3DYIA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
240
structure length
240
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
molecule keywords Esterase D
total genus 88
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dyiA00
2QRUA 4K2AA 3K2IA 2PSFA 4OB7A 1KU6A 5AI9A 1QTIA 1K4YA 1G42A 2OGTA 4G4GA 1XZLA 3C6XA 3B5EA 1XQVA 4DIUA 3WIOA 3ESAA 3I1IA 1T2NA 4UBLA 4H7HA 3WIBA 5CXXA 1LPNA 2WHPB 2HL6A 3FOBA 3MGAA 4ZV9A 1GT6A 4MYDA 5CMLA 5EIAA 4YPVA 4QNNA 3B3QA 3WK8A 2Q0XA 3T4UA 1QFSA 2HDWA 4PO3X 1W76A 3I2GA 3WYDA 1XQXA 2DQYA 4MJ3A 2HADA 1QONA 3E0XA 2QKYA 2ZYIA 1CFJA 1SC9A 2XQJA 5AICA 1LNSA 2O2GA 1QO7A 1K5PA 4B85A 5ALXA 4C6HA 5CT8A 2C4HA 3IDAA 1GXSA 1QIHA 2AJLI 2JGFA 4ZGBA 5BWCA 4BAZA 2EDCA 5D3KA 1W75A 1XZFA 3LIIA 4MXDA 5LLSA 3UUEA 2VQ6A 4EY8A 5HQ3B 1A7UA 5CW2A 4G8DA 5HCUA 5AI0A 1FJ2A 1FFAA 2G4LA 4BE9A 5ALKA 5EGNA 2BKLA 1BE0A 4UHDA 1E5TA 2O2IA 2EEPA 2HA6A 2NW6A 1I6WA 4Y2YA 2PL5A 4MWSA 4AO8A 5AIAA 3LP5A 2XLCA 2JGKA 2ONCA 2FX5A 2QVBA 5DJ5A 3SX4A 5ALLA 4F21A 1MO2A 1JKMA 2HRQA 5FPQA 4BVKA 2ZYSA 5LYYA 5LKAA 3HABA 5JZ9A 4FOLA 4EA6A 2VTVA 4FTWA 2WFLA 3H1BA 1MJ5A 3EBLA 3I6MA 3TRDA 2B20A 1ZIXA 2XE4A 1IMJA 4OD0A 5ALRA 4U2DA 5ALPA 1UK7A 4I3FA 5SYMA 1F0NA 5HK8A 2OGSA 2ACKA 5ALHA 1LPSA 2WIJA 3M3DA 1O6GA 4EUSA 1XZAA 3PFCA 1N5RA 3VJKA 3JYHA 4UBKA 3HJUA 1P0PA 3H17A 1ZD5A 3F9CA 3GFFA 2VJAA 4GHWA 3BIWA 1TKRA 4FFWA 2DR0A 3IURA 3VJMA 3I2IA 2IX9A 3QMVA 3W06A 3BDVA 1MAHA 2VT7A 1WPXA 1DTEA 3C43A 2DHCA 5CH3A 4BDTA 1QJ4A 2XUJA 4BAUA 3AFIA 3E1GA 3F98A 3VKFA 2QZPA 3I28A 4Y2PA 2JGEA 4CG1A 3HACA 4G8CA 4AXBA 2GBIA 3WWEA 3QPDA 1VA5A 2RHTA 5IH7A 2HU8A 3I2KA 1TK3A 1UK9A 1HQDA 3WWDA 1YS1X 2HIHA 5IVDA 1FFEA 2WU4A 4GW3A 3G0CA 3FLBA 5C8XA 3WJ1A 1GPLA 4X7BA 1LBSA 4RE6A 5E4TA 4P08A 2YH2A 5AO9A 3HYSA 4G4IA 4GXNA 4RGYA 5DLPA 5LIPA 1YB7A 4GDMA 4P9NA 3WKCA 5LZ9A 5FUMA 4EB0A 4H77A 1XZHA 1P0IA 2WTMA 3SWWA 1YR2A 1A8SA 1N1MA 4I19A 5KBYA 2B9VA 2WHPA 4PSUA 1CUJA 2WIFA 4DGQA 2GZRA 4QLOA 1EVQA 5ESRA 2GYWA 4FKBA 2XLBA 2ZJ6A 2D5LA 4BTLA 2JEZA 2VSQA 4OB8A 4Y7DA 4Y2VA 