3DXSX

Crystal structure of a copper binding domain from hma7, a p-type atpase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'MRKIQVGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEEIEDAGFEAEILAEEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase RAN1
publication title Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 20
structure length 74
sequence length 74
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dxsX00
2OKQA 1TL5A 2CRLA 1X0PA 2KKHA 2N7YA 2ZDOA 2XMWA 5B0CA 2GGPB 4FNHA 5KAKA 5T7LA 1SI9A 2OFGX 5B0EA 1YRXA 1KQKA 5A6WA 1MWZA 1S6OA 2K2PA 3QMQA 4Y2IA 4OJ1A 1CC8A 3UDCA 2LDIA 2ASYA 3FMBA 1OPZA 2RMLA 5B0AA 2BBEA 1W2IA 2KT2A 1MWYA 1LQ9A 2KT3A 2FB0A 3TOQA 2GCFA 4A46A 1VQSA 4HI1A 1JWWA 2PGCA 1FESA 1N5VA 2IYIA 5B0FA 1P8GA 2K1RB 3QGPA 5B0GA 2HFOA 2BYCA 3MZIA 2AW0A 1FE4A 3CJKA 3GZ7A 2QLXA 3BDEA 2RILA 1ULRA 4HH1A 3WDOA 2BJEA 1R6YA 2GV1A 2XMJA 3TNVA 2KYZA 1YG0A 2FHMA 3HHLB 2G9OA 2L3MA 1N5QA 2LQBA 3BN7A 4A4JA 4ZA1A 2QIFA 3IWLA 4Q2MA 4F67A 1CPZA 2GGPA 3IWXA 4YEAA 1GXUA 2FTRA 4NL5A 2ROEA 2ROGA 3HHLC 1RJJA 3MCSA 1WD6A 2BUNA 3FRYA 5F0UA 1CC7A 4ZOSA 4YDXA 4FNIA 1SQEA 1Q53A 2LQ9A 3E8OA 4OJGA 1JK9B 1Y0HA 2QLWA 1SB6A 1YJVA 1KVIA 2HLTA 4DL0C 2OD6A 1IUJA 2HFNA 5B09A 1APSA 4OIXA 4A47A 1P6TA 1N5SA 3F44A 2K1RA 4Y2MA 3HDSA 3HHLD 2XMKA 2OMOA 2GO8A 2W4DA 3K7RA 2RSQA 3KNGA 1QUPA 1S6UA 2OP5A 1VQYA 4Y2KA 1YJUA 5IXUA 1OQ3A 3TRGA 2XMMA 3HHLA 2Q3PA 2HLUA 4OJ3A 1Q8LA 4DN9A 4EFAC 2QYCA 1TR0A 1FEEA 3HFKA 1Y9OA 4A48A 1GXTA 1YJRA 3HF5A 4Q2LA 4DPOA 2AJ1A 4U9RA 1XBWA 3T9NA 4NPOA 3LO3A 2PD1A 2GFFA 1AFIA 2IYGA 2XMVA 3VTIA 1FE0A 1U7LA 5F0WA 3KG0A 5T7LB 2AJ0A 2ACYA 1FVQA 4QOTA 1KVJA 1X7VA 2LXFA 1TUVA 3DXSX 3HX9A 3BM7A 1Q8BA 2K7KA 5B08A 5B0DA 2AP6A 1TL4A 4HI2A 2RU9A 1OSDA 2XMTA 2OAUA 2ZDPA 1Q4RA 3BF4A 1AW0A 3LGNA 1AFJA 1URRA 1Y3KA 2HQIA 2ROPA 5A6PA 2W4PA 1TZ0A 2HIQA 3I9ZA 2FIUA 2N4DA 2BJDA 2W4CA 2VH7A 2XMUA 1Y3JA 3FGVA 2IFXA 1N5TA 3DCAA 3CJKB 5B0BA 1FVSA 3BGUA 3KKFA 3LGMA 2JDJA 2GA7A 1YJTA 1OQ6A 2OFHX 4HL9A 2OD4A 1K0VA 3BR8A 2VV5A 4HH0A 2EW9A 3KG1A 4OJHA 5K9FA 2N4CA 1FD8A 3BB5A 2K7JA 1X8DA 1V3ZA
chains in the Genus database with same CATH superfamily
2CNLB 1R7IA 3CD6S 1R0AB 1SCJB 4ZCKA 2RKIA 1X4BA 4FYWB 4CLWA 3FUYA 3J81Y 4X4UA 4NXMF 3ZZPA 4MTPA 2JFDA 1HQUA 2K8GA 1RAFB 4LSLA 4DV4F 1S79A 5KFOA 2NPIA 4OHXA 2R42A 2J7WA 3DRXA 1RWKB 1VRUB 2VG5B 4LF6F 2UVWA 2KG1A 4O3NA 4N76A 2ZC3A 3AT1B 3ADAC 1S4FA 3VZIA 2PA8D 1GXTA 2CQ2A 3MCMA 4LT6A 3LAKA 2HQCA 4EZ9A 2EBEA 2V4JA 3VQTA 1VQ5S 4ZN3A 3HLUA 3UFCX 5B08A 1Q79A 2RQ4A 4NLUA 3E51A 5L39A 4LFCF 1VJQA 3W9JA 3PRVA 2JFKA 4TY8B 1R8CA 4H54A 4DSJA 1N32F 4RNHA 3CC4S 5KG5A 5CZXA 3FBBA 4DU7A 2KKHA 3M1VA 1CJUA 4F3OA 4CH7A 3JSYA 5C42A 3ZTOA 3C16B 1X5PA 5KG2A 3RZAA 3K8WA 1UTAA 1U6ZA 4M5KA 4OI2A 1TU0B 1L3VA 1UJ6A 1Q82T 3T9ZA 4DFMA 3Q8UA 2XY7A 4DV2F 1K47A 2E5HA 2MZSA 1S6PB 4AYBD 4PG5A 3VVTA 4P7VA 1VGYA 4LQ9A 3HSGA 2DO4A 2Z2LA 2MZRA 5F8NA 2E1MC 3GIJA 3RG6A 4OJ3A 3TZXA 3ZFVA 5AJ3J 3X3UA 1U7LA 2DPIA 2DGVA 1ZZNA 4USHA 2B9YA 3DGVA 2VJVA 2VKRA 2Z0GA 3GYXB 2QL5B 5LXYA 3SSSA 3G8QA 4JI5J 3TA0A 1BMQB 3PACA 4DR3J 4CNYA 4LRBA 3IR6B 1RADB 4OI6A 2D9PA 4RO0A 2DR5A 1WHXA 4ITSA 1F60B 1UVNA 1IXKA 4K4UA 1DY3A 3ZTQA 5HMZA 1QSSA 2V69A 3ZNJ1 3AJDA 2B4VA 3TAMB 3IWLA 2CQPA 4UF4A 3VQSA 4UOCA 3BO4A 2KFNA 1GEHA 3IR5B 1XWLA 5B09A 3FDSA 4Y2MA 3BYPA 3M2UA 3ZTSA 1LFWA 5F3TA 3MURP 1RT7A 3LF0A 1DQAA 4UZBA 3BJYA 1GMVA 1WDDA 2NUUG 4J90A 1O6XA 2HRUA 4X4RA 3J81j 1T02A 1VBXA 5BR8J 3JYTB 4USVA 4F0KA 2DXEA 4LUBA 3NS5A 4ZLPA 1OSDA 2FGCA 2BQRA 1IKWA 2W4PA 4FS1A 2GIRA 2W4CA 3IG1B 3H5XA 4Y6IA 1RB0A 3M2VA 2FPHX 3DLJA 2OFHX 1NAQA 2EW9A 4YB7A 1VRUA 1RTJB 1NCLA 2CA9A 2VODA 1FXRA 2B3TB 1PKUA 4BLGA 4EI2A 2JLFA 3H7HB 1LWCA 1UZHA 5ITHA 1ULRA 2FVPA 1NU4A 1FTCA 3SQOP 2DJWA 3I4PA 2BM1A 3HKWA 1S76D 4QCLA 3FC9A 2XLKA 3MPUB 2CQDA 4YB1P 3GIRA 2B56A 5KFNA 2KM8B 3SMZA 2H5EA 4A47A 2DB1A 2CNNB 2BANA 3FVYA 1Y5IB 1N52B 1GH8A 2YKAA 3MPWA 4DN9A 2ZH3A 4LVNP 3HFKA 4RNNA 2UXCF 3JQKA 2RRAA 3TAQA 2DBBA 2KRBA 5LOQA 1JLCB 1BQMB 4J9NA 1FWLA 5KFKA 1D3WA 3W9HA 2C2ZB 1URRA 2AQ4A 4I68A 2Z2MA 3ISZA 4GKJJ 3HHKA 3NS7B 4NMXA 2RUGA 2MQ8A 4JI6J 3SV4A 4ZIWA 1X9WA 2GGPB 1VQ8S 1HL6A 2XLIA 3QMQA 2VBZA 4DOZA 2R8JA 5KG7A 1U2CA 3PJ9A 2EKNA 5D6GA 3H25A 4QW8A 1YSJA 4M95A 1J5OA 4KT0C 1BHNA 4CLFA 2CPJA 1QD1A 3VV2B 2VQFF 3SSQA 1TAQA 3QGGA 4NZ7A 4TN2A 1RT1A 1AA1B 1OQ3A 3N6NA 1N5YA 4QBUA 3PV8A 4LMZA 2HWIA 5A8RB 5H9EK 4Y34A 1EIYB 1IJEB 2P6SA 3ILLA 4FF3A 3PX0A 3IM9A 1C1CA 3DU6A 5F0WA 5KTQA 2QC3A 5HSPA 2YQ3A 2CQ0A 4HEA9 3VAKA 3BKUA 1X9SA 2H54B 3D6MB 4KIAA 1HBOA 2E7XA 4NYZA 2GQQA 2NYHA 5HL7Q 9RUBA 2CPIA 3LOUA 1SVDA 2XYPB 4JB8B 3RU0A 2J7KA 3JAMU 2XWXA 3SV3A 1RACB 4DCPB 2Q6BA 3JYTA 4PPZA 8AT1B 5CD4A 2VQEJ 2AJ4A 2G13A 3E3XA 2WOMB 4NLWA 2DGQA 1K1QA 1FI4A 3G71S 5LMUF 5CCMA 4KGKA 3EZ5A 4EYIB 3OSNA 3W63A 4DV6F 4CLLA 4WFZA 5AE3A 5GADU 1FEEA 2WVBA 3EXYA 3NGDA 3HF5A 1XMQJ 2PD1A 1IR2A 1E6VB 2GFFA 4LF1A 4JI2J 1FDAA 2UVUA 4LR7A 4USIA 1VR6A 4BCAA 4ZLJA 4L76A 3DGPA 2RU9A 3UCZP 3KLFB 2CQ3A 2DH7A 2J9CA 3J7ZT 1S77D 2OI2A 3CCJS 1C0UB 3MCOA 