3DXZA

Crystal structure of ectrmb in complex with sah
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
200
Chain Sequence
HALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEGHGVWDLMFERVKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomeric tRNA (m(7)G46) methyltransferase from Escherichia coli presents a novel structure at the function-essential insertion
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
total genus 65
structure length 200
sequence length 206
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dxzA00
1ZHFA 3MGGA 4R8SA 1INLA 2AOUB 4X60A 3DH0A 3HCCA 3C6MA 3H2BA 3HCFA 2FRXA 4HC4A 2AN5A 3EGVA 5KYGA 1YUBA 3S68A 3HA3A 4M38A 1SQFA 5F2KA 3G89A 3GIWA 4LG1A 5EMJA 4PYOA 4YMGA 4P7KA 5CCXA 3ERCA 1JTEA 4OBXA 1WY7A 3TKYA 5LSAA 4PWYA 2PT6A 2ZW9A 3OCJA 1VQ1A 2QE6A 2ZZMA 2E5WA 2VDWA 1VPTA 1BC5A 3T7RA 5K0FA 3BT7A 2B78A 2O05A 4PYQA 4FP9A 3K6RA 3DUWA 3LDUA 1MJFA 2H1RA 4CWAA 2ZWAA 3O31A 4ER5A 2PT9A 4MWZA 4RSRA 3JWIA 4RVGA 4YUVA 3PS9A 1JR4A 8MHTA 3PT9A 4QPNA 1XCJA 1YFLA 4HGZA 4CTKA 4R8RA 2AVNA 2N47A 3PLAE 4ATNA 4E70A 3BWBA 1RI5A 2XYQA 1F38A 4P7GA 3LSTA 3OFKA 3OPNA 2ZBQA 2JHAA 4RV9A 4BLVA 1R18A 1WG8A 1RI4A 5LQUA 4AZVA 4P58A 3FTCA 5CVEA 5K01A 1P91A 4XUDA 3ER9A 1EIZA 1JG1A 3G5LA 3DXYA 2HV9A 3GJYA 2HR1A 4UOEA 2Z6QA 3LHDA 3ANXA 10MHA 1DL5A 5EVJA 4FGZA 5LQCA 2ERCA 5M5BA 2GA9A 3HEMA 3KQVA 2V74B 3GRZA 1N7JA 4X41A 5JUWA 3MCTA 4X61A 5KS2A 3Q87B 5CVJA 5DX1A 3BGDA 2UZ4A 1XCLA 3A25A 5DTMA 3KU1A 1T43A 4RWZA 2O0LA 4PYNA 3IYLW 3CKKA 4PYMA 1KP9A 3DP7A 5CCBA 3A7DA 4C08A 2PX2A 4U7PB 4F86A 3F4KA 3HM2A 5K05A 1X1DA 9MHTA 4HSGA 5LQJA 2XYRA 1Z3CA 2PY6A 5GIOE 2IGTA 5HFJA 5C0OE 2YTZA 4QQKA 1KPHA 4CTJA 4M36A 2XVMA 3QOWA 2QRVB 3KQPA 3DLIA 5ERGB 3M6UA 4QTUB 4ER3A 3M6XA 3OFJA 4GQBA 4KW7A 1YZ3A 5K0JA 2BR3A 3ELWA 5DLYA 4AZTA 5ICEA 3LECA 2O07A 5EHGA 3EEOA 4IWNA 4RTQA 2I7CA 5E1BA 3NJRA 2UYQA 3M33A 1JG3A 3CCFA 1BOOA 3HTXA 3NVKI 3OE5A 4GBED 3CJTA 3IV6A 3RW9A 3SMQA 1X19A 4P7JA 3KQWA 3FUXA 1R8XA 4QPPA 3EVZA 3NTVA 2PX8A 4KIFA 3ME5A 4EQZA 5FHQA 4MIKA 1I4WA 1KR5A 4AX8A 4FSXA 4FT2A 5DM4A 2PXAA 3BZBA 1WS6A 1QAOA 3FTDA 4DZRA 1DUSA 4M37A 3DTNA 4PYLA 4QVKA 2AVDA 3NMUF 3OE4A 2AOXA 4BY9E 2GB4A 3RIEA 5EHIA 2VZ9A 2JH8A 3I5UA 5K0CA 1G8AA 3MHTA 4OQEA 1ZG3A 2O57A 5E2AA 5FHRA 4YUWA 3NW9A 1AF7A 1IM8A 5F2NA 3KQQA 5FTWA 1JQEA 1VP9A 1Y8CA 2CMHA 1KXZA 1XVAA 2ZIFA 3EVDA 3FUUA 3HVKA 5DT2A 5K0LA 3T7SA 2AN3A 3LBFA 2B2CA 3TM5A 1M6YA 1NKVA 3VC2A 4F85A 5EGSA 4HTFA 1VIDA 2QM3A 2QRVA 2AS0A 2GLUA 2R6ZA 3BKXA 1HNNA 5K0NA 2OPBA 2P7IA 2OO3A 2OBFA 1X1AA 1MHTA 3JWJA 4E32A 3B3FA 3HCEA 5E1MA 4E2ZA 5CVDA 3SVZA 1WXXA 2H11A 4L7VA 3LKZA 3KR0A 4E2XA 1L3IA 4YUZA 1X1BA 3ID6C 3THSA 4E2WA 3BWMA 2OXTA 3KQSA 3LL7A 2DULA 2GPYA 5EPEA 2ZIGA 1XJ5A 5EOVA 3VYWA 5GM2A 2G71A 2FK7A 2I62A 3IEIA 4CKEA 1R6AA 1BHJA 2JH9A 1L1EA 2G8NA 5U4XA 2VDVE 2ZZNA 3VSEA 3LCCA 3B89A 3DMHA 3HCAA 4R6XA 1QAMA 5DRYA 5EZQA 4V0RA 4E2YA 2B25A 5EIWA 4G56A 2HWKA 5G02A 3BWYA 3KQOA 2YXEA 2ZVJA 3KQMA 4MQ4A 3MERA 2OB2A 3R3HA 4GOLD 4ISCA 3LKDA 4PCAA 1M6EX 5DX0A 3ORHA 1SVUA 4RVDA 3EEYA 3FPJA 5P8WA 3SSNA 4R6WA 2BR5A 5DX8A 4R05A 2ZBPA 1EG2A 1D2CA 3NDIA 4PINA 2ZFUA 3V8VA 2C7QA 3LDGA 4YMHA 3R24A 5LR6A 3FUWA 4BLWA 3P2IA 4RTKA 2IP2A 2FCAA 1O9GA 4IV8A 2P3QA 3BWCA 1L3CA 2EG5A 5H02A 5E8JA 2NYUA 4V0QA 2WA1A 1KIAA 4JXJA 4GC9A 2OKCA 3PX3A 4O29A 1SUIA 2BM8A 1IXKA 3KQTA 4OA8A 4Z2YA 2WK1A 4E33A 4RTOA 2UYHA 2XBMA 3KR2A 3PX2A 1JG2A 4RVHA 3GRVA 4LWPA 2C7RA 3EMBA 3JWHA 4IKPA 4DM3A 5HZMA 4BP3A 1I9GA 2BZGA 3ELYA 3EVGA 4H0NA 5CIYA 3FYCA 3SX0A 5K03A 3ER8A 3DMGA 2NP6A 4WVLA 3T0IA 5E2BA 2F8LA 3FRHA 3NVMB 2ESRA 2B9EA 1VP3A 3I9FA 1M0EA 2ZCJA 1ORHA 3PFHA 2VS1A 3B5IA 1WXWA 5GWXA 4Y30A 3G2PA 1DCTA 3HNRA 4GC5A 4BP1A 3Q7EA 1ZGAA 3MTEA 2Y1WA 3P71T 5E1DA 3CVOA 3FPHA 2P40A 2PX5A 3UJ7A 3PTAA 2IBSA 2JG3A 1QANA 2NXJA 2PBFA 2IH2A 1P39A 3AWIA 4FS8A 1JTFA 3SSOA 4C03A 5KQRA 1Q0SA 1NT2A 3TRKA 3JWGA 2P1DA 2P41A 3M6WA 1RJEA 2PJDA 3E05A 4RTMA 3TQSA 2PLWA 3CGGA 1FPQA 4MTLA 1TW3A 3FTFA 2IDKA 5IH3A 1N2XA 2FPOA 4PGGA 3P8ZA 4QTTB 2AR0A 3FUVA 1JQDA 2CKDA 3DXZA 5K8VA 1FJXA 2IH4A 4KIGA 2P7HA 3BGIA 2PX4A 4OQDA 3I64A 5HIKA 4DKJA 4WXHA 3ELUA 5LQNA 5EZSA 3FTEA 4GOOD 3DMFA 5GIPE 3OZTA 4RVFA 3EGIA 3AXTA 3FPGA 2ONYA 3VC1A 3DXXA 1O54A 2IFTA 1QYRA 3HP7A 3UBTA 4EVIA 5HOQA 1L3BA 1PRYA 1XDUA 3UJDA 2P8JA 1JSXA 3LCUA 3P9KA 4BLUA 3ELDA 3OU6A 4RTLA 2HTEA 4C4AA 4FT4A 3UZUA 5ICGA 3EVEA 1OR8A 2YXDA 2YVLA 3UJAA 4RTRA 1VE3A 3FZGA 4CKCA 4CXMA 5CM2Z 3UWPA 1P1BA 2IDJA 1H1DA 5DSXA 4CKBA 4ER6A 3DULA 5EMKA 5HIMA 5K0BA 4RTSA 4DA4A 1XXLA 5ICCA 5EG5A 2ZTHA 2PKWA 1JG4A 5KVAA 5FA5A 4PIPA 3BUSA 4HG2A 5KQSA 3GRRA 1NV8A 2GH1A 2VDUE 1PJZA 2ONZA 3DLCA 5E9QA 1G6Q1 1SUSA 2O06A 1N7IA 5FWAA 3K0BA 2ORED 3O7WA 5CVUA 2KW5A 3HA5A 3PFGA 3PVCA 4RTPA 3GWZA 1KYWA 5JR3A 1AV6A 4AZWA 5BW5A 5ICFA 1F3LA 3HVIA 1EQAA 5EMLA 5DXAA 3CJQA 5FQOA 2PGXA 4IV0A 4M7RA 2C7OA 1B42A 1VBFA 4HH4A 3LCVB 3KPVA 1FBNA 3G88A 3KHKA 4PGHA 4PNEA 4P7FA 5E9WA 3TMAA 3V97A 4PCLA 1R8YA 1XDSA 2EX4A 3AXSA 3P9NA 3B3GA 3HVHA 4FZVA 5GP1A 5HIIA 4YV1A 2NXEA 4A6EA 4EKGA 2NXNA 5K0EA 