4CCWA 4OU4A 1LPAB 3CCCA 1XLUA 2WIKA 2OAEA 4Q3LA 4E15A 4Q05A 4ZXFA 4X93A 4UPDA 5LP1A 1LPOA 3RKSA 4G5XA 4CIAA 3PF8A 1EK1A 4U2EA 3WWCA 3G9ZA 1XZIA 5IKXA 5EHZA 4LXHA 2XDWA 4UBNA 3GROA 5E4JA 2WU3A 4U2CA 2E3JA 3A2NA 4IH4A 5K3BA 4OSEA 1VE6A 3STYA 2O2HA 5K3EA 2R11A 4FWBA 3STTA 4FLFA 3KOOA 2XQKA 3WL7A 1AMNA 4UHFA 1JU3A 4EZIA 4QDXA 2DCMA 3WL8A 3CXUA 4MWTA 3IUQA 4HXFB 1ZI8A 4KAAA 3O9MA 1CUAA 1K8QA 2I3ZA 3G0DA 2HA4A 4DNFA 5JD4A 5FOQA 5AKHA 2WSLA 5JIBA 3U0VA 5D7BA 1BCSA 3FCYA 1MX5A 1H2YA 3AIKA 5I7UA 2C0QA 1DWOA 3KDAA 4W1RA 1XQWA 2VEOA 1SCQA 5E2IA 2BFNA 1F0PA 5IVKA 1K63A 3I6YA 3G0BA 5F4ZA 5ALSA 4NMWA 4Q3OA 1AURA 4IQ4A 4QDOA 1P0MA 1TCCA 1QGED 4J0GA 1YAHA 1SFRA 1MX9A 1IUNA 1AGYA 5CT9A 1QIIA 4L3WA 3BL8A 5JYCA 1PFQA 4RNCA 5DYYA 3QM1A 1CLEA 3ANSA 3H18A 2DHEA 5KWJA 1ACJA 3FYUC 4F60A 4Q1VA 2HHAA 6YASA 1XZKA 1XRMA 3PE6A 3HC7A 4U2BA 4WFKA 4Y2UA 2ECFA 5H3HA 2HU7A 1JT2A 4WY8A 4XX1A 4AX4A 2WLSA 5LZ4A 4QEKA 4IH1A 1YSCA 4J0JA 3FSGA 2CUTA 4LYEA 2Z8XA 4HS9A 5C81A 2Y6UA 4N5IX 5JZSA 1LBTA 3QVMA 4WJLA 1EX9A 3C6BA 1JFRA 4AZ0A 2XMQA 3DYVA 1USWA 2ROQA 3IB3A 4KACA 4X94A 2PSJA 3A2LA 4K6GA 1ORWA 3FAKA 1CUGA 3R3ZA 4OYLA 1C7JA 4MQMA 3R3VA 4ARAA 5ALIA 4DM7A 1EH5A 3HEAA 5DYWA 4QWMA 2EDAA 4C87A 4B9AA 5JANA 4DNPA 3ZI7A 4JUIA 3UMJA 4UHBA 4H7DA 4B81A 5K3DA 3FVRA 1CUUA 2RI6A 3C8DA 2BUBA 4JYMA 4BVJA 4XIIA 1XLWA 5ALTA 5HF6A 3FBWA 3D2AA 4M0FA 4BCCA 1AQLA 2WUFA 1FFBA 5CBKA 1E8DA 2JGMA 3OC0A 3K6KA 2IIVA 3U1TA 3QITA 1XRRA 2G5TA 1YA4A 3G7NA 2AJ8A 4BC0A 3F96A 1UOOA 5AM5A 5CXUA 2VA9A 4DLNA 3DD5A 4WFIA 2BAGA 1U65A 2HA2A 3MUOA 4ZWNA 3LIPA 3FYUB 3DYIA 3FCXA 3GUUA 4UHHA 4EY4A 2PM8A 4TVKA 1JJBA 1NU6A 2OGZA 4JEIA 3GA7A 3WWOA 4CG3A 3STXA 1BN6A 5HFNA 3H04A 3M82A 2QM0A 2HA0A 1R50A 1E66A 4BATA 4YX9A 3QH4A 3BE8A 4MYSA 3NOXA 3DOIA 5A6VA 5CTAA 2QS9A 3DDUA 1E89A 5EI5A 4KE8A 2DSNA 4BTVA 5HKAA 4A23A 4PNZA 2P8SA 4Y2XA 3H2HA 4LXGA 1L7QA 3QZUA 1MNAA 4DTCA 1W1IA 1H2WA 4DNOA 3WI7A 3AJAA 2AJDA 4B9EA 1KU0A 3ZLTA 1G4HA 4BC1A 3M83A 1HL7A 4GBGA 3EQ9A 1YB6A 3G0IA 3ESCA 5ALMA 1XZDA 3FSGD 3H2GA 5AM2A 1CUEA 