3VAIA 3H5SA 4DV5J 3KMQA 3MR7A 2IIHA 2OPSA 4CYUB 4PXBA 2CJXB 2B4PA 1IBLJ 4ECTA 2E29A 2IPOB 1X4CA 1RT6A 3Q2TC 2DNGA 4QIGA 2E5LJ 3EDQB 2ILYA 2BOAA 1JLCA 2OJ3A 2RIJA 5KFYA 3CWJA 2YWWA 3MCSA 1BE4A 5DM6Q 1FO1A 5ETMA 2FLNA 4OJGA 4QIVA 2I5JA 1YJNS 1WTBA 2DNNA 1RQ0A 1P9YA 5DGBA 3B4DA 3QWUA 2XI2A 2J7UA 1JKHB 3PKMA 1HI0P 4KAIA 2X7IA 4USKA 3PVXA 3P6YC 3H98A 9ATCB 3I32A 4G65A 1L3KA 4MIBA 3TX0A 4P2XA 3W7BA 1SL1A 3BN4A 3R1LA 3MI7X 2ATCB 1Q78A 4NRUA 3SCIE 1H2UX 1S1UB 2ZZTA 2I8EA 1Y3JA 3UCUP 4M5NA 3HT0A 2V94A 4WBFA 4TNOA 1MROA 3QFWA 4IDKA 3PG9A 3OR1A 1GK8A 3OW2R 1NK4A 1PCAA 3DLLQ 3HK2A 1RWUA 2V6AA 3L3CA 3RTVA 2XNRA 3UNYA 3RYLA 1VRQC 2CDRB 5E7OB 4C6AA 4QQBA 1O0PA 2DR8A 2RQKA 1YJWS 3ETMA 4J91A 1X4FA 3LP0B 2VFRA 3POTB 1T11A 4JI7F 4RW9A 1KLMB 5KFRA 5C25A 3JS9A 3OL6A 5IT0A 4FVMA 3N6MA 5F8MA 2HHHJ 1TK0A 4ECYA 4NLRA 1JMTA 1AFIA 5EWGA 2N3LA 4U7UK 1LXNA 4CLUA 3W5ZA 3AD8C 3CCMS 2KYXA 4KTQA 1S48A 5HLFB 4C7QA 5CZVA 2RF2B 2EC2A 2LXUA 3Q89A 4ZPAA 1U48A 1UP1A 4NCBA 2BZ2A 2OFGX 4EK2A 1U0SA 3M32B 3BBFA 4K2JA 1R43A 3MOZA 1J5EJ 2J76E 1VQNS 1VQ6S 3TOQA 1CQMA 3QQCD 2XULA 2MSTA 2HNYB 3IN5A 3C8YA 2Y0SD 2G0CA 4NCGA 3CJRA 1E6VA 2B7CB 2QIFA 4Q2MA 5IZHA 5JUMA 2FTRA 1BY9A 4KH1B 5MLCV 1DZ5A 3QLHA 3A3NB 2NR0A 3GONA 2NS1B 3LUYA 3PHTA 1VCTA 3MPDA 1VIXA 2CJBA 1RBOB 5D78A 5G4DA 2F63A 1QTMA 4KH0B 2F3JA 2J6UA 1P27B 4ZKAA 4HI2A 3KHLA 2XMTA 4RUCA 3GFXA 3KKFA 2OMLA 3KWMA 2IDLA 3KG1A 4CNZA 3WHIA 2XMJA 1PIEA 4CM2A 1LW0A 4HHHA 3R7SB 2D3O1 1Q8KA 2A6OA 5D15A 5GADI 2CDQA 3ENVA 2K1RB 4I67A 2HNZB 3QT7A 5KFQA 4LIWA 1WF2A 4A8QA 4F67A 1VLYA 4WP9A 2VPWB 2FD2A 4UOFA 4ZVPB 4X4TA 2OEKA 4F3MA 1IUJA 1APSA 5I42A 2ZOGA 1N6QA 1S7HA 2G0JA 1TL7B 3HSDA 2H5IB 1U1RA 4A8SA 4HT5A 3K5OA 3AFGA 2OTJS 1QAXA 3T9NA 3SCLE 2AV5A 3B78A 3TO8A 3M8PB 1OPIA 3MUTP 5J1NA 5KFVA 1I5OB 1XMBA 2HGNA 2QT7A 4DQQA 2GS8A 1KQGB 2FLOA 2MQQA 4CDIA 2MY8A 3BQ2A 1KOOA 3KJNB 5DLFA 4X4VA 4XK8C 3CCUS 2IFXA 1N5TA 4JYAF 3GYNA 1FVSA 4PWDA 4FBTA 4E8UA 2CQCA 3FZ2A 1FERA 3LP0A 1L3UA 3AODA 3GV7B 2EK6A 2AEJA 4DQPA 4DX5A 3MD3A 4ZCLA 2ZBIA 2OLWA 2ASYA 1H6KX 1FDDA 1H2VZ 3ONQA 1DTQB 2HHVA 4RUHA 2DNZA 4B3OB 4ED2A 1T95A 3CJSA 1K0TA 1F9FA 3C6TA 5KFPA 2VB6A 3S6EA 1DRZA 2C2RA 2XGQA 1GTEA 1NK6A 3CCQS 4DL3A 3T3FA 4FKXA 4GVLA 4L73A 4TKTA 1IM4A 1FEHA 5ETRA 2C22A 2CFXA 1VJWA 1W25A 3FBFA 1TELA 4DR5J 3NOGA 3KJFB 3KK3B 2C2OB 4OYAA 2UUAJ 1MU2A 2QLFB 4GO5X 2HNYA 1RT5B 3AQOA 3FEXB 1LV5A 2DXDA 3IA0A 1TQLA 1D9FA 1N33F 2Y3YA 5K9FA 4X62F 1S1TB 1PSDA 5DG9A 4PUOA 3BQ1A 3UDCA 4NA2A 2DNOA 1JQGA 4YB5A 2E1AA 2ZH8A 4OHYA 5SZTA 1S9FA 2XY6A 1JJHA 2KTQA 2JOQA 3HHLB 1RTHB 4X64F 1A0OB 1UFLA 2UZAA 2UUCJ 3J7Z5 3QATA 2HNDB 4ZP6A 2ERRA 3W9IA 5A0YB 2COLA 2MPUA 2Z4PA 3KHHA 2BE7D 4FYXB 1N5SA 3K7RA 2J9DA 1U8WA 2P8IA 3OVSA 2E5JA 4Y2CA 2K3IA 4TYAA 1M5KC 1L3TA 3KDOA 1C1BB 2I38A 4USJC 4Y00A 2LXFA 1TL1B 4Q43A 2Z58B 4C3MA 4H4MB 4LSNA 3CJTA 4J9LA 2LQJA 2HMIA 5D0RA 3DOLA 2IMWP 3QSYB 4RX6A 4Q8EA 1KQKA 4YUDA 2IJNA 1N34J 2KT3A 3D54A 3GG0A 2JEJA 2Y9HA 1G1XA 3BDEA 4C48A 1UWAA 2F8EX 3KLIA 5C24B 1I1GA 3M8PA 2VA2A 2VG7B 4X4PA 2HSEB 2RH3A 4YP3A 2XBPA 2YNGA 4LF8J 1RXOB 1DAXA 6FDRA 3TQEA 1M5HA 1R8HA 2VOPA 2HVEA 4DS4A 2HHTA 1C0TA 4YQWA 1CJKB 5D3GA 1PGZA 1T9TA 3AQPA 1NB2A 3NWGA 5IM0B 4PRFA 5EDWA 1JXEA 4RKUC 3C6UB 1X0FA 3LGNA 1XC9A 2GHPA 2XMUA 4KQZA 1NH8A 1GTHA 1WF1A 5AJ3F 4C8LA 4DR2J 4HH0A 2DR7A 1UL3A 4WZQA 2FHKA 2DISA 1CJVB 1TTHB 1UPPA 2XYGB 3EUNA 4N47A 3KK3A 3D66A 2AGQA 1B7YB 5DDRC 2BR0A 1WEXA 2V0NA 2Q6CA 3DRRB 2HRTA 4ETXA 1N5QA 4JI4J 4DR1J 3UPFA 4IQMA 1RLCL 2Z57B 1ZZFA 2HLTA 1AUSL 1UFWA 2QEXS 2ZHOA 2RQCA 2MTLA 1FRHA 5IV3A 3AD7C 3W65A 2AMCB 4P9SA 3DLGB 4DLEA 5J2QB 4R8UB 3QGHA 4OX7A 4CT9A 4LBIA 3MR3A 1S1XB 3UNGC 1ZAVA 3UDEA 3M8YA 3AA9A 3ZZUA 4Z7CA 2QGFB 3V6DA 2HNDA 2DCUB 1WC1A 2OKQA 5J2NA 4M5JA 4NE9C 3DOMB 3G9CA 5T7LA 3F41A 1U26A 4MK8A 2D3OR 3T5KA 2QV6A 1R89A 3D67A 5M2UA 3H2LA 5FJ4A 2BW7A 2RILA 1VQ4S 1JLBB 4DG1B 1DURA 3MR6A 4ED7A 3TVZA 4LF9J 3MXHP 3Q8PB 1BD6A 5EN1A 1YTYA 1HQEB 1REGX 2NYIA 1Z2ZA 2JLEA 2FQQB 1RGVA 1UVLA 4YHHF 4J9VA 3PDNA 4DUYJ 4QWAA 4RW6A 4ID5A 5LMNF 4DV3J 4M8LA 2VKZG 3L9ZA 1QY7A 4FYVB 5DDPC 2RHSB 3UCGA 3I6PA 2CAJA 2J8AA 5CQGA 3VF0B 3AXKA 3OHBA 1HWUA 3WQPA 1TL3B 3MM5A 4RW7B 4AXIA 2D7SA 1ZYQA 3FBEA 2YKNA 3WX4A 4DR6J 2ZVSA 2F1FA 4ICLB 4HDHA 4GVBB 3KJQB 2ZE2B 4JOUA 2V50A 4FZVA 2GHWA 4JI0F 5J1EB 1O51A 1IKYA 4QR2A 5RUBA 2F8MA 4ED4A 2PFFB 4JI6F 1B64A 1RP5A 1H7XA 2RDJA 1S72S 2HIYA 5JVGQ 2DPJA 3UD4P 1RAAB 3IRXB 2UUBJ 4MH8A 3ENQA 3MAAA 2ABYA 3FJ2A 3BS9A 4FF2A 2VU5A 3O5TB 4WU2A 4PXDA 1S7IA 3PNIA 4RUBA 2MKHA 4USUA 3I5CA 2I6WA 1U25A 2R7TA 4USTA 1HARA 3I55S 1VQMS 4X65J 2WSEC 2YNFB 3BF4A 3D4JA 2Q79A 1NJYA 2E44A 5D77A 3QBCA 4Q0BA 3FNNA 4QU6A 2HAFA 3MM6B 1ZA1B 3BKFA 2MLXA 3TW0A 2GVZB 5AXLA 3NCPA 4X4QA 1V3ZA 2MKSA 4G1QA 1FRIA 3MF5A 4H4OA 3PX6A 2MZ1A 1SQFA 1PILA 3T6JA 2M5YA 1RAGB 4OQJA 1PYOB 2DY1A 2RJZA 4ED6A 1CULA 2A0FB 2Q43A 1DBDA 1RT4B 2C3OA 4O44B 1F1BB 3GG1A 3OVAA 4BC9A 2DNMA 5GMEA 3RR7A 5KFBA 3S1TA 3NGTA 2FLLA 2HFSA 3GTYX 4MKYA 1WHVA 2YNHB 1TV6B 3RAQA 3WX8A 3DI6B 1P6TA 1U8SA 4DWIA 2GJIA 1CQNA 4DQRA 2VQEF 