The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
74
|
structure length |
74
|
Chain Sequence |
MRKIQVGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEEIEDAGFEAEILAEEW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains.
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Arabidopsis thaliana
|
| molecule keywords |
Copper-transporting ATPase RAN1
|
| total genus |
20
|
| structure length |
74
|
| sequence length |
74
|
| ec nomenclature |
ec
7.2.2.8: P-type Cu(+) transporter. |
| pdb deposition date | 2008-07-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| X | PF00403 | HMA | Heavy-metal-associated domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