3EGEA 3LPMA 1XTPA 4PYIA 2JHPA 3M6VA 1YF3A 3E23A 4EK9A 3P9CA 3C3YA 3U81A 3KKZA 3B3JA 3SGLA 1RJGA 2LD4A 2IPXA 3P2EA 4LECA 2H00A 4XCXA 3GU3A 3GNLA 3SM3A 2OB1A 1Q0TA 2G72A 5D1HA 2CMGA 4OA5A 5DXJA 2XVAA 1EJ6A 3B7PA 3KPWA 5EC8A 2IIPA 3R6TA 4B17A 5E1OA 1ZGJA 2VP3A 5DM1A 5LQRA 1V39A 2BM9A 4PYKA 4KWCA 3KR1A 2P3LA 5DRTA 4A6DA 3G5TA 3D2LA 1YZHA 1NBHA 5GOZA 2ZIEA 1NW5A 2K4MA 3KR9A 1D2GA 3OZRA 2R3SA 2ZBRA 3LX6A 4HTFB 2Y1XA 4GF5A 1JSZA 5EEGA 3SSMA 3HA7A 4QQNA 3LGAA 4OBWA 4LWOA 3QOXA 5FWDA 4YV2A 2UYOA 2ZLBA 2EJTA 3KPUA 3PB3A 1VLMA 5K09A 3R9XB 1G55A 3M4XA 3O4FA 2GS9A 5DWQA 2DPMA 2AOVA 3L8DA 3GCZA 3FYDA 3UJCA 3MAGA 3GDHA 3X0DA 5EKXA 4GUAA 5T6BA 5DSTA 3GGDA 5MHTA 1YFJA 2PXCA 5HEKA 3TR6A 3UJBA 3REOA 3MB5A 3GRUA 4PIMA 3FPEA 1RI3A 4C05A 1XDZA 4F84A 5T67A 1X1CA 4HGYA 5IKMA 3UA4A 1BKYA 1NBIA 1FP1D 3EVAA 2FK8A 5GINE 1NW6A 4FR0A 2Z6UA 1RI1A 4EKIA 2CWWA 4DQ0A 1EAMA 4YUYA 5E8RA 4C07A 1UWVA 5EMMA 1KPGA 4KDCA 4E31A 3R0QA 4MHTA 1R00A 4E30A 3HCBA 3I58A 4Y2HA 4ER7A 3NDJA 5B1SA 4K6MA 4U7TB 4X1OA 5GM1A 4RTNA 2ZSUA 3M70A 5CUQA 4YUXA 3RODA 1NV9A 2WA2A 3BKWA 1AQIA 3LBYA 2V7EA 2FHPA 5EQJB 5BXYA 1G38A 2IH5A 2ADMA 3KPJA 2AN4A 2EJUA 4C06A 2FYTA 2PVCA 2P3OA 1QAQA 3NWBA 3UJ9A 3P9IA 2NXCA 5DTQA 3GRYA 5LQAA 1I1NA 5HILA 4NECA 3OU7A 1RJFA 2ZWVA 5DPMA 4PONA 5T64A 4RTJA 3MCZA 3OZSA 3KQYA 4AZSA 3DOUA 4C04A 2ZZKA 2BR4A 3BXOA 3CBGA 4PYJA 4GOMD 2AZTA 4OX9Y 3FUTA 4ER0A 3SXJA 3QV2A 4GOND 3LDFA 1ZQ9A 2PWYA 3KPYA 3A7EA 3G8AA 1D2HA 1SG9A 3P2KA 4KDRA 4QDJA 5FCDA 1AQJA 2NP7A 5F2OA 1QZZA 1O9HA 4RX1A 3TPZA 2I9KA 4QVGA 1RJDA 3C3PA 2OY0A 5FA8A 3TFWA 4HRAA 2IBTA 3MQ2A 1IY9A 2JJQA 5DM2A 5FQNA 2OYRA 4POOA 3G2MA 1KPIA 1G8SA 3G2OA 3GO4A 2PWPA 3THRA 3SR4A 2GAFA 4DCMA 4GEKA 2P35A 5DTRA 5K0GA 1SKMA 3FRIA 2XYVA 3E7PA 5HIJA 2Z6AA 2AOTA 2YXLA 4AUKA 3DR5A 4XUEA 4DMGA 2ZULA 4EMSA 3EVFA 4DCGA 4FSDA 1NW8A 3MTIA 2PV0A 3HVJA 2I6GA 5FADA 4ZTBA 7MHTA 3I53A 3T7TA 1RI2A 3TLJA 2AOWA 1R74A 2QYOA 3E8SA 3NWEA 4QDKA 5EKUA 2EFJA 2G1PA 1WZNA 3G8BA 1ORIA 1P1CA 2PSSA 3WSTA 1HMYA 2HNKA 5E9JA 2OZVA 3CJRA 1NE2A 3AY0A 1KHHA 4YV0A 2AOUA 3TOSA 5FULA 3A26A 3A27A 1KYZA 2CL5A 3OU2A 1EJ0A 1NW7A 3UFBA 2BH2A 5D1NA 2YQZA 3C0KA 3G2QA 4KRGA 5LQKA 1VL5A 2YR0A 5CD1A 3IHTA 2HMYB 5BP7A 5C1IA 5EIFA 3TM4A 3UJ8A 1TW2A 2NNWB 1SQGA 2PXXA 4KVZA 3UA3A 1L9KA 5FUBA 2B3TA 3FPFA 3BGVA 2G70A 5CVVA 5BW4A 1YB2A 3G7UA 1U2ZA 1UIRA 2JHCA 3CC8A 2Q41A 2QY6A 3A4TA 3GXOA 1G60A 1ZKDA 3C6KA 4RYLA 1JQ3A 4XUCA 3EVBA 3AJDA 3EMDA 2YX1A 3EVCA 3P97A 3EPPA 5DM0A 1UFKA 2C7PA 3TKAA 5EEHA 3HCDA 1NW3A 2YUIA 2UYCA 5C9ZA 1FP2A 3UJ6A 4X63A 4DF3A 1TPYA 2AOTB 2A14A
chains in the Genus database with same CATH superfamily
1JVSA 3RF6A 1PSDA 3WYGA 1YS2X 1LNQA 1X87A 4BQIA 4GRDA 3HCFA 3DKVA 1SOMA 1CY4A 5ABPA 2QM8A 2JCGA 1E5LA 5NULA 3FX2A 3DE6X 1H22A 1Z8DA 3LC0A 1WKBA 2O19A 3W1WA 1OQAA 9ATCA 2W2KB 4NAUA 1JTEA 5HUQA 1WMEA 1B16A 2ADFA 1JDBC 1YMQA 2Q6IA 3K53A 4PAGA 1GKUB 1VQ1A 3COPA 1J20A 4RKEA 1MU0A 2VDWB 1E6CA 1Q0ZA 1Z35A 2OT3B 1XAJA 1RXEA 1K0UA 4PO3X 1QONA 1HSOA 3SHTA 3LUDA 1G4AE 3K6RA 2Q0SA 5M3BA 4JLAA 4F4IA 3JWEA 4L50A 3KWFA 3M82A 2IHNA 1T8PA 1AG9A 2GPWA 1NBAA 3GG9A 3OFNA 4N6NA 3B9RA 3M81A 3PLAE 1IY1A 1N5LA 1OIVA 2QTVA 4RVSA 3Q6IA 4KLNA 4RZUA 3CIFA 5J59A 4C2UA 4R1NA 3IHLA 3HYCA 3MJSA 2G09A 1Z17A 5K8JB 2QQ5A 5BUCA 1NX9A 2GCOA 2WZBA 1WG8A 4MQFB 4PFJA 4XLLA 5DW0A 4ZDJA 3HJRA 3I0ZA 1NF8A 4FOLA 4A5OA 3CVJA 2ZRAA 4GMXA 1MW8X 3FTEA 1MQ8B 1ZS9A 1U8CB 3GJYA 3OQPA 1JLMA 2YV4A 3ANXA 4DIUA 1YE3A 3E9DA 3FKSA 2QA5A 2CLCX 3R3YA 3VAZA 5CCEA 1U31A 1E4OA 4O02B 2MMCA 1NONA 2DC1A 1R3DA 5FUQA 3W7VA 1U7OA 4V0KA 5CVJA 6ADHA 2PR7A 4IIYA 4OEHA 1SZPA 2YWRA 2JLVA 5EZYF 2OHOA 3P4YA 1R0YA 4PO8A 3UUGA 1NQXA 1SHJA 2R2AA 2EU8A 4IWXA 4ZGBA 1E96A 3F4KA 2JGRA 2D2XA 3NHAA 2WV9A 1BHSA 4DG8A 5A0TA 4AJ1A 3U44A 2VPQA 3GRAA 2PUWA 4ZK6A 1VMIA 4E21A 4GXNA 2AZDA 4CR7A 3L3BA 1QG4A 2R6JA 4BDSA 4F06A 1W30A 1QH8B 2ST1A 4FC6A 4TYPA 3S70A 3KB1A 3N7AA 4QTUB 4CGZA 2IHKA 4ZCLA 3TN7A 1S89A 4LGYA 4UUPA 1S9DA 2FX5A 4OQZA 5C31A 1T6ZA 5TGZA 5AESA 1Y6RA 1FJGB 3C7TA 3HTXA 2WE7A 2JA1A 4W9NA 2AYZA 1XZEA 5A62A 1DINA 2FPPA 3LUHA 2RSLA 1UM9B 2N0SA 2C92A 3I01A 3GJTA 4XDYA 1YMUA 4CM3A 5LVAA 3JQ7B 4EYEA 2WWIA 1VE7A 4ZVTA 3FG9A 4RFSB 2OQIA 2PM8A 3NRCA 2CMKA 4ZV9A 4NOJA 3WB9A 2PZGA 3EK2A 2CV2A 2O4CA 4IW3B 4B2PA 5BV7A 1QFXA 2GZ1A 1JHYA 1JVNA 3DZDA 1AQ6A 3N5KA 2J31A 4U5QA 5LZ8A 4HGNA 3WLTA 3ZDBA 1M0TA 4BATA 2JFBA 3OHPA 3PC6A 4W63A 5CIQA 3GMSA 4I55B 2VZ9A 1TQ8A 4LDZA 1XA4A 1DAHA 2O2CA 2EDCA 3BMQB 5DIZA 2VZEA 3Q7QA 1F0KA 4FZJA 3I34X 3HQ4O 4M60A 1P73A 2INGX 1V2HE 5K5EA 1XWWA 1HC7A 1EFPA 1HTBA 1VP9A 1NVXQ 3KK0A 3OQIA 3QELA 4RDIA 5HF9A 1O89A 3B3AA 4BNUA 1U2RA 3SF8A 3W5HA 1PJLA 3OPYB 1S2MA 5I47A 3U4QA 2DHDA 3PHLA 3WXMA 4JIMA 3K1TA 1C80A 1O96B 1Y3HA 2IYZA 5KSWB 2DPXA 1W36B 1XSEA 5CA1F 3NC1C 3PUHA 3F7NA 4IPTA 3U4AA 1IUNA 2C83A 4M53A 4NAHA 3CLRD 2ZAYA 1JHRA 3EXHC 4QREA 2BUBA 5DGHA 2VJPA 4S1TA 3SHQA 1WQ4A 3I09A 4M9QA 3OE1A 3DGEC 1MF7A 4NFSA 4O1HA 1OH6A 1FXUA 2CNWA 1OKKD 3QPCA 4NATA 8AT1A 4D98A 4DQXA 3IUEA 3ID6C 3A32A 3NBZC 2NU7B 2C4TA 3TRIA 3P0RA 2HMAA 4I8IA 1G2QA 