5FRDA 1MN6A 3I6ZA 3MVEA 2GBGA 4EHBA 2WM2A 4V2IA 5A62A 5HFAA 2AJCA 4AN1A 5AI4A 3I2HA 2WIGA 1Y37A 1CUXA 1G5FA 4H7KA 1AKNA 4K6KA 2OCIA 2ZSHA 3K9BA 3V1NA 3AINA 1W6RA 5ALOA 3D2BA 3FYUA 4BE4A 1VJ5A 1WB6A 5D6OA 5LZ5A 1UKBA 2X76A 1BU8A 4PV7A 1XZEA 4ETWA 1MTZA 2XI4A 2XT0A 4UBIA 3HXKA 3H0CA 1QIFA 3WL6A 4B6GA 1Y7IA 3WA7A 3WQHA 1WB4A 1ZI9A 5T4FA 1Q83A 5FKJA 3O4HA 2J3DA 3OM8A 1CQWA 2XUFA 4C4XA 4HVTA 2HFJA 3R3WA 3DNMA 2VJDA 4X6YA 4CCYA 4EBBA 3FLEA 5A71A 2OG1A 4M0EA 1LPPA 4BCDA 1QFMA 5AI5A 5AKLA 4QE3A 3W9UA 5LZ7A 4KYVA 4QDTA 2AXEA 3G0GA 5SYNA 3QYJA 5ALYA 1H2XA 3I2FA 3BDIA 1E8NA 3FLAA 5FLKA 1QIKA 1GQSA 1U8EA 2CZQA 4HRXA 2WFMA 1A8QA 2XQIA 1IZ7A 4MEBA 4EY6A 2WILA 3F67A 4E14A 1OCEA 2GBFA 1EB8A 5ALWA 4FMPA 4UUQA 3V9AA 3OOSA 1P0QA 2BUCA 3IBTA 3OPMA 2I78A 4N8DA 1WB5A 1K6EA 1FFDA 2Y2VA 4BYMA 1CEXA 3HLKA 3AUKA 4M0MA 4ZRDA 3V48A 2FJ0A 2DFPA 2XUIA 4NVRA 3AZPA 5CT5A 3D5EA 3D7RA 3VJLA 5AI6A 2X5XA 3DJYA 1QLWA 4W1SA 4D9JA 2QXUA 5D3ZA 2GYVA 3VISA 2XMRA 4HXEB 3KD2A 5AK4A 5I8PA 5AKGA 1JMKC 4BCBA 1CUVA 3PI6A 1X2EA 3WA6A 2PSHA 2VAXA 3G9XA 5AKKA 1GKLA 4LIPD 2Z5GA 5JALA 3GELA 4GI1A 4DSAA 4N5HX 2OCGA 2XQGA 1J06A 3FNBA 5ISMA 3JW8A 2K2QB 4K5QA 4FLMA 5ALQA 5AM0A 1BROA 3FVTA 4RPCA 1EK2A 4QWWA 4K6HA 1JJIA 1XRPA 3UUFA 2O7RA 3ICWA 5AOBA 3D59A 2W22A 2XUQA 3N2ZB 1BEZA 5ALZA 1EI9A 1XKLA 1F8UA 5CURA 3WKBA 4W9RA 3IULA 4O08A 4Y9SA 2OQVA 4NZZA 3DLTA 4EY7A 4E46A 4L0CA 2XMBA 5FDFA 5JZBA 5AK6A 2JGLA 2Y6VA 2ZJ7A 2GBCA 3W04A 4Y2RA 1L7RA 4ROTA 1QIGA 5ALGA 1H23A 3WL5A 3V1LA 1Q0RA 3DS8A 1JI3A 4WFJA 3V1KA 5HQ3A 3AIMA 5C8ZA 2O7VA 3QPAA 1X2BA 2YASA 1GPKA 2QXTA 1CUYA 5JARA 3A2MA 1ZOIA 1HLGA 5BOVA 4AMYA 1TAHA 4TGLA 3D0KA 4C88A 4OPMA 3ESDA 4QZVA 2WUGA 2CKMA 2BGNA 2XMZA 5AOCA 1QIDA 2CMFA 4JH0A 4W63A 3EF3A 4L9AA 3OG9A 5DYTA 4CFSA 3PUIA 5FV4A 4N8EA 2H7CA 1CRLA 4Y2QA 4EY5A 4P92A 3H1AA 5DWDA 4J0CA 1X70A 2ZYHA 2J3QA 3WWPA 4DMKA 4UFPA 5AKZA 1MNQA 3BF7A 3C45A 4ZI5A 4OCZA 1XZMA 1JU4A 2WG1A 4JYPA 1Q84A 2WKWA 4H7IA 1MT3A 4H0CA 5KREA 1FSSA 3PUHA 1L7AA 4BRZA 5JASA 5CT6A 1TRHA 1W52X 4Q3KA 4AQDA 1R3DA 