3DXSX

Crystal structure of a copper binding domain from hma7, a p-type atpase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
MRKIQVGVTGMTCAACSNSVEAALMNVNGVFKASVALLQNRADVVFDPNLVKEEDIKEEIEDAGFEAEILAEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords Copper-transporting ATPase RAN1
total genus 20
structure length 74
sequence length 74
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dxsX00
2OD6A 2OFHX 1OQ6A 3KNGA 3HHLD 1VQYA 2FHMA 2HIQA 2LQ9A 2GV1A 3BB5A 1YJTA 2IFXA 2XMUA 4FNHA 1APSA 3WDOA 1XBWA 4A4JA 2GA7A 2ASYA 4OJGA 2K7JA 3E8OA 4Q2MA 3MZIA 1TL5A 2AJ1A 1IUJA 3K7RA 5IXUA 2GFFA 2KT2A 2CRLA 4DPOA 2HFNA 3HF5A 2XMWA 3MCSA 2XMKA 3BF4A 4Q2LA 4YDXA 1URRA 4OJ1A 2KYZA 1FESA 2AP6A 2KT3A 1R6YA 2RU9A 3KKFA 1Q53A 1OPZA 2JDJA 2IYIA 2K1RB 2OMOA 2HLTA 1FEEA 4HH0A 4HL9A 4OIXA 4YEAA 2XMJA 1SQEA 4NL5A 4ZOSA 3CJKB 2KKHA 3BDEA 3BN7A 3HHLB 2N4CA 1JWWA 1OSDA 1LQ9A 1X8DA 2ZDOA 3TNVA 5B0GA 1Y9OA 3BM7A 3VTIA 5B0EA 2BYCA 4QOTA 2QLXA 2BBEA 1QUPA 2BJDA 2IYGA 1VQSA 2K1RA 2OKQA 3GZ7A 1AFJA 1N5VA 1FVQA 2QLWA 2GGPA 2VH7A 4OJ3A 1Y0HA 2RSQA 2LQBA 2PGCA 3HX9A 4U9RA 5T7LA 2HFOA 1AW0A 1MWZA 3HHLA 1K0VA 1ULRA 2OD4A 2XMVA 5B0CA 2ROPA 1X0PA 2N7YA 5B0BA 2QYCA 1FVSA 2PD1A 3QMQA 2W4DA 4HH1A 2VV5A 3TRGA 3LO3A 1YJRA 2ZDPA 1Q8LA 2BUNA 1GXTA 2XMTA 5K9FA 4A47A 5A6PA 4OJHA 3CJKA 3IWLA 2EW9A 1U7LA 2L3MA 3KG0A 2AJ0A 1RJJA 5F0UA 4A48A 1Y3KA 3TOQA 1KQKA 1SI9A 2XMMA 2RILA 2AW0A 2ROEA 1Q4RA 1SB6A 2W4PA 4NPOA 1CC7A 1Y3JA 2K7KA 1FD8A 2RMLA 5B0FA 4F67A 1N5QA 2G9OA 5B08A 3FMBA 3UDCA 1TL4A 3KG1A 1FE0A 2FTRA 2BJEA 1YJUA 1P6TA 3LGNA 3DXSX 4EFAC 2FB0A 1CPZA 1X7VA 1N5TA 1W2IA 3DCAA 2W4CA 4FNIA 3FGVA 2HQIA 2ACYA 2Q3PA 2GO8A 1YG0A 4HI2A 4ZA1A 1N5SA 5F0WA 1OQ3A 1TR0A 1S6OA 1GXUA 1MWYA 1KVJA 4Y2KA 4DL0C 4DN9A 4A46A 3BGUA 2HLUA 1TZ0A 5A6WA 3HHLC 1FE4A 3HFKA 3QGPA 1WD6A 4Y2MA 4Y2IA 1YJVA 1JK9B 2QIFA 3IWXA 2LXFA 2OFGX 1AFIA 3T9NA 5B0DA 2GCFA 5B09A 1YRXA 2GGPB 2OAUA 5T7LB 2N4DA 2K2PA 2LDIA 1Q8BA 1KVIA 1CC8A 1TUVA 2OP5A 3I9ZA 1V3ZA 2FIUA 3F44A 3HDSA 3LGMA 1P8GA 5KAKA 3BR8A 2ROGA 5B0AA 4HI1A 1S6UA 3FRYA
chains in the Genus database with same CATH superfamily
1GMWD 1F3FA 2RKIB 2LEPA 3KNGA 2VDIA 3DLEB 3HHLD 5ETOA 1VQKS 2AWZA 2LA6A 2B8PA 1I1GA 3BSAA 3NCQA 1U8SA 4W92B 2MJNA 3D66A 2JLGA 4F4KA 1GTEA 1QJHA 2LU2A 5DDOC 3EJMA 4K2JA 3GE9A 4X4VA 7FDRA 2RT3A 4IO1A 3SV4A 1DTQB 3O8WA 1ZAVA 1MMLA 2F65A 1B64A 3ZZRA 4J9KA 8AT1B 4DL2A 4ELTA 3M2VB 3AB2B 2YKAA 3GCWP 1LW2B 1UPPA 2RDDA 1RT2A 1RYSA 2UXBJ 4HKQA 3CEDA 3PDNA 4K2XA 1C0TB 1S1UA 3ZZTA 2VHGA 1Q81T 2AF6A 1L3VA 2DVIA 3BF4A 3H4BA 2D74B 2ZITA 2CZ9A 2W2NP 4X4TA 4B3OA 3NCRA 3CO9A 4IKAA 1JLAA 1VLYA 3AQOA 3TR5A 1OPZA 3IG1B 1YBUA 4PPZA 2UUCF 3IM8A 1VRUB 2NREA 1FRMA 3RTVA 2HRUA 4ED5A 4DUYF 2UUBF 1O51A 3NBPB 1FKAF 2D9OA 4WKRA 4KH1B 2QX0A 1Y9OA 1TFWA 3KHGA 5GAEI 3SYZA 2A1BA 4KGZB 5A0YB 2EBEA 2PC6A 1VQSA 1XR5A 3H42A 3KK3B 1Q7YT 1AFJA 1DBDA 1RT6A 1N5VA 2KYXA 2MYFA 3P8BB 3GFZA 3DLHA 1Y0HA 3VWSA 1LNQA 2PGCA 3BSNA 1VC0A 2HHXA 3MR2A 2YQ3A 1S7HA 4AQYF 3MECB 3N4WA 1R0AB 4DPTA 2C2EA 5B0CA 3V6HA 2RD5C 3UN5A 4NZ7A 4QBUA 4DR1F 3SZ2A 1B0VA 3JAMY 1L5UA 2MQ8A 4LSNB 1URNA 4M5GA 4DR1J 2KB2A 3P49B 3S8SA 3L3CA 2COLA 4L74A 2CJ9A 2EFVA 1DQ9A 1HBOB 3QBCA 2VG5B 2DNHA 4TY8B 3MECA 2QL7B 5D0EA 3BGRB 3NS5A 2MKSA 1RLDA 3T9ZA 4WP3A 3C3LA 4DCOB 4ZVOB 2X51A 1WC6A 2B5JA 3GONA 3TOQA 2FGOA 4ZVRB 1ELOA 2F5GA 2WSFC 2HHVA 4ZLNA 5KG6A 4JI0J 3C14B 4D3GA 2F7VA 1KP6A 1HWJA 4PQUA 4B02A 3R5AA 2GX8A 4U95A 3D1QA 3IRWP 2BABA 2CPDA 1KNZA 4K4UA 3SXLA 2XGQA 4F3OA 4PKDB 3G82B 5KFAA 2B4UA 5KFNA 3TAPA 3KK1A 2C28A 1S59A 1GX5A 2B4VA 1C0TA 2C2NA 3V6JA 1P9QC 4KGVB 1S9EA 4NYOA 1NDLA 4BHQA 2N82B 1I51B 3NWRA 4EK2A 4ZP8A 1JXEA 3JSMB 1FNOA 3K2YA 3UNGC 2AGQA 1KR4A 1T7PA 2RF2B 2RDJA 3VAMA 4U7UD 4CLSA 2K8GA 5ETQA 4ZLPA 2ADBA 2X7IA 2P9GA 3Q0AA 3MR7A 4FP9A 1M1GA 4OYWA 1K73T 3TW0A 5A8RA 1UZDA 1C1CB 1XN9A 2MGZB 3R7NB 3CC7S 4R0JA 4FF2A 5EN1A 1NXIA 3D4JA 1RZMA 2DB1A 1XR7A 2EG2A 5D0RA 3ZZPA 5HSPA 1NK0A 2Q79A 5IWAF 1K1QA 1R89A 2KT5A 1BY9A 2Y3YA 4RPFA 4ZVEA 1RT5A 2HNZA 3M7VA 3UDEA 4K0KJ 4J90A 2FLLA 2OP5A 4CLZA 1HQ2A 2XLJA 1U45A 4JI2F 4RW8B 2NSCA 4IDKA 3EICA 4DBQA 2OH2A 1OSCA 3M2RB 1M1KT 2X1FA 3UW1A 1N88A 2YQ1A 4ZP9A 1NNDA 5CA5A 5MLCV 1NJXA 2D3ZA 5H1SV 4URQU 2NXUA 4MYUA 5AXKA 2LQ9A 3EUNA 2IBOA 3BB5A 3I31A 2FZGB 2VFVA 3EGWB 1TAQA 4ALZA 1TL1B 1HBUA 3D68A 2E1PA 3MOJB 1AUSL 1TELA 2DHXA 4LMZA 4NRTA 4TY9A 3D2WA 3A13A 3SSQA 4IFVA 1SCJB 5C25A 3W8GA 1RT7A 2EWHA 1N48A 1XMBA 1QAXA 2OGUA 3M30B 2R7WA 2DTJA 3SDEB 1IBMJ 2YPZA 4DS5A 2DNPA 3FEZA 5DETA 2KRBA 2BRKA 2WCXA 3M6UA 3SSRA 4E0DA 1EETB 1SQFA 3WX4A 1VQ8S 4MKYA 3PJ9A 3PRDA 4C0HA 5HROB 3QYYA 1RU2A 5KT3A 3KLHA 4JBCA 4RW6A 2FVPA 2RH3A 3MEGA 3CDAA 2M7SA 3CDUA 4ZOSA 1KOOA 3CJKB 5E3RA 3HHLB 3UN2A 1NKCA 3H25A 1OSDA 2IMOA 3CCWA 2FHJD 5CYQA 1MU2A 1KLMA 1RWXB 2YKNB 3CD5A 2ILZA 3TAMA 4CDIA 5AJ3F 3MAQA 4ELUA 1RISA 5C2GA 3ILIA 2MHEA 2QSWA 4DL0C 2AIRB 4K5SA 4YR0A 1U1LA 2UXDF 5KFFA 2LQBA 3QGIA 4U9RA 2Z0GA 1NSQA 2DNZA 5KG4A 1DFDA 3HHLA 4DV4F 2BMBA 2E7XA 2IVMA 3LP2B 1VK3A 4KHPJ 3CC2S 1LKZA 2PN6A 5IC6B 