3P8BB 2BMBA 2V8DA 3DOMA 4QR0A 2QSFA 2YX4A 5IQ6A 4CCHA 1EAYC 1KP6A 2XO6A 4F3QA 1IWAA 5KFHA 1ZETA 3PFEA 4NX9A 2MDAA 4P2SA 3J80U 5GAGU 2V2ZA 3MCNA 1XMQF 2H4WB 3DCAA 1P1TA 4ZVHA 1UVJA 2V8VA 1SQGA 1EP4A 4NCAA 2GQ2A 2HAIA 3C46A 4O3OA 2KVQE 2FVCA 3R7BB 1IBMJ 4CZCA 5DZ7A 4F7VA 2IRUA 1BXNA 4CIOA 1G4CA 2LDIA 1U1NA 1KHWA 4NWBA 3D7SB 3SXLA 4AXJA 4Z2XA 1P1LA 1P8GA 4I7FB 2BYCA 4F0HA 4DV5F 4A8OA 1FJ7A 5ETSA 2F4VJ 3OTDA 1GQEA 4I2PB 2AYMA 3CCLS 4DUTA 4YMEA 2VC0A 1Q7LB 4L3NA 1NRKA 2DHHA 4QWDA 1TL3A 4ZVUB 2BVZA 2DNQA 2E5LF 1HPZA 4DLGA 3OFEA 2O66A 2X3DA 1LXJA 2W9CA 3GSDA 1YJRA 3KLEB 3HZEA 3PTWA 4NASA 1JLQB 2QN6B 1YGYA 2HW3A 3IS9B 1RAEB 4O3QA 5J1EA 3MEGB 3ICLA 3NOCA 2YY3A 4HACB 3E2EA 1RWOB 4F02A 4XO0A 1VQOS 1BC6A 3FCHA 4HHUA 4DX6A 1KWMA 3HXMA 3CTRA 4DV1J 1HYSA 2E7WA 4F26A 1NM2A 2VONA 2YKPA 1X4DA 3M2RA 3TVYA 5A2QU 1S6QB 2GCFA 4DR7J 5L46A 4KRWA 2HBRB 4DSKA 4BHQA 3ZC4A 2MJNA 4B17A 1FF2A 1VQLS 5JXSA 5H9FK 3B6BA 1JB0C 3A8EA 1Q1KA 2HS3A 2KDOA 2OPPA 5K8MA 4N7TA 3MEEA 1LEOA 1QE1A 1HNWF 1TVRB 3RR8A 5IT9U 4WXOA 3MEDA 1ZM3A 3EPIA 2GAHC 2QRRA 2R3VA 2ZJPQ 1NH7A 3I0SA 2QMWA 1G6BA 4DEZA 4ANCA 4N41A 1GX5A 2I9SA 2NXCA 1VQ7S 1S10A 3BGOP 4DSIA 1DQ9A 5KFZA 1S57A 1RT4A 3F56A 5THWA 3P49B 2E1PA 4OZJA 1XMOJ 1RWNB 2FJVA 3QGIA 5CYQA 7AT1B 1QAJA 2J0WA 2ZM6J 2W9BA 3LA0A 1K0VA 1OQ6A 1FX2A 1Z4UA 1H72C 3SDEB 3Q22A 1M5VC 4B9NA 1HBNB 3DI6A 1DLOB 4DL6A 4OYIA 1HNVB 3P3DA 4ANEA 3I96A 1Q5VA 3OTEA 4C11A 4J5OA 4ES2A 4IG0B 2DXFA 3MPVA 4PG4A 1VLOA 5J2PA 3TWZA 3DXBA 3R7NB 4LF4J 2CPFA 1RTDA 4ID8A 4IFYA 1U6BA 1IJFB 2MSSA 1UZDA 2R7XA 1J5EF 4ZOSA 2J0XA 2LQ9A 1HD0A 1CEZA 3RB4A 4LR8A 4LF5J 4YR2A 2DT9A 3JAMY 3CF5Q 4C3KA 1PYTA 3NEKA 2CJ9A 1H73A 3PIPQ 3QAUA 5DZ6A 3DRSB 1PJ5A 2WONB 4ZP7A 5B7WA 1GMWD 5A8KA 4IR1A 3R5JB 3MDFA 3Q8SB 1O8BA 5U47A 4F36A 3DKDA 3VAHA 3I9ZA 1REVB 1S0OA 3A4TA 4P7TA 4DPUA 1UWBB 3BDPA 4KO0B 4ZHRA 3NY0A 1X0PA 2XZWA 3EE3A 4P6QA 2E5GA 1IKVB 2OPQB 2C3UA 4PYAA 3W2VB 3SQGA 4IUFA 4RLEA 2JC1A 1HNIA 3K89A 2KXNB 1ZTWA 3KJVA 3NGRA 2BQUA 2X1FA 3U27A 4HTIA 2FHJD 1JLEA 1FXLA 4ZPDA 5GAGI 4HACA 1T0TV 3FCVA 5CAAA 1YJ7A 2XSFA 1AB8A 2HBQB 4PEOA 1VRTA 3LWLA 4HDGA 1TKZB 3CC2S 1VC5A 2P9EA 4P52A 2UVVA 1SKUB 4FF1A 4OLOA 1N54B 4WU3A 2W7AA 4I64A 2ZH5A 3UO0A 4OZNA 2BE2B 4KBIA 1H74A 2AJ1A 4F50A 1T9WA 2AEFA 3TUPA 5HBMA 3VTIA 4RNFA 4EO8A 3K17A 4QOTA 4CO3A 4C8NA 1KVJA 1Y4ZB 3AJ2A 4YR0A 5FLXU 1ROFA 2B5JB 4UTGA 4FXDA 3UDVA 3CD7A 5F8IA 1NK7A 2OSRA 4KB7A 1WC4A 4LIRA 2BDPA 1GMUA 4ZPWR 2XHWA 4K4ZA 2YTCA 4NZ6A 3GCWP 4F4AA 3MAHA 2HQDA 3VCDA 5K8OA 5EGYA 2RVJA 3PX4A 4IRCA 1SC4B 2DKOB 3D3BJ 3IMQJ 4FYYB 2VG6B 4B3RJ 2PEHA 4CO1A 3OLBA 1FRXA 4QWBA 1TKDA 3L7PA 3IWXA 2M8DB 5LSLA 2XZDB 2BXJA 4PKDB 4YY3J 2JLGA 2XWYA 3GWCA 4Y28C 3EVWA 2LXIA 1ZAXA 2RHQB 3THVA 3KYLA 1QUPA 2LFVA 1CJTB 1FKOA 4NEYA 4QYZJ 1RWVB 1S49A 3CCVS 2DNPA 3DOKA 1GAOA 2MY7A 2IAJB 3V4IB 1D0EA 2JJ4D 4N56A 1JLFB 4UOHA 1PBAA 2H9ZA 4IFVA 4NLPA 4R5PA 3KHGA 1S1WA 3H5UA 2R7VA 4D3HA 4HTJA 3GJQB 3K5PA 2UUAF 3PHEA 5LSOA 1N0VC 4CLTA 4AFFA 2GZOA 4B3MF 1R6VA 3R6LB 2BQ3A 2RD5C 5DLGA 4M5HA 3ZXWA 3IM8A 2IVMA 3GIIA 2ZJQQ 4DUZJ 2JL9A 3HFVA 1PC4A 2C3MA 1BWEA 2VD3A 1RT2B 3MR5A 3D0HE 2WONA 3MMAB 3UVJB 4DV0J 5KOWA 4YOEA 3FEYB 4KV8A 4FYDA 4DV7J 1UEVA 2HQGA 2FVSA 4DQIA 4CH1A 3O2IA 3MPYA 2DR6A 1E6YA 2CVEA 4BS2A 1F2HA 5L1JA 4HVZA 1FFSB 3I9V9 2MEWA 3X1LB 1IKXB 2UUCF 5GAHU 3R2CJ 1IKVA 4CP5A 1YX2A 2IC3A 4I2QA 1SBRA 2LQ8A 2PN6A 1S9GB 2R7QA 2D69A 3GMGA 4JI8J 2YQ0A 5KT5A 1XJWB 3OFGA 3MM7A 3MM9B 1XNRJ 2VFUA 1NLKL 2NSCA 2FLPA 2LKZA 2KFYA 3JQMA 2Z8QA 1M5OC 2BEFA 3QRRA 5J2MA 4C9DA 5B0GA 3VVUA 4USMA 2M4MA 1HNZF 1SUQB 1SJ1A 3W60A 1JXVA 3CO0P 5KFCA 3C15A 1N34F 4FF4A 2KJWA 2VC1A 5KG6A 2B5JA 4XIUA 4DL4A 2V5HG 3MMJA 3BREA 5F41A 3OV7A 2KM8C 3ZNUA 3QSIA 1RTZA 1AZSA 4WE1B 3UW1A 2ZWPA 4OZ1A 4L74A 3KK1A 1SPBP 4CT8A 4LF8F 3UN2A 2B8PA 5ETTA 3QJPA 2MQLA 3AOCA 3LQVA 4DFJA 2LP4A 2J0SD 2ASJA 2CG4A 5K14B 1AUDA 3BGUA 2YKOA 3DLBA 4P10A 4A8XA 3A3OB 4OJHA 1T05A 4FPRA 4PWUA 3CDEA 1VK3A 3CJ4A 3R5AA 3UE2A 5DS7A 1FA0A 3OL8A 4MKAA 4DR2F 3TYTA 3L4BC 2YWGA 4ECQA 3C14B 5CH7B 2DGXA 2KJVA 4P71A 3OFHA 4Y3CA 2VICA 1Q81T 1JLAA 1ZH5A 3D6TB 4KFBB 4DXLA 2M52A 4OYMA 2ZUAA 3M8QA 3HHDA 1NSQA 5AE2A 1T03B 2YWFA 4LFBJ 2YX1A 4CO2A 7FD1A 2AD9A 2OP5A 2J9EA 3OTOF 1Q7YT 2Q3PA 2W2NP 3QT8A 3E01B 4EFAC 5HQ8A 1BGXT 5FDLB 2D1CA 5HJYA 4F25A 2NREA 2XO7A 3LP1B 4O3SA 2F9JA 1RWXB 3HSJA 5E3AA 1W26A 2ACMA 1DHMA 3MMAA 2CJAA 5LJ3Y 4WFAQ 5F3ZA 1U2RA 3UQSA 2FHOB 5IC6B 2IVFB 3NBPA 2F7VA 2V8HA 4CLSA 4DPTA 4EEYA 1CS4A 5KFFA 2XS2A 2BJ7A 3RJMB 2K2PA 2NXJA 4GMKA 2OGUA 1U02A 3R27A 4NLOA 3T5HA 3CJ0A 4K4YA 2MJUA 2LLZA 3ET6B 4M5DB 3KLGB 4EU0A 3VAMA 2DCLA 2QJ3A 4RWXA 2BE9B 3IXQA 4DBQA 2J6TA 1HWJA 3R2DJ 2YNIB 2W7PA 5DETA 1EETA 3VAFA 1IR0A 4UZCA 4DCOB 1GNKA 2XY5A 3QT5A 1S6UA 4NXNF 1WOOA 2DH9A 1F5AA 4LF9F 2IM0A 4ZITA 1HBUB 1FE0A 4DUYF 2YKMB 3HCXA 4DV3F 2C42A 2O5DA 1S9EA 1S0VA 4K2XA 2HBZB 4KHPJ 2V9WA 3V6HA 2LEAA 4UY8T 3PO5A 3T1AA 1ZA2B 3CIZA 3F0NA 5CYMB 1MWZA 5GAHI 2X1AA 2HVIA 1X5TA 4CRJA 3Q0AA 3BO3A 3LAMA 4Y0FA 2GJ2A 4DR6F 4HH1A 1WF0A 4AUKA 4YN3B 3DM2A 4IOCQ 3O1LA 1KEKA 