4YK7A 2G5PA 4DSZA 4J3JA 3BWXA 4BP8A 3L1JA 3ZLUA 3KXPA 4B80A 4F0JA 5A2GA 1MAAA 1CQZA 3EQ7A 5EHQA 3STWA 4G9EA 1XZJA 4UBMA 4XVCA 5K3FA 1QTRA 3AZQA 1VXRA 4J0HA 4OUKX 3STVA 1QOZA 3BF8A 2C58A 1GGVA 3D4LA 1A88A 2Y2UA 3WK9A 2RHWA 4KEAA 3IUNA 3R0VA 2Y1KA 5AKYA 3IIIA 3WK7A 1U4NA 2H7XA 3WMRA 3NGMA 3LCRA 1SCIA 5JD5A 4L72A 4AZ3A 5C7YA 1TIBA 1ZJ5A 5BWBA 4UBJA 5AKIA 1IUPA 2PUJA 2OLEA 3NUZA 1ODSA 2ORYA 4Y2TA 3JWEA 1JJFA 1YCDA 3VXKA 4ARBA 1CR6A 5AM3A 5FPPA 4HRYA 1QIJA 2PPLA 5CRIA 1CUIA 4QLAA 4YASA 1YASA 1DT5A 2RONA 2XMDA 2FJPA 2CBGA 3LLCA 2B61A 2X8BA 4C89A 5CT4A 4XWGA 4DYHA 3EIOA 1EINA 4KE6A 4B0PA 1H2ZA 4KAFA 1UXOA 1LZKA 4A5SA 2ZVDA 3QMMA 3T52A 4PSCA 5ALNA 4G1FA 1H22A 4OU5A 3D2CA 5JADA 1EXWA 1F6WA 2WJ4A 3WK5A 1XRLA 2JBWA 4KE9A 2QJWA 5CH8A 1LPMA 1QIEA 2VT6A 3SK0A 1KEZA 1IVYA 3I2JA 5LZ2A 3OURA 1TQHA 3O9VA 4H7FA 3KWJA 4Y2JA 5A7GA 2XUHA 5FP0A 3GBSA 1CUHA 5BV7A 4BZWA 5EIHA 5HKBA 3O4IA 1WPRA 3C5WP 1QIMA 1XQYA 1ISPA 4FFVA 3QBJA 3WZLA 2HM7A 4KR0A 4AO6A 3H19A 4B84A 3WYNA 1DX4A 2XUOA 4LKOA 2PUHA 1ZD4A 3RLIA 1T4MA 2YYSA 4X97A 2V98A 2ZYRA 1R4ZA 3O95A 4B7ZA 4G9GA 5EIEA 3DKKA 3EQ8A 1EB9A 2PU5A 5A7HA 1UK8A 2AJBA 3C8HA 2IITA 3G9TA 1IUOA 1U2EA 2G63A 1SOMA 1BCRA 3AIOA 3HI4A 2UZ0A 5I9IA 4KJXA 4H7EA 1ORVA 4C4YA 5EHNA 2D0DA 4JNCA 4Z49A 1PJAA 3L1HA 2XQFA 2V9ZA 3MUNA 1FFCA 2J4FA 2PSEA 1ZICA 1DQZA 5AM4A 3WK4A 4FHZA 4ZREA 2PBLA 1CIJA 2YXPX 4PW0A 4AN0A 1UKAA 3RK4A 2WHRA 4XJVA 1GQRA 1XRQA 2WG0A 2JF0A 4J0KA 3CN9A 4H18A 4BP9A 2OQIA 5LKRA 5K3FB 1BEEA 1SCKA 2HRRA 4UHCA 2QUAA 4KE7A 3G8YA 4E11A 4GECA 1QZ3A 1DWQA 1LPBB 2I3DA 1CUFA 2JGJA 2JGIA 4FNGA 3O0DA 3WKAA 1JMYA 2HA3A 1DT3A 4ITVA 4OB6A 1YA8A 5HF5A 3WLAA 4KAJA 4GEGA 1Q0ZA 4PSDA 1THGA 5K3CA 1AX9A 5HK9A 2HA7A 3DEAA 4NS4A 5E4YA 4CG2A 4DNQA 4X3CA 5AKEA 3HRHA 3NWOA 5K3AA 2WUEA 3Q0TA 2QJRA 2J4CA 2RGUA 3R3UA 2PVSA 3PDCA 1UOQA 5AHXA 3KWFA 1UKCA 2PKYX 1XFDA 2ZSIA 3C6YA 1CUCA 5YASA 3DCNA 4U2FA 1Z68A 3DKRA 1N5MA 2H1IA 3ILSA 3WZMA 1VKHA 3QPCA 4QDZA 3FYTA 2WHQA 1VA4A 3ZWQA 3X3HA 4UFOA 5EFZA 3H2KA 4W1PA 1G66A 1R9MA 5AIBA 5ALDA 