZTE A;  2FML A;  4EFE A;  1B6Q A;  3K04 A;  1F4M A;  2HP8 A;  2A79 B;  4J7K A;  3TXQ A;  1GK9 A;  3L71 H;  4FLU A;  2D2C B;  1S0V A;  4JV5 O;  1SQG A;  3JAT A;  1BSM A;  2EBO A;  4LFB B;  5LP6 B;  4XDK A;  2W6J G;  5IJ9 A;  5LXT A;  5JJN B;  2DWE C;  1KEC A;  1Y4M A;  2ZM6 O;  1L0N H;  1JX9 A;  1P4R A;  4DRX B;  4DV4 B;  5TIS Z;  1MSW D;  1Y66 A;  2PI5 A;  5FPO A;  4JI2 B;  4P9P A;  4JGS A;  4TWK A;  4UCR A;  4JI1 B;  4R7C A;  4RUE A;  5C93 A;  3UM7 A;  4J7Z A;  2Q7G A;  3RBZ A;  4GKK B;  1VQK V;  1HNW O;  4UVB A;  1G8M A;  3QTC A;  3ZMT A;  2XHB A;  4MVR A;  3FAV A;  4KHP B;  1BZK A;  3Q4H B;  4MVQ A;  4NXM O;  2ZKO A;  5CB4 B;  1Y76 A;  2Q5Z A;  3K08 A;  2Y4U A;  3CC4 V;  4I5S A;  2M6Y A;  3CXH F;  3LDE A;  4DUY O;  4DV0 O;  4ZI7 B;  3SJB C;  1KP3 A;  1SQV H;  1XBL A;  4FFK A;  1N36 O;  1SS3 A;  4FM0 A;  1E1R G;  3ETD A;  4U3J B;  2Q73 A;  2P6J A;  3UKM A;  3NXS A;  4KXR A;  4DR1 B;  1AI7 A;  2RN9 A;  1TAE A;  4AQY B;  2Q0O C;  3WG7 B;  1KKD A;  4FLV A;  5DN6 G;  3CJH A;  3CP1 A;  2UXC B;  2LO1 A;  1RM1 C;  1XDC A;  2ZE8 A;  4LNU A;  4LH6 A;  2ZIO A;  2G38 A;  2OCH A;  3SR2 C;  3JAW A;  3ASN C;  1M90 W;  3D3I A;  4GX5 A;  4LCU C;  5L3E A;  4TV8 A;  4W4K A;  1QLE C;  3STL C;  1CPY A;  2QEX V;  4K0K O;  2BTQ B;  1OCZ B;  1ZL8 B;  1EM1 A;  3BHP A;  5J2U A;  3F5W C;  4LFA O;  1YHQ V;  3SYA A;  1I0H A;  2DQ0 A;  1GMG A;  1H2N A;  1BL8 A;  2PTM A;  1L0L H;  4DV3 O;  1SQF A;  3GB7 C;  1W0K G;  4DV2 O;  4TUY A;  3G6E V;  1I5X A;  3SJC C;  4GX1 A;  4PDL A; 
#chains in the Genus database with same CATH homology
 3CJH A;  2BSK B;  3DXR B;  2BSK A;  3DXR A;  3CJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...