4YR7A 2HA5A 4RVCA 3AJRA 1C1DA 1Y1SA 4YRDA 1WZIA 3KTDA 5DMXA 2G8NA 3D8HA 4RENA 2XGOA 4Q9HA 3FJ1A 5U4XA 3SOZA 2FFAA 3OZDA 5EZQA 2XY4A 1B8PA 1E2LA 2R1VA 1HQYE 1SCUA 2Z04A 3NWPA 3KYIB 1AHHA 4KK3A 3RVLA 4BE9A 4J2TA 1YHZA 1W4BA 1A3CA 2TMYA 4I9HA 2VDJA 2HYDA 5AXDA 4ZCQA 3QVGA 1G8HA 2PDAA 4JLVA 2DAPA 3R9KA 3GFBA 5DX8A 5C81A 1TIKA 4TS1A 2AL7A 4BKRA 3RK1A 8OHMA 3ACDA 3ENVA 1BZYA 3R24A 4JJ8A 2ZRKA 4PVDA 1AUOA 5CX1B 4OXXA 1Y89A 3I6BA 4Q3CA 2O8FB 5IVIA 3G8CA 3ILXA 5LP1A 4ZYYA 3I5MA 1KIAA 4PZZA 1DJPA 4MR7B 3KQTA 3TZ6A 1IH8A 2WVGA 2W43A 5EUBA 1VPEA 3UO8B 4NJEA 2XODA 3RGWS 4BO1A 8ABPA 2AUMA 2G9VA 1XZMA 3GLRA 3KXLA 4KP7A 4QOEA 1S6YA 1DKUA 2W9XA 3NM4A 1L4HA 5AJWA 5I9TA 1XJQA 1HLPA 4OLBA 5E0KB 4CM8A 4JFAA 1H4SA 1Q74A 3E70C 1MRSA 5CIYA 3HJFA 1QV9A 1QUFA 1NPDA 4PM4A 2AXEA 1U65A 1YOVB 3EPLA 4S1VA 1I80A 1QOQB 4HQKA 4YPFA 3UB4A 2LV8A 3DBOB 4O4LF 1CY8A 1X1RA 5JARA 3HDTA 1CZUA 4M1MA 1ORHA 2V6GA 2OORC 5DCLA 1YQUA 4KKXB 1V6CA 1ZSYA 2COUA 3G2PA 5JS1A 2GMWA 1D2AA 3HRKA 3K9LA 5D6NA 5M04A 3W3AA 3VDQA 2R8YA 1ZGAA 1YCGA 3BDAA 4Z1MA 2GHTA 1JIIA 1NATA 5LPNA 1HETA 2HH9A 1DKRA 1X38A 2P40A 4INJA 3RJMA 3WNZA 4EOGA 2DRIA 5C52B 2IH2A 1O0BA 3C7DB 1HDEA 4UBJA 3QEKA 1RQNA 4W5JA 4EABA 5GY7A 5KTKA 3OLYA 3BTUA 4Q4LA 1HG1A 5A6SB 1YHNA 2D0OB 3REFA 4HEJA 2QN2A 4PGGA 5SV2A 2VWGA 3DNPA 3LQ4A 4LRYA 4M9SA 5L6MB 3MINA 2PS0A 1GUFA 3BSYA 4FHGA 4CQLA 5CFZA 1FS4A 1KYIA 3OQNA 3I64A 4XSHA 5I7OA 4I4LA 1QTRA 4DCTA 2Q9UA 3FUCA 5A4AA 1MA0A 3EGIA 1E1QA 1U7TA 1FDWA 2CN1A 3ESXA 4H17A 3RF7A 2LDBA 4CMIB 4IQ8A 4J7CA 1G18A 1XD8A 1MAVA 3H05A 3H4MA 4TMKA 4O3MA 1IWOA 2FPUA 2J7PD 2NVOA 1XRMA 3QE0A 3CF4G 1FYXA 4YQFA 3AB3A 3RJZA 3CM0A 3JQDA 1J4AA 4RHUA 4O8ZA 5FBWB 2YXDA 3BA6A 4PPGA 4ARBA 4LCEA 1T91A 1VE3A 4RTRA 1VIMA 2D1QA 4RH0A 4HEA6 4UCQA 1ZISA 4DDWA 1OZ0A 5E7QA 5I9MA 5KNCD 3Q5GA 3VDMA 2QIOA 3ASYA 2FKAA 4Q1AA 1M0SA 3TLMA 1ENYA 3RAJA 4MVJE 1UWKA 4IMRA 4BKMA 2ZTLA 1Z29A 3BUSA 1KI3A 2P0EA 1Y3DE 2AR9A 2HJRA 2ONZA 2ZANA 4RS4A 4WKBA 2XCRB 4E08A 2KE5A 3E9RA 4RL4A 1VE5A 2CLFB 4DDHA 4ETMA 1GG5A 2Y2UA 4KPGA 2BFOA 4EW6A 2GRUA 3STWA 1EVIA 5BVGB 2KSQA 5IXJA 2C84A 3F9RA 1EQAA 1N3BA 4UM7A 1W5AA 2HGZA 3A4YA 3H86A 3ZOKA 2ZUUA 3BORA 1JF8A 3HL4A 1E79A 4ZZ3A 3CUEF 1QQAA 3NTQA 1U3TA 4PGHA 1BWRA 2P77A 4IV5A 5FI5A 3RASA 4XJSA 2CZCA 5NLLA 1L7XA 1AB5A 2ARKA 4PCLA 4B9AA 2VP6A 4ZV4A 2J08A 2OWEA 4Y0AA 3UKOA 4ZI7B 2J4FA 3C5HA 4YT4A 1Z0AA 3ESRA 1E5DA 3T5AA 1WHSA 5ILQA 3OIUA 1CUYA 4R9NA 4CLHA 3E23A 1JR2A 3C3YA 2FZEA 3U81A 1Y6ZA 1YZQA 3LXUX 5EJ4A 5HUHA 1YQ9A 2XZPA 3A05A 3KDPA 4CM6A 4UPVA 1I4DD 2WNSA 3SM3A 2IQ5A 5D00A 4IQGA 3VH2A 2RHCA 4QNRA 1PR3A 1PZFA 1D2EA 1I4EB 2VZ0A 2YHAA 2EP5A 3H9EO 3QXJA 5B3AA 5A0FA 3OWHA 3E53A 1FZQA 2V7GA 3OE7A 4PC1A 2FDCA 3N2YA 1P5FA 2DJ5A 2WTAA 4QXMA 1FFGA 1OX4B 4MQUA 4CL2A 2X58A 1HYGA 1HYHA 2NZVG 3JARA 1GQOA 3DZGA 3RREA 3A04A 3GT3A 2VHCA 1ITZA 1KMHA 4IHJF 5C1BA 2VLIA 5K2MA 5BVHA 2QVZX 2A86A 1Z2EA 4CCSA 4D02A 1BMFD 4DLRA 2CVOA 4R41A 1U9IC 3KJFA 3M4XA 3NANA 1NSFA 2HF9A 2QRNA 1TKCA 4NYJR 1H1LA 1XRRA 2VXYA 5H5JA 4DNXA 5BNWA 4YQEA 4MZXA 3BWVA 3UAOA 4CG0A 4WJLA 2EP7A 4YP9A 1KL7A 1RCTE 2VEDA 3BK1A 3CF6R 2GN2A 1LZKA 2J30A 2WJWA 4DLLA 4DQUA 5JSZB 2L42A 1WDWB 1JH9A 4P08A 3REOA 3AK4A 4NOMA 4D9BA 3DVLA 3TJZA 1TFUA 4K7JA 4ZD6A 3GVXA 1BKYA 3AOEC 4LC1A 1NBIA 3EVAA 1MP0A 1BX1A 1GDTA 1SUBA 1TO1E 3KKOA 3ZBUA 4D8XA 2BFWA 2OCGA 2PYIA 3HCBA 1GKLA 1U7ZA 1EE2A 2X1VA 4Y2QA 5CNKA 1BGVA 1TAQA 5DGCA 5HNKA 4RTNA 2L0XA 2VI5A 3G5UA 5IDYA 3TX6A 3TGLA 4NAVA 4N18A 5EXTA 5BXYA 1GY8A 3JW8A 2Z30A 4JN6B 3R7LA 2IH5A 1MC5A 2E4WA 4WV3A 3ST7A 1RDFA 1PX0A 1ISPA 2HT6A 3NWBA 3X1XA 1N6NA 4CMKA 3T5MA 5HILA 5BSKA 1EB8A 1LK5A 1Z83A 3IVRA 5T64A 3A1CA 1X7XB 4P36A 3MCZA 3BXOA 1TCCA 3NVKI 1P9NA 3QMPA 2DBVO 1IQPA 1I01A 2XYGA 3FFXA 3R74A 4EATA 4R2WA 4TKVA 2O8CB 3PA6A 1DKQA 2PWYA 3JXEA 3L0BA 2HRZA 4FCCA 3P2YA 4XD7A 4XW2A 2E48A 3W8FA 5CDGA 1Z45A 2AJTA 1QF9A 4DL9A 5CXUA 4AKHA 2JK1A 4FBMA 4QXAA 4V38A 4L5CA 4DWVA 3C3PA 4ZRMA 1S2OA 4OHOA 4HRAA 3RUPA 3H75A 1FTYA 4U2GA 1Z7GA 4O4JF 1R0KA 4UM5A 1MORA 4MDHA 2PWPA 3GJ4A 3WZLA 2WHEA 2DWCA 3TW8A 4UBLA 4YCBA 5EJMA 5CLIA 1UJ2A 3HY3A 4P4TA 5DJ5A 3MOGA 5CM9C 3UT0A 4D9NA 1IMJA 4CT5A 2OZLB 3NP9A 1TXGA 3GFQA 4IFEA 4D9KA 4DMRA 4MQEA 1SVOA 4MYHA 3AIOA 5CR9A 3ULKA 3WLFA 1V1RA 5JBNA 1OHHA 4XYGA 1JDJA 1JPVA 2GPBA 1D1PA 1CUVA 3E8SA 3FCAA 4MS1A 5JPCA 3MAAC 3IAXA 1CD5A 1ORIA 3A0UA 4O2AB 2PSSA 3G9UA 4C4SA 1V11B 4MWOA 3QKSA 4CKEB 3UQZA 2ZRPA 3OZAA 4YV0A 2ADOA 1CJMA 1IATA 1N2HA 1CNFA 2AMFA 2F59A 4FHZA 4IH9A 4LBZA 3L4BA 4G8DA 4OFZA 4CLOA 4LS3A 4XWYA 4B9EA 4Z49A 2G7MC 2BH2A 4Q1EA 3ZK8A 2XUFA 4NFLA 3AGQA 1WF3A 2VNHA 3ZUGA 1YR1A 4U7GA 3U1BA 3JQ6A 3RS2A 2WP8J 1GU7A 4M49A 1HE1C 4KVZA 4RY0A 3W9YA 2V8BA 5IBCA 5LJIA 3GHYA 1A9YA 2C0PA 1QGOA 2I87A 2PVSA 3EOAI 3QWHA 4I1RA 4IJVA 2QB5A 5DP2A 4YYEA 1YZYA 5DK4A 1A7AA 2Q41A 2B92A 1F0PA 4GPZA 1YJCA 3PNOA 4QYIA 4UU7A 2CLSA 3BJRA 4XUCA 4PLZA 5ALJA 1WLSA 2R85A 5ESWA 5H3CA 3RUAA 1OB2A 2WTMA 3AM1A 4JJ6A 5TMBA 1I14A 2MYPA 3LUJA 3ONWA 3T7KA 4KQXA 2PZBA 2A5LA 1NVVR 4I5FA 3B3QA 4PQRA 4U0JA 1EJ2A 3VPDA 4ESHA 1BU8A 1O6ZA 