4PG4A 1SL0A 4IDKB 1OYDA 2BQ3A 1V3SA 1XMQF 1WOOA 2ZHOA 3MR3A 3D6HB 3MEEA 1TV6B 3T6JA 1GT8A 4O0IA 1IQZA 4F4XA 2H4WB 2B0GA 3T19A 2DHSA 3CMAS 2RQ4A 2VFUA 3Q86A 4DPXA 4A47A 1NUEA 4DOZA 2W2PP 1N36J 1HHTP 2FVSA 4NXNF 4MK7A 5KFUA 1U7LA 3RZAA 3I56S 1M90T 1ACMB 1S0MA 3LW5C 3FCHA 4HTJA 3TA0A 2GJFA 1CJKB 2IJRA 1G1XA 2MQMA 1VHIA 3VF0B 2ZJPQ 4KBIA 5EHHA 1SKSA 2LVWA 2B56A 3FJ2A 4DUYJ 3KYLA 5HJXA 1HBUB 4LF6F 5KT6A 1N0VC 3KJNB 3W5YA 2W1BA 1LK5A 2FVCA 5B0FA 3ZTQA 4AFFA 1GH8A 5FIIA 1S0OA 1S9GA 2PI5A 1IKWA 4NZ6A 1PJ7A 4JI1J 4C7QA 4MFBA 1XEZA 2E9RX 5D15A 1P6TA 3AH6A 2HNDB 2ILYA 2UXCF 2B9XA 4A8QA 3QZ7A 5AXMA 1FF2A 3R1LA 5DS7A 4DSLA 1UJ6A 2Q3PA 3FZBA 1RWMB 1UL3A 4I6YA 2JRSA 4RUBA 3RBXA 3ENWA 3RAMA 3J7ZT 4I2QA 4BBYA 3KOAA 4J5OA 4I64A 5GMDA 4RBTA 2BE9B 2WVBA 4RBVA 2CQDA 4Y2KA 1FHTA 1BLUA 1JLGB 2XTJP 2VJVA 3TQEA 2CQIA 4YQWA 4V19X 3X1LB 4KIAA 3VAJA 2RHQB 3D67A 5SZTA 4LFBJ 3R8YA 3VZHA 3UFCX 1HQEB 1HNXJ 1YJVA 2IDEA 4NXMF 2GAHC 3MM5B 5DDRC 1FX4A 1HARA 3W64A 1DHMA 4KGMA 4LSLA 5F9NA 3PVXA 4O3RA 2B3TB 3KLGA 1U6ZA 2E9TA 3F0NA 2QE5A 3OSNA 2MLXA 4AL6A 1PGZA 3QATA 2AD9A 1RAGB 3JSBA 3OTCA 4FXWA 2CVEA 3C46A 3AD9C 3DGPB 2E9ZA 1UP1A 1UJ5A 4M1KA 4DPUA 4QWCA 3PJXA 4QW9A 4EO6A 1F60B 2CQPA 4C4WA 3NL0A 1YRTA 5DO2A 4DUTA 4UOGA 4MMOA 6FD1A 1Q78A 2BQUA 4OQJA 1HKAA 3UVJB 4LF7F 4NLWA 2VICA 4DR4J 3P4UB 4DCJB 4KO0A 4P9SA 4JI8J 1U4BA 2Y1RI 4LBPA 3CMES 4USWA 1DLOA 4PXCA 5D6GA 2XMAA 3VGVA 4ZJLA 1UA1A 2YTCA 3UCZP 2FYXA 2YX1A 3IMQJ 2G0IA 1OYEA 4LREA 3GIKA 3TI0A 4JV1A 2GA7A 4WFXA 1WNEA 4ILMA 5CH7B 2XWXA 4WZMA 5A8RB 3H5XA 4JI2J 4OLOA 1VRTA 1S77D 2CRLA 4PEOA 2XHCA 3MD3A 4QIWD 5D0GA 2MQLA 5F41A 3TUZC 2V4JA 2BE7D 4FF1A 1FNXH 1GK8A 2WRMA 2HNYA 2KT3A 3DKDA 3HSZA 1XMOF 4C3MA 3PKMA 1LW2A 2MEWA 3UDLA 3QAUA 3A8JA 4EI2A 4K50A 1VDHA 3MEDB 3N5BA 1S4FA 1S9EB 4Q5VA 1E6YA 4NLQA 4HLBA 1HFEL 2N4CA 5I42A 1TK8A 2HWTA 2EC0A 3HZEA 5ETVA 5B0GA 1HA1A 1WHXA 2JC0A 3O6QA 1K0TA 3R27A 3TX8A 2BBEA 1QUPA 2IYGA 2I5JB 2HG4A 5JMNA 3T3FA 4ED7A 2BKNA 3QJPA 4PUOA 2AEJA 3A4TA 2F9JA 5M2PA 2W2QP 2QYGA 5G4DA 1CBKA 1AXQA 2B9WA 2C2MB 2KN4A 1R8BA 3BKFA 3IR6B 4EU0A 1WUUA 3AHPA 3UNYA 1VIXA 4CP5A 2YNHB 4G6VB 2CIMA 1JLAB 2F8MA 1UCNA 3L95X 1OO0B 2M9KA 3QPIA 4OZJA 4TU9A 2HRTA 2EFOA 1QTMA 1RT1A 5AE3A 5L1IA 5HAOA 4DL3A 1NCLA 3W60A 1P9YA 5HP1B 3NNAA 1TAUA 3OL9A 4MT1A 2BJ9A 2IM3A 2P6SA 1S9GB 2BKOA 2XEXA 4F4WA 1FRJA 2CUYA 4MIWA 3R2CJ 1DTQA 3OVSA 1REVB 2AYEA 4JI1F 4NCGB 2EK1A 3GG0A 2GVZB 9RUBA 4PR6A 5B08A 1C4CA 4PAAA 2PMWA 4IFYA 3X3UA 1NKEA 2DPIA 4DSJA 3CJTA 3KG1A 2BXJA 1KC8T 1IR0A 4J9LA 1FDBA 3PG9A 1CJUB 5E5NA 3RBZA 5I3UA 4CRJA 4C48A 1K8AT 1N34J 3K5PA 3MD1A 3HK2A 7AT1B 4FNIA 2QZ8A 4ES1A 4BLGA 1DTTB 2CPIA 2WHOA 5H9EJ 2IJFA 4FXDA 1RB0A 3GLJA 3DRXA 4H4MA 3ICLA 1TV6A 4WFYA 4C2MA 4LF9F 2GIFA 4DL5A 5E2QA 5HMXA 3FCVA 1XNQF 1WTFA 4YS2A 1HNZF 2DNKA 2MPUA 4YFUA 1RHMB 4F4AA 4WFAQ 1TZ0A 3ZXWA 1OIAA 3F56A 1VQ4S 1OS5A 3DRRB 3GB0A 5L9XA 2L9WA 1H73A 3LH2S 4K8RA 2UUWA 3ZFVA 2OPRB 1X9WA 2R8IA 3KLFA 3IWXA 3KLIA 5ETTA 3GSDA 2VC1A 2YKNA 2ZH5A 3C16B 3DYAA 1IQTA 3HHKA 3VGTA 2OSQA 5G0RB 3V6DB 5KFWA 1TK0A 2OTJS 4ID5B 4BC7A 2NSBA 3AB4B 2FQQB 4MTPA 1B0TA 4OI6A 1V3ZA 3L4BC 1HPZA 2QTWA 3N79A 5CYMA 5KAKA 4Q43A 2V63A 3A3OB 3N0VA 3D28A 5CZVA 4CZCA 2GS8A 3JYTB 4ZK7M 1BC6A 3B8HA 4TLRA 1NPRA 3Q2SC 3MCMA 4ED8A 1Q95G 4I0WA 5ETMA 5HROA 1CVJA 3VZIA 3PY8A 3R6LB 1Y7PA 4ZVPB 3CJ0A 3QRPA 5C25B 2KXHA 1EB0A 2CNLB 4FNHA 1KTQA 5ETKA 3RB6A 2OMLA 2ASLA 2LP4A 3LP2A 1NHVA 4IOCQ 2VPWB 1U25A 2VPZB 4QW8A 3SMZA 2C1EB 3DI6B 1PAUB 1X9SA 4LF6J 4WFNQ 1PG5B 3Q83A 5LXYA 3CCVS 1SVDA 2AEFA 2GW8A 1RAHB 1VQOS 4Y34A 2Y1IA 1KEKA 4NMXA 2ACMA 2X1GA 3TWZA 2H5JB 4FPRA 3MMBB 1FRXA 2HFSA 1Q1KA 3C6TA 3P5TL 2DHAA 3QNWB 5KFCA 1ZETA 3I0RA 5HI7A 1RLCL 1SC3B 3ENVA 3MPDA 3TUPA 5HO4A 1N6QB 3D6TB 1JLFA 3RB0A 1RBOB 2GO9A 4WIQA 1NO8A 4QIFA 1PC4A 3AA9A 4ZIWA 1O5JA 3E01A 1T03B 1DURA 3N6NA 3CDEA 2YNHA 5CCLA 5IS2A 1RTIB 3ZTRA 3B54A 4KJIA 2NZ4A 1PO6A 3MPUB 3IP0A 4DR5J 1WF2A 4FS2A 3UD5A 3GMGA 4RR5A 4QIGA 4WXWA 4XTTA 4KHRA 4K4VA 1F5AA 2UXDJ 3ZZZA 3OPKA 4OHYA 3DM2A 2DYAA 5IC4B 1ZOTA 1JKHA 2CPFA 1DZ5A 2VDHA 1FJ7A 1Q7LB 1V9OA 3I96A 2OJ3A 2CVIA 2ASJA 2R7RA 4P2XA 1YVFA 4RUAA 2WTFA 5A6PA 2QFJA 2JEGA 4C8NA 1SC1B 1REVA 3HSGA 2NS1B 4OX9F 1RHQB 3F73A 2EW9A 2XB2D 1IBLF 3HO1A 2WW4A 2Y1LB 1NLKL 5F0UA 1Y3KA 1U24A 4H4OB 1N4LA 2P9CA 1IN0A 4OYXA 5ETPA 5LOQA 3G8SA 4J9OA 4M5MA 4ZVGA 1MROA 1X4FA 2PA8D 2BZ2A 4NPOA 1SKWA 5ETLA 5EWFA 3J81j 3H40A 1TTHB 4F8RA 1FXDA 1H72C 2E1RA 1M0SA 3M6XA 2CA9A 3VR1A 4EGLA 4JYAF 2BJEA 1NAQA 1X5TA 2WK4A 3BGLA 3HI9A 2E66A 3M8PA 4QR2A 1N8RT 2LU1A 1N5TA 3SBMA 2E29A 1NH8A 2MLYA 1S1VA 2ACYA 2KHCA 3IC1A 4B9VA 3PEHA 3M6WA 2IVFB 4JI3F 3HKWA 2WB1D 3H20A 2ZHBA 3QGGA 1Y5LB 5DQIA 3BKTA 2FHKA 3HVTA 1H38A 2XLKA 3G9CA 3T41A 2DGQA 4DN9A 1OWXA 2DIUA 4LRFA 3HVRA 2J9DA 2GNKA 1S6PA 3MEDA 3QGPA 4I1TA 4QWBA 4DQIA 4Y2MA 6FDRA 2JC1A 1F5CA 1YQHA 2DD8S 3JTNA 3OR1B 1SKUB 3LA0A 4Z7CA 1SC4B 1S6QB 1SBRA 1FD2A 3FBEA 2XLIA 1HNIB 5F8MA 4X66F 3IN5A 1KHVA 4PZVA 2NQPA 1JQGA 3H0PA 1HNWF 5D3GA 2H4YB 3MM6A 1NZ8A 3W2WB 3RRHA 1U1OA 4LFAF 1PJ5A 1HMVA 