4X6UA 4OYYA 3I1YA 1HBJA 2H7YA 1J1IA 2HA5A 2OPHA 3G02A 3L1IA 3G9UA 3A6ZA 1CUZA 5KWIA 1BRTA 3W05A 3BXPA 4U2GA 5DNWA 1UWCA 3BJMA 3R3YA 4X92A 2GYUA 1WOMA 3TJMA 2V96A 4H7JA 4J0DA 4KRXA 4QDUA 5AM1A 4DMFA 2OCKA 1Y7HA 4Q82A 3H2JA 4J7AA 1XZBA 2I03A 4C4ZA 3KSRA 4C01A 4X90A 1LLFA 3IA2A 5IVIA 1XZGA 2VJCA 1OXMA 2JIDA 1ZIYA 1EDDA 3GZJA 2XB6A 2W6CX 4AB1A 1ZGBA 1RP1A 1DINA 5LZ8A 3RARA 1VZ2A 3O4JA 3ANTA 3VVLA 3WJ2A 3F8SA 1THTA 1CUDA 5JATA 1HPLA 4WDQA 2XUAA 3O4GA 4N8SA 5JAHA 3W2TA 4BDSA 2R8BA 2DHDA 4Q34A 3PICA 4PQEA 2XMGA 1ETHA 1ZD3A 3AILA 3C5VA 3IUJA 1XRNA 3IUMA 4FDMA 1HKHA 7YASA 1LZLA 5IVHA 4X95A 3D3NA 1BS9A 5C8VA 1MPXA 1DX6A 2LIPA 3Q8WA 2Z3ZA 3VDXA 4WDRA 5AJHA 4KRYA 4UHEA 3HZOA 1E3QA 2ZJFA 3H2IA 3TEJA 5DTJA 2C5FA 4X91A 1PV1A 2XUPA 2C0PA 1EVEA 4P93A 1UOPA 1OILA 5AKJA 5JD6A 1CUBA 5FXMA 2OXEA 1CVLA 3A70A 2Z3WA 2PU7A 1D07A 1CUWA 2ES4A 4X6XA 2QTBA 4HZGA 1ODCA 3TGLA 1UT6A 4BAGA 2ACEA 1LGYA 1B6GA 4Y2SA 3C70A 1UZAA 5CH5A 5ALJA 4J0IA 1HDEA 4ZV7A 1W4LA 4AO7A 3N0TA 1J07A 1MU0A 1QE3A 1J2EA 1XROA 2QT9A 1R9NA 4LYDA 4IH9A 2XUGA 1WM1A 1ACLA 2BGRA 2HFKA 1NU8A 1IZ8A 1YS2X 2WQZA 4LHEA 3FWHA 4CCYB 3B12A 1VLQA 4X71A 1EDEA 4BZZA 4PF1A 4RE5A 2PSDA 1CPYA 3BIXA 1GKKA 4DMCA 5HZGA 3AZOA 2BJHA 3C87A 1M33A 3R40A 1NX9A 2OCLA 3WKDA 3S8YA 3V1MA 2XMSA 3IVMA 1C4XA 4W1QA 3SC2A 2VATA 3CN7A 1YAJA 1RYYA 2VJBA 4WY5A 2QUBA 1WHTA 4F5ZA 1GPNA 2QMQA 2XUKA 2WG2A 2JEYA 4MEAA 2VF2A 1ZGCA 4HXGA 4DMHA 2BCEA 1VZ3A 4WCVA 4UFNA 1VOTA 4INZA 3DL7A 3DOHA 4BBZA 3WK6A 5AK3A 1ZI6A 3C6ZA 5ALFA 4B0OA 4CI9A 4X00A 1XKTA 4BRSA 2QR5A 3STUA 1ZD2P 2DQZA 3E4DA 3PFBA 3ESBA 2WTNA 1DU4A 5T4EA 2VAVA 4AMZA 5ALVA 1GZ7A 1AUOA 3ZLVA 1EA5A 3E3AA 3QMWA 4FLEA 4J03A 5AH0A 1N8SA 5JAOA 3DQZA 2WJ6A 1RWQA 3W9BA 4S0XA 2PX6A 1MX1A 2Z8ZA 3ICVA 4G8BA 1QO9A 3RM3A 2BUAA 3DL4A 3M81A 2H9YA 4A16A 1EDBA 2C7BA 2RIPA 2FUKA 1VE7A 5DNVA 4FBLA 1DWPA 4X85A 1ODTC 2V97A 4CIBA 2C5GA 2CB9A 2RAUA 5ALUA 1WHSA 4IO0A 4QA9A 4LXIA 1BN7A 2OAGA 2WJ3A 2HU5A 2WFLB 3PF9A 3VVMA 3ZV7A 4H35A 3CCBA 3YASA 5DNUA 3WKEA 5ALEA 1TCAA 1C7IA 5DTIA 1WCYA 1R1DA 