1XALA 2JANA 1TPYA 4M8NE 2BFBA 1MEJA 1ZHFA 2BJWA 2H54A 5KC9A 5DNYB 3WDKA 2BFEA 1MO6A 4F2GA 3HXOA 1W4RA 1TVEA 3GZ4A 4NBRA 1T3LA 4RZHA 5BNFA 4IKOA 3BXHA 2IDZA 1XAGA 4WXYB 4OK3A 2E21A 3LIPA 5KYYA 2WPDA 1FMFA 1C8VB 2JC3A 2JKYA 2W6CX 4KXYA 5J47A 4P3XA 4PYOA 4P7KA 1XPJA 4X6UA 1JFFA 1PTJA 3OECA 1K97A 1LTQA 2W11A 2NUAA 5K2OA 4I1YA 2EWVA 2PT6A 2ORVA 1HF3A 1S8AA 2XQVA 4MQ6A 3R09A 4HS9A 2Z2ZA 1NUTA 1MABB 3SQOA 1OBCA 4JDUA 1MABA 1VPTA 1E3EA 1U3UA 1O94A 4IM7A 4BWVA 5EJ8A 5I7VA 5K0ZA 1ST2A 1SGWA 5LMZA 2XKJE 3DE7X 1CF4A 1FRFS 4DEYA 2IXDA 3EXEB 3OKFA 2VSYA 5EJ6A 5I5EA 2PT9A 2XNHA 3T1YB 4Y2RA 3T3IA 1V5WA 1DEOA 3O0TA 2P65A 3NYIA 4X8MA 4L9SA 4ZARA 1QO7A 4Q1CA 3EULA 1OXUA 3DMDA 2VBIA 2FZGA 4EPVA 3S2GA 3DDOA 2GN6A 4OHVA 1XLTC 1Y48E 2GDJA 2X40A 3BWBA 1RCFA 1JVBA 4AMZA 1Z63A 4P3YA 2GETA 3DEFA 1CXZA 1U2GC 1OWPA 2JIZD 1QLHA 3ETLA 4G23A 1DC3A 3KEMA 3UHPA 1OY1A 1AK1A 3WNCA 4BMYA 5K01A 4C5BA 5D5QA 4AX4A 2RK3A 4AKIA 1DELA 4OM7A 2XSZA 5JXJA 1E9VA 2G1UA 2FMHA 3CNNA 2WSYB 4LGVA 1P61B 2ZDHA 3VYVA 1XMSA 1TC2A 3AFHA 2OD2A 2PL3A 4BXOB 3O91A 5DNWA 5JZOA 1KDTA 1EUDA 4A8HA 4TX1A 2IHBA 2PMFA 2PAFA 1PG2A 3A25A 5EP4A 2AMLA 2C57A 3KSZO 3MBKA 2FEXA 1U4OA 3DONA 4BAZA 1NUUA 2QVBA 3JAWA 1EDBA 1I3KA 1Z6ZA 2B36A 4KE6A 1DCKA 3CZ4A 1MNAA 3HM2A 4PPFA 5EIBD 5EXEA 3NBAA 4F3YA 3GNQA 4CF7A 3OKCA 2FSSA 3ND8A 3OVMA 2WSMA 4EY7A 1QFMA 1XKTA 4MV1A 4X62B 1E58A 2XITA 2J09A 3GJ0A 4IXMA 4NULA 2XVMA 3NH6A 1VA5A 1OXBB 3GRPA 3IGFA 1IN7A 4OAOA 5EUQB 3OKAA 1CU1A 3PFNA 4BEJA 1EBUA 4JGIA 4AJJA 2V0NA 1ICEA 3E35A 5HTOA 1VJ5A 3IMGA 4MYCA 5JNRA 1L4KA 2JLRA 2O07A 3KFLA 3IOMA 2ZJOA 1WP4A 1Y9EA 3NJRA 5E1BA 4RTQA 5I4CA 1SAYA 2AZMA 2UYQA 3UWSA 4YRRA 6YASA 4H6PA 3CJTA 5GMOA 3SMQA 3VOTA 3FUXA 1X7GA 2BFNA 2PV7A 2E1PA 3T7JA 3UV7A 1MEOA 1Z37A 2H3EA 4G0XA 4KLAA 1B73A 4OG2A 2QRUA 2UZ3A 3CN9A 1UF9A 1WXQA 2ENUA 3Q7RA 1L7VC 3RWBA 4BV8A 3RRZA 3JD0A 4RSMA 2BEVA 3L8YA 4CCWA 4I50F 2AEMA 1OXMA 1R5NA 1TK3A 3PQEA 4FSXA 4PW0A 1ONSA 5F1YA 3V8MA 5LOVF 4M37A 3DDHA 3DTNA 4LRSB 3IODA 2VT6A 2FZWA 1NDQA 2XUQA 4YQYA 5ARDA 1JBKA 5K8TA 1ULAA 3LY7A 2FW8A 4BNDB 3X1JA 4S12A 4Z0NA 3WK4A 3MHTA 1KQOA 1X9GA 4NONA 4OHUA 5FHRA 1UMCA 3W9UA 4B6EA 4BZWA 2DECA 3LNCA 3H0KA 3NW9A 3CCCA 1Z73A 1BE6A 2VTBB 1L1RA 2O14A 5KPDA 4QX6A 3HXMA 4I9NA 1Y8CA 4C3VA 1CP2A 3D0KA 4EAQA 4Q3NA 5IRCD 3CR3C 4X95A 2B2CA 1ECJA 1LGYA 3A2NA 2JDIA 4C76A 1AKVA 3GJ8A 4BLQA 1YIAA 4BVGA 1XTSA 3BKXA 1FMCA 3QX7A 2PK3A 2NPIA 4JB8A 4LY0A 5JTUA 5CGQB 3TBFA 2EP8A 3CF4A 4CEJA 3RVJA 5F77A 5L3QA 3ZEIA 3RSSA 1MVOA 5KX5A 4E2ZA 4KX5A 5CVDA 5TQ0A 3IEMA 1OFHA 2GEJA 1JHQA 1YNSA 5JH7B 4RFSA 1U11A 4PAQA 1U6IA 5FPSA 2ZR8A 4DWWA 2EZ4A 4LYAA 4ZVPA 4JA2A 5GM2A 5TF4A 4AO8A 2W83A 4XIGS 4C22A 2HHAA 2YNMC 1QVRA 5KDLA 4M54A 4WOBA 5I4KA 1LWNA 5LD2B 4P0PB 1TYZA 2RAUA 3I30X 2IYWA 3MMXA 4P4NA 5DB4A 4B47A 4EKNB 1DAEA 3FW1A 1AHIA 4ISCA 3I01M 3QXGA 4HDNB 2E4YA 1Z0IA 4Z8XA 1N5OX 1YZTA 3MBOA 4HB4A 3IAUA 3FGPA 3W9SA 2YIJA 2C8JA 4A15A 1EG2A 1MD9A 1PR4A 3VOBA 4DA9A 1K7YA 2QL5A 1AO0A 2BF7A 2Q1WA 3EDQA 1VRVA 1ZM2A 4Z7OB 1Z4IA 4PBTA 4C0BA 2D7CA 3CH4B 3RHZA 3BWCA 3Q8WA 3WFJA 1ZA2A 4JXJA 3KL4A 4KO1S 3PENA 1BS1A 4Z2YA 5C80A 2XBMA 1M2WA 5EHXA 3CZMA 3EG5A 3Q8KA 2C5HA 4NJOA 4PPYA 1VCHA 5EJIA 3BMOA 1SCQA 3S1AB 1MC8A 5AJUA 1RHKA 2G28A 4W7SA 1DQPA 1WZCA 3WGMA 4CLXA 6CHYA 1K75A 1MQAA 1EXNA 1U1IA 3DB2A 3FSRA 4G6ZA 4BFXA 2Q5FA 4OBBA 2CB9A 4CQJA 1HDOA 2Y0EA 4NKRA 1TTHA 3HEAA 3RRYA 3W34A 2VT7A 1M0EA 1V3QE 3S7TA 3T4EA 1WVGA 3U4IA 1WHSB 2FWAA 3OLQA 4LJ5A 5DXFA 3ZDXB 3GT0A 3KEGA 4K05A 1X80B 4P93A 1KYQA 5CFMA 4YJGA 3Q7EA 4RKQA 4FDMA 2YCBA 3UANA 4O4IA 4ECAA 3B52X 1YTUA 5BV2P 1U7XA 3P71T 3AEXA 3FWPA 1Y4UA 1W87A 3IUBA 4YLEA 2D1YA 3E8XA 3RHTA 3T3NA 4OOEA 4MKZA 2VXOA 2FCRA 1SJ9A 2QM7A 3N8NA 5KQRA 1BXZA 3L0OA 3EA5A 4AB1A 3OC0A 1RJEA 1JDUA 4I1SA 5CA1A 4JR1A 2XKBA 3IMEA 1PFWA 3K6KA 3JX9A 5FXMA 5IH3A 4XYBA 1C4XA 1GTL1 2X9GA 5LC1A 3V34A 5JQWA 5K8VA 3ZZTA 3OQMA 1YRHA 1EFVB 3OBIA 4MJLA 1XL0A 1SELA 4PFSA 4DKJA 5ALYA 1PJ3A 1DRVA 4Q3AA 3LKVA 4IR7A 4HEA1 1PZXA 1TAHA 4HR7A 4MP3A 2GJKA 4KXXA 3RRFA 2JFQA 2D2IA 2OHHA 3DXXA 4IFTA 4K9NA 4MQMA 3ZWWA 5IU6A 3A1NA 1XDUA 3IKMB 1R15A 3N3BC 4Y0VA 2V7UA 2IHYA 3GK3A 3QG5A 3D6JA 1X15A 2PUFA 2GYUA 3H9BA 1CFJA 4R3UC 1I3LA 5KOIA 1M54A 3AR2A 3IHWA 3UJAA 1K88A 3TW4A 3LOQA 1I0ZA 4RAOA 4OJTA 5ECYA 2MR5A 1PDWA 3AB8A 1LTHR 1H1DA 5EE3A 3RS5A 2FF7A 3OEHD 1XZNA 1T3TA 1NOJA 2DJIA 3IKLA 2UKDA 3IX7A 3U61B 5IK2D 1HNWB 4EFLA 4B5LA 2JLCA 1QNLA 4UPDA 2CCKA 1B8UA 4HG2A 5AIAA 4GM4A 3BEOA 4IMJB 1OROA 4DR3B 2FLVA 3FYSA 3WAJA 4LHSA 2JB9A 2XXAA 1KZ6A 1U0FA 4W4TA 1ZD9A 1PW5A 1BHO1 1R9MA 2XMGA 3OZGA 4LEIA 3V2GA 1NF9A 1U0NA 2XI4A 1J5PA 2ZRDA 4NV0A 2JGDA 5JR3A 1KH1A 1GIAA 4QULA 5AKZA 4URVR 2H1VA 1NULA 1BS9A 2FZ5A 3DV2A 2GJSA 4NU6A 5JZ9A 4UEKA 2GJAA 1WJGA 3DZFA 4QAQA 2YYZA 5FQOA 4NICA 1RM3A 2KHZA 3LMKA 2D59A 1GGKA 4PNEA 3MWDB 5GVSA 3WLRA 1R8YA 1L5FA 2BTQB 2IZ6A 3IOYA 4ZOLA 1MAWA 5DGTA 4TQGA 3FF4A 3RVSA 3SKYA 3RFFA 1YJXA 4Q0MA 4ARUA 2VKTA 3EQ9A 4EKGA 4LUCA 5K0EA 4QNNA 1J9ZA 3DL4A 3RPEA 4G84A 3PX7A 1YJAA 2I2FA 2PJZA 1FS5A 3Q2KA 5FKJA 2PNFA 3P52A 1QM5A 