1VRUA 2J0SD 5H9FJ 4X84A 1PSDA 4BC9A 5L39A 3PNIA 1HHSA 2W7OA 3BR8A 3CTRA 3EPIA 3CCQS 3W5ZA 4L3KA 2UUCJ 2XM3A 5B7WA 4H4OA 2B43A 3BZQA 1I5OB 3FRZA 2V2VA 3FDSA 2XHWA 2OEMA 2LQJA 2WOMA 3NP5A 1D8ZA 2SXLA 4FPIA 4CT8A 3BDPA 2DH7A 1VISA 2Z30B 3CSKA 4ZPDA 4KHMA 1QAJA 5LSOA 2A3JA 4XK8C 3DDIA 3LQVA 1IKVA 1S97A 1YJ7A 2HWIA 3DC2A 4K4WA 3ZTOA 1WACA 2CPHA 2YWGA 2XMKA 1KD1T 3TA1A 4O44A 2QEXS 4P75A 1EHWA 3PYEA 2HEKA 3MR6A 1JLEA 1NJWA 4ICLA 2VQEF 3CC4S 1A9NB 2IYIA 3OVBA 3HXMA 2FDNA 3OTBA 1S48A 2JH3A 1HIYA 4ECZA 1NU4A 1UFKA 1UKUA 5HL7Q 1RWWB 2ZH2A 4X62J 4CO5A 4E98A 1JWWA 1RTHA 2ALYB 3Q24A 1SH2A 4KH0B 5DLFA 3PW0A 1IR1A 4O3PA 2J0WA 3AA8A 2QN6B 3MM7B 4RNMA 3MEEB 1PC5A 4ZHRB 2VQFJ 4EBCA 3MOZA 2J0XA 3QLHA 2CAJA 4LR7A 1RTJB 1ULRA 3DOKB 2PSZA 1G7CB 3ADAC 5L1LA 2HFZA 2YWFA 3O44A 2B4PA 5A8KA 5IM0A 2QYCA 2M8HA 2DRBA 4F4ZA 4RNNA 3KWMA 4LSZB 3R2DJ 4ZN3A 1GX6A 3CCZA 1QAYA 5K9FA 3BREA 2BV3A 3TAQA 1TKTA 3IA0A 1Q5VA 3KG0A 4C0BA 4M5KA 5DM6Q 3IFEA 4FVMA 2CJKA 4HDHA 5D77A 3H2LA 1JJ4A 4I69A 2HS0A 3H5YA 1GNKA 4KT0C 1BQXA 1C2PA 2BM1A 3PFEA 4LQ9A 2VOPA 1T02A 2J5AA 4L76A 1I94F 1H0HB 2B51A 2CDRB 5F8JA 1VBYA 4PXBA 5C24A 1B7YB 2DGWA 3BSCA 3F41A 4DU8A 3J81U 2OIHA 4IFVB 1X4HA 4HEA9 5D4LA 1FRIA 2H51B 1YJWS 5ETSA 4IYQA 2RUGA 4NCGA 1IM4A 3J80U 2FHOB 3UWTA 4CYUA 2PEHA 2QA1A 1K47A 3CIMA 4YR2A 2K3IA 2HIYA 2VKZG 4ZA1A 1L3SA 4JI4J 3DRRA 3W1YC 2BACA 2YY3A 1WHWA 4G65A 2KO1A 2N3OA 3EXCX 2BE2A 1SV5B 2IM2A 1JJCB 2KRRA 2I6WA 3DDKA 2FLPA 2FVRA 2ZH7A 2HLUA 2MXYA 1WF1A 3Q8VA 2P9EA 4O4GB 4WPAA 4ECUA 2ZUAA 1X4BA 3HCXA 4OZ1A 3T5JA 2WVEA 2ZBRA 4EO8A 2VIHA 1GQEA 5CCMA 1RT4A 2MZTA 2DR5A 4ZVFA 1LEOA 3CXCR 4B3TJ 1UETA 1WSRA 3M8QA 4JUZA 3QO9A 4ZJOA 4ANDA 1ZAXA 4L3NA 4AD6A 5BJRA 5HQMA 2GGPB 1CJUA 5D8HB 3WQPA 2MGZA 2KG1A 1RAIB 3DOLB 4Q0BA 3NGDA 4GO7X 5I3PA 1FNMA 1PIEA 1FJCA 1WKKA 4ZKAA 1LXNA 4NEYA 3ET6B 5DZ6A 4RJVA 5I42B 3MWBA 1ZYQA 1UVNA 3LTOA 4LIWA 3VV2B 3NEKA 4IRCA 1KTVA 1S0NA 2ALZA 2FHMA 1ZM3A 1MLAA 2LEAA 4I68A 4B9TA 5J2QB 2VU5A 3N6MA 4DFPA 3Q89A 2DH9A 1GFWB 4F0HA 2DITA 2I0XA 2KZZA 4HACB 2XSJA 2Z57B 2EG1A 3W9JA 3OW2R 2DRAA 2UV8G 2V0NA 2R8JA 2KDOA 1JB0C 2ASYA 5KG5A 1UPMB 1RGVA 1RHRB 3E8OA 3K8VA 2B6AB 5IXUA 2KT2A 4PQUB 4WIIA 4DHVA 3E2EA 3OL6A 2XMWA 5MAOA 2E1MC 1ZS6A 4GVBA 4DF4A 2IRUA 1URRA 2JOQA 2M70A 4I4BA 3PR5B 5EX0A 3EYZA 1U2FA 2B5JB 1U0HA 2PDAA 3O2IA 4USTA 2CYYA 3GV7B 1HMVB 1MW7A 2HKEA 2L9NA 2WONB 3D1HA 3R6GB 2C2KB 1LWCA 4DN0A 5HQLA 3BGRA 2KM8C 4C8OA 2ZE2A 2YQ0A 2VB6A 3AD7C 4HHJA 5GADU 4KV8A 4CNZA 1QVGR 1W26A 3BM7A 2IA6A 2UXBF 2BYCA 5KFVA 4FS1A 2H3EB 4GKKF 4PWUA 1T9XA 2QLWA 3B82A 1CSJA 2VH7A 4W4MA 1T3OA 2MQQA 3DLKB 1IJEB 3GYXB 5K14A 1J5OA 4C8YA 3WZ0A 4QPXA 1WG4A 2AX1A 4CT9A 2ROPA 4UQTA 5HN0A 3FC9A 4TU7A 3G6XA 2C2OB 3R97A 1EAYC 3G71S 1JJHA 2CZVC 3LWMA 3TRGA 2XNQA 2ZOMA 3EVMA 2QL9B 3S01A 3KUEA 1G6BA 4K59A 5HVFA 4DR3J 2BUNA 2BJ8A 1FFWB 2HK3A 2ZBCA 4DV6J 2XSFA 2VQFF 4F36A 1LWFB 2VA3A 1RA7A 4R8UA 3KTQA 2CWXA 3MPVA 2O66A 3TO8A 3K89A 3GG1A 4OHWA 3J80Y 1S76D 3OJSA 2VODA 1HLWA 3Q8RB 3DLJA 1Y3JA 1WWHA 2MQNA 5KG0A 3QWPA 4ECXA 3M9MB 4F7VA 1EKSA 5FJ4A 3J81Y 3D7SB 4M5NA 3PHTA 4RL1A 2QMUB 5JUMA 5GAHU 1N5YA 2FHJA 2XWYA 3BSOA 4Q7AA 2CPEA 3AOCA 2EI5A 2W01A 2FB0A 3PX4A 4DV3F 3FGVA 3QT6A 1TFYA 2DNGA 2GO8A 1VJQA 2EXUA 3JXOA 1HQEA 4DCPB 3RGIA 3IRXA 2HHTA 4URGA 2CJYB 1S6OA 4DQSA 1UA0A 2PE8A 5KFXA 3RBDA 3AAWB 1KN6A 4AE5A 3TZYA 3KMSA 3M8QB 4OZ0A 1LV5A 4ERDA 4C97A 3FK4A 3M8ZA 3R7BB 5L1JA 3JSYA 3PYDA 4Y2AA 3ULHA 4LJMA 3TUIC 2XO6A 1F2HA 1FE4A 4JI8F 2RIJA 5GMEA 2IBKA 1WDDA 4N56A 5IZHA 2XYGB 1UVJA 4PPDA 2BOAA 1AFIA 4FYVB 2U2FA 2OPPB 3KUGA 4G1PA 4USMA 5B0DA 3MURP 1F9HA 2FZCB 1T05B 1OJ4A 1RWKB 3NCPA 5K5MA 1M1HA 1RUSA 1YLXA 2HNDA 4USUA 3IAM9 2LLZA 4PWDA 1HWUA 1S72S 5HANA 1XJWB 4LVNP 4GRSA 3GV5B 4HT7A 5E0OA 3ZZ0A 3K5LA 3BH6B 5A8KB 3UD4P 2NPIA 1Q82T 2FIUA 2YNIA 5EWGA 1B4SA 1UEKA 3FSXA 4C3KA 2KXNB 3DYAB 4C8LA 4NLVA 4IOBA 2G2OA 5LSLA 4WTOB 3H59A 4ZVTB 1SJ3P 1OQ6A 2E44A 1YX2A 1U1QA 2HHHF 2MKKA 3PZPA 5L9NA 4ECQA 1KSPA 3NGTA 2QG9B 1PBUA 3C15B 2I2YA 3HZGA 4U8YA 4M5DB 4WXOA 2I38A 2C3YA 4JOUA 5HMZA 3SDEA 2M8DB 3CDWA 4FYWB 3T1HF 3B4DA 2JL9A 3OFHA 3QIPB 3A1YG 2AV5A 2DGOA 3RB4A 2ZC3A 1I6JA 4NE9C 3I9V9 2GFFA 2YKMA 2ZVSA 3CWJA 3W66A 4YP3A 4JI3J 3KXDA 2DGVA 2HZAA 3B6BA 5KG2A 3CNQP 2DPJA 4EYIB 3BO2A 1TUWA 4OJ1A 3RJMB 1A7GE 4B9NA 4DX8H 1IKVB 4P73A 1Q53A 1TL3B 1KRPA 4B9LA 1C4AA 4OYZA 2P5VA 2HLTA 1KHWA 3P96A 3TAMB 4YY3F 2R7VA 4JI7J 5T41A 4KRWA 4YB7A 4C3LA 3QLHB 4IQXA 3CB4A 3Q8UA 3VTIA 2QV6A 3HLUA 3DRSA 4CLPA 1IWAA 3OLBA 3KLHB 4C8MA 3THTA 1TVRB 2ZZTA 4LUBA 2KHDA 4ELVA 3PTWA 1VI7A 2RSQA 4UZCA 4X66J 1RTHB 3C66A 3VGSA 3ENAA 2A0FB 1RT1B 4YMEA 5A8WB 1K0VA 3FVYA 4EMDA 4LFCF 1GMWA 1X0PA 3UO0A 2CPJA 2X1AA 3HJVA 2UVRA 1FT8A 2CNNB 1JLEB 1ZM9A 2OPQA 3BPDA 4M8LA 1KWMA 1EIYB 3MM6B 1QLNA 2UV8A 4J9VA 4CWBA 4EZ6A 3CD0A 1S1TB 3M8WA 3OXFA 1GXTA 5IT0A 2HPUA 1QSLA 1NDKA 4P7TA 2G1DA 4KB7A 2C42A 2MZRA 2YH1A 5AXNA 3CJQA 3ZO7A 3LPYA 1ITPA 3RU0A 3R5GA 4LBHA 1FTRA 3MCNA 1S4EA 4O3SA 1WOSA 1FCAA 3TZXA 3EGNA 1CS4B 4RW4B 4ECYA 4GC7A 5J2PA 3SIPB 4DPYA 5J1PA 4DQPA 2LA4A 