2NXNA 1HMVA 3BH6B 1KHVA 4B9UA 4DV4J 5KFEA 3OR2A 4DF8A 2W1BA 4WTYA 3JSRA 3TA2A 4Q5VA 1EQMA 2NXEA 3IFEA 3KK2B 3LP2B 1KQFB 1Q8LA 4C0OC 2HWHA 3GP9A 3N5BA 2VPYB 2P6TA 2UUBF 1CSJA 2N82B 1FDNA 3MMBA 4KE5A 3DRPA 4NLGA 3LGMA 2CPYA 5T14A 2CPHA 3MMCA 4M5GA 1F3VA 2CADA 2RS2A 4NI2B 4X65F 2FZCB 3QIPA 1RZMA 4O23A 3HSZA 1RT3A 2W01A 2AT1B 2EK1A 3IBFB 1VI7A 3MECB 1VISA 1KOHA 1WEYA 1R8AA 2VIHA 2WHOA 1MWQA 2ZITA 3JTNA 5HROB 4IKAA 5KG0A 1RAHB 4DL0C 2JZ5A 1UEUA 4OZ3A 1ZS6A 4NZ0A 4NLSA 3G8SA 3OTBA 2ZOMA 4CM0A 2GQCA 2YXLA 3I5BA 3AOBA 2PE8A 4DPOA 4EBDA 2GMJA 2C3YA 3BM7A 3KLGA 2R4FA 3AB4B 2WTFA 3U1NA 4OV1A 4PWWA 2B43A 2VF3A 3CDUA 2O1PA 2DTJA 2ZUGA 1MNEA 5A8WA 1HHSA 3OBIA 4MKVA 3EVMA 2OELA 3G8TA 5G0RA 2XGPA 4Y2AA 1TL5A 1HBMB 5A6WA 2EWHA 1NK0A 4ZCMA 3KLHB 2DK2A 2VBXA 1ACMB 4TLQA 4AQYJ 3RB6A 4WIQA 1N5VA 5B0FA 5I3UA 2EFOA 4MK7A 1T8EA 4NLVA 1Z2LA 2YKMA 3O8WA 1GXUA 5HJXA 4DQSA 2EI5A 1SL2A 3GLJA 4K5SA 2KG0A 1GXLA 2HURA 3R5BA 2JVRA 1RLDA 3RRGA 4TU7A 4B3TJ 1YJUA 3TJ9A 4RUAA 2PMHA 2B6AB 1RISA 1BLUA 2DNLA 1FRLA 4C0BA 2XMVA 2ZD1A 3BO2A 3BBCA 2HQFA 3H2UB 1TUVA 2AP6A 5L9XA 4OLPA 1WACA 1TZ0A 3WIVA 2ZH4A 2LU2A 1U2FA 3SYZA 3BH7B 5DDOC 2PC6A 4TY9A 2ZH1A 1WG4A 5FD1A 5KG3A 2GVDA 4K4XA 5HP1A 3H90A 3KK2A 3QYYA 4WP3A 1FK9B 2HFZA 1S1VB 3GFZA 2PGCA 1TKTA 3HVWA 1LW2A 3DLEA 4DV1F 3MD1A 1I94F 2XQCA 4Q7AA 3AJ1A 2R8IA 1LWEA 1PBUA 1QTNB 1FJCA 2E1CA 2R8HA 2W2PP 2UUTA 1R0AA 2LQ5A 3MHYA 2BUNA 4DR7F 2DO0A 2QL7B 5E3PA 4NEZA 5HVGA 2EC0A 3T1HJ 2HFNA 3AAWB 1LWFB 4J9UE 4HLBA 3IAS9 3HM9A 1VHFA 4IRDA 2ZC4A 1UJ5A 1RUSA 3D28A 1RYSA 1XBWA 1T3OA 1SKSA 2IBKA 2RAQA 2OSQA 3QO9B 2IM2A 2VDIA 2VG5A 3CNQP 5GMDA 3PW0A 4ERDA 2AYGA 3UDLA 2W8KA 1PO6A 2E5IA 5DG8A 2HPUA 1H2TZ 2EG1A 3M9NB 5HAOA 1XMOF 3GJSB 1QUVA 4I56A 2ZM6F 2M8HA 1B70B 1Y5LB 3G6VA 4LF7J 4TY8A 1T94A 3FSIA 1XNQJ 2OHDA 4CWBA 1XIQA 3CUNA 2ZBPA 3I31A 3CJ2A 1WTFA 4B9MA 2DGOA 4QZVB 3I0RB 1YRUA 5F0UA 4K4WA 3C16A 3P45B 3N9UC 2XM3A 3DN9A 3W3SA 4LBHA 3U1MA 2KHDA 4ILLA 2YWEA 4F4WA 1RHQB 2FJEB 4WP8A 4IR9A 1FHTA 5C7PA 1TK8A 1WC3A 3OJUA 3M30B 1S6PA 5DGAA 3DU5A 4PQUB 3KNAA 2R8GA 1VC6A 1AW0A 4F4YA 4ATNA 4O0NA 3G82B 2NXUA 2ZOFA 4R0EA 2K3KA 5A76A 3CD5A 3BGFA 2ALZA 3AD9C 2B4OA 4XTTA 3MM8B 2AEMA 2GNKA 1N8RT 1LOUA 3BGRB 4F4XA 2ZBRA 2R2TA 5K5MA 1QVFR 4O0IA 2SXLA 3J80Y 1EB0A 4X66F 1UKUA 2L08A 2QLXA 4TQRA 1VBKA 4Z7YA 3VR1A 4ZA1A 4WWSA 4WYLA 1D09B 3HHLC 2QG9B 1D8YA 2JH3A 3H4BA 3V81B 2PMWA 1UA1A 5LMUJ 2FC8A 3TAMA 3PZPA 4DV6J 2AJFE 2R7WA 2EFPA 3WC2A 2QTWA 2AX0A 3UD3P 5JMNA 1S1VA 5F8HA 4QIEA 1K8AT 1WOPA 2A1BA 2E9RX 1TMJA 4AE5A 2R9LA 1NSKL 1UETA 3L7OA 1U1KA 2DGTA 3CJKB 1U1QA 2CNOB 4ECUA 2B9XA 4RL1A 2MKJA 1QVGR 3IO1A 4XDCA 1D9DA 3KMSA 2MKKA 2HVDA 3PYEA 4CO5A 2ZFHA 3SI8A 2VFSA 2MHNA 1JJ2R 4OX6A 3IG1A 2WB1D 1R0CB 5C2GA 3QAEA 4J9RA 1T9UA 2KYZA 1RTIB 4IG3B 2AKWB 3THTA 2D41A 2KRRA 1TK5A 3K5LA 2L3MA 1RTJA 2PSZA 2ROGA 2I0XA 1NSPA 1OJ4A 3HMJG 2GAGC 4RZRA 5A2QY 2HYIB 4B3RF 2ADCA 6FD1A 5IQQA 3L95X 3ISNC 5D0EA 1DTTB 1IBKJ 4YY3F 1B0VA 4P2MA 1HIYA 4URGA 3TJAA 1RAIB 1TKXB 2AZ3A 2HVZA 2UXDF 3CD0A 2CZVC 2PI4A 2R7OA 3HVTB 5IT9Y 2H48B 1NDCA 3PRBA 4ZMMA 2CWKA 1VMBA 1Y3KA 4FP9A 2HGMA 2NZ4A 2EFQA 1S0NA 3I0RA 2ZNZA 4EWTA 1FKPB 1SKWA 4ECZA 2V2VA 2CWXA 2DGSA 1HR0F 3VGUA 3I87A 2Y8YA 2BJ1A 2XMWA 4URQU 3FFIB 1G2EA 1BQMA 2JC0A 1RHKB 3KTQA 2XTJP 3RRKA 3BGLA 2YWHA 1ZAWA 2R2UA 2UUWA 3UD5A 2XI3A 4IH7A 3K5MA 4C8MA 1FRMA 2PEBA 1DFDA 2GGPA 2IHR1 2QL9B 4WPAA 2RB7A 3PW4A 5ETPA 4DUZF 4DL7A 2POKA 1SB6A 1U0HB 2JX2A 4L75A 4JI1J 1W7WA 4CTAB 5DG7A 2OMOA 2Z56B 4CLPA 2WRMA 4DV0F 4ZJLA 3ITHB 3ZO7A 2A2DA 4J9SA 2QSWA 4LSZB 4O3RA 1U1OA 3TARA 4U8VA 4PXCA 1RHRB 1V5VA 3EZOA 4N8OA 2VFTA 1FJEB 3TEHB 1Q8BA 3N4WA 4EMDA 5CABA 2CIMA 2CVIA 4I1TA 4QJVA 2V8PA 5A8RA 3OTCA 4QU7A 4HL9A 1UJ4A 3ULHA 2OUGA 3AB2B 5SUHA 3OLAA 4J7CA 4JI8F 3JSMB 1NDLA 2XYHB 2XCAA 2RMLA 3LTOA 2WVFA 2IYIA 2A18A 3CPWR 2HFVA 1LK7A 1MLAA 1N56A 3PO4A 1OIAA 2WAQD 3W2WB 3HO1A 2EXUA 3GCXP 2YH1A 4KKOB 2KZZA 5CYJA 2W4DA 3NL0A 2RNEA 4I6AA 5D4PA 4DL2A 2WOMA 1Y10A 2V8GA 4K4SA 1FWKA 3W8GA 2RKIB 4OHWA 2HK2A 5K8NA 4DU8A 1RTIA 1VS3A 3T6BA 3K5NA 2PDAA 1C2PA 1PYSB 2L9DA 5FIIA 5DM7Q 4Q44A 3HHNB 3TZYA 3FKBA 2C2MB 2ASDA 4PYDA 2F40A 3D3CJ 4DPYA 4BDPA 1ZBTA 1HQUB 4LSLB 4GO7X 4EO6A 1OPZA 4DSEA 3FEZA 2XLJA 3KLFA 5FLXY 5KT6A 4IQXA 5ETVA 2DNHA 5F9NA 3UWTA 1C0UA 5D8HB 2G9OA 1CPZA 3QJLA 3I56S 3NLCA 4DFKA 2WSFC 1N88A 1D8ZA 1OSCA 1YK9A 4CYUA 3L7UA 3N0VA 1YWXA 1FWPA 2IJRA 3ENAA 1IQZA 2V4JB 1R8PA 1FKPA 2KU7A 1J2VA 2B0GA 1NPRA 4U7CA 2B8QA 4LQ3A 3MUMP 1YZ6A 3QPIA 4OV6A 2KXFA 2QFIA 4HT7A 4LFBF 1UW4A 3M1VB 1CJUB 2AJ0A 1UAWA 4F4KA 4L6V3 5C42B 2H5JB 3CT9A 2AGPA 1KDNA 2HIQA 4GC6A 1JKHA 2VZ9A 1YJTA 5KFAA 3TX8A 2P2CB 3F73A 1KFDA 3TVKA 4L3KA 4LFAJ 1ZM4A 3NWRA 4DN0A 1WWHA 4K4TA 4ZVTB 1S1UA 3PW7A 2KO1A 4F0MA 3Q8VA 1WC0A 5ETOA 4ZVQB 3GJTB 2ADBA 2RDIA 4EBCA 1WJ9A 4L72B 3BN7A 1RHMB 1FFWB 3H4DA 5EWFA 2YPYA 4CH0S 2DYAA 3KOAA 2JVOA 1FCAA 2GMLA 2PMZD 4ELTA 1PG5B 4C98A 3HJVA 4F2RA 1Y9OA 1FRKA 2G1DA 3Q23A 5IOLA 3C19A 3QFHA 3POTA 4B3SJ 1KLMA 4NLDA 5KFXA 2WVCA 4QWCA 2VPZB 1SH3A 3H40A 3M9MB 4WFXA 2A2CA 2IA6A 4KHPF 