2TECE 1RRFA 2BGTA 3M49A 2EW1A 4B75A 5DBIA 2WU0A 4CNQA 2G9UA 3CH7A 3P2EA 3F8SA 2VYND 2H00A 1XYGA 3PC8A 4U3JA 3ZDEA 4BQEA 1URPA 2G72A 5D51S 3U3DA 2F67A 1AHNA 4CODB 2A0XA 1U5BA 1NXPA 2I8AA 4HAZA 5TMDA 1H2YA 4HT3B 1PE0A 1P6UA 2IIPA 2XXJA 1M2JA 3CZAA 2VPTA 3ZGOA 1XHLA 3QG1A 1HQCA 3EDMA 2H07A 5HK8A 5I4IA 4XR4A 2B1RA 2OAQ1 4GFDA 4MUMA 1IBLB 4XFDA 3OTHA 4LXTA 1EX9A 4MW7A 4HTFB 2OQRA 3Q9LA 5EEGA 3SSMA 3U60B 4V0LA 2I6SA 1OMOA 5TVGA 1GEGA 4C6TA 4TGLA 2EKDA 4FE4A 1D8AA 3ZD8A 3QOXA 4KN6A 1QRRA 4J0JA 2QAIA 1WAMA 1XWFA 5E9AA 4OHFA 3KZKA 1UOEA 2CJWA 1P5HA 1E62A 4AJ9A 4C7BA 1YIOA 1YV9A 4J2HA 1ISRA 3O1LA 4ENUA 2B35A 3PF8A 5T6BA 3T1OA 2H1CA 3PRKE 5LMUB 4BPBA 3GNTA 3HO6A 4PQGA 5C2JB 1V6AA 4CHTA 1QQBA 4C05A 1Q91A 1PQ4A 1DAKA 2CBZA 3NBFA 2JBHA 3UA4A 5BV0A 3ET5A 4B2YA 2Q6VA 3IQIX 2CGEA 1OF1A 3F67A 1FVFA 2H2FA 3TI9A 1KJWA 4B2LA 4YUYA 5AVQA 4ZMBA 2ID9A 2HEGA 1KPGA 4LZNA 5HX7A 5CDSA 5K6AA 3O2QB 1F6BA 3I58A 3QITA 4CMIA 1NUQA 4N03A 4TS4A 2Z5FA 4QXOA 1ZD1A 5CUQA 5DKFA 1PL8A 3EZ6A 4JNCA 2V3WA 2O6LA 1CZOA 3NJ8A 3I23A 2ZPAA 3ZJVA 1AQUA 2J7KA 3VPGA 1USUA 2RARA 2XF2A 4YNBA 3TOXA 2XRFA 1H2RS 1OFUX 3SJUA 3L7KA 1H3EA 1Y5RA 3OU7A 1HKHA 4DLYA 4Q18A 1NLUA 3SHOA 2W6JD 5JYBA 1Q95A 2W8BB 2RB5A 2A59A 3NGMA 2V58A 2ATCA 1KS2A 3FWYA 1NQ5A 3PNMA 1UJ6A 1DRWA 1NRWA 2E18A 1ATZA 3HFGA 5DNEA 1JAYA 2NV2B 2ONKA 2QI9C 3TH5A 3V3TA 3VYSB 5KNCH 5FCDA 2ACWA 2AN9A 5KINB 1TQ6A 1R10A 3ZHRA 1PT5A 2PS9A 1PEKE 2PTHA 3C3KA 3IJPA 4K6FA 4PXSA 4WY8A 3W1VA 3GR6A 1SXJA 5AJYA 1RZ3A 2ODNA 3EXIA 3MQ2A 1FXWA 1A4UA 1FQWA 1U0OC 1A4IA 2BI7A 2QRKA 2WSSA 2J0UA 4Q7LA 3K0EA 5H3HA 3KOWA 3TIIA 5BN3B 2ZCUA 3N2GA 5KU7A 3IKVA 4QTXA 2ZPTX 5ER6A 3UV3A 4GEKA 3O7MA 1FUIA 3HY6A 1JSLA 2LE0A 2P9JA 5AKYA 1VGRA 2YXLA 2ZBFA 2XA2A 2XRMA 4ILKA 5H1YA 4A8JB 5BSVA 3KTOA 3L93A 5ADHA 1POWA 4HHEA 5IAKA 2D2EA 4RV5A 3LAWA 2ZYHA 1JKXA 3SZGA 3BC1A 5IULC 2MCFA 3I53A 4MQBA 1V96A 2I8CA 1RI2A 2YXBA 2IV3A 3T35A 1VLVA 4JP5A 4UUNA 4WXEA 3GF4A 1B8OA 4RETA 2EFJA 3UH0A 3WJ7A 3CH6A 3G8BA 4HVTA 5KOHA 4WRRA 3VSDA 1IXYA 3H5OA 4PBRA 2EJVA 2Q49A 1C0PA 1V5FA 1XZAA 2B2NA 5CH3A 2FKNA 1KYZA 2XDWA 2WD7B 1XTZA 3JPYA 3LU1A 3RG2A 1T0PA 4M9CA 5GTDA 4F8JA 2I6QA 1UT5A 3PPYA 3KSAC 2UZ1A 1EIWA 1JG7A 3KUXA 4KWIA 4B31A 4BLOA 5E3JA 3JQRA 1ORRA 1RC8A 1MB9A 5AP9A 3WYAA 4FIDA 3EZLA 1QU2A 2BSXA 3KCNA 2G70A 1WVMA 3L0ZA 3DD5A 2QRGA 3A1DA 5J4HA 2A1UA 4O2BF 3RTGA 3VPFA 1E66A 1W59A 5JQGA 1SC3A 2AQHA 3K1ZA 3IIEA 1T36A 4UU8A 3R76A 3RYFA 1DKNA 2VRNA 1W5SA 3O9VA 5CA0F 3J81k 3QE3A 4FW8A 2NUTB 3KJGA 1CY7A 4WFQA 3RC8A 2IYOA 2FRDA 2DQZA 5EEHA 1JU3A 2YUIA 1WXDA 2Q1TA 1FYWA 3F5DA 1TTTA 3PRJA 4BQRA 1SCAA 5BT9A 2HAEA 1WKVA 3GA7A 3PGVA 1ES9A 3PEFA 2XUGA 4JQSA 4F2WA 1AHPA 4X60A 3I8XA 3DH0A 2ZAGA 2RGBA 5T4HA 1PFQA 4CM9D 4EWLA 1IWPB 1Y4AE 4E1BA 2QTLA 3Q3GE 4TROA 3LHFA 4WESA 4Q7QA 1MOPA 3PE3A 4F92B 3QLTA 5CCXA 2PKYX 1T8WA 5LSAA 1ELOA 1M5TA 3F5MA 2Q7OE 2NSDA 5EI5A 3WRXC 2UVPA 1IY0A 3BJMA 4OBEA 4JWKA 4HD8A 4KFRA 2DQYA 2E5WA 2OO5C 2VDWA 3H11B 4URFA 5FIUA 1OHHD 3NR2A 1Q5PA 4JHXA 5EE9A 3SKVA 5IF3A 4N49A 5LYJA 5CVTA 1TMOA 1W0KD 3FCUB 5HG0A 3D2AA 1II9A 2DUJA 1OA0A 4K6HA 2JRCA 1TT7A 4Q82A 2XQGA 1GPWB 1YRWA 1ZZEA 4JB0A 4RSRA 5G40A 1AC5A 3PT9A 4TXHA 2IEDA 3NOXA 4HGZA 4PU0A 3CX4A 1FCJA 2P6MA 3EIHA 3QKRB 3VJMA 1LB1B 1HNZB 4HFNA 5J40A 2IW3A 1MUUA 1G291 3OFKA 3OA0A 1PHPA 3A3NA 1RXSA 3E03A 3FIJA 3K05A 3RARA 3IUYA 3S2ZA 1B0UA 5J23A 3IT1A 1RI4A 4OIFA 4P82A 5HFAA 3B7WA 1MQSA 2X9NA 4P58A 3T52A 2C8LA 5JMOA 4WCDA 3Q0EA 1I6MA 1D6MA 2XUAA 5H80A 1KKLA 2YWFA 1QFJA 3OF5A 3DXYA 3VBCA 1TNDA 2VJMB 4WNCA 3BHMA 5IHPA 3LHDA 4G5YA 1TQHA 2JAQA 2YY5A 1UBKS 3R3ZA 4EHAA 4RY9A 5JJIA 2WTEA 3QE9Y 2R6DA 4JODA 3WZ2A 5KREA 1QE3A 1V0JA 2HCBA 2DHEA 1T2FA 1M10A 2Q3MA 2QYHA 4L76A 1ECPA 2JIDA 2FQ1A 3NAZA 5DX1A 3RS8A 4C4XA 1NDUA 5E4TA 1QB8A 4ENVA 2JAPA 1WL8A 4RWZA 5DNVA 2VQFB 4X66B 1U8AA 2WP0A 2YZNA 3KAKA 4Y6LA 3ZHVA 4HY3A 4GZLA 5JSHA 2UU9B 5HKKA 4OK6A 1ZN8A 4G9BA 1WW8A 2C3PA 4JEHA 1B3RA 1D8TA 1MTZA 2J85A 7AT1A 1EXWA 4YRPA 3C41J 3M6MD 3QUSA 3CSSA 4O5OA 1PBTA 1WXFA 3CUTA 3DAOA 3QKUA 4H1TA 1BFDA 4K6KA 4LZLA 1NHGA 3LM8A 1TIPA 1PT7A 4KODA 1IJKA 4LBYA 5F7ZA 3TZEA 5B3LA 4TTVA 4UMEA 4AY4A 3BXZA 1PR0A 4OFBA 3AI2A 1H6DA 4NXMB 5KWEA 2HI0A 2IE8A 3QSGA 5GGYA 5ICEA 5KVVA 4IWNA 3AM3A 3U9SA 4A6PA 2E87A 4QELA 3M6FA 5KO2A 1DIOB 2ZREA 1GITA 5KNDH 4UFOA 3D6VA 4GBED 5U9CA 5JWRA 3MINB 4GIBA 2MDTA 4TTTS 2HJSA 3M1LA 4KZPA 2DEUA 1CUJA 4FFNA 2J6CA 5CDFA 4U8GA 1OFVA 2IUEA 3MG9A 2ABWA 2AG5A 1OTXA 5B7PA 4EMBA 3PR1A 1B0ZA 4MKXA 4ALKA 3A8TA 2WTUA 4YXFA 3ZV6A 4YT5A 4FT2A 1PGJA 3IILA 5DM4A 4LE1A 2CB0A 2OBYA 4BRUA 2A5JA 1SULA 3MA0A 4PGAA 1ZN7A 2DTXA 3IR7A 3Q3CA 1K8XB 4Q1FA 5B12A 3NMUF 1VL6A 5HDQA 1JN0A 1NMZA 5CLFA 4A23A 1X13A 3MWDA 4DQDA 5AK0A 4FQ8A 1ZD3A 1G8AA 4NBUA 4GPAA 4N47A 2D7JA 1FRNA 4OQEA 4BMXA 3CNEA 3R1IA 4Q3KA 1QS0B 2NSJA 4MIOA 4D97A 1BYIA 1RLOA 3GMDA 2Z95A 4TTSA 1ECFA 5CA0A 2YJ5A 4EEZA 1M34E 1NFRA 3D43A 5K0LA 2F8SA 3LBFA 2W48A 2JLWA 4RF4A 1R0BA 5TX7A 4HTFA 1QVAA 3T5TA 2Z6VA 5AW4A 3Q9NA 4AP6A 1FRVA 4ZGWA 1X3LA 1R5JA 1DE0A 1NPTO 1ESEA 2R44A 2AXPA 3KYDB 3PFFA 4KQIA 