5DLGA 3GV8B 3HP6A 2NUUG 4N8OA 1AZSA 2Y1JA 3UDCA 2L08A 3HFVA 1NJYA 3RR8A 2IRXA 4DSFA 3RRKA 4TQRA 3VVUA 4X4RA 2O5DA 1I3OB 1LFPA 2I1RA 3ZC4A 5LJ5Y 2HVHA 1WHYA 2CDQA 1F5BA 4KYZA 4NLUA 1F9FA 1SJ1A 1YWXA 4YHHF 2IDLA 3CJ8A 3MPWA 4DS4A 3N5FA 3HPOA 4DV6F 5FDLB 1OQ3A 2X3GA 1A0OB 1GXUA 1V5IB 2W2MP 2CQCA 2O1PA 3M4XA 4NEZA 2I8EA 5KFLA 2RS8A 1UVIA 1WG1A 5KFBA 4J9MA 4A8SA 3HT3A 2AZ1A 4TY8A 1Q86T 3NGSA 1NJIT 2G2ZA 2QA2A 3HHLC 4DJBA 4F0MA 3MFIA 1R43A 1E6VB 4K4TA 1FTCA 4Y2IA 3IBCB 1KFSA 1UZHA 1TKZB 2KTQA 4ES2A 3I0SA 3D1OA 3RAQA 3TJ9A 2H5IB 2JHEA 4CM0A 3QT8A 4IUFA 1H3DA 2BJ3A 1E6VA 3D9BA 1SH3A 2DO0A 2XI3A 2HVIA 1CC8A 3I9ZA 3DM2B 1HNVB 1VC5A 1T95A 2VG7A 4UUXA 2Y8YA 2P6TA 4DWIA 2V4JB 1RAJA 4U8VA 3ELHA 3FRYA 2OUGA 3FQLA 1DLOB 3A3NB 1ZPVA 2VBYA 2WONA 5DQHA 2D69A 1RK8A 4NX9A 3AQPA 4BWJA 2IHR1 2GV1A 2CJQA 3GILA 2UVUA 1Y4ZB 3M2UB 5SUHA 2HFVA 3I4HX 3W9HA 4PG5A 3KNAA 1PYTA 3KUHA 1Q16B 2CQGA 3BQ0A 3K57A 4OJGA 4TLQA 2JSXA 4M94A 1DQAA 1YSJA 3G2XA 2MKHA 5J2QA 3K7RA 3M9NB 2HHQA 2DGTA 4MH8A 2B7CB 1QY7A 1WC1A 1RAAB 5GMKa 3DRPB 3DN9A 2DEIA 2AQ4A 2FVQA 2KYZA 2F63A 4A8WA 2AP6A 4DEZA 1VOMA 3THPA 4ANEA 2MSTA 3A3PB 4OX9J 2C2ZB 4OI2A 1FKPB 5AE1A 3MMAA 4HH0A 4HL9A 5CYJA 4KHPF 1RT6B 1BD6A 2AMCB 3PR4A 3DOLA 4KFBA 1SQEA 1U1KA 1RBAA 2UUAJ 3DOMA 3JAMU 2R42A 2KKHA 3BN7A 4BCAA 4GVBB 3TNVA 3GWCA 3KHRA 3DLGB 3N6LA 3J7A1 2DJWA 3EDRB 4RU9A 1YGYA 4IH7A 3G8QA 4LFCJ 2IRYA 4Y65A 1XC9A 1W7WA 1FA0A 1WELA 4R5PA 2A10A 2CPZA 2AT1B 1H7XA 2M52A 2R4FA 5T7LA 4IQMA 3U27A 1U2RA 2RE1A 4I6AA 2C3OA 1U09A 2IVYA 1MWZA 3CW2C 3EDQB 4OHXA 3A8KA 3C6UA 1VQ9S 3RRGA 1S1UB 2XMVA 1WI8A 2ZBIA 1H7WA 4M5LA 1H2VZ 1TVRA 4ZPCA 5B0BA 3FQKA 3QZ8A 1U48A 4GMKA 3D6MB 4DFKA 3MMBA 4QZVB 3VAHA 3C6TB 3SCJE 4NLRA 2ZH9A 1F3VA 4C8KA 1U26A 2BE2B 4I6WA 4U6PA 1WSVA 4OJHA 4A8YA 3N9UC 1CULB 3KLFB 2AJ0A 4NMLA 1TL3A 2AYMA 2DCLA 1Q8KA 4CLUA 2ZD1B 3M9OB 2DEJA 1EQ0A 1TKXA 1F1BB 2CQ0A 2FC9A 3H7HB 3EVWA 1RWPB 2WVDA 2RHSB 3QO9B 3SFUA 1T9UA 3W2VA 2YKMB 4B3MF 3TA2A 1LW0B 2Q66A 1RHKB 1RTIA 1UFLA 4UF4A 4USIA 5F8IA 1HBMB 3QIPA 4ZLJA 3M8YA 4J9PA 4ZPBA 2FTRA 4P72A 2LXIA 4QIVA 4DQQA 5CD4A 5D0HA 2ZH1A 1FXLA 2MHNA 1W2IA 3NKYA 4CO2A 4LRDA 3PW5A 3MPYA 3QFWA 2LECA 1VJWA 1N6QA 3RG6A 4E8UA 3K17A 2LDYA 3EX7B 1NSKL 2DH8A 2RDIA 4RUCA 5G0RA 3V6DA 2Y9HA 2VASA 3PACA 1MWYA 4MAKA 2VKRA 4OYPA 4L72B 2ZNZA 4P52A 1C0UB 1RWNB 1Z2ZA 3HSJA 3LUYA 4M5HA 4UT4A 5EGYA 4I56A 4DMZA 4DV2F 3W61A 3PW7A 3DU6A 3OL7A 2G2YA 1JK9B 3CVKA 3A8EA 2YBVA 3AJ2A 3FSYA 2LYVA 3MM7A 3VQTA 4LF5J 1Q8IA 1XNRF 4QYRA 3VVTA 2FY8A 4ECRA 2ZZNA 3KDOA 1MN7A 1AA1B 1YRXA 3I82A 1NK5A 2XZTB 5AXLA 2K2PA 3MF5A 3Q22A 1N32F 5LL6d 5F9LA 4TQSA 1VLOA 3FFIB 1DTTA 3KJFB 2DGSA 2J9DE 1DAXA 3CJ3A 3QQCD 4ZS6A 2VG6A 3DLGA 4DUZF 3MXHP 5CZXA 3MAAA 2NXEA 5IQ6A 3OUYB 2HAFA 2XYPB 5LMUJ 2OD6A 4NXMJ 3NNHA 1S1WB 1S9FA 2Y0SD 3H2UB 1HNXF 1CULA 1N33F 2KFZA 4KPCA 2PIIA 2YNFB 5DDQC 1AT1B 1WC3A 4LF4F 2J76E 1R0CB 2UUTA 2ZKTA 3G4SS 1S5ZA 3DRPA 1XBWA 1H2UX 3H90A 5EX3A 4A4JA 1WI6A 2IAJA 3NLCA 1NZAA 1XTZA 1KBRA 2I9SA 4Q2MA 2DNLA 1D09B 2APOA 2CPYA 2MZSA 4JB8B 4CTAA 5BR8J 1ZAWA 4X4PA 3K5NA 4CO4A 2R2SA 4ED2A 4PWDB 3SCLE 4DPOA 3LAMA 4OI1A 1NMEB 2VJUA 1VCTA 5J2NB 1R3NA 1IKYB 3KK2A 4NLGA 2HNZB 1RDRA 1U2CA 4OIXA 5THWA 1R8HA 3H8YA 2KU7A 3L7PA 5E7OB 3WC2A 4DR7F 3MUVP 3CJ4A 4MJKA 4IG3B 4WE1B 2Z58B 2VBZA 4N77A 2NR0A 2AEMA 3BEGB 3CD7A 4ANCA 2GIRA 1WTBA 2V94A 1HD1A 2QMXA 3MHYA 5FD1A 5EDWA 1GEHA 4WU2A 1IJFB 4K4YA 3IR5B 4QWAA 1XR6A 1NK4A 3HVWA 3HJFA 5LMNJ 4H4KC 1AW0A 5A2QU 4DR2J 4FYYB 1RABB 4WP9A 5HJYA 2QO3A 3FBFA 4DV3J 2R7QA 4MKVA 3KMQA 3EVOA 4AL5A 3EZOA 2N7YA 1P27B 2J6UA 5KFEA 3QMQA 5M2UA 1SJFA 4DSEA 1YJRA 4UOCA 3D3BJ 1Q8LA 2LKZA 4EZ9A 1IBKF 5KFQA 1SPBP 5BR8F 2HHSA 4DV4J 3OHAA 3MMJA 4RX6A 4XPCA 3HVAA 3ETOA 3MM5A 1C1BB 2G0JA 4ZMMA 1RJJA 1JLQB 2ZM6J 5A0YA 3H5UA 4O3OA 1YK9A 1BQMA 4F0KA 3ILOA 2PEBA 1YTYA 4RWXA 2W9CA 1RWUA 4B3TF 2J7WA 2G4BA 3FEXB 3Q8QB 2XY7A 4OI4A 5J1EA 3OR1A 3KJVA 1JLQA 4FF3A 2KM8B 1HYSB 4JV2A 1B70B 1FK9A 1RHUB 2CQ2A 4U7UK 3FKBA 4LSNA 1FE0A 2LCWA 1MROB 5ETNA 2RB7A 4IRKA 1RAEB 4RW4A 2HK2A 1HBOA 1NDPA 1RU1A 1YRUA 2HQDA 2AX0A 3DHXA 1TKZA 4NZ0A 3D6FB 4J9NA 2HYIB 1R7IA 1DJ0A 4AXJA 3MCOA 4DR2F 1G4CA 1OPIA 1CJTA 4DV1F 1UW9A 1V5VA 2V67A 1HI1A 1TR0A 4OZ2A 3W65A 4DV1J 3AOAA 4MIAA 1WEXA 4H54A 2W9BA 4O4RA 3OTDA 4A46A 4PRFA 3MFHA 3OFGA 4IG3A 4WE1A 3CD6S 3HFKA 4WYWA 4WF9Q 4NA2A 1ZTWA 2CZ4A 2G13A 4DV0F 1Y00A 3OV7A 5D4NA 4OI0A 2RKIA 4B3MJ 2HBZB 1GAOA 3T9NA 3BQ1A 2CXEA 2W24A 1NK9A 3CIZA 1ZH5A 4RW7A 2RQKA 4LR9A 3NGRA 3SFGA 1MWQA 1RT4B 2V69A 1Q5YA 5DM7Q 1XWLA 2KJWA 4OHVA 1HW8A 1OY8A 2Z2ZA 3O1LA 4L75A 3FZ2A 3UVJA 3WX8A 3UR0A 5DQGA 4IR1A 4O4GA 1RAFB 3CMQA 3ZZOA 1WJ9A 3SQGA 4Y28C 1YITS 4R25A 2FC8A 2HWHA 2GMJA 2R2TA 2XZDB 4LF4J 4KGKA 4LF8F 3MM9A 2CADA 2UXCJ 4HYKA 2R3VA 4H4KA 2R9LA 4R0EA 1RI7A 5JVGQ 2OHDA 3WC0A 2HQ3A 5CYQB 2HAIA 3CJRA 3A8IA 2IC3B 2XG8A 3RAXA 2F4FA 3D5MA 3KLGB 3PX0A 1RTDB 1NM2A 2R2RA 2JEJA 3MZIA 2MJUA 1RWVB 3BGFA 2OPQB 1IUJA 3BPSP 3NRBA 2XC9A 1N56A 4B9MA 1R8AA 2H9ZA 4J37A 1BQNA 1JIHA 2G1HA 2HFNA 1FKOA 1NDCA 4QPTA 3TYTA 2EC2A 3L7UA 4KR0B 3W7BA 