4B82A 1TCBA 3F97A 1EHYA 4FBMA 3ZPXA 5A7FA 3S2ZA 3LS2A 1B41A 5HF9A 1XLVA 4HTAA 4GLBA 2XMCA 4UBOA 3HSSA 2CEKA 4MQLA 5T4BA 2WIDA 2WFZA 3R41A 5HF8A 5K5EA 1R88A 4FNMA 4GWLA 3OTQA 3P2MA 5AP9A 4G4JA 1XZCA 4BVLA 5EHXA 2QOEA 4B83A 1VXOA 5AKXA 1E8MA 5JAUA 5AI8A 1AC5A 4HAIA 5AK5A 4BB0A 3BJRA 2CJPA 1UK6A 1DQYA 4TPKA 1O6FA 5J3JA 2GZSA 2XUDA 5T4HA 2B4KA 3ED1A 5AOAA 1UFOA 4IHAA 5JAPA 1S8OA 1AZWA 1CUSA 4I4CA 1CV2A 1ZJ4A 3R3XA 1A8UA 2WUDA
chains in the Genus database with same CATH superfamily
4I8IA 4PRKA 4B4VA 4D92A 1W88A 4R8MA 3WGZA 5KSWB 4MCIA 5AI9A 1EWKA 2JVJA 3TAHA 4Q19A 2C4KA 1Y1RA 2FPKA 4D5EA 1W0JA 1JI0A 1I2BA 3R6DA 4IOJA 1XZLA 3C6XA 5IBQA 1GP2A 3DG9A 5FOXA 4PIVA 1SHKA 3QVLA 4ER6A 2FW9A 1YQUA 1EUQA 2GPYA 5DTQA 3WGTA 5ICEA 1RYZA 3PLNA 4RY9A 2FWNA 3ZYCA 1XVIA 1TF2A 2M1ZA 1LPNA 1RKBA 4Y1RA 2E87A 1Z2PX 4HDOB 4HTFB 1E3WA 2QLNA 2O5CA 5BOSB 2M98A 3ECCA 3I8OA 3JZMA 1XT6A 2AQ8A 3GFBA 2HK9A 4MVJA 4OO3A 4RS4A 4Q9LA 4ZV9A 3TM4A 3TVYA 1JB9A 4Q9DA 3IP3A 2I6XA 1B15A 2X13A 3G7SA 3NFYA 2X3YA 4D7AA 1Y81A 4UM8B 1GV0A 2Q0SA 2IYYA 1U0BB 3WK8A 4R8KA 5JLAA 3HG7A 4TRNA 3W6OA 5K4HA 4J2OA 5A5VA 3CRRA 3EGIA 3P8ZA 4R3WA 7REQA 5AVQA 1BZYA 1Z5NA 3P2YA 1TW2A 3VR6H 1PUJA 3Q2OA 4EG4A 1AKUA 4IW3B 5LQKA 3ZHTA 2WZCA 2MYNA 2XHEA 5LXTB 2YWJA 2VS1A 5CX1A 4BEWA 1KOJA 5BMOA 3CUWA 3E0XA 3F49S 1RI4A 2N0SA 3EVTA 3G2NA 4OV6B 4ZVSA 4WEOA 1CE8A 1QPBA 3MSXA 2ZBPA 1XJ5A 5D87A 2L2QA 2ZWIA 3MCAA 3U4GA 2GCNA 5KYTA 4OXQA 2K4MA 4DUYB 1LNSA 2J5KA 2V5VA 4FX2A 2HPHA 1PD1A 4LTDA 1T24A 3FTFA 2IZ6A 3QEOA 1PI3A 4OHCA 4C07A 5JZOA 1K5PA 1IZ9A 1S2LA 2IW3A 3CTMA 4DW8A 1A9XB 5IMBA 3O91A 4C6HA 1WZ2A 2GX6A 4LVUA 4OXXA 4I1OA 4XEUA 3BTVA 4HUQA 5CGZA 2C4HA 3B9BA 5FBLB 4EF4A 1GXSA 4GXTA 3IJEB 1SG0A 2H17A 3S8EA 1M2VA 1PX0A 1T6YA 1VDMA 2ERYA 2XX3A 1FRNA 2O1XA 3D5QA 2EDCA 4M9UA 4EENA 4U5XA 2WSSA 3ZR4B 2VC2B 3M4ZA 4BNLA 1XZFA 3KYCB 3E9NA 4R83A 5ICFA 1P81A 1QP0A 3UUEA 4M9QA 2B1GA 5F2OA 1RPZA 5HQ3B 1HC7A 4GOKA 5HCNA 2A1UA 4G8DA 4IFIA 2QI9F 1PEYA 4M36A 4US2R 3WB2A 4ZTBA 1U7UA 1FFAA 2G4LA 5ALKA 1N6LA 5EGNA 1ZKDA 