3S7RA 3LPEA 3G4SS 2XSJB 3GV8B 5HLFA 2RF2A 4LBPA 4M94A 5KT3A 3G6ES 3TUIC 1RT7B 2HFUA 4U95A 2EVZA 4AL6A 4X64J 1YLXA 3M32A 2DGWA 1FJGF 3CJ8A 4PG7A 2V63A 3AA8A 5BYRA 4UQGA 2OTLS 3QIDA 3CIMA 1IKWB 3AXMA 2CPZA 5H9EJ 4E98A 3M2VB 2AWZA 2PO4A 3W1YC 4QR1A 1F3FA 1X60A 1WHYA 2HQ3A 3RB3A 3EGZA 3CMQA 4MMOA 3A8JA 3V4MA 3TUJC 3DMJB 2IDEA 4K59A 3CCRS 1LWCB 2VBWA 1VBYA 1Y00A 4BC7A 2CPEA 2EG2A 1EKRA 2IY5B 2EBGA 2GX8A 1GT8A 3EICA 1R6YA 3O3LA 2BANB 2CPDA 3ZZYA 4B08A 2BABA 3T19A 3TR5A 1X4GA 1IM6A 5HN0A 1MSWD 2M2BA 1YKWA 4TYBA 3Q8QB 2UP1A 5LL6d 3US5A 3CGIA 3RBXA 2K1RA 4C97A 5L1LA 3VAJA 4J9PA 1ZPWX 1WNEA 2HNZA 3D2WA 3LANA 2KXHA 4ENOA 2G2YA 1RA7A 8ATCB 1UEKA 2APOA 1HI8A 3EGVA 2WK4A 2MQMA 2P5VA 1OMSA 1QLNA 2U2FA 3L09A 1TL7A 2ROPA 2FIUA 1B0PA 1FNXH 2XG8A 5KT4A 1M0SA 2G2ZA 2R7RA 5C2CA 3UI3A 1J5OB 3W66A 5B0EA 2DITA 1A6LA 5AE1A 3H20A 1KTQA 3GIKA 3ETOA 1SJFA 1FESA 3GV5B 4X84A 2HHUA 3MZIA 4YB6A 4PZVA 1RT1B 1YQHA 2DRAA 1N5YB 1B0TA 3SCJE 4EGLA 4G1PA 2FZKB 2MXYA 4MJKA 5HI7A 3KLVA 3DHWC 1SJRA 2PT0A 2QLJB 1WD6A 2FJAB 4AQYF 1WSVA 2IRXA 1C1CB 2CXEA 1DTQA 4P2FA 4B3OA 5H1SV 3AY0A 4DX7A 2AX1A 1YZ7A 4DZ6A 4E0DA 3K59A 2HLUA 1WEZA 4ZS6A 5KT2A 1RWPB 1K44A 4A48A 5KFWA 4DS5A 3DC2A 1HBOB 1YBTA 4KY3A 2XSJA 1MMDA 2HHWA 4B3TF 4OHZA 1MG7A 4JI5F 3KUGA 3R1HA 1HWIA 4NOHA 5A6PA 3HPOA 2LECA 2VH7A 3W8PA 1I6JA 4DR3F 4ZPBA 3HULA 2AGOA 3CCWA 1RU1A 1RT5A 2VFVA 3A8IA 2DEJA 2L41A 3C3LA 4DR4J 1T9XA 1Q95G 2RE1A 5CA5A 1S1TA 5LT5A 3BPSP 4A4JA 3CMAS 5HVFA 3O6QA 4KHMA 3DMJA 1AT1B 4KJIA 4M1KA 3M9OB 4YHHJ 3DGPB 4FN5A 1G7CB 2XNQA 5LMNJ 3P5TL 4ZPVR 2WW4A 3HHLA 3SBMA 1RTHA 2F4FA 3BEGB 2YPZA 3TANA 4YFUA 3T1HF 4GKKJ 4NPOA 5BR8F 5AXKA 2HZVA 1IVZA 5C5JA 2LVWA 4HYKA 2ZEJA 5A0YA 1H7WA 4HKQA 1S12A 3IP0A 4DJBA 3HX9A 3NS6A 4CQ1A 2CUYA 2DH8A 2OPSB 1HA1A 4RBUA 1WHWA 1NK9A 3D0GE 3PR5B 2DVIA 4NMLA 1RT6B 2E9ZA 2VJUA 2J0QD 2AIRB 1C1BA 1R3NA 2ZDOA 4RW8B 2ATLA 1NJIT 2M9KA 4WTOB 1TL1A 2BJ3A 1W2IA 3BZQA 4G3IA 2I5JB 4H4MA 4HI1A 5E3CA 3ILOA 4JI0J 2HFOA 2MZTA 1F9EB 5T41A 2U1AA 4ZN1A 3JB9k 2E7VA 2H3EB 5M2RA 3R3TA 4CLKA 1KD1T 4NL5A 3N79A 5KFSA 3UR0A 3B8HA 4R25A 4LF7F 1XNQF 1T9YA 1YBAA 2HHPA 4OI4A 4ED8A 3H42A 3ZZRA 4XDDA 4MKBA 4RWWA 2G4BA 3DNCA 5C24A 1TAUA 2NLWA 2UV8A 3EX7B 1HKAA 2VG7A 3EJMA 2CZ4A 1MROB 3LO3A 4IDKB 3PJXA 2QFJA 3OR1B 2HRYA 1NJXA 4QPTA 1EKSA 3MWBA 4FDFA 2RQMA 2OO4A 4R0JA 3SSRA 4PCQA 1V5IB 2HQIA 3T41A 4GKJF 5LSRA 2DHSA 4TVAB 5HO4A 2MKYA 3SFGA 4ETZA 2FJXA 5F8JA 3FSXA 2JHEA 1CJKA 5IM0A 1VIOA 3PR4A 3C6UA 1CC8A 2IRYA 2A6MA 4ZP8A 1ZPVA 2HBYB 3M05A 4RW9B 1KQSR 4Q8FA 3VGTA 5C25B 2V4RA 1NJZA 3PYFA 2LQBA 1XEZA 1CJVA 5F9LA 3ZTRA 2Y1JA 3G6YA 3DLKB 4IYQA 1NPPA 4DPWA 2XCPA 3RW6A 3DRRA 4OX9J 2MHEA 1C4CA 4HR2A 1C4AA 3NP5A 3EPGA 1HW9A 1RDRA 1XN9A 3FMWA 3NNAA 2IYGA 2VUGA 3BV8A 1N48A 4AL7A 5IC4B 1FTRA 4QIFA 3SZ2A 3THPA 2ZNYA 2I2YA 2CQ4A 4URSA 4NCGB 1B3TA 3DLGA 3IGVA 2W25A 2MLYA 1NHVA 4W92B 1KLNA 5J2QA 1RI7A 4OYZA 3G87A 4R8UA 1Q0NA 1S1XA 3QLHB 2WVDA 3NCQA 3Q8RB 1SL0A 3GQCA 1FE4A 3OXFA 4B9LA 3KXDA 4PG6A 3K57A 4LR9A 2M3DA 4KC5A 3LW5C 3H2VE 3NRBA 2JWNA 1K73T 4U96A 2R2SA 5BXIA 3TEGA 3TJ8A 4B9TA 1JLBA 3BSAA 4DG1A 3WC0A 3G6XA 4OYOA 4RW8A 2UVRA 4JI2F 4IO1A 1HQEA 4J37A 1M1HA 1IQTA 1LW0B 1J27A 2LEPA 4TQSA 3J7YU 1IBKF 2DD8S 5GVQA 2BJDA 1DQ8A 5B0BA 2BACA 2GMHA 4W4MA 2N4CA 1GX6A 2V4QA 3W61A 3RW7A 4FNHA 2NCKL 2CJQA 4Y65A 1IBLF 3NGSA 1NPKA 3QGPA 5I42B 1N6QB 4RW7A 4BBYA 3KUEA 2DRDA 3VAGA 3UN5A 4CLYA 4PAAA 1WKJA 2C28A 4ICLA 4GVBA 1SC6A 2KVIA 2ZE2A 3QRPA 2FC9A 1HNWJ 2RT3A 2GIQA 1OY6A 3DDIA 2DHGA 1EX8A 5BYQA 3OUYB 1WI8A 4C4WA 4GC7A 4PWDB 3P4UB 3EDRB 4EZ6A 1NSAA 2WBRA 4JI1F 5HMWA 3KG0A 3EMTA 3IRXA 4OHVA 3R5GA 5KFMA 2IJFA 1T9VA 3AOAA 4DFPA 1M1KT 3PCOB 3K58A 2CJYB 3OFFA 3AH6A 1V3SA 2V9KA 2DIUA 4UQTA 2ZVIA 3C6TB 1WC5A 3V5RA 2R2RA 3N5FA 5KFGA 1D1UA 2KN4A 3DLKA 5KFJA 2MGZB 4JV2A 4U7UD 4NA1A 1WG5A 4LREA 2YNFA 4A46A 4PG8A 2FGOA 2ZHAA 3MM6A 4YR3A 3M7VA 1FD2A 2Z2YB 3M6XA 3M6UA 2GVZA 1KSPA 4JV5J 1ITPA 2W2QP 5IFMA 3NGKA 3N01A 1SH0A 3OXGA 2OIHA 4LRAA 1VK8A 4DSLA 3M8WA 1MU2B 2XMAA 5L38A 1CLFA 5F8GA 4WFNQ 3HHLD 2OH2A 3GR0A 2YVSA 1CBKA 4O3PA 4O44A 2HHHF 1VFJA 2FZGB 3EZUA 3BSOA 3FCWA 4ZVRB 3PW2A 3W64A 2BM0A 1IBCB 2H65B 3SEOA 1AYEA 2IBOA 2ACYA 3BSNA 1UVIA 2OPRB 2YNHA 1TV6A 4G1IA 3S01A 1X7VA 4ZPTR 1WKLA 4QPXA 4PUOB 1LKZA 1NDKA 3TUZC 2IM1A 3D1HA 3FBCA 5K20B 4DX8H 2UXBJ 3T5JA 1LNQA 4C8KA 1MWYA 1L5UA 4ECSA 4Q45A 1EARA 4RJVA 2C2EA 1WUUA 1SC3B 5KOXA 4V1Ak 1YG0A 1QJHA 3D9BA 1RCXB 3U02A 4K50A 1RJJA 1RCOB 1U1PA 1L3SA 2YH0A 4J9KA 1YIJS 2PIIA 2B9EA 1RWWB 4MK9A 2VDHA 4I7FA 2GO8A 2B4UA 1VQYA 1MMLA 3U1LA 3GB0A 3CJ3A 3A3PB 4LSNB 1VQ9S 3GE9A 1HI1A 4WYWA 2HMIB 3DOLB 4I2PA 2V67A 2X1BA 1U4BA 2ZH2A 4A8FA 5EX0A 5AXNA 1ELOA 3ISND 4DF4A 3PY8A 2BV3A 2NSBA 1VQPS 3HT3A 4OX8A 1UFKA 1NK5A 3KLEA 3KLIB 2C3PA 2BW2A 1JLQA 1NK8A 1F0XA 1NEEA 4ECXA 3IS9A 3LALA 3T1YJ 3MEGA 2HHQA 3EXCX 2BJ8A 3OUYA 2QE5A 3OL7A 1JWWA 2YNGB 4USWA 3PRDA 3OT9A 4DCJB 4KR0B 2K06A 3J7YI 4LFAF 3CB4A 1X5OA 3W5YA 1AXQA 1C0TB 2V34A 1CG2A 2HS0A 1IWGA 5D3GB 1Q53A 1V6HA 3B54A 1F2GA 1NZ8A 1KVKA 1S6QA 2P9GA 1FXDA 3NGUA 2C2DA 2CG8A 