1J5EF 3PO5A 4WFBQ 1S49A 2HQGA 4ETZA 4N5SA 3KKFA 2Y0BB 4NWBA 2V4RA 3V81A 1QVFR 4WKYA 4LR8A 3NMRA 2CKWA 4X4UA 3DXBA 4YEAA 5CD4H 3G96A 3BH7B 3CF5Q 1D9AA 3IXQA 3PM9A 5DG8A 1VBZA 3R5CA 1X8DA 4YB6A 3R5DA 5E33A 3WIVA 1O6XA 2NXCA 2HVEA 3IBWA 4RNHA 1IKWB 3IGNA 4CO0A 4UZBA 1MMNA 3GZ7A 1T0TV 4J9RA 4A48A 2PO4A 3ILJA 4JP8A 4OJ3A 2GQ2A 1B0PA 3US5A 3KLEB 3VAKA 1RADB 3NWGA 2JFDA 5KFPA 3KLVA 5JVHQ 4TXSA 2OPPA 4DL7A 1X5PA 4CH7A 2A18A 2D3O1 3T5HA 1G3OA 2WBMA 3LO3A 3UCUP 1FDAA 2ZDPA 2PMHA 3OQ2A 1L3KA 1R8CA 4NRUA 3TZWA 2NYIA 2XMTA 2R7OA 4PQAA 2VZ9A 1R8PA 3C8YA 4MIBA 4DSKA 2PFFB 4FKXA 2NYHA 2FUG9 5KT2A 2MKIA 4FBTA 1JLCA 1IKXA 1LWEA 2HS4A 3S7RA 1Y10A 5HQ8A 2HMIA 3K0JA 1N52B 1X60A 1XQIA 1RYRA 4V19J 1EJ7L 2C3PA 2RILA 3HD2A 1RTDA 2MQPA 2AW0A 5HMYA 2KH9A 3TQ1A 1A6LA 4B3RF 2W4PA 1H74A 2K7KA 1T9VA 3TARA 1RKJA 2N7CA 1TL1A 3BBCA 2MTLA 5L38A 4NI2B 2BKPA 1BWEA 2Z56B 1ZM2A 5IM0B 2QLBB 3KFWX 2EFPA 4TN2A 4CLKA 4X4QA 4N8NA 3K5MA 1YJUA 1XERA 1NK8A 5KT4A 2KJVA 2DR8A 1FFGB 1UFWA 2DNYA 4DF8A 3DRYA 2Y8WA 2DR6A 2CQHA 3PHEA 4FVCA 4HI2A 4LF2A 2YKPA 5CABA 4A8XA 3P5BP 3TEGA 5HP1A 4XDCA 1N5SA 3NNCA 1AB8A 4RO0A 1NKBA 2W2OP 4ED3A 1JLBA 2PMZD 2GHPA 2POKA 3RUBL 3TUJC 3EM1A 2QMWA 2W9CB 1TQLA 5KG3A 5KFDA 2LFVA 1NH7A 4JYAJ 1WHVA 1RBLA 1WD6A 4B9SA 1MSWD 3PEJA 1VGYA 1X5SA 4ID8A 3KJQB 1RT7B 2Q6CA 4Z37A 1M5HA 4ZVSB 1HWLA 4OFZA 4X2BA 4JI4F 1YZ6A 4WYLA 3TVKA 2CNOB 2HQFA 1FJGF 3NAIA 2L48A 1UEVA 3JB9k 2OAUA 5J2MA 4B3SJ 2YX4A 2FJXA 4PWWA 4Q45A 4B3SF 1TK5A 1GXLA 1TUVA 4O3QA 4RZRA 3MM9B 1N5YB 4XAKA 3CJ5A 2JX2A 3F44A 2A2CA 4JI6J 4KV8B 1QSYA 3HHEA 3GJSB 4QQBA 4WZQA 1TUGB 2J0QD 2YWWA 3GIIA 2W8LA 1M5KC 2YXLA 1IVZA 2EFNA 1LFWA 1RKIA 2HIQA 4L73A 4CLWA 3TZZA 4ZCKA 5DDPC 3AXKA 1CQMA 3OFFA 3DFEA 2IFXA 3PRVA 4Z7YA 4AUKA 1VQ5S 3H2VE 2QLFB 4R8UB 1M5SA 2C2RA 1XMQJ 4W98A 1VRTB 1S0VA 2MY7A 2LXUA 4XIUA 1PYSB 1BQMB 2YVSA 2BX6A 4DXLA 2V4QA 3DHWC 4CLLA 4PUOB 2RQMA 1TL5A 3GIJA 1M5OC 3POTB 1IKYA 1HL6A 2ATCB 1RT3B 3G87A 5KFSA 4ES3A 3KK2B 2QA4S 4MKAA 1HR0F 3W9IA 2VC0A 1T9YA 1UTAA 3HF5A 3OVAA 4RLEA 5KG1A 1FESA 3PIPQ 1HBNA 2DKOB 2YNGA 3FBCA 4KC5A 4CTAB 1FI4A 2OTLS 2F4VJ 4QU7A 3IS9A 2XS7A 4IH5A 1VQNS 3BYRA 2VL1A 4ZVHA 2NUHA 2IA0A 4E2FB 5DG9A 2XS2A 2GC8A 3OBIA 4NLTA 3R5BA 2WVCA 3CULA 1U8WA 1RSCA 3LANA 3AJDA 3D3CJ 4HHUA 2J6TA 3PW2A 3M1VB 1LWCB 3HKZD 3ZZUA 3PO4A 4CH0S 2K1RA 2OKQA 1JKHB 1H6KX 2V8VA 2ZOGA 1S1WA 4HTIA 4UOHA 7FD1A 2QC3A 3MUTP 2K3KA 2V8PA 1U0HB 2MKJA 1T94A 2WB4A 4NLDA 1LK7A 2VD3A 5KFZA 4DR3F 4N76A 2XZWA 4W90B 1AUDA 4P71A 3LPEA 4Y3CA 4KGXB 4ZPWR 4ZDNA 2QJ3A 4DR6J 3VALA 2UUBJ 2DNQA 5KFOA 1C1BA 1NJZA 3E01B 4WK1A 1T03A 4USVA 1U6BA 2R2UA 4DR7J 1FRHA 1U0SA 3DGVA 4ECWA 2AZ3A 4O23A 1XMOJ 3M05A 1SJQA 1SIWB 4LRAA 3GFHA 2GIQA 2KVQE 5DGAA 1KQKA 1S1XA 1FERA 4TYBA 2V8DA 4Y6IA 5IT9Y 4ED0A 4FXVA 3V4IA 1FD8A 2LQ8A 5KFYA 4P7VA 5BXIA 5HBMB 2FJBB 3MI7X 2BANB 3PKYA 1M5PC 4Y0FA 3KK3A 1PCAA 4ER8A 1S12A 2VQEJ 2JJ4D 4DI6A 5F8LA 3GFYA 3NXZA 3VCDA 2XS5A 5KFKA 4QU6A 2YWHA 1IBCB 2PFDA 1JLBB 3K8WA 3DCAA 4JI5F 1S10A 3WIUA 4L6V3 4ED6A 1YG0A 3RYLA 1UW4A 2HGMA 3J7YI 1BHNA 4QJVA 1TL7B 4JV5F 1R27B 4ZPVR 5F0WA 5HLFB 2HVZA 3R1HA 3SCKE 4C98A 1CEZA 3DRSB 5L1KA 1KVJA 1X4AA 3W63A 1EZZB 3ISNC 3DNCA 1F2GA 3TJ8A 5AE2A 1JLFB 4UW2A 3BGUA 4F25A 2VUGA 5A6WA 2F40A 5CYMB 5F8GA 3MEKA 3J7Z5 1U49A 3T5LA 2MY8A 2AKWB 2V8HA 4PG7A 4NI2A 5HATA 1KQFB 2LXFA 3E51A 3JS9A 5BYRA 5JXSA 9ATCB 3MTJA 1Z1ZA 2GCFA 3KDNA 3KLEA 2Z4PA 3FNNA 3NGUA 4WU3A 3CCLS 2MZ1A 4DV5F 3M8SA 1FWKA 2EFQA 1WEYA 1TP7A 2OPRA 4QWDA 4RW6B 2ZC4A 1SL2A 3C2PA 1TMMA 2WVFA 3QRQA 3T5KA 1RXOB 1KQGB 4P10A 3GP9A 3HHDA 3IM9A 2YX7A 2RRNA 4FF4A 1FX2A 2M0GB 2HGNA 3LP0B 4R5PB 1I94J 1VQ6S 3FFIA 3S1TA 4IOAQ 2Z2MA 1NSPA 2M5YA 3GYGA 4EYHB 2RVJA 4RNOA 3QFHA 4NLYA 1TKXB 2HURA 1HPZB 1RP5A 1EP4A 1BGXT 3QSIA 4OYIA 4OHZA 2BRLA 4AQYJ 4DG1A 4B3RJ 4UQGA 3MMAB 3ONQA 1JX4A 4ID5A 2MQOA 3TX0A 1RACB 2AJQA 4FYXB 3NMAA 1VS3A 3MCSA 4OX8A 4BDPA 1J2VA 1EARA 4OV6A 3SQGB 3LP1A 3D0IE 4A8OA 3Q2TC 2V9WA 3ZTSA 1VQ7S 2X3DA 3J7YU 5KFJA 2XO7A 4DR4F 3LALA 3PYFA 2MB0B 3Q23A 2F8EX 2QLXA 4FBUA 1HBMA 2ZM6F 3FSIA 3H4DA 2JEIA 4DQRA 2GVDA 3CCJS 1L3TA 3KHLA 1LWFA 1GMVA 3MGJA 1EKRA 2HFOA 1Q0NA 2M4MA 3T1HJ 2F4VF 4U67Q 2FJDB 2F3JA 4LBIA 2N3LA 1NHKL 5IFMA 4KFBB 3R3TA 1HW9A 1YDLA 2D1CA 3CT9A 3ENQA 3JSMA 2HHUA 3OR2A 4YB1P 2VV5A 3CCSS 3I87A 4DV7F 2FLNA 4OL8A 1N33J 1FKPA 1NRKA 3E3XA 4TVAB 2BOPA 2D9PA 3T6BA 2W9AA 5EUHA 3RBEA 4JI6F 2FJAB 2UP1A 3I55S 4CNYA 4QYZJ 3EE3A 3G6ES 2YNGB 2QGFB 2R7XA 2E7VA 2PI4A 3B78A 3IAS9 1HYSA 1VRQC 3G6VA 2XMMA 3T1AA 2HBQB 3EGVA 3U1MA 1SB6A 2E5GA 3QRRA 2BVZA 4HR2A 4UTGA 5D78A 4F50A 1RT3A 2XY6A 2VPXB 2M2BA 3V2UC 2KI2A 2RMLA 1IM6A 3M2UA 2UU9J 4LF5F 1N5QA 4F4YA 3FMBA 4P2SA 5DG7A 2QSFA 1PAEX 2XGPA 3M8RA 4LFBF 1FO1A 2ZEJA 5KFHA 1K9MT 5CHCB 1J5EJ 4RBUA 2W9BB 4C11B 2RF2A 3PRBA 3NS6A 2W4CA 5BYSA 2JWNA 1S6QA 2DXEA 1LXJA 1VBKA 4P74A 3RR7A 2CQ3A 2AHOB 1V3RA 1YBTA 3OTEA 3S6EA 3UE2A 3HHNB 2XSJB 4EBDA 2VG5A 4NA1A 3U1LA 5CQGA 4I7FB 3AJ1A 5M2RA 5DRKA 4TU8A 2PA3A 3I0SB 4AXIA 2ZE2B 4ILLA 3HM9A 2ATLA 4BWMA 4USHA 4DLEA 5J2MB 1JJ2R 6AT1B 5HVGA 2HHHJ 