4BVJA 1VPWA 4NBKA 2C3MA 3EZ2A 4JI5B 1FLNA 3OZCA 4P4UA 2CD9A 2O0HA 3FCXA 4KGXA 3TCXB 3FGOA 5JDCA 1E2GA 1MAHA 5ARBA 5JMWA 3JWJA 1EWQA 4MDYA 3U7EB 4GPEA 3VKHA 5FJIA 3ETNA 5HE9A 3VU3A 4J0CA 4R68A 3W4IA 1TVMA 4GI7A 2AQKA 1L3IA 2MSCB 7MDHA 4MI3A 2Q1XA 2E55A 1COWA 1LNZA 1U28A 1ZI6A 2GXSA 2C54A 4NYJQ 3ICQB 1V3UA 1EDOA 1ORWA 3QIVA 1K8RA 2PGNA 1SA0A 4OIMA 4C0SA 1XPOA 2O5VA 4BE7B 1JX6A 3DDNA 2WRZA 3KVRA 2GN4A 4M86A 2Q5OA 4CUZA 3ASVA 1ZWKA 5HPYB 5LLSA 1Z8HA 3DFMA 3HBFA 4BASA 1ISHA 1NMYA 2HZ7A 3C3XA 4ZCRA 2Y93A 3E7FA 4IFIA 1XZHA 2OOKA 1RS0A 3A3KA 4GOLD 4WERA 4Q1BA 4TYYA 1JIXA 4MV3A 1IOLA 4NP6A 2P2ZA 2DU8A 4EW1A 4KO2S 1C0EA 1PU2A 2C7QA 1V2GA 5AOVA 2C8KA 3D7LA 1AN0A 3NASA 2Y1GA 2PFKA 2CT8A 3LUKA 3SVLA 2NZXA 2ZJ0A 3E0QA 2BZSA 4V0QA 5AKHA 4HLQB 2WA1A 2ONCA 1SRRA 3OT5A 5IBRA 4AXXA 5F12A 1T35A 2WFLB 4KRYA 1NMEA 4E33A 4OGLA 1ODLA 4IF6A 4J3JA 3QI7A 1BIFA 3AJAA 5CB0A 1XV5A 1XXHE 4NDZA 3K9FC 5AM2A 1N34B 4S3MA 2O8CA 4DMKA 5IAEA 3K31A 4EB6B 1I9GA 3CMCO 3QF7A 4NCJA 4B3BA 1Z13A 4KPUA 1NBMD 1SC1A 3N6RA 5FB3A 3N70A 5I48A 4JHLA 4HWTA 2FPIA 2X0KA 5F2EA 3SJ7A 3RS3A 2Z1MA 5AO9A 4MYSA 1SU6A 4TUYB 2ZYAA 5LLDA 1XMOB 1JHMA 4GMFA 1IBRA 2YWXA 1G9TA 1WXEA 1LI5A 4U6NA 4Y30A 5B1EA 3GFTA 3MGKA 4JIGA 3ORQA 4MVJA 5FL7A 1TZJA 4DM7A 4DIDA 2WT9A 3MTEA 3OWOA 4NENA 3BIOA 2YOFA 5K3DA 2XCTB 2EQBA 1TUBA 1T6NA 1ZK0A 1XI2A 2PX5A 3ZWVA 1FP7A 4GLBA 3LCRA 4M3NA 1PVOA 1QH9A 5F3RA 4L5JA 1IIBA 1AVTA 2HLNA 1WIWA 3AESA 3B70A 4EJ0A 1G63A 2C2ZA 4FDVA 3ZNNA 3O94A 3A2LA 1EFDN 1UK7A 4L5YA 5FAKA 5L6LB 3UN1A 1N0IA 2V96A 5IJ0A 3UT6A 4OLFA 1LJUA 2PSEA 1DJNA 2PEZA 4QWMA 4BGUA 4I9GA 3VKWA 5DEOA 1T9KA 1PWZA 3G0OA 3STUA 4Q21A 3H5VA 3GBPA 1SKYE 1GRRA 4MNTA 5B7NA 3A1UA 5D3MA 5I7WA 1BVHA 1JXOA 4HDAA 4D92A 4IDAA 1XXHB 4QQRA 4Z7NB 2RIPA 4P7BA 5JS2A 5EWMA 2WPNA 2ZR9A 3DLBA 4W99A 2ONYA 3BXFA 1T9CA 3EGDA 2IFTA 5FPKA 1BFKA 4PR3A 2GOYA 1WPXA 2DT8A 2WJ3A 2A5YB 3OU6A 2A30A 4HRVA 3VSCA 1HZZC 3WO0A 3OLZA 4FW9A 4H7FA 1XRQA 3DE3X 4OQ4A 3S27A 1FPMA 3FYTA 4C5CA 3OG9A 3FZGA 1WW3A 2H65A 3EZGA 4FMBB 1QGUA 3UWPA 5ILGA 3L6OO 4ZGGA 1VHDA 1VXRA 4OJMX 1JGTA 1E8NA 2QQFA 2VWPA 2YJNA 3DOOA 5COAA 3WSVA 4PX2A 4EUKA 1HT0A 2HJVA 4M55A 5EG5A 3NUZA 5H82A 3SFZA 3NRBA 3EZYA 2L19A 4GDFA 3GRRA 5E9QA 1U9IA 2GPSA 2X8BA 4Y67A 3I2JA 5D7NA 2BJVA 3K0BA 2YRFA 2IPNA 4H7KA 4TYQA 3DF9A 1HE3A 2NWQA 4CLRB 5E6SA 5F76A 1JXQA 1VLJA 2QZ9A 1T6YA 2LRHA 4BOYA 3ZXIA 3MNFA 4HBZA 4S0XA 1AMNA 3U3MA 4AIRA 2HRRA 3A9VA 2NG1A 4D8TA 1MVLA 1FXWF 2PT5A 3BJIC 1LF0A 2EGHA 3KSMA 4ND8B 4MHSA 4LXYA 5HMLA 3KYJB 2RGAA 1A5BB 3NCHA 4C43A 1PL7A 2ZSDA 2IOQA 4BNDA 1VSBA 4PVCA 1X7ZB 3EPJA 3GV0A 1XYVA 1XN1A 3II6X 4RPHA 3WWYA 4I3FA 4XD7D 4JJAA 5IFLA 2EBHX 1NYRA 2RI0A 2W5UA 4BVHA 5HVNA 5COQA 1M1UA 3RYIA 3OJOA 2WWTA 3M6VA 3QBDA 5FA6A 1V1JA 4TWBA 2GEFA 4MRAA 3NHSA 1PWYE 2RGXA 1FFWA 1VSUA 1J39A 3CISA 1L7EA 3U7HB 3CLKA 4FN4A 1ZJYA 1XP8A 2OAGA 1AN9A 3KS9A 3WG9A 1E3QA 2P1ZA 2YL2A 4QDTA 2Z5GA 4OA5A 2XUKA 4HH1A 5FWXA 3GLGB 1LW7A 4O6VA 4QTZA 4B17A 3QLVA 4FGSA 5AK5A 3VR3D 1STOA 4JCOA 4RIHA 3R6WA 4NMXB 3GMIA 5C7YA 2FPKA 4Q7KA 3WB1A 2VATA 1US8A 4OL9A 4P5PA 2ZBRA 3FETA 4YJKA 4NYMQ 3GWGA 5HCNA 1SHKA 4GG1A 4UOZA 1ANKA 3OF2A 3PHGA 1CBUA 3AHJA 1L7OA 2ET6A 1MTOA 3HCWA 3AFNA 2ZLBA 1PX2A 1M2FA 1MFZA 4P6VF 1IRIA 4QE3A 5K09A 4DLPA 1PQWA 2IIQA 1P31A 3QUTA 4UHKA 4WADA 4W1SA 2JFOA 2P2LA 4X8HA 2WE8A 3U7QB 4G5XA 1BX3A 2A3NA 4BMSA 1UAAA 1FDIA 5HW0A 1J56A 2O7NA 3OMXA 4JJGA 1VKHA 2QLJA 3TRJA 3CX6A 5JSKA 3CNBA 3MRTA 3K9HA 1B00A 1ZJWA 4ZAVA 3F3KA 1JDSA 2F55A 3G8DA 5REQB 4IHAA 2P4UA 5HF8A 3IHKA 5FF9A 3F6RA 3GOQA 4FR0A 4P2BA 4HLUC 3SI7A 4DBLE 4NS1A 3X1DA 2VK1A 1XZCA 1ZCJA 2NV0A 1O97D 1EFLA 1N1GA 1XU4A 4PC2A 3WV5A 2VF4X 4GWGA 4RYDA 2TMGA 4X20B 5IVDA 1GGVA 1I5EA 2AE1A 2GERA 1UFOA 2X42A 2XE7A 3I52A 3LG2A 2B8NA 2WA2A 4I3GA 4TTJA 5C3UA 3RODA 1DIBA 1HDXA 5HS6A 4MROA 4G1UC 2X1HA 1FNSA 1G6KA 2W93A 5A3JA 4Z9XA 3GLIE 2QRLA 5G0TA 1WKCA 2O8BB 4GM0A 3OT4A 1TKRA 4J0KA 4DGSA 4EA7A 3JAKA 4EELA 5K8CA 2IS6A 3BTOA 2P2GA 2CL6X 3EQ2A 5AW5A 2KPOA 4K3VA 4KQ2A 1YQXA 2HT1A 1BJKA 4OFWA 4JELA 2IU3A 2IP4A 5IANA 4ZAXA 3U16A 1WB5A 4W5QA 2IYLD 3S44A 1CF2O 2GFHA 2BCGY 2AD1A 2PMWB 4CKBB 3KPYA 1YACA 2NT3A 3G68A 3QVOA 4WKPA 1CVRA 4X7MA 5KTTA 4Y2SA 3QEBZ 4JI0B 2J6BA 2OOSA 2WF9A 1JW9B 3A6FA 2A0FA 4AC9A 3I9MA 2GVDC 4XASA 1Z2CA 3D1JA 3DFZA 4FS3A 3KYCB 1M8GA 1QHHA 4EJ2A 1UOOA 4ALJA 2R66A 3TQHA 1CULC 1VJGA 3BMCA 3JALA 2PFSA 4KRXA 2R79A 4R1SA 3WRYA 2J4CA 1P3DA 2XYVA 3OZFA 4MKIA 5E6UA 3N5CA 1Z28A 3IIJA 1X86B 3OFND 3E5RA 4HNAA 4WCFC 4LOJA 4MCAA 5CK5A 1SHLA 4TVOA 2CXQA 1L8LA 3NNNA 1LS6A 2XDYA 1DOAA 2W2PA 4GPIB 1SPXA 2ACKA 1XR3A 4TKUA 2HY7A 4ZU1X 4RD3A 1DFHA 3L7YA 4D46A 1DV2A 2OV3A 1K3FA 2Y71A 4FHFA 4RXMA 3MZ0A 1CIJA 3ONVA 1N4AA 2G40A 4YRKA 4PZ0A 1S7GA 3VZDA 5KJ6A 4HLNA 3WL6A 1CIVA 2QI9F 2I2WA 2PUHA 4TV9B 1B26A 1QHSA 1VG0B 2CL5A 2XE4A 1M7GA 1WDTA 2SKCA 3BL8A 4FWIB 3OIFA 3AVQA 3SZ3A 2IYTA 3T5DA 2WU8A 5FV7A 1WSWA 4K6GA 3UFBA 2X9VA 1WABA 3BBLA 3L8EA 1Q16A 4PX5A 4KVAA 3WKDA 1TM5E 2ZUCA 3AKYA 2EJCA 3UUFA 1TW2A 2X6QA 3NV7A 4E5KA 1VJDA 1O6CA 4RGQA 1FA9A 4CM5A 4D80A 3BGVA 3PUJA 