1QSYA 2MGZA 2VPXB 3V6KA 2MZJA 1WELA 3NAHA 1R27B 4TU8A 1VQKS 1U09A 3CDWA 4MYTA 4JUZA 1TVRA 2JRSA 2FDNA 4ED3A 2WW8A 2O01C 2B9WA 5MAOA 3DYAB 2HVHA 5EHHA 3NG8A 2HKEA 1RU2A 4LJMA 4B3SF 4K4VA 5CHCB 1YRXA 4B3MJ 5EX3A 3G2XA 2WVEA 2Y8WA 1Z1ZA 4J9QA 1NKCA 2AHOB 3V2UC 4NLYA 3DDKA 2AW0A 2VASA 3SDEA 2OPRA 1HBNA 1X4EA 3CC7S 2XEXA 1DLOA 4YDDB 1HNVA 1KN6A 1EQ0A 3QZ7A 5ETQA 1N36J 1B99A 1K9MT 4IG0A 4I4BA 1NMEB 3BQ0A 1JX4A 4NLXA 3UR3C 2MLZA 2CZ9A 4DR5F 2D3ZA 3U7JA 2HHXA 2Y1LB 1HNXJ 2GHVC 3V6DB 1CVJA 2HHSA 1RABB 1RAOA 5J2NB 2GW8A 3K8VA 4J9OA 5T7LB 2H1YA 4EBEA 1NNDA 3ILJA 1Q86T 1WKKA 4ED5A 3RAMA 4DL5A 5LXRA 5ETKA 1RA6A 3R6GB 3IRWP 2R7UA 3GIMA 2VA3A 1O5JA 1OY9A 2Q1LA 1XTZA 4I69A 3DRSA 4ER8A 3R5CA 3EYZA 3VGSA 3MEKA 2LYVA 1M1GA 2ZWOA 4F2SA 1REVA 1YRTA 4W90B 4RW6B 4ID5B 3AHPA 1UWBA 2KI2A 4KO0A 2IVYA 1HNZJ 2PI5A 2BJ9A 2OPQA 2I1RA 4NLTA 4OI1A 4E2FB 1CC7A 3W2VA 4FNIA 1WOSA 2M7SA 1P9QC 4O4RA 5HATA 5ETLA 1FNOA 3CXCR 1A7GE 1K1SA 5KFLA 5JJBA 2XS5A 3ZZZA 1RAJA 2DRBA 1RBAA 3MM5B 3IBWA 3NXZA 4NA3A 3A13A 2IM3A 2CJKA 3D1QA 2YKNB 3OL9A 3MGJA 1TKZA 3J81U 4FBUA 1IKYB 1V3RA 2BE2A 3M8RA 3HJFA 4TLRA 1KFSA 1YDLA 1RKIA 3HHEA 3TZWA 4U6PA 1HWKA 2YBVA 2VHGA 2L9WA 2Y0BB 4XAKA 4N77A 1SXLA 4XPEA 3MAAB 4ZPCA 2CPXA 1KKHA 2GV1A 2CQIA 4EYHB 2W24A 4ZJOA 5CCLA 2G2OA 2BRLA 2FY1A 3DYAA 5HQLA 3QNWB 3TP2A 4K0KJ 2HGLA 2VG6A 4Y2KA 1UA0A 1KNZA 1ZTTA 2HZCA 4Q0BB 4V19J 2PA3A 2GJFA 2ZH6A 3OTOJ 5HK4A 5CXTA 4OYXA 2F9DA 5D4LA 3RBDA 2MQOA 4G1QB 3PM9A 4H4OB 4EUVA 4C3LA 1G3OA 2EFGA 2DGUA 2B7BB 1QDUB 3CW2C 3BSCA 1YI2S 1CJTA 2ALYB 1CULB 5HVHA 2A10A 3FQKA 3ZTPA 3OQ2A 2IAJA 3V4IA 3QRQA 4X4NA 5BJRA 3QWPA 1JLFA 4RR5A 3NNHA 1WG1A 2V2QA 2DHAA 5DRKA 1S99A 1S4EA 4AT1B 5DJBA 5H9FJ 1S97A 2A3JA 4JI4F 4DR1F 1YVFA 3KHRA 4DR4F 1JK9B 1Y0HA 3EGNA 1HLWA 3IC1A 5IWAJ 1FRJA 2MYFA 4WZMA 2M0GB 1RT2A 2LU1A 1JJ4A 1RE1B 3TRGA 4MYUA 4NXNJ 2XMMA 1D9AA 3UVJA 2GO9A 4WF9Q 4W98A 1KRPA 1EP4B 2Y1IA 5E5NA 1SJ4P 1QAIA 2ZHBA 2ZJRQ 1XR5A 1SKRA 3VHQA 3KUHA 1OYDA 4RBTA 1M90T 2DIVA 2C2NA 1FT8A 1OWXA 2LA6A 3QJJA 4KGMA 4I6WA 1IKXA 4ECRA 5D4OA 2UU9J 4GKKF 5E33A 4JI3J 4RU9A 2QO3A 3D6HB 1RYRA 2K7JA 1YJ9S 1X8DA 2QA1A 3OVBA 2WBMA 4ECWA 2AJQA 5B0CA 2NPFA 5KG4A 3LGHA 2LCWA 1S9GA 2E9TA 1YITS 3JQJA 1BWVA 1GMWA 1VQSA 2J8SA 3VZHA 4JBCA 2IMOA 2RRNA 1H0HB 5E2QA 2BRKA 1HPZB 2BJEA 3MFHA 3MM9A 2X1GA 3RUBL 3A1YG 2EEYA 4OYBA 2W9CB 1NKEA 1H3DA 3ELHA 1TUWA 2CQ1A 4YDXA 4JV1A 1IR1A 3GR1A 2QMUB 3A12A 1SUQA 4UUWA 4MT1A 4QYZK 2CYYA 2FHJA 5ADZA 1S5ZA 3CJQA 1HYSB 4OMFG 3M2RB 2NQPA 4TU9A 4A8YA 2OEMA 4WE1A 4I6YA 3H8YA 1Y11A 3HFZB 2HWTA 2O67A 2JDJA 2CQBA 2OD4A 4NXMJ 2OPPB 2N7YA 2RDDA 1BQXA 3MEEB 4OJ1A 2RRBA 1QE1B 5IT4A 1QSLA 3JTPA 2G0IA 3MEDB 5K14A 1LWXA 4I0WA 4K7QA 2D3UA 4LF6J 4F8RA 5D0HA 4LRFA 3I0SB 3JTOA 2LEBA 3K2YA 3PEJA 2FJWA 2DY9A 2ZBCA 2FJBB 5ETNA 2QYGA 1MW7A 1NHKL 5L9NA 2XMKA 4KHRA 3CCES 2HK3A 3C14A 1F5CA 3NAIA 1XR6A 2NUHA 2QZ8A 5CYQB 4B9VA 3MOJB 2W9BB 4G6VB 2JEFA 4LFCJ 1ICEB 1B7FA 4KFBA 1Q8IA 4IO9Q 2ZH9A 1N32J 8RUCA 5DQHA 1T03A 4OZ2A 4OX9F 1FFGB 4C11B 3WZ0A 1URNA 1Q4RA 3MR2A 4ALZA 5M2PA 3FGVA 3TI0A 5J2PB 3E01A 1RTDB 4LRDA 4IFYB 2BKNA 3RBEA 2YKQA 1U1MA 5FDLA 2FY8A 4ZLLA 5E3RA 1ZOTA 3LP1A 4QWEA 3H5YA 2JEIA 3FQLA 1SIWB 1HHTP 3CDBA 1NZAA 1VDHA 1YBUA 2KT2A 4DV2J 1SJQA 3MAQA 4OL8A 1FDBA 4NYPA 1GFWB 2VBYA 4KPYA 2FHMA 3OSPA 4KSEB 5DDQC 3GILA 1TP7A 3BYRA 1X4HA 2X51A 3M8SA 3TZZA 3DHXA 4OIXA 4RW4B 5A8KB 3ET6A 4TXSA 4M5DA 1NBEB 5E3QA 2F8HA 2KZMA 1SIZA 4N5SA 1TFYA 3J7A1 1I3OB 4RNMA 4RPFA 3HI9A 2YNIA 3A8KA 1RSCA 4ZHRB 2KT5A 3CDAA 4FVCA 1NJWA 1SH2A 4H4KC 3SQGB 4M5MA 2BA9A 5DO2A 3DFEA 1V9OA 1RHUB 1HNIB 3ZZTA 1RHJB 2Q66A 4PQAA 4N8NA 4ZP9A 3KJVB 1HBUA 3HVAA 3N6LA 2JNJA 2XS7A 2MQNA 2W8LA 1QAYA 1EHWA 1SJ3P 1IBMF 1M5PC 2CRLA 1JLEB 4LRCA 4B9SA 3PW5A 4ZVGA 1S6OA 1JNZB 3V6JA 1VRTB 4WKYA 3LH2S 2D9OA 4ZCIA 3WIUA 1MN9A 1M5SA 1LFPA 4QIWD 2F4VF 1I94J 1T7PA 3DDNA 4PPDA 2R7SA 5CYMA 4P72A 5HBMB 2XHCA 3SIPB 2QLWA 4MAKA 2ILZA 2JSXA 4WIIA 2RUSA 2DNYA 1OS5A 1N4LA 2FJDB 1EJ7L 1U47A 1U24A 1T3NA 3RGIA 4GRSA 1NB7A 5I4MA 4ILMA 1ZM2A 3CMES 2GC8A 3Q83A 3HP6A 4KGVB 5KFTA 2W2MP 3FSYA 3MUVP 3LPYA 4X4OA 3P96A 3NMRA 1KTVA 4IRKA 2ZKTA 3LP2A 3IGNA 1R8BA 3I5AA 4OZLA 4O4GB 2P9CA 2KB2A 4V19X 2J6SA 4FS2A 5KFDA 3G86A 4KYZA 2L48A 4DHVA 1NUEA 3KG4A 3JXOA 3JSBA 4K5RA 1LQ9A 3BBBA 2F5GA 3I4HX 4WK3A 4ZK7M 4C2MA 5L1KA 3GZ7A 2JEGA 1DJ0A 4JV0A 1FKOB 3PIOQ 2C1EB 5F8LA 1LK5A 1S59A 4NI2A 3VALA 3EM1A 3DOKB 3H59A 2MZQA 3PYDA 5E41A 2C2KB 4D3GA 2UXCJ 1XQIA 4ZDNA 4OI3A 4IFVB 4JV5F 4R5PB 5E0OA 3HDSA 1S1WB 4NRTA 3TQ1A 3QT6A 3MECA 2MQPA 4C0HA 4YS2A 3EVOA 4U9RA 1RKJA 2CKWA 3K0JA 2KFZA 3J7AN 1WI6A 4OI0A 1XERA 3RBZA 5HROA 2CNKB 5B0DA 4Z37A 2N4DA 3SFUA 3M6WA 2BKOA 4UT4A 4WFYA 4NLQA 4ZVFA 1SI9A 4RW4A 1VC0A 1XK8A 4KV8B 2HZAA 3RAXA 3FMBA 4F04B 2VQFJ 4LF4F 4X66J 1E6YB 3R97A 4QYRA 4DDFA 5HANA 1H98A 2UXBF 1WSRA 5EUHA 2N3OA 1HBMA 1NHUA 5AT1B 2HG4A 3FRYA 3KLHA 2IC3B 4CI0B 4I2QB 5HMYA 4OYWA 1PJ7A 1YJVA 4FXWA 2W2OP 4PR6A 4ANDA 3OD2A 4LF5F 2ZZNA 2LDYA 2XB2D 1TR0A 3HD2A 3O44A 1TFWA 2MB0B 3CCZA 3MM7B 2DNRA 3BR9A 3QZ8A 2XZTB 3RB0A 4UUXA 3D5MA 1ZM9A 