4YOEA 1RE1B 2H1YA 1OY9A 3OTOF 1FWLA 1S1VB 3GQCA 1RAOA 2CJXB 1EQMA 3C14A 2HHWA 1QTNB 2KZMA 3I4PA 2DXFA 1N54B 3I5BA 4G1IA 4MKBA 2KFNA 2E7WA 3POTA 4N7TA 2QT7A 2JFKA 2HVDA 2MLZA 2NZCA 3V4MA 1SJ4P 4CH1A 1UVLA 2BR0A 2CFXA 3OJUA 4M5IA 5B0AA 5IWAJ 3GSIA 2RNEA 4NCBA 5C42B 1S6UA 1ICEB 4X4NA 3GJTB 4O0NA 2H65B 1WEZA 3R9LA 2OFHX 4I2PB 5LXRA 4DX6A 5F3ZA 2M3DA 3W5XA 3DU5A 4ILRA 3I5CA 1HNVA 3SQOP 3O5TB 1GTHA 2EBGA 3AODA 3N01A 1ZM4A 4X65J 2WSEC 4ECVA 4KPYA 4DZDA 4B3OB 4P6QA 2W7PA 2VFSA 5J2PB 4F2RA 2ZZMA 2CQ1A 2AJ4A 2Z2LA 3WDOA 5IV3A 1R0AA 2V50A 1WKJA 2R7SA 3PV8A 1WOPA 3HSDA 1WF0A 1WC5A 4MFBB 5LSRA 5LMNF 2NCKL 1U1MA 2CPXA 3BGOP 2QA4G 2AJ1A 2B7BB 1BWVA 2HW3A 2HBRB 1QM9A 1TU0B 4KKOB 3AOBA 2YH0A 1CJVA 1NHUA 4OX6A 4Q2LA 2K06A 1IBLJ 2WAQD 5HK4A 2RJZA 1KFDA 4G1QA 1CJKA 3PJWA 4DFJA 1T9WA 5FDLA 2JDJA 4Q0BB 4D3HA 1IBKJ 1NB7A 1FEEA 2C3MA 1VK8A 1WORA 3CCUS 4HDGA 2UZAA 1JNRB 1VFJA 4NL5A 3DDNA 1MMDA 1RA6A 4F02A 5J2NA 3BDEA 1KLNA 2E5IA 4AYBD 2ZOFA 3OLAA 1SV5A 1VMBA 3GJQB 4QOTA 4QR1A 2BJDA 3JQKA 4USKA 3UI3A 1MNEA 3BBFA 1ZTTA 2IY5B 4MK9A 3TJAA 1B99A 2A6MA 2P8IA 3FBBA 3TVYA 2V9KA 2EFGA 2ZHAA 2E5HA 4PYAA 8ATCB 3MR5A 1FXRA 2D3UA 2OLWA 2AYGA 4LF1A 4NASA 4F2SA 2W4DA 2GJ2A 4JI7F 3DI6A 3VAGA 2RRAA 2DNRA 3M6VA 2OELA 1KLMB 4CLTA 3SSSA 4YY3J 3DOKA 3IWNC 1PJ6A 3ETMA 4C9DA 3MEGB 2O01C 4NYPA 5EWEA 3BO3A 2D41A 2VG6B 3CJKA 1S79A 1NK6A 2B9YA 4GKJF 5HLFA 3PIOQ 4IG0B 4CO3A 1SIZA 4LFAJ 5HVHA 3LP0A 1YKWA 2J8SA 1HQUA 4ZJQA 4KY3A 2O67A 1HNWJ 5CXTA 3HULA 4F3MA 2H5EA 4X62F 1NEEA 1TKTB 1BE4A 2RS2A 4DL6A 1FJGJ 2R7UA 4WP8A 2DGUA 1Z2LA 1N36F 4DL4A 2XY5A 2OPSB 4NXNJ 3QJJA 2X1BA 2G9OA 4IG0A 5LJ3Y 2HZCA 1ZZFA 1TL4A 2BEFA 3LAKA 4A8MP 2V8GA 2L41A 1D1UA 3RW6A 4YB5A 3V4IB 1NBEB 1Y5NB 4KKOA 1RTJA 2DISA 2MKYA 2WW8A 4Y00A 2FD2A 2OO4A 3G86A 3GIRA 2XCPA 5LM7E 3CO0P 2CWKA 4LF9J 5BYQA 3MMCA 4B17A 1HHQA 3ZNUA 3EXYA 2AYBA 3M2RA 5F8HA 4K5RA 2EEYA 2CG8A 1N32J 4I67A 2QLJB 4EWTA 3CCRS 1H98A 5IOLA 5CAAA 1FDNA 1U1PA 1KVKA 3I6PA 4UUWA 5DZ7A 2QL5B 3V5RA 1HWKA 3UDVA 5HMWA 1LW0A 1RT5B 1T11A 2ZWOA 3CJSA 4ZP6A 4RKUC 3W3SA 4IH6A 1D3WA 2R8KA 1F9EB 1S7IA 2D7SA 5C42A 2KFYA 2BJ7A 5LMUF 2YKOA 2MZQA 4KQZA 3QIDA 4QCLA 4ITSA 2W25A 4X4OA 2JVRA 5J1NA 3GIMA 4JI5J 4Q8EA 2DIVA 4X4SA 3EWGA 1KVIA 4K4XA 1MN9A 3CE8A 4IFYB 5HBMA 2B9EA 4LRBA 3PXGa 1XNQJ 4IO9Q 2J6SA 3LGMA 1B3TA 3J7AN 1YJNS 2IC3A 3HT0A 1F0XA 4S0MA 1G2EA 1KOHA 4WK3A 2CJBA 5C2CA 4TNOA 1S1XB 2JVOA 4C8ZA 1CJTB 1ZBTA 2FZKB 3WHIA 4EUVA 1U6FA 1X4DA 2V34A 4DV2J 4ZPAA 3C6UB 2ZH3A 3TP2A 3Q8SB 2FPHX 4WBFA 2XQCA 2ZBPA 1S57A 3O3LA 5JJBA 5GAHI 3H5SA 2Q43A 1NK7A 2HS3A 1SJRA 3CCMS 2XULA 4AL7A 3JTOA 2JNJA 4FZVA 5J1EB 2JZ5A 2Q1LA 4I2PA 5IQQA 3KJVB 1DQ8A 2DR9A 2RAQA 2HZVA 1CLFA 4YDXA 1VBXA 3QWUA 2FJWA 2QFIA 4FKYA 4YR3A 1JXVA 2IIHA 1SUQB 4CI0B 1HNIA 5E3AA 3K58A 5K8NA 1DRZA 2FY1A 2B6AA 3M32A 3OXGA 2K1RB 3GCXP 2AGOA 1T3NA 1PBAA 1QUVA 2I5JA 5I3QA 3LOUA 2R7TA 4EBEA 4DZ6A 3KHHA 4ZPTR 1S6PB 3ZNJ1 3PFOA 1LQ9A 3DLKA 5K14B 2GMLA 4OZ5A 2RUSA 1OMSA 2BM0A 3EGZA 4ETXA 2XYHB 5C5JA 1SKRA 3CUNA 2HNYB 1VQLS 3HX9A 4DSIA 1QSSA 5I4MA 2OSRA 3W8PA 2OD4A 4B08A 2EKYA 2ABYA 2GMHA 1AROP 4GVLA 4GO5X 4LSLB 4RUHA 2DCUB 1FK9B 4NLPA 4RU2A 4NA3A 2FJVA 3BJYA 3QT5A 2WSCC 2BW7A 4ATNA 1VC6A 3I5AA 2UUAF 3VHQA 1SH0A 4C11A 2AU0A 4ZCLA 4Z2XA 2MMYA 4OYBA 4F26A 3IWLA 4KO0B 1P1LA 2EK6A 3DMJA 1REGX 1KS2A 1X4EA 2C2DA 4K4SA 3IG1A 1HI0P 2VFRA 3P3DA 1SI9A 1VR6A 3MM8B 4K0KF 2AGPA 5L8RC 3K59A 4HACA 4MK8A 1LOUA 1TMJA 4M5JA 4NOHA 4YN3B 1J5OB 1RQ0A 1RT2B 3BKUA 2DO4A 1WDTA 3DGPA 2GQCA 2BQRA 1CG2A 2E5JA 4ZCIA 2VONA 1WKLA 4LQ3A 3OR2B 1VHFA 2DHHA 4DDFA 2IAJB 3KG4A 1K44A 4ENOA 1SXLA 2YWEA 3JSRA 1X5OA 3BV8A 1CPZA 1UWBB 1X31C 4ZITA 1D9FA 2HHPA 2HQIA 3EMTA 1AYEA 2C3UA 3RW7A 5DJBA 5C24B 2JLFA 3UN3A 3IGVA 3CPWR 3M32B 2QRRA 2HBYB 4EEYA 2HMIB 1YIJS 4K7QA 1N34F 1UEUA 1S1TA 2VF3A 3IO1A 4NLSA 3CCTA 4RWWA 1YJ9S 1TKDA 2V5HG 2XBPA 5GAEU 1L3UA 1U02A 3NOCA 4TYAA 4ZVQB 1F6TA 1PYOB 3SEOA 1OY6A 2IM1A 2ZFHA 3D0HE 4I2QB 4RW9A 4USJC 4WTYA 4N47A 4XPEA 2BW2A 2DXDA 1KONA 1UAWA 3ITHB 2MKCA 2KVIA 3Q8PB 4JI0F 1CS4A 2V2KA 3R7SB 1D8YA 3MMCB 2NXJA 1RTZA 3QAEA 2N4DA 1Y5IB 3I0RB 3JQMA 4FDFA 4NLOA 8RUCA 5AJ3J 1Q8BA 2HRYA 1XK8A 3TEHB 2ZJQQ 5H9EK 1QD1A 1P1TA 4OYOA 3VAFA 3MDFA 2HSEB 3MTKA 2JLEA 3HDSA 4F04B 1KKHA 1JNZB 1P8GA 2J7UA 2VPYB 3IR7B 4HI1A 3TVZA 3QSYB 1U1RA 1M5VC 2DGXA 2EVZA 3GPAA 1RHJB 4K4ZA 3MAHA 3KLIB 2Z2YB 1VQYA 2O3DA 4YUDA 4DG1B 4LIRA 1IKXB 1LWEB 5KFRA 2GQQA 2XMUA 3D54A 3H98A 2OPSA 3V81B 1JLCB 2L9DA 3CDBA 5IT4A 1SL1A 4LF7J 3IBFB 2NXNA 2GHWA 3BYPA 3MAAB 5A8WA 3OUYA 3JYTA 1APSA 5KOXA 1BQNB 3D0GE 4OV1A 1HQUB 3OHBA 4DR5F 3HD1A 1GMUA 3GU0A 4DUZJ 4QYZK 2BDPA 1ZA2B 5GAGU 1YHQS 2CJAA 4QR0A 4URSA 3THVA 3AT1B 3HFZB 4ECSA 3L09A 3VGUA 3AXMA 1QE1B 4DR6F 2J9EA 2A2DA 1WC4A 1ZA1B 2ZVIA 3C15A 5FLXY 3QGHA 1O8BA 1R6YA 3NOGA 1J27A 2ZD1A 3FUYA 3PW4A 4CO1A 3AD8C 4B9UA 2OMOA 1X0FA 1FJEB 3BS9A 2DRDA 5DGBA 1IWGA 2MDAA 2ZH4A 1RCXB 5A2QY 5L46A 4PXEA 1UVMA 2OEKA 1QE1A 3W62A 4LRCA 2LMIA 5K8MA 1NPKA 3V6KA 1JXLA 1W25A 3ITHA 1D0EA 2WOMB 2IMWP 2IPOB 2P2CB 1T05A 4U7CA 4RW7B 4QWEA 5U47A 2H54B 