1CUBA 4BFWA 5AVOA 5IHXA 5A3VA 2R5NA 4KAJA 1U2ZA 3AR7A 3EEQA 3DOCA 3Q88A 2UUPA 3ZU3A 3QTLA 1ZKDA 4BGDA 5JZMA 3TUIC 4MQ5A 2H59A 1QK5A 3EPPA 5T3UA 4OMCA 3DYVA 4IDFA 1PL0A 2H31A 4H1HA 2VP5A 2PKRA 5DNCA 4GI2A 1NW3A 1HR0B 3KJQA 5I8PA 4P98A 4AWBA 1DPGA 3VU0A 1Z3IX 3OQBA 5DYIA 3V2HA 5C8YB 3IEXA 2V6FA 1ADFA 2WJ4A 3EGVA 4B4WA 1GCUA 1H3FA 3Q2IA 1YE8A 3V5NA 1G5RA 2V03A 1BE1A 2VA9A 3CEJA 3DVSX 1YBHA 3NP7A 3SN6A 3V2IA 4JKOA 1E3SA 5J4YA 2WYVA 1WY7A 1NDHA 2JGAA 3BF7A 4KN8A 4DBVO 3IT3A 4QG3A 3QW2A 2FEPA 3EBPA 2QPLA 3GMTA 5CYGA 5HYVA 4BO4A 4KXNA 2ZYRA 1BC5A 5B37A 1M2HA 1Z18A 3FCSB 2J07A 4LF8B 3BT7A 3HRHA 1KBQA 4UZSA 1MN6A 3T4UA 1U0SY 4ENTA 2QNBA 3SZMA 2PPLA 4F6RB 5KI6A 3DYIA 4B5KA 2P79A 3CURA 4WBXC 4RJJA 1Q0RA 2EAUA 3PLRA 1ZRNA 2P9QA 3NTLA 2WYIA 3FPLA 3FY4A 4U2CA 4UHCA 4Y98A 4BJ5A 3L04A 4JYPA 4ATNA 5JH7F 4CL0A 3AQIA 1RI5A 1N6KA 1ZM9A 2Q46A 1CWUA 4HYEA 1MW9X 2Q7DA 4C01A 1WXGA 4OO3A 1O96A 1TCBA 2RHTA 3BF8A 3HH8A 3TOCA 2EJWA 3LHKA 1O95A 1A71A 1P91A 3BZWA 4JCCA 3RHFA 4K03A 3WIVA 5B6PA 2HIHA 3SK0A 1K8YB 2LZ0A 3BAZA 1FX0B 4D3YA 4HQOA 4ENWA 4NY1A 5EIEA 2ZWPA 1N8TA 1SB9A 3ZDRA 2JFNA 4FGZA 2LCIA 1JQLB 1ZM3A 1CS0B 1N7JA 1C7EA 3WGKA 3IMKA 2VYVD 1PT9A 3KWJA 4WDRA 4P31A 2FJPA 2FSHA 3DZCA 4RJIA 1RBMA 3TQCA 4AN0A 1VG1A 2K2WA 1B41A 4I55A 2ODQA 2IXTA 4LYHA 3MJFA 3RABA 2E9SA 1H69A 2LNDA 2MR6A 2PX2A 1C9EA 1DBSA 2B3DA 1H1LB 1M2KA 1NR5A 1QIIA 1XOIA 4MGZR 4NARA 5KUTA 2VCYA 2ZB8A 1HDRA 3TEFA 2R6AA 7YASA 4D7AA 3K6SB 1N5RA 2X7JA 2ZI9A 3RRNA 3ZVMA 4GOKA 4US1R 1KPHA 1SBTA 4ZOEA 1NE7A 2JGJA 1ULZA 1P1HA 2QMOA 3KQPA 3PFKA 1D04A 1GSHA 4G2NA 1JAIA 1FTQA 1QMGA 1T29A 2PSDA 4DCNA 1I6LA 2B94A 2AJ8A 2QD3A 2W2LA 1CCWA 3JZFA 3PZRA 2BGIA 2J67A 2ZAIA 3QLVC 1VKNA 1Y1KE 5KJ1A 3BRCA 1KQNA 4DS3A 5THXA 3DTVB 2A88A 4HI0E 4J9VA 1QH1A 4AJ2A 1R8XA 4BZXA 3PR2B 4DRYA 3PTLA 4ZO6A 3E2PA 2JVJA 3PUIA 5CW2A 1GCAA 2QT9A 3KJIA 5ALGA 1SIOA 4YR9A 1UCFA 1H3NA 3CWQA 1JG6A 3GEHA 5FHQA 1Z12A 5TJHA 3UCXA 4V24A 4Y1EA 2VAVA 3V55A 3ONFA 4YJHA 2BPOA 1COZA 2RAVA 1RXWA 1YAJA 1Z5PA 3ICOA 2PXAA 2ZWOA 1QAOA 3W6PA 3FROA 3OLCX 4ZOCA 1FNNA 4C6HA 1YZKA 1BDJA 5FI3A 3V1NA 3NZEA 2B4TO 3S5JA 1EQUA 3RC9A 1PJCA 4PZDA 3K0SA 3R77A 4KR7A 2IS4A 1NAIA 3KJZA 1YL6A 5K3EA 1ZI9A 4WCVA 2WWWA 3WGZA 1AKTA 4REOA 3AKZA 1F48A 3WI7A 4DLNA 1KK1A 1O77A 2P4QA 2PFGA 4PZPA 1XZGA 3QFSA 3AKCA 4OQYA 1XZBA 3HG7A 1R8JA 1PKXA 4JASB 5MFZA 4WNIA 4P22A 4A8JA 2PRZA 2VTBA 3MWEA 1K89A 4O0LA 2B0JA 5FTNA 4PXYA 1L1QA 5FLYA 2CE2X 3AF3A 3TDMA 3BDVA 3WGTA 4MQFA 4AQDA 1Q0HA 5KYKA 1ZR4A 1DUVG 2M2IA 3PGKA 5BVHB 5E38A 3HXQA 3G17A 4ZPXA 2I4TA 1J25A 1GFWA 2I03A 1WTCA 2MSDB 2XVXA 1C14A 3C85A 4GD3Q 4MICA 4F93B 2YYAA 4GLJA 1UZUA 1L4BA 4RHEA 1E69A 2Q99A 2F1HA 5K45A 3SVZA 4BQNA 2QTHA 1TO6A 2ECFA 3G2IA 3V7NA 1PV2A 2PGOA 4P34A 4D0SA 3F6YA 1L8QA 3FTNA 2BGLA 3FWKA 3K0FB 3J7TA 5B53A 1KYXA 2JFFA 4LHXA 4O33A 5ALQA 3DOEA 1TEVA 4PZ9A 5FOWA 5BUZA 2GPJA 2AQ8A 2G71A 1M3SA 4ITVA 1IAVA 1PDVA 3NEPX 5IC5A 4D3SA 1P2UA 2JH9A 4E12A 3QPAA 1W0JA 4G81A 3D3WB 3HY4A 3U5ZB 2BT4A 4AF8A 1O0SA 3D2BA 4UUQA 1YAHA 4KOEC 1FDOA 3ZWPA 2HWKA 5F21A 4AULA 1X9IA 5IN4A 1NJ2A 1QK3A 4KQ6A 4W5NA 4DV2B 1SO8A 3LKDA 1M74A 3O90A 4IXTA 3ZCQA 3DLPX 1RFGE 3A4MA 4W5OA 2M9MA 4BNNA 4KQEA 1HL7A 3LDGA 2CLMB 4B76A 2A92A 3R41A 3DWIA 4KNVA 3H1EA 5EJGA 4RDXA 9ABPA 4HAIA 2IP2A 2BM1A 2FCAA 2VJCA 2P3QA 3FVTA 2XA1A 2EG5A 3PK0A 2A9RA 5M7EA 4P38A 1D9XA 1ZLYA 1WDMA 2BMEA 4UC0A 4AD8A 1M33A 5PGMA 4ZQCB 2ZBEA 5C7LO 4RTOA 1PJQA 4FYWA 4TLCA 3FGZA 1RKBA 1EXDA 3HUTA 1B76A 1PBNA 5C1DA 1V7QA 2OVBA 1HE2A 3UHOA 1NQAO 2FETA 2RGCA 3OZVA 4B3FX 2OXRA 3KT6A 1NNUA 4LXQA 4PC7A 2C99A 1KSFX 1MX1A 1YDWA 1QG2A 1YA8A 3FYCA 4I2NA 3RSOA 3ER8A 3DMGA 2D6FA 1EAYA 2J0VA 4OHXA 3SE0A 4GWLA 3U9TA 1GXSB 1R4NB 3L0DA 4EJSB 1GXSA 1D09A 4RHCA 3TLCA 2FEOA 4OLAA 3CRVA 4ZYUA 2VDLB 3GCWA 2HSDA 4NCKA 3E9QA 5EXPA 1W6RA 1P72A 2YJZA 4JLSA 4Y18A 5D5HA 1QCCA 3BCSA 3C3JA 1J21A 3BREA 1J22A 2REBA 1NJFA 4DTIA 4D9HA 2IXGA 2PZEA 4N5LA 4C3OB 4PBSA 4KXMA 2ORIA 3IE0A 4QUBA 2BGJA 3T1QA 3KQNA 2PBFA 3VU9A 3KU4A 3MMNA 2A57A 4Q16A 5HFNA 4Z54A 1Q57A 4QLBA 1SUAA 3Q7SA 4KH1A 4Q1DA 2FU5C 2Z2JA 2PJDA 4N41A 3L43A 3TQSA 4DMHA 2GEUA 1GO2A 3MGAA 4IDQA 1K5HA 2EQ5A 4BLSA 3O92A 1A2QA 3M9LA 3D6UA 5A4MS 3FLMA 4YT2A 1DJMA 13PKA 2K5UA 4JJEA 1C7IA 2VWHA 3TBHA 2W4QA 2PX4A 2WTBA 4JS0A 4I46A 4RZ2A 2P9ZA 2H1HA 1XK7A 3EY4A 4HFRA 1P7WA 4CMEC 4QHTA 5SICE 5CFNA 1ULBA 3CEHA 3L9XA 4RGYA 3U49A 1Y5MA 4JU8A 4ZVLA 2IW1A 1I7SB 1T9GS 1JHUA 1TQDA 1PP4A 1O54A 5ADUS 2X5OA 3A3OA 5EWLB 4AYTA 1PQUA 1FK8A 3IO5A 1OFTA 3LBAA 1AA9A 2MTBA 4M89A 1SD2A 2AMYA 3IKJA 3IBYA 4CU2A 2IZ5A 4OL0A 2J3KA 4C4AA 1U8TA 3DEIA 1IU9A 3UZUA 3LSYA 1T9GR 3KLMX 3STXA 1RXYA 4XARA 2DUNA 4XGKA 1FL9A 3DC2A 2PRKA 1G0OA 4HNVA 4WPGA 1H23A 5BT8A 1JPJA 4O2BB 3U1TA 4MJXA 4RMNA 1RABA 2DPHA 1JSCA 3O47A 1UK6A 2RGWA 3J7AC 6ABPA 2E7ZA 1VPDA 3I5AA 3AY6A 1FNDA 1BX0A 4KI0A 2O3QA 5DISB 2GH1A 4MV9A 4E0BA 4M83A 1J0DA 2OV6A 2EF0A 2JHFA 4F2PA 3FOCA 5CD9A 2V98A 4V2IA 3JTMA 3MN1A 1P60A 4Q9AA 4C0KA 2W2NA 3OFSA 1R6BX 3T0GA 4E09A 3AKEA 3N8GA 3EC7A 1C8BA 3LI2A 3T1TA 1FVHA 2CF6A 3N58A 1C3OA 4ZVQA 