1GL7A 1ZN7A 4B6PA 1AHHA 2R68A 4B4UA 2C2HA 3NTVA 1MXHA 3GJ4A 2O2IA 5CNIA 4N4AA 3ZU5A 4CYMA 2NW6A 4HPXB 4AIIA 1FQOA 2GRAA 3G1UA 2IODA 4F8JA 2PL5A 5BN5A 3VZCA 4OA5A 4PC3A 1AHIA 4YCAA 4KXQA 2QX8A 2I4OA 1AKEA 3VYUB 5BPFA 1WTCA 3N6RA 1HYBA 4YN3A 3SHTA 3UMGA 3LBYA 2XLCA 2JGKA 2ONCA 2QVBA 2JLBA 2R1TA 2O3UA 3QXXA 4MS4B 1DADA 3SY8A 1XOIA 4ZDKA 1R15A 4GC9A 4I4NA 1Z4LA 3H9UA 4R0VA 1RI5A 5A04A 1FRZA 4FS8A 1HTBA 1MO2A 2WVAA 4ADSG 5EUQB 2N46A 1IN8A 3TMAA 2F2TA 3OCVA 8OHMA 1JKMA 2XDAA 3U1VA 2VQEB 1W19A 4EVSA 1A9PA 4PGAA 4WH0A 4BVKA 5LYYA 2OCDA 5LKAA 3ONFA 3HABA 3TLKA 3RADC 3B89A 3ANXA 3C3DA 2GF9A 3VDRA 3VNAA 3I58A 2NZJA 2GHIA 3NONA 2VK4A 3H1BA 3SGLA 3TQOA 2DHRA 4NMHA 1L4MA 3EBLA 4XX0A 1E4OA 1SKBA 1U1IA 3GOQA 3I9KA 2JA1A 4OKIA 1T0JB 5FWXA 4NNPA 5ALRA 1K66A 4PR0A 5DMXA 2FH5B 1CR0A 3HJAA 4HYQA 3NOOA 3Q40A 1FSGA 1FMTA 2D5IA 4B7AA 2OGSA 4FEEA 3VPSA 6NULA 3BXOA 4HMPA 4MICA 4V0QA 2WIJA 3U7GA 1QYVA 4LY0A 4G1CA 2WF6A 1KMQA 5J4YA 1PWXA 1O6GA 1XZAA 3PFCA 4IP0A 1I1QB 4MGYR 1UBFA 3N28A 1XTZA 1SG9A 4NU0A 3BK7A 1P7CA 3OEED 4L75A 5DM70 4BZQA 5D5HA 1TT7A 2OFXA 1E1RD 1V47A 2Y1LA 4L74A 1YKSA 2VJAA 4FYIA 2Y0PA 4LJYA 4MMZB 4YLEA 3GFQA 5JMTA 5LMZA 4GHWA 4LMBA 1RW4A 4LF6B 2XB9A 1FTWA 2Q4RA 4M83A 2HX1A 2Y1WA 1TKRA 4CQMB 1FX0A 2BELA 5B3KA 3U6KA 3FRIA 4AMVA 4QQFA 4F92B 1B8UA 3HP7A 3F6PA 4OQNA 1X80B 1I3MA 1YCFA 1YB4A 5E6UB 5A0VA 3K8OE 1JA9A 2OOSA 5JWHA 2N1MA 1FQWA 2QMOA 2I87A 2XXBA 3IESA 4P0TA 2FRDA 5CM2Z 4B17A 1ID8A 2VT7A 2XKJE 2WWIA 3C43A 4GLOA 3K96A 4IUDS 5IAKA 4EELA 4LYJA 5JWOA 4X62B 2DUWA 2JFGA 3B1FA 1DHTA 3CF6R 3KHKA 2XUJA 5G0WA 4BAUA 3AFIA 3GLFA 1ZOLA 2KHZA 2QWXA 3BMOB 3ZVLA 2WD7B 4GOJA 3DLHA 3B6ZA 2JGEA 2JLUA 4CUJA 3IT3A 3HACA 1G9TA 2DULA 3RDPA 1FNSA 2XW6A 3A4LA 3G5MA 2HNBA 1Z63A 3QPDA 1VA5A 1KF0A 3RSLA 1QV9A 2IPXA 1V1MB 1CW2B 3FAZA 5IH7A 3CLUC 3TLYA 2NXCA 2I3GA 1F6BA 2E37A 2OR3A 2WAYA 2HU8A 3ZX4A 1VG1A 2JASA 2YV5A 4ZCTA 5G4KB 2LW7A 1ULZA 4DV4B 1GZ5A 1RQRA 2MU1A 1TT5B 3HE3A 1XK7A 1YS1X 3ONDA 1TVMA 1CR2A 1SVOA 2QN9A 3EVEA 3RKRA 5A2QA 1PR0A 3UV7A 3D7LA 