2VBXA 4OZLA 4M5DA 3ISND 3EZ5A 1X4CA 4YDDB 1KQSR 1FKOB 2AJ2A 4NCAA 1PILA 1TL7A 1FRLA 4HH1A 3OD2A 4H4MB 4PYDA 4IR9A 3IRXB 2Q6BA 3AFGA 4J9QA 4UY8T 2GVZA 4ED4A 2G0CA 4FYDA 3BBBA 1BUXA 1CJVB 4PCQA 5D4OA 3BO4A 2YNIB 1X4GA 1R0BG 5A76A 1WC0A 4G3IA 2BANA 2IJNA 1T8EA 3HMJG 2JEFA 3G8TA 2VBWA 2KL8A 5F8NA 4N41A 2ROEA 4C0OC 1NSAA 2WZ1A 1IR2A 2J7KA 1MG7A 4MYTA 4PABA 4DFMA 1E6YB 1PKUA 4LVOP 4LT6A 4Q44A 4DV5J 4X64J 2A6OA 2UVVA 4M95A 1B7FA 3L9ZA 3P45B 3FMWA 3OT9A 4RW8A 4X64F 4NYZA 3T1YF 4OZ3A 3OL8A 2ZWPA 3CJ2A 2XNRA 1HBNB 2EKNA 4FN5A 5GAGI 2KXFA 2DT9A 1JMTA 3LGNA 3PYGA 3DXSX 2ADCA 5IT9U 2D3OR 2HQCA 2CQ4A 5K8PA 1IBMF 3MM8A 1Z4UA 3GR1A 3R5JB 3GJRB 2V68A 3BN4A 4HHHA 3TANA 1IXKA 2ZBQA 1Q79A 3BR9A 5E41A 4ED1A 3DMJB 3NY0A 3VAIA 1C1CA 1DY3A 4ICLB 4F3QA 4OLPA 4J91A 2ZNYA 2HGLA 4G1QB 5D4PA 5D3GB 1S99A 3M1VA 2E1CA 1UWBA 3DLLQ 4ZP7A 3WBZA 2DY9A 1UWAA 2RU3A 2AJFE 4J9SA 2YWKA 3DOMB 2C22A 2V6AA 4CIOA 4J7CA 4U96A 2F9DA 5GVQA 4OZNA 4A8KA 2FLOA 2QIFA 3GFXA 4LF8J 1RCOB 2E1AA 2DY1A 4ZN1A 4HT5A 3OXLA 4I7FA 3G82A 5LT5A 3LGHA 3KK1B 4GKKJ 1EX8A 1XIQA 1YBAA 2DBBA 2LDIA 3IS9B 3LWLA 4KE5A 3U02A 2B4OA 2ZUGA 5RUBA 5E3PA 1X9MA 1HI8A 3PX6A 2VOOA 5E3CA 1UMJA 1SUQA 1HWIA 3NBPA 3NG8A 5KFGA 4OI3A 5KG7A 3T1YJ 1XNRJ 3M8PB 3CGIA 3QT7A 5KFMA 2UU9F 1FWPA 4PXDA 2GVDB 2M88A 2BA9A 2GHVC 3JTPA 2R8HA 1FRKA 4DV0J 3B4MA 1YJTA 4CLFA 3Q8YA 3W2WA 2YPYA 4JV0A 3UPFA 1H2TZ 5FLXU 3GTYX 4V1Ak 1HNZJ 4A8FA 1JLGA 3UD3P 1BXNA 2WBRA 2GZOA 4CCHA 1NPPA 3C19A 2VG7B 1AZSB 2OI2A 4DX7A 2V2ZA 2DNNA 1FEHA 2K7JA 4OYMA 4DU7A 1ZZNA 2DNMA 1VQPS 1BMQB 4O3NA 2GAGC 4WJBA 2PT0A 5KFIA 3U7JA 2FGCA 4PG8A 4DV7J 1QDUB 4P2MA 2U1AA 1ZPWX 1DARA 1QAIA 3HVTB 1D9DA 4BS2A 2RU9A 4UOFA 1T9TA 1CQNA 4M63A 2XMJA 2NLWA 3BQ2A 4QIEA 4CM2A 4ZCMA 2CG4A 5C7PA 2ERRA 2Z8QA 3GR0A 3K5OA 1W2BR 2ZDOA 2FJEB 4ECTA 5B0EA 3UCGA 2MSSA 4KSEB 5T14A 1HR0J 4CQ1A 3ZZYA 4GKJJ 1R31A 4NLXA 1FFSB 3NAHA 2W7AA 2LEBA 5F3TA 1FVQA 2GGPA 2H48B 3N28A 5AT1B 4OMFG 3LF0A 1YZ7A 2ZH8A 4YHHJ 1RWOB 4ZIVA 5ITHA 2UVWA 1R6VA 3P6YC 4CLYA 1WG5A 2E5LF 3UQSA 1FVSA 2PD1A 4J9UE 4ZLLA 4X65F 3ZTPA 2E5LJ 3LP1B 3L7OA 3M2VA 4PG6A 3EPGA 2ASDA 1K1SA 2J9CA 5K20B 2GJIA 1C0UA 1NB2A 4RNFA 2ZKUA 1VQMS 1YI2S 3ET6A 5H9FK 5K8OA 2L3MA 4XO0A 4Q8FA 2YNFA 2V2QA 3FCWA 1ROFA 3ILLA 5ETRA 4KAIA 3MUMP 1O0PA 2XCAA 1EP4B 3SI8A 3DLEA 1Q4RA 3OFEA 1FDDA 2W8KA 5KT5A 1CC7A 3JQJA 3SCIE 2MZJA 2VFTA 5ADZA 4F67A 2B8QA 4AT1B 2J8AA 3OTOJ 2EPIA 4TKTA 4OX7A 2F1FA 3EZUA 2IM0A 1EETA 5KT7A 2XI2A 3W2VB 1HD0A 2F8HA 2BJ1A 2DHGA 4C6AA 4OYAA 2NPFA 4EFAC 2KG0A 2R8GA 1X7VA 2HFUA 1V6HA 3M30A 1Y11A 2VA2A 2CQBA 3GYNA 3UR3C 4P2FA 2CNKB 3NGKA 4UY85 3QJLA 3VQSA 2DNOA 4DPWA 4CYUB 1KDNA 1MU2B 2DK2A 3C16A 3ISZA 3A12A 5KOWA 2RQCA 4GC6A 4XDDA 3SV3A 1VIOA 2YKQA 4HVZA 1UVKA 3U1NA 1U1NA 5GADI 4IRDA 1N0UA 2DR7A 3DLBA 3NS7B 5E3QA 1LWXA 1VYAA 1UJ4A 2OFGX 3PCOB 4WCEQ 4WWSA 4DLGA 3I32A 4DX5A 4JV5J 4ZVUB 5B09A 2OEJA 3CCES 4WFZA 2ZJRQ 1SQGA 4ZHRA 2ZH6A 1SC6A 3AY0A 1U47A 5T7LB 4Y2CA 4RW9B 5KFTA 5KTQA 3OSPA 4KTQA 3G6YA 3FEYB 3RB3A 2ROGA 4O44B 5I3UB 5IV4A 2LQ5A 2RRBA
chains in the Genus database with same CATH topology
2RKIB 1VQKS 2LEPA 3KNGA 3DLEB 3HHLD 2AWZA 2LA6A 3NCQA 1I1GA 3BSAA 1U8SA 4W92B 2MJNA 2JLGA 4F4KA 1GTEA 1QJHA 2LU2A 5DDOC 4X4VA 3GE9A 7FDRA 2RT3A 4IO1A 3SV4A 1DTQB 3O8WA 1ZAVA 1MMLA 1B64A 3ZZRA 4J9KA 4DL2A 4ELTA 3M2VB 3AB2B 2YKAA 1LW2B 1RT2A 1RYSA 4HKQA 3CEDA 3PDNA 4K2XA 1C0TB 1S1UA 3ZZTA 1Q81T 2DVIA 2AF6A 1L3VA 3QJPA 3BF4A 3H4BA 2D74B 2ZITA 4B3OA 4X4TA 3NCRA 3CO9A 4IKAA 1JLAA 1VLYA 3AQOA 3TR5A 1OPZA 3IG1B 4PPZA 2UUCF 1VRUB 2NREA 1FRMA 3RTVA 2HRUA 4ED5A 4DUYF 2UUBF 1O51A 3NBPB 1FKAF 2D9OA 4WKRA 1Y9OA 1TFWA 3KHGA 5GAEI 3SYZA 2A1BA 5A0YB 2EBEA 2PC6A 1VQSA 1XR5A 3KK3B 1Q7YT 1AFJA 1DBDA 1RT6A 1N5VA 2KYXA 2MYFA 3GFZA 3DLHA 1Y0HA 3VWSA 2PGCA 3BSNA 1VC0A 2HHXA 3MR2A 2YQ3A 1S7HA 4AQYF 3MECB 3N4WA 1R0AB 2C2EA 5B0CA 3V6HA 2RD5C 4DR1F 4NZ7A 4QBUA 3SZ2A 1URNA 1B0VA 3JAMY 1L5UA 4LSNB 3P49B 2KB2A 3S8SA 3L3CA 2COLA 2EFVA 2CJ9A 1DQ9A 1HBOB 4TY8B 2VG5B 2DNHA 3MECA 3BGRB 3NS5A 2MKSA 3T9ZA 3C3LA 2X51A 2B5JA 3TOQA 2FGOA 1ELOA 2WSFC 2HHVA 5KG6A 4D3GA 2F7VA 1HWJA 4PQUA 4B02A 3R5AA 2GX8A 3D1QA 3IRWP 2BABA 2CPDA 1KNZA 4K4UA 3SXLA 2XGQA 4F3OA 4PKDB 5KFAA 2B4UA 5KFNA 3TAPA 3KK1A 2C28A 2B4VA 1GX5A 1C0TA 3V6JA 1P9QC 1S9EA 4NYOA 4BHQA 2N82B 4ZP8A 1JXEA 3JSMB 1FNOA 3K2YA 3UNGC 2AGQA 1KR4A 1T7PA 2RF2B 2RDJA 3VAMA 2K8GA 4ZLPA 2ADBA 2P9GA 3Q0AA 4FP9A 1K73T 3TW0A 5A8RA 2MGZB 1C1CB 1XN9A 3CC7S 4R0JA 4FF2A 5EN1A 3ZZPA 2DB1A 1XR7A 2EG2A 1NK0A 2Q79A 5IWAF 1K1QA 1R89A 2KT5A 1BY9A 4ZVEA 1RT5A 2HNZA 2HVHA 2FLLA 2OP5A 1U45A 2XLJA 4JI2F 4RW8B 2NSCA 4IDKA 4DBQA 2OH2A 1OSCA 3M2RB 1M1KT 2X1FA 3UW1A 1N88A 4ZP9A 5CA5A 1NNDA 5MLCV 1NJXA 2D3ZA 5H1SV 4URQU 2NXUA 4MYUA 5AXKA 2LQ9A 3EUNA 2IBOA 3BB5A 3I31A 2VFVA 3EGWB 1TAQA 4ALZA 1TL1B 1HBUA 3MOJB 2DHXA 4LMZA 4NRTA 4TY9A 3D2WA 3SSQA 4IFVA 5C25A 1RT7A 2EWHA 1N48A 1XMBA 1QAXA 3M30B 2R7WA 2DTJA 3SDEB 4DS5A 2DNPA 3FEZA 5DETA 2KRBA 2BRKA 2WCXA 3M6UA 3SSRA 4E0DA 1EETB 3WX4A 1VQ8S 4MKYA 3PRDA 4C0HA 5HROB 3QYYA 5KT3A 3KLHA 4JBCA 4RW6A 2FVPA 2RH3A 