2W2LD 2BN4A 2X8AA 2OHFA 1IVNA 4OUDA 4WEQA 1U8YA 4ABYA 1P2GA 2H5IA 2J9FA 2PIDA 4QYWA 1QIKA 2OWDA 3AVPA 5C8YF 4HH4A 3ZS9A 4EYSA 3G88A 2B5VA 4XPZA 2BFCA 2XADA 3HJCA 1WLYA 2EX4A 4EA8A 3HVHA 4A0RA 1E0AA 5TEVA 3EY9A 4KAAA 4D42A 4MCJA 1P80A 1UBCA 2NXNA 1OCEA 2QW1A 3PEVA 3NWJA 5EAIA 3TWOA 1NZDA 2IYRA 9LDTA 1JMVA 3ILVA 4HH3C 4UARA 4E5PA 1JJIA 1A9XA 2BE9A 4R69A 1YF3A 1KEWA 1F9AA 2DMRA 3A1SA 5AKGA 3ED1A 1FYFA 4UTVA 5IDQA 1NF2A 4YRBA 4FMCB 1TKAA 5SZHB 4CR8A 1RXCA 5ITWA 1IK6A 1JLHA 3BWEA 5LL6P 4X20A 5AQEA 3L8FA 1RM5A 3HB0A 2H9IA 3HXTA 5EC8A 1OFGA 1SXHA 1T26A 1OBHA 4BUZA 2RKBA 5IKXA 4L15A 4EHNA 4MYTA 4O1IA 4URXR 1J49A 1JLRA 1GPYA 3SEFA 1GNRA 1TLTA 3UW1A 3U62A 4A6XA 4AWXA 2V1UA 4TV9F 3MSCA 4FFRA 3ZI4A 3OOSA 4H6VA 4Q9JA 3SICE 1TF2A 1UBSB 1SBYA 1AKNA 2DFPA 4LWOA 3GYBA 4RLHA 4XVHA 2ZJFA 3KEQA 1OAOC 3PB3A 3SY8A 1HEYA 1W48A 3GCDA 1TIBA 3VR6H 5L7TA 4EPWA 1FFCA 2QWXA 4HXYA 2WDPA 3CU5A 3P0HA 2AOVA 1ZONA 2VRBA 2WQZA 3GA0A 3UOGA 1GRVA 3DPUA 4RFLA 4FYHA 1GEEA 4WN9B 1GAQA 1VL8A 5MHTA 2PXHA 4PAMA 4CV2A 5AMXA 2GFQA 1ZMOA 3CRRA 3FMFA 1BMDA 4PIMA 3WJ1A 4A8JC 4C7VA 3D6AA 1H9CA 1YB5A 2C4KA 4ZEOA 1FUEA 1OI4A 2AQIA 3G0CA 2V45A 2Z2XA 2WILA 4Y9TA 2CKMA 1FP1D 1QLWA 2R60A 4TM8A 4Z1MD 1K8QA 4B84A 3AIKA 4DEVA 3H84A 4EKIA 3U3ZA 4EM6A 4MVJD 4P3NA 5FL7D 2PUGA 3AV0B 3KVVA 4WZBE 4WN3A 3UK0A 3CKLA 4H3KB 4EFDA 1QQTA 4C7MA 1FFDA 2GCOB 3TFQA 1DEKA 5GV7A 2CEKA 2XCLA 1TVKA 3D3QA 1PYDA 1U5AA 2I7DA 2BEUB 4BO9A 4GLLA 1VBMA 3K4PA 2Z83A 1TDJA 3DTVA 1S1MA 2QZ4A 2NXCA 1Q7BA 1G2IA 3R6LA 2VHQA 4WSOA 1AH2A 3Q6MA 1K4KA 3ZWAA 2IQIA 1OFUA 2CFRA 2QNRA 2WZCA 4YC7A 5D87A 3M4ZA 2Y1OA 4F56A 4HZGA 3AVTA 1RACA 3DOUA 5BORA 3WK5A 2AX3A 1YC2A 1PK8A 2X9LA 2QMUA 4GBJA 4L5AA 2F3QA 3HV0A 4XDHA 1E1NA 1NQVA 2Z3ZA 3KYBA 3H1PA 4ES6A 5L7WA 5JW6A 4IRUB 2XWSA 4YP7A 1VA4A 3Q7IA 3ZDCA 4HNTA 4D43A 1PLKA 1DIGA 4NEQA 4Q6WA 3UGJA 3V6MA 4MUKA 4WLEA 4Q37A 4Q48A 2D5CA 1TUBB 2R11A 4U2BA 2DBYA 1D2NA 4NV1A 1CF9A 4I8XA 4POOA 3UMYA 1DFGA 1L4YA 4ZFNA 2I33A 3NTOA 2N1MA 4NEGA 2HU8A 1V5GA 4J91A 4M1WA 3CYFA 1ZAKA 1BDMA 1EPUA 2GPTA 3CEMA 3SZOA 3E2MA 3GJSA 3TLXA 3EODA 2YZMA 2E1RA 1W76A 1EA5A 1CS0A 2HK6A 4S24A 4X1KA 5F9FA 3HO1A 1Y4ZA 1RYEA 2GFIA 4E3WA 3CPHA 2AT1A 4MI6A 4TL8A 3H1BA 5TEWA 2G0TA 3AF5A 3NHJA 1EWRA 4J0FA 4A8TA 3SWWA 4C0AC 7MHTA 5FPPA 2Q3JA 3BGWA 4N7RA 4R5MA 1XNQB 1TT5B 3NOOA 5DYYA 5L7YA 1YL7A 2X2FA 4Y1RB 5TMEA 3WO1A 4EMUA 1O2DA 1M2OB 1N33B 1YT5A 4MVYA 1XZLA 1J07A 1FP4A 1PN3A 3T7CA 2QENA 5GZ6A 5LQKA 1VL5A 3PIDA 3C1TA 3CVVA 1YUNA 2IEYA 1P2SA 1T1GA 2D4AA 4CMEA 1DG9A 4YS6A 3NALA 4IFBA 1TCVA 1TK9A 3LDAA 1N92A 4FEAA 3CVYA 2K87A 2VF8A 3PHHA 2Z8XA 5FUBA 3UA3A 3AVWA 2B3TA 4AY2A 3IVCA 4K9DA 1ZNZA 4B6PA 3P4XA 3DAGA 4D0LB 1NOKA 4HJXA 4XQEA 1MOZA 1P4RA 4FQ5A 1VL0A 3MJHA 2G5PA 5C32A 1JYSA 1LDNA 4QO7A 4KSCA 2RIRA 4JNKA 3EXIB 3EVCA 3Q5EA 4ZC1A 4G0MA 3LLMA 1M72A 1Z5VA 3HWSA 4JL5A 3TJRA 1UFKA 1ESDA 3MD9A 3R3SA 2GWHA 4JLDA 3GJ6A 4YJ2F 1GL7A 3DHEA 3RIHA 3CLSC 4C4ZA 2H2IA 1CUGA 4F04A 1F8GA 5BUSA 3QU9A 3ZXSA 1IB6A 1QO0D 3V33A 3CB2A 3DAHA 5AM5A 1VKOA 5G2OA 1BCRA 3MELA 4YRNA 1KYVA 1ZN2A 5KYGA 1L5MA 4P80A 1SXJC 1UBFA 3K92A 4C6TB 1O3YA 1NVBA 5JYDA 3D6HA 4ROTA 4TRMA 1U90A 3TKYA 2HSWA 5JCOC 2G9ZA 3JAWB 3N1UA 1EMDA 1K2WA 2JBWA 3H5AA 5FR2A 3EFBA 1Z8FA 4NX2A 2V7QA 3HEBA 3DD1A 1ZD4A 4GSLA 1TU4A 3HFRA 1RD4A 2QAGB 3UG7A 1BXGA 3WL3A 5F9MA 4G5HA 1A9QA 4Q66C 3T95A 3JWPA 5GJVC 3LRPA 2QX9A 2WAYA 1JR4A 4M0DA 3VO1A 4B0OA 5FBZA 1U7UA 1WUTA 1P4SA 4XM0A 3TEJA 4HUTA 5AQ1A 2A78A 1Z22A 3JASB 3KKNA 3NUQA 4HGOA 3DCYA 4OI2A 3LQKA 1NC3A 4MEJA 3EQ6A 3BXPA 1P17A 1SCIA 2VQSA 5E4FA 4BNHA 4GGMX 3HBMA 4R81A 1AKYA 2FMUA 2YC4C 4QECA 2OCIA 4RV9A 3UC5A 4LV5B 2XUJA 3WYEA 4BLVA 1FMLA 4TWJA 4MVJH 5J5CA 4CFYA 3I0MA 2ZS7A 4MK4A 4BNGA 4RELA 4D0NA 2YDXA 4KVGA 2HQ1A 3QMWA 1H8HA 3L8HA 1OW3B 5E6UB 1NVAA 4CM1A 3HYTA 1Y7LA 5EVJA 1QZXA 1XZKA 4JBXA 2HUNA 2GD1O 4QRHA 3VMMA 1DZ3A 1WRBA 3L0PA 4CKXA 4YRFA 1PLJA 1YOVA 3F8TA 1R3UA 4L6IA 4XVCA 2G0AA 5KS2A 2VK4A 2G6TA 3EGCA 3HDYA 4JEMA 4YAFA 4BLRA 2X8WA 1DHRA 1XRJA 5JAZA 5FLEX 1M83A 1DQNA 3W2GA 2C5AA 3LBHA 5HMMA 4R71A 2Q0XA 4GZ5A 2RI1A 3NBXX 5EFZA 1W2WB 4J3FA 4BB6A 4U7PB 5CCBA 1B6RA 4K0RA 4BNLA 2VHVA 2JLQA 3ISTA 3ONNA 2HFKA 1GYQA 1O7JA 3G2LA 1C0LA 1DAPA 1M34B 4PHCA 3S0JA 4RVOA 3WQSB 2IGTA 4ND3A 2EFEB 2Z56A 3EH1A 4F7WA 3FDFA 3PQFA 1KK0A 4XOIA 3HKEA 5DLDA 2YHBA 4FMPA 4YRMA 1GQYA 3L0SA 2WSBA 4NZYA 4LMBA 1FYEA 4DCVA 1LZLA 2B61A 2IYUA 2Y0PA 2VYFA 4LOKA 5EHGA 5SYAA 3DAPA 3KLNA 1K9SA 5L3ZA 3KG2A 1EVKA 3PKZA 4HQRA 5I45A 3NETA 1CEYA 3WL4A 3KQWA 1I5RA 3NYQA 3RVKA 1XVTA 4LK2A 3SBXA 1DWQA 1KAEA 4FWBA 4NVRA 1M1YB 5B3JA 2PZKA 1EGHA 4ZYXA 4OH1A 5HR5A 1WB4A 1BRMA 2AYYA 4NBWA 2Z2KA 4PLVA 3SDSA 2VNJA 1I4WA 5DBOA 1Y9DA 2M6RA 2ETVA 4FGLA 3UPDA 2QVCA 4EUEA 1M2OA 4F2HA 1UDCA 1R7RA 1IBCA 3K5PA 3N2LA 4MW9A 4QVKA 2ID4A 3QVLA 1C4OA 2ZJ1A 4E5UA 1U1CA 3ASUA 1L5NA 1AUPA 3PSHA 3MJRA 2GRAA 4A16A 3FNIA 1PTKA 4FNMA 3AR4A 2OV2A 2I2BA 3RFTA 3GRCA 5CT4A 4UNSA 3OURA 2QUHA 2LIVA 2XR1A 2UV8A 3QJYA 1ISSA 4GL4A 3TB4A 1GV1A 4KUGA 4L51A 3C4QA 3PRYA 4LDQA 3ROXA 1CDEA 2E82A 2CVPA 1W5BA 3OY2A 1DXYA