1MMNA 3VWSA 1BQNB 4BWJA 1FKAF 2ZDPA 1JLGB 1B4SA 2B6AA 1TUGB 5J2MB 2MKCA 2YX7A 2EPIA 4M5IA 2GA7A 2QA2A 2QMXA 1WDTA 1KBRA 3BB5A 1UPMB 4M5LA 2BX6A 3M4XA 2MMYA 3C15B 2MKIA 2QX0A 2DNKA 3WBZA 5D4NA 3CULA 5B0AA 5KFIA 2E66A 4UY85 3HD1A 5CD4H 3WDOA 1NO8A 3TNVA 1AZSB 4C8YA 4ZIVA 5GAEU 4ED1A 1Y7PA 3T1YF 3EGWB 1X31C 3C2PA 3ENWA 3KK1B 2WB4A 3PJWA 1X5SA 1KR4A 3OXLA 1FK9A 2M88A 3CCSS 1U49A 1KVIA 2VL1A 4B02A 4O4GA 5I3QA 1Q16B 3RRHA 2RU3A 2LA4A 3MTJA 3NNCA 2BKPA 2IA0A 5K8PA 1T05B 2BOPA 3ILIA 4RNOA 2QA4S 2H4YB 4XPCA 3VGVA 2UXDJ 1LWFA 1DARA 1YHQS 4AL5A 1Y5NB 1F9HA 1Q5YA 2RS8A 4WJBA 1KS2A 2K7KA 1HR0J 4U67Q 1JLAB 4DPXA 5I3PA 5KAKA 3BKTA 3QO9A 3EWGA 3M8QB 4ZVSB 4WXWA 1UCNA 3D0IE 3G96A 2ZBQA 1R31A 2N7CA 3LWMA 3W62A 4LF2A 3PFOA 4K8RA 5EWEA 3GFYA 4AD6A 1NDPA 4DZDA 4YEAA 2OEJA 3DRYA 4MFBB 7FDRA 3IR7B 2FUG9 3ZZOA 2KH9A 2CQGA 3KNGA 3TA1A 2RSQA 3CEDA 1HFEL 2L9NA 2DEIA 2M70A 3NBPB 4Q2LA 1N36F 2Y1RI 2D74B 1KC8T 4UW2A 3HKZD 1CS4B 3MTKA 3T5LA 1TL4A 1HNXF 1SV5B 5DQIA 2FVQA 2O3DA 1TMMA 2X3GA 3CJ5A 5JVHQ 3M30A 2HEKA 1PJ6A 2H51B 5KG1A 4PQUA 1PC5A 3D1OA 1UW9A 5BYSA 3PYGA 4C8ZA 2AYEA 1KONA 3GSIA 3DLHA 1EETB 2ASLA 3NKYA 3D6FB 4OZ0A 3G82A 2GIFA 1XR7A 5HQMA 5HMXA 4A8MP 4JI7J 4UOGA 4ZLNA 4CLZA 3MM8A 6AT1B 1BQNA 2WCXA 3Q86A 2ROEA 1X9MA 3BGRA 4DV7F 1JIHA 2PFDA 3PKYA 5IV4A 1UVKA 1SQEA 2YQ1A 3E8OA 3OPKA 1JLGA 2F65A 1R0BG 2V68A 1S9EB 5IXUA 4OYPA 2AU0A 2VOOA 2V2KA 4ES1A 2FVRA 1I51B 4CO4A 3GYGA 1A9NB 3CVKA 3NMAA 2AYBA 3V81A 3OJSA 4ZVOB 3DXSX 3S8SA 2ZZMA 5AXMA 1JJCB 3Q24A 2E1RA 1S0MA 3GFHA 1AROP 4KGZB 1NXIA 3R5DA 1XNRF 3BR8A 1X4AA 3DM2B 1UVMA 3OHAA 2UV8G 1HMVB 2R8KA 4FKYA 2BBEA 3OR2B 3NCRA 1FNMA 3FZBA 4P74A 2J5AA 1U1LA 3CJKA 2LMIA 3BPDA 4M63A 4U8YA 4IH6A 2EFNA 1HQ2A 5LM7E 1HW8A 4DI6A 4FXVA 1VHIA 4JP8A 4X4SA 4MIWA 1UMJA 4ECVA 2OD6A 2HS4A 4MIAA 4P75A 3R9LA 1SC1B 2WSCC 3MMBB 2YWKA 3DRPB 2DR9A 4IG3A 5KFUA 2QYCA 4WK1A 2QLBB 3Q2SC 2W7OA 3PXGa 1WORA 1PAEX 3TAPA 3MMCB 4J9MA 1VOMA 3FRZA 1FVQA 4K0KF 5GAEI 1RWMB 3QIPB 3ZZ0A 4ILRA 3KFWX 3M8ZA 3M6VA 1RBLA 1RT3B 1MN7A 1DTTA 4QW9A 3Q8YA 4MFBA 2VV5A 1TKXA 1HWLA 1HHQA 1PAUB 3R8YA 1OY8A 3CSKA 2W9AA 1F5BA 3UN3A 3HVTA 3GPAA 4HHJA 2FB0A 3D68A 4P73A 4BWMA 1WC6A 4RBVA 4KGXB 2ZH7A 3C66A 4ED0A 3IBCB 1IN0A 5D0GA 1QM9A 2Z30B 4ZVEA 3FFIA 1NKBA 1FX4A 5J1PA 2DHXA 1OYEA 2NZCA 2FYXA 3GU0A 3P5BP 1SV5A 2AJ2A 4IH5A 3HZGA 4C8OA 1N0UA 4WKRA 1U6FA 5A8WB 2KHCA 1JXLA 3PEHA 5KT7A 4JYAJ 1VYAA 5G0RB 2CQHA 1W2BR 5IWAF 4F4ZA 1U0HA 4WFBQ 4A8KA 4CTAA 4ELUA 2AF6A 2AZ1A 4NYOA 4X2BA 2QA4G 4S0MA 1AFJA 1F6TA 4OFZA 3ITHA 5I3UB 3CCTA 4ES3A 1OO0B 2EKYA 3SCKE 4RU2A 2WZ1A 4IOAQ 4LVOP 1HD1A 1U45A 4Y2IA 5L1IA 2UU9F 1EZZB 5L8RC 4ZJQA 3W5XA 3HVRA 4JI3F 2KL8A 3FK4A 2J9DE 3H0PA 3CE8A 3IWNC 3B82A 5GMKa 1H38A 3IAM9 3MFIA 2ZKUA 2XC9A 5IS2A 3N28A 3JSMA 4IOBA 4KPCA 1FJGJ 2ZD1B 4FPIA 3F44A 4A8WA 2G1HA 3CO9A 3GJRB 4CO0A 1RK8A 3I82A 1VBZA 4WCEQ 1N33J 3W2WA 4OZ5A 2GVDB 4X62J 5HP1B 5LJ5Y 5DQGA 4KKOA 1JNRB 4PABA 3KDNA 3B4MA 2OAUA 1BUXA 1TKTB 1LW2B 4DSFA 2B51A 4DMZA 3M2UB 4PXEA 4ELVA 3DLEB 1FD8A 2Z2ZA 2EFVA 1LWEB 4H4KA
chains in the Genus database with same CATH topology
2MKJA 1QVGR 2MKSA 4G1QA 4LJMA 1R7IA 3IO1A 1FRIA 3CD6S 3MF5A 4H4OA 4XDCA 1R0AB 5CHCB 1YRXA 3PX6A 1D9DA 4B3SF 4K4VA 4ZCKA 2MZ1A 3KMSA 2MKKA 1PILA 2RKIA 5EX3A 3T6JA 1X4BA 1Z1ZA 2M5YA 4J9QA 4OQJA 4CO5A 2ZFHA 1NKCA 3J81Y 3SI8A 2VFSA 3V2UC 2MHNA 4NLYA 2RJZA 3IG1A 3DDKA 4OX6A 4ED6A 1JJ2R 2WB1D 2AW0A 2Q43A 1DBDA 3QAEA 4X4UA 1RT4B 4J9RA 4NXMF 2VASA 3ZZPA 2KYZA 1RTIB 4IG3B 2C3OA 3THTA 4MTPA 2D41A 3SDEA 4O44B 2KRRA 1TK5A 2JFDA 3K5LA 2L3MA 1HQUA 2OPRA 1HBNA 1X4EA 3GG1A 3OVAA 4BC9A 2DNMA 1RTJA 2K8GA 2XEXA 1DLOA 4LSLA 4YDDB 3CC7S 5KFBA 4DV4F 1HNVA 3RR7A 2PSZA 2ROGA 2I0XA 3S1TA 1S79A 5KFOA 2FLLA 1KN6A 2NPIA 3QZ7A 4OHXA 3HMJG 2J7WA 3DRXA 4RZRA 4MKYA 1WHVA 5A2QY 2YNHB 1TV6B 3RAQA 1VRUB 1K9MT 4IG0A 2HYIB 3DI6B 4I4BA 1P6TA 2VG5B 4B3RF 3BQ0A 2ADCA 1U8SA 1JX4A 4DWIA 4NLXA 6FD1A 4LF6F 3UR3C 5IQQA 2GJIA 2UVWA 1CQNA 4DQRA 2KG1A 3L95X 2VQEF 4O3NA 4N76A 4DR5F 2ZC3A 2V8DA 3ISNC 3DOMA 4QR0A 2QSFA 1DTTB 1S4FA 2YX4A 4YY3F 2D3ZA 3U7JA 5IQ6A 2HHXA 1B0VA 4CCHA 3VZIA 2GHVC 4URGA 2PA8D 1GXTA 2CQ2A 3V6DB 1CVJA 4LT6A 1TKXB 2HHSA 3LAKA 2HVZA 5J2NB 4F3QA 2GW8A 3K8VA 2UXDF 4J9OA 4EZ9A 2EBEA 3CD0A 2CZVC 5T7LB 2PI4A 5KFHA 1NNDA 4EBEA 2V4JA 2R7OA 3PFEA 1ZETA 3HVTB 3VQTA 1Q86T 5IT9Y 1VQ5S 4NX9A 3HLUA 4ED5A 3UFCX 3PRBA 5B08A 1Q79A 2MDAA 2RQ4A 4NLUA 4P2SA 3RAMA 4ZMMA 3E51A 4DL5A 5L39A 5LXRA 4LFCF 1RA6A 5GAGU 1VMBA 1Y3KA 3IRWP 4FP9A 2HGMA 2JFKA 2NZ4A 2EFQA 1S0NA 4TY8B 1R8CA 1XMQF 3I0RA 2R7UA 4H54A 4DSJA 3DCAA 2ZNZA 1P1TA 4EWTA 3GIMA 4RNHA 2VA3A 1FKPB 4ZVHA 1N32F 1SKWA 4ECZA 3CC4S 1UVJA 2V8VA 1O5JA 2DGSA 5KG5A 5CZXA 1EP4A 1HR0F 4NCAA 2GQ2A 2HAIA 2Q1LA 1XTZA 3I87A 4O3OA 4I69A 3C46A 2KKHA 3DRSA 3R5CA 2FVCA 3M1VA 2XMWA 4F3OA 4URQU 4CH7A 3FFIB 4CZCA 3JSYA 1G2EA 1BQMA 3EYZA 2IRUA 5C42A 4CIOA 2LDIA 1U1NA 1KHWA 3MEKA 4NWBA 1X5PA 2JC0A 5KG2A 2LYVA 3KTQA 3SXLA 3RZAA 3K8WA 3RRKA 4F2SA 3BGLA 4AXJA 1REVA 2YWHA 4Z2XA 1YRTA 1P1LA 1ZAWA 2UUWA 2R2UA 1P8GA 4I7FB 4W90B 2BYCA 4RW6B 1U6ZA 4ID5B 