3MEGA 3CDAA 2M7SA 3CDUA 4ZOSA 1KOOA 3CJKB 5E3RA 3HHLB 2XLIA 1NKCA 3H25A 1OSDA 2IMOA 3CCWA 2FHJD 5CYQA 1MU2A 1KLMA 5AJ3F 2YKNB 3CD5A 2ILZA 3TAMA 3MAQA 4ELUA 1RISA 2MHEA 2QSWA 4DL0C 4K5SA 4YR0A 1U1LA 5KFFA 2LQBA 3QGIA 4U9RA 2Z0GA 5KG4A 2DNZA 1DFDA 3HHLA 4DV4F 2E7XA 3LP2B 2IVMA 1VK3A 3CC2S 1LKZA 2PN6A 4PG4A 1SL0A 4IDKB 2BQ3A 1XMQF 1V3SA 2ZHOA 3MR3A 3MEEA 1TV6B 3T6JA 1GT8A 4O0IA 1IQZA 4F4XA 2B0GA 3T19A 2DHSA 3CMAS 2RQ4A 2VFUA 4A47A 4DOZA 2FVSA 1HHTP 4NXNF 4MK7A 5KFUA 1U7LA 3RZAA 3I56S 1M90T 1S0MA 3LW5C 3FCHA 4HTJA 3TA0A 1G1XA 2MQMA 3VF0B 2ZJPQ 4KBIA 5EHHA 1SKSA 2LVWA 2B56A 3FJ2A 3KYLA 1HBUB 4LF6F 5KT6A 1N0VC 1LK5A 2FVCA 5B0FA 4AFFA 1GH8A 5FIIA 1S0OA 1S9GA 2PI5A 1IKWA 4NZ6A 4C7QA 4MFBA 1XEZA 2E9RX 1P6TA 3AH6A 2HNDB 2ILYA 2UXCF 2B9XA 4A8QA 3QZ7A 5AXMA 1FF2A 3R1LA 5DS7A 4DSLA 1UJ6A 2Q3PA 3FZBA 1UL3A 4I6YA 2JRSA 3J7ZT 3ENWA 3RAMA 4I2QA 4BBYA 4J5OA 4I64A 4RBTA 4RBVA 4Y2KA 2CQDA 1FHTA 1BLUA 1JLGB 4YQWA 2CQIA 4V19X 3X1LB 4KIAA 3VAJA 5SZTA 3VZHA 3UFCX 1HQEB 1YJVA 4NXMF 3MM5B 5DDRC 3PVXA 1HARA 4O3RA 1DHMA 4KGMA 4LSLA 5F9NA 2B3TB 3KLGA 1U6ZA 2E9TA 2QE5A 3OSNA 4AL6A 1PGZA 2AD9A 3JSBA 3OTCA 4FXWA 2CVEA 3C46A 2E9ZA 1UP1A 1UJ5A 4M1KA 4QWCA 3PJXA 4QW9A 4EO6A 1F60B 2CQPA 4C4WA 3NL0A 1YRTA 5DO2A 4MMOA 6FD1A 1Q78A 2BQUA 4OQJA 4LF7F 4NLWA 4KO0A 1U4BA 2Y1RI 3CMES 1DLOA 4PXCA 5D6GA 1UA1A 2YTCA 3UCZP 2YX1A 4JV1A 3GIKA 1WNEA 3TI0A 2GA7A 4WFXA 4ILMA 5CH7B 2XWXA 4WZMA 5A8RB 3H5XA 4OLOA 1VRTA 1S77D 2CRLA 3MD3A 4QIWD 2MQLA 5F41A 3TUZC 2V4JA 4FF1A 1FNXH 2WRMA 3PKMA 2HNYA 2KT3A 1XMOF 4C3MA 1LW2A 3UDLA 3QAUA 4K50A 3MEDB 3N5BA 1S4FA 1S9EB 4Q5VA 1E6YA 4NLQA 4HLBA 1HFEL 2N4CA 5I42A 1TK8A 2HWTA 2EC0A 3HZEA 5B0GA 1HA1A 1WHXA 2JC0A 3O6QA 1K0TA 3R27A 3TX8A 2BBEA 1QUPA 2IYGA 2I5JB 2HG4A 3T3FA 4ED7A 4PUOA 2F9JA 5M2PA 5G4DA 1AXQA 2B9WA 2KN4A 1R8BA 3IR6B 4EU0A 3AHPA 1VIXA 2YNHB 4G6VB 2CIMA 1JLAB 2F8MA 3L95X 1OO0B 2M9KA 3QPIA 4OZJA 4TU9A 2EFOA 1QTMA 1RT1A 5AE3A 5L1IA 4DL3A 5HP1B 3NNAA 1TAUA 3OL9A 2IM3A 2P6SA 4F4WA 1S9GB 2XEXA 1FRJA 4MIWA 1DTQA 3OVSA 1REVB 2AYEA 4JI1F 4NCGB 2EK1A 3GG0A 4PR6A 5B08A 1C4CA 4DSJA 4IFYA 3X3UA 1NKEA 2DPIA 3KG1A 2BXJA 1KC8T 1IR0A 4J9LA 1FDBA 5I3UA 5E5NA 1K8AT 3K5PA 3MD1A 3HK2A 4FNIA 2QZ8A 4ES1A 1DTTB 2WHOA 2CPIA 5H9EJ 2IJFA 4FXDA 4H4MA 4LF9F 3DRXA 4WFYA 3ICLA 1TV6A 4C2MA 4DL5A 5E2QA 5HMXA 1XNQF 1WTFA 1HNZF 2DNKA 2MPUA 4YFUA 4WFAQ 1TZ0A 1OIAA 3F56A 1VQ4S 1OS5A 3DRRB 3GB0A 5L9XA 2L9WA 3LH2S 1X9WA 3RR7A 2UUWA 3ZFVA 2OPRB 2R8IA 3KLFA 3IWXA 3KLIA 2ZH5A 3GSDA 2VC1A 2YKNA 3DYAA 1IQTA 3HHKA 2OSQA 5G0RB 3V6DB 5KFWA 1TK0A 2OTJS 4ID5B 4BC7A 2NSBA 3AB4B 4MTPA 1B0TA 4OI6A 1V3ZA 3N79A 1HPZA 4Q43A 5CYMA 5KAKA 3N0VA 3D28A 5CZVA 4CZCA 3JYTB 4ZK7M 1BC6A 3B8HA 4TLRA 4ED8A 3Q2SC 5HROA 4I0WA 1CVJA 3VZIA 3PY8A 1Y7PA 3CJ0A 5C25B 2KXHA 3RB6A 4FNHA 1KTQA 2OMLA 2ASLA 3LP2A 1NHVA 4IOCQ 2VPWB 1U25A 2VPZB 4QW8A 3SMZA 1X9SA 3DI6B 4WFNQ 5LXYA 3CCVS 2GW8A 1VQOS 4Y34A 2Y1IA 1KEKA 2X1GA 4FPRA 3MMBB 1FRXA 3P5TL 1Q1KA 3C6TA 5KFCA 2DHAA 1ZETA 3I0RA 5HI7A 3ENVA 5HO4A 1N6QB 1JLFA 3RB0A 2GO9A 1NO8A 4QIFA 1PC4A 3AA9A 1O5JA 3E01A 1T03B 1DURA 3N6NA 3CDEA 2YNHA 5CCLA 5IS2A 1RTIB 4KJIA 2NZ4A 1PO6A 1WF2A 4FS2A 3GMGA 4QIGA 4WXWA 4KHRA 4K4VA 1F5AA 3ZZZA 3OPKA 4OHYA 3DM2A 1ZOTA 1JKHA 2CPFA 1DZ5A 1Q7LB 1V9OA 3I96A 2OJ3A 2CVIA 2ASJA 2R7RA 1YVFA 4RUAA 2WTFA 5A6PA 2QFJA 2JEGA 4C8NA 2ZZMA 1REVA 2XB2D 2NS1B 4OX9F 3F73A 2EW9A 1IBLF 3HO1A 5F0UA 1Y3KA 1U24A 4H4OB 1N4LA 2P9CA 1IN0A 4J9OA 3G8SA 4ZVGA 1MROA 1X4FA 2PA8D 2BZ2A 4NPOA 1SKWA 5EWFA 4F8RA 3H40A 1FXDA 2E1RA 1M0SA 3M6XA 3VR1A 4EGLA 4JYAF 3BGLA 2BJEA 1NAQA 1X5TA 2WK4A 3HI9A 2E66A 3M8PA 4QR2A 1N8RT 2LU1A 1N5TA 2E29A 1NH8A 1S1VA 2ACYA 2KHCA 3IC1A 4B9VA 3PEHA 3M6WA 2IVFB 4JI3F 3HKWA 2WB1D 3H20A 2ZHBA 3QGGA 1Y5LB 5DQIA 1H38A 2FHKA 3HVTA 2XLKA 3G9CA 2DGQA 4DN9A 1OWXA 2DIUA 3HVRA 2J9DA 2GNKA 1S6PA 3MEDA 3QGPA 4I1TA 4QWBA 4DQIA 4Y2MA 6FDRA 2JC1A 1F5CA 1YQHA 2DD8S 3JTNA 3OR1B 1S6QB 1SBRA 1FD2A 1HNIB 5F8MA 4X66F 3IN5A 1KHVA 2NQPA 1HNWF 5D3GA 3MM6A 3W2WB 1U1OA 3RRHA 4LFAF 1VRUA 1HMVA 2J0SD 5H9FJ 4X84A 1PSDA 4BC9A 5L39A 3PNIA 1HHSA 2W7OA 3BR8A 3CTRA 3EPIA 3CCQS 5B7WA 4H4OA 2B43A 3BZQA 3FRZA 3FDSA 2XHWA 2LQJA 2WOMA 3NP5A 1D8ZA 2SXLA 4CT8A 3BDPA 2DH7A 3CSKA 4ZPDA 4KHMA 1QAJA 5LSOA 2A3JA 4XK8C 3LQVA 1IKVA 1S97A 2HWIA 3DC2A 4K4WA 1WACA 2CPHA 2YWGA 2XMKA 1KD1T 3TA1A 4O44A 2QEXS 3MR6A 1NJWA 1A9NB 1JLEA 3CC4S 4ICLA 2VQEF 2IYIA 3OVBA 3HXMA 2FDNA 3OTBA 1S48A 2JH3A 4ECZA 1NU4A 1UKUA 5HL7Q 2ZH2A 4CO5A 4E98A 1JWWA 1RTHA 3Q24A 3PW0A 1SH2A 5DLFA 4O3PA 2J0WA 3AA8A 3MM7B 4RNMA 3MEEB 1PC5A 4ZHRB 4EBCA 3MOZA 2J0XA 3QLHA 1RTJB 1ULRA 3DOKB 2PSZA 1G7CB 5L1LA 2HFZA 2YWFA 3O44A 2B4PA 5A8KA 5IM0A 2QYCA 2M8HA 2DRBA 4F4ZA 4RNNA 3KWMA 1GX6A 3CCZA 1QAYA 5K9FA 3BREA 2BV3A 3TAQA 1TKTA 3IA0A 3KG0A 4C0BA 5DM6Q 3IFEA 4FVMA 2CJKA 4HDHA 5D77A 3H2LA 1JJ4A 4I69A 2HS0A 3H5YA 1GNKA 4KT0C 1BQXA 1C2PA 2BM1A 3PFEA 4LQ9A 2VOPA 1T02A 2J5AA 1I94F 1H0HB 2B51A 5F8JA 1VBYA 4PXBA 5C24A 2DGWA 3BSCA 3F41A 2OIHA 4IFVB 1X4HA 4HEA9 5D4LA 1FRIA 1YJWS 4IYQA 2RUGA 4NCGA 1IM4A 2FHOB 3UWTA 2PEHA 2QA1A 3CIMA