2XI3A 4IH7A 4DV5F 3AHPA 3K5MA 4OI2A 1UWBA 4A8OA 2KI2A 1FJ7A 4C8MA 1UJ6A 4KO0A 1FRMA 2IVYA 1L3VA 1Q82T 2PI5A 1DFDA 3OTDA 1GQEA 2GGPA 4I2PB 2IHR1 3T9ZA 2AYMA 3CCLS 4DFMA 2OPQA 2I1RA 2RB7A 4NLTA 4OI1A 4YMEA 4DV2F 2XY7A 3PW4A 2VC0A 1CC7A 2E5HA 4DUZF 2MZSA 1S6PB 1Q7LB 3W2VA 4FNIA 4DL7A 4L3NA 2POKA 4AYBD 1NRKA 4PG5A 4QWDA 1SB6A 1TL3A 2M7SA 1P9QC 4P7VA 4O4RA 2JX2A 1VGYA 1FNOA 4LQ9A 2BVZA 4CTAB 2DNQA 5DG7A 2OMOA 2E5LF 3CXCR 1A7GE 1K1SA 1HPZA 2WRMA 5KFLA 5JJBA 3ZZZA 2DO4A 4DV0F 2XS5A 1RAJA 2Z2LA 4DLGA 2DRBA 2MZRA 5F8NA 3OFEA 2E1MC 2O66A 3GIJA 3MM5B 3IBWA 4OJ3A 3ITHB 1LXJA 2A2DA 4NA3A 2IM3A 2W9CA 4J9SA 2CJKA 2QSWA 3D1QA 3GSDA 1YJRA 3KLEB 4O3RA 3ZFVA 2YKNB 3HZEA 3OL9A 1U1OA 3MGJA 3TARA 3X3UA 1JLQB 4PXCA 1YGYA 1U7LA 2HW3A 2DPIA 3IS9B 4O3QA 5J1EA 2DGVA 1ZZNA 4N8OA 4USHA 2B9YA 3MEGB 3ICLA 2VFTA 1FJEB 1TKZA 2VKRA 2Z0GA 1Q8BA 3GYXB 5LXYA 3N4WA 2YY3A 3E2EA 2CIMA 2CVIA 3SSSA 3G8QA 4I1TA 4F02A 4XO0A 3TA0A 4FBUA 4QJVA 1IKYB 5A8RA 1VQOS 3PACA 1V3RA 2BE2A 3OTCA 3M8RA 1BC6A 3FCHA 4QU7A 4HL9A 1UJ4A 3HJFA 4CNYA 3HXMA 3ULHA 4TLRA 3IR6B 3CTRA 3AB2B 1KFSA 1HYSA 5SUHA 1RKIA 3OLAA 2E7WA 4F26A 2VONA 4JI8F 2YKPA 3HHEA 3JSMB 1X4DA 3M2RA 2XCAA 4OI6A 3TVYA 4U6PA 2RMLA 1HWKA 2D9PA 2L9WA 1S6QB 1WHXA 2GCFA 2DR5A 4ITSA 1F60B 1UVNA 4DSKA 4KRWA 1IXKA 2IYIA 4XAKA 3ZC4A 4BHQA 2MJNA 4N77A 2A18A 3CPWR 4B17A 4K4UA 1FF2A 1SXLA 1VQLS 4XPEA 4ZPCA 5JXSA 2CPXA 1LK7A 5HMZA 1QSSA 2GV1A 2CQIA 2B4VA 1JB0C 3TAMB 3A8EA 1Q1KA 2HS3A 2KDOA 2OPPA 3IWLA 2CQPA 3VQSA 1N56A 4EYHB 5K8MA 3PO4A 2W24A 1OIAA 2WAQD 3MEEA 4UOCA 5CCLA 3BO4A 1QE1A 1HNWF 2KFNA 1TVRB 2BRLA 3IR5B 3W2WB 3RR8A 3HO1A 2FY1A 3DYAA 4WXOA 3MEDA 2YH1A 1XWLA 3TP2A 4KKOB 5B09A 3FDSA 2KZZA 4Y2MA 3M2UA 5CYJA 2W4DA 2HGLA 2VG6A 4Y2KA 3NL0A 1ZM3A 2RNEA 1UA0A 1LFWA 5F3TA 3MURP 4I6AA 3EPIA 1ZTTA 1KNZA 2HZCA 4Q0BB 1RT7A 2QRRA 4V19J 3LF0A 2PA3A 1DQAA 5D4PA 3BJYA 2ZH6A 2ZJPQ 1NH7A 5CXTA 2NUUG 2F9DA 3I0SA 5D4LA 2QMWA 1G6BA 3RBDA 4DEZA 4DL2A 2MQOA 2WOMA 4X4RA 2HRUA 4N41A 1GX5A 1T02A 4G1QB 1VBXA 3PM9A 2V8GA 3JYTB 2I9SA 4H4OB 4K4SA 4EUVA 1VQ7S 4C3LA 1S10A 4DSIA 1G3OA 1DQ9A 2EFGA 4LUBA 5KFZA 2RKIB 2DGUA 4OHWA 1RT4A 3F56A 3NS5A 5K8NA 5THWA 4ZLPA 3P49B 2B7BB 1OSDA 2FGCA 1RTIA 3BSCA 4OZJA 1YI2S 2BQRA 2FJVA 1IKWA 1VS3A 3QGIA 5CYQA 3T6BA 2W4PA 4FS1A 2J0WA 3K5NA 1QAJA 2PDAA 2GIRA 2W9BA 1C2PA 2W4CA 3IG1B 2L9DA 3H5XA 5FIIA 5DM7Q 4Q44A 4Y6IA 3M2VA 3HHNB 2FPHX 2A10A 1K0VA 3DLJA 1OQ6A 2OFHX 1Z4UA 1NAQA 2EW9A 2ASDA 3SDEB 2F40A 3Q22A 1M5VC 3FQKA 4BDPA 1ZBTA 3OQ2A 4B9NA 1HQUB 2IAJA 1HBNB 3V4IA 4YB7A 1VRUA 4X4NA 5BJRA 1RTJB 3QWPA 3DI6A 1DLOB 1JLFA 4LSLB 4DL6A 1HNVB 3NNHA 2VODA 3P3DA 1WG1A 4GO7X 1FXRA 3I96A 2B3TB 4EO6A 1OPZA 3OTEA 4C11A 4DSEA 2DHAA 4J5OA 5DRKA 1S99A 3FEZA 4ES2A 2XLJA 5FLXY 5KT6A 3KLFA 4IQXA 2JLFA 4IG0B 2DNHA 1LWCA 3MPVA 5DJBA 5F9NA 4PG4A 5J2PA 5H9FJ 3DXBA 5ITHA 2CPFA 1ULRA 1S97A 1RTDA 4ID8A 3UWTA 2FVPA 4IFYA 2A3JA 1NU4A 1C0UA 1U6BA 1IJFB 1FTCA 4JI4F 5D8HB 2DJWA 2MSSA 4DR1F 2G9OA 3I4PA 1CPZA 2R7XA 2BM1A 3HKWA 1J5EF 3QJLA 1S76D 4QCLA 3I56S 3NLCA 4DFKA 2XLKA 2WSFC 1N88A 1YVFA 3KHRA 1D8ZA 1OSCA 2CQDA 4YB1P 4ZOSA 4DR4F 2J0XA 2LQ9A 1JK9B 1Y0HA 1YWXA 2B56A 3N0VA 5KFNA 3EGNA 1IQZA 3SMZA 2KM8B 2V4JB 1R8PA 1HD0A 1CEZA 2H5EA 1FKPA 3IC1A 4A47A 3RB4A 1FRJA 2KU7A 1J2VA 2MYFA 2DB1A 4WZMA 2M0GB 2BANA 3FVYA 1RT2A 1Y5IB 2DT9A 2B0GA 2LU1A 3JAMY 4YR2A 1JJ4A 3CF5Q 3TRGA 4MYUA 4U7CA 1N52B 4C3KA 2XMMA 1GH8A 2YKAA 3MPWA 1D9AA 4DN9A 2ZH3A 4LQ3A 2GO9A 4LVNP 2CJ9A 4WF9Q 3HFKA 4RNNA 3MUMP 1KRPA 3PIPQ 1EP4B 2Y1IA 3QPIA 2UXCF 2KXFA 5E5NA 4HT7A 1SJ4P 1QAIA 3QAUA 2RRAA 2ZHBA 3TAQA 4LFBF 2ZJRQ 3DRSB 1UW4A 2DBBA 1XR5A 2KRBA 2WONB 3M1VB 1SKRA 2AJ0A 1JLCB 1BQMB 1UAWA 4F4KA 4ZP7A 4RBTA 4L6V3 5B7WA 4J9NA 5A8KA 1M90T 5C42B 2DIVA 4IR1A 5KFKA 3MDFA 1FT8A 1OWXA 3Q8SB 3CT9A 1O8BA 1D3WA 2LA6A 3QJJA 5U47A 2AGPA 4KGMA 1URRA 2AQ4A 3VAHA 3I9ZA 1REVB 2HIQA 4I68A 4I6WA 1IKXA 2Z2MA 4ECRA 5D4OA 1S0OA 4GC6A 1JKHA 3ISZA 4P7TA 4GKKF 2VZ9A 5E33A 3HHKA 4RU9A 1UWBB 1YJTA 2QO3A 5KFAA 3TX8A 2RUGA 1RYRA 3BDPA 3F73A 1KFDA 2K7JA 4KO0B 1X8DA 1YJ9S 4ZHRA 2QA1A 3OVBA 1X0PA 3TVKA 3SV4A 2WBMA 4ECWA 2AJQA 2XZWA 1X9WA 5B0CA 2GGPB 2NPFA 5KG4A 1VQ8S 2LCWA 1ZM4A 1HL6A 2E5GA 1S9GA 4P6QA 1IKVB 4DN0A 2OPQB 2XLIA 2C3UA 1YITS 2E9TA 3QMQA 2VBZA 4DOZA 2R8JA 1WWHA 3W2VB 3SQGA 4K4TA 4IUFA 4RLEA 5KG7A 1VQSA 1S1UA 3VZHA 2KO1A 3PW7A 4JBCA 2JC1A 1HNIA 2IMOA 2KXNB 1ZTWA 2RRNA 1H0HB 2ADBA 5D6GA 2RDIA 3H25A 3KJVA 5E2QA 2BRKA 1HPZB 4QW8A 2BJEA 1YSJA 3MFHA 4EBCA 2BQUA 3MM9A 2X1FA 2X1GA 4M95A 3U27A 1J5OA 4KT0C 4HTIA 4L72B 3A1YG 3BN7A 2FHJD 1JLEA 1FXLA 2W9CB 4ZPDA 5GAGI 3H4DA 2CPJA 5EWFA 1NKEA 1H3DA 2VQFF 2CQ1A 4YDXA 2XSFA 3SSQA 4CH0S 1TAQA 3QGGA 1VRTA 4JV1A 3LWLA 4X4QA 3KOAA 4NZ7A 4HDGA 1TKZB 3CC2S 4TN2A 1VC5A 2P9EA 3GR1A 2UVVA 1RT1A 4FF1A 4OLOA 1N54B 2JVOA 4WU3A 1FCAA 2GMLA 2W7AA 1OQ3A 3N6NA 4I64A 1N5YA 2PMZD 2ZH5A 4QBUA 4ELTA 1SUQA 3PV8A 4UUWA 4LMZA 2HWIA 4C98A 5A8RB 4OZNA 4Y34A 2BE2B 4KBIA 4F2RA 1IJEB 2P6SA 2CYYA 1Y9OA 1FRKA 2G1DA 2AJ1A 2FHJA 5ADZA 3Q23A 4F50A 4FF3A 3PX0A 1C1CA 5HBMA 3DU6A 3VTIA 5F0WA 4RNFA 1HYSB 4EO8A 4QOTA