4MRSA 5TLSA 3G0CA 3SICE 4HOYA 1RQ7A 1MR3F 1FUKA 3I9V6 2ICAA 4G0VA 1V39A 5AHWA 4HLCA 1II8B 2J6BA 4KMMA 1GPLA 3UAWA 3Q7RA 1LBSA 4X1IB 3B8HA 3AL2A 5HBRA 2H52A 3REFA 1W88B 5D8DA 2W6PA 4GKVA 4BZXA 4KQXA 1M54A 1KEWA 4D9GA 1RYNA 3A1DA 2PQ6A 4FGLA 1UMKA 2B83A 3UN1A 4FD3A 1L5RA 5KNBA 4G25A 4GXNA 4RGYA 3W2IA 3F1KA 3PQ8A 2QGZA 1YB7A 4FNAA 4GDMA 5LZ9A 1FQKA 2W37A 3VC3A 1V6SA 3ZIUA 4LK3A 3QSGA 3ZVRA 2J9ZB 3ZUPA 2JHAA 4JL6A 1JEOA 5IWCA 1R4NB 2FPPA 3LYAA 2UZ4A 4DV2B 3ZCPA 1Q3HA 3E6AA 3ET5A 4CMAA 1JALA 3NEPX 4BEJA 1SXJE 4ZI7A 1RCFA 4TS4A 4JNKA 3E9QA 2J4DA 1Q1BA 3D7NA 4CQLB 1OXSC 4JVMA 4D26A 3D3JA 3PHJA 2GZRA 1L7VC 4IQ0A 5J4KA 4FYPA 1E2JA 5K8IA 1W85B 2GYWA 4NFHA 3ES9A 5CW1A 4FKBA 5IG2A 5JQWA 3UK6A 4K86A 1QGOA 3GP3A 5FUWA 3T7IA 3CLTC 4BKPA 4B71A 4BTLA 1ZM7A 5CYGA 1WPGA 1U7DA 3JD3A 1XMVA 3MTEA 4XASA 3VPAA 4DXAA 1G59A 4PZCA 3ZWAA 4FR2A 5DP1A 2ZUEA 8ABPA 2QMHA 2QM8A 2HJHA 1CETA 3LCMA 1M8JA 2YYZA 1NW8A 4JLPA 1J2YA 2IP1A 4HDAA 4UUBA 4Z1MA 1AB6A 3CCCA 3KEOA 1I0ZA 1U3FA 1V9LA 3INYA 3ND9A 2XDYA 3BL6A 1O95D 3SQMA 1MIHA 4BVFA 4UVHA 4IGEA 1G21A 2JIBA 3CX6A 4PZZA 4LGYA 2J30A 1PFGA 4EHHA 1B93A 1ATZA 4ZXFA 3RW9A 4IUYA 3FDIA 1B14A 5JECA 2FDRA 2YN4A 4TTTS 4N0DA 4D42A 3H6GA 4XGNA 3B7GA 3NJ8A 9LDTA 3ZWNA 1GGFA 4B79A 1RYEA 2B2CA 3KJNA 5TPZD 5I8WA 1W46A 2ZB7A 4MEJA 1ZVVA 2QE7A 3OE1A 4G3XA 2RJ3A 4IKOA 4RPKA 2IQ5A 3PF8A 2DOKA 3ROQA 2GWHA 4F4IA 4XWKA 2NADA 2IS1A 4WNAA 3SNKA 2JI4A 1P1RA 1EESA 1P1IA 5LQDA 1E0DA 4BQNA 1E1NA 4KX5A 5EMKA 3ZU4A 3MSCA 4L16A 1Z2EA 2D5AA 3G9ZA 4TMTA 3RTBA 5JC8A 1VE1A 5FEUA 3NIFB 3LTNC 1RHMA 4BO9A 5ARBA 1VE3A 2BLNA 5B1YA 3NYQA 4UBNA 4PCUA 5IJ0A 1AUVA 2QT1A 4JUCA 3CVXA 2KW5A 2BHLA 1SXHA 3GHHA 4ND1A 5GONF 5FPSA 3RG2A 4DVJA 3C4QA 1WTAA 4COKA 4D9BA 1WZIA 5TMEA 1WDKA 1KA9H 4IH4A 3ZLJA 2R8PA 1A0OA 3RS7A 3DT6A 3N07A 3Q3VA 5BRAA 1GM5A 3STYA 5H3LA 1GSOA 1HT1E 3W5JA 2LCQA 4UM5A 1DUIA 2X0IA 1E98A 4UKDA 4P4TA 5E9JA 1CEYA 3VBCA 2OZPA 5KQGA 2BEVA 4RGBA 4JUAA 3STTA 2XUZA 2ID7A 3ZKWB 3K09C 1JF8A 4FW9A 4GMFA 3SJBA 2XQKA 3QQ5A 4XPZA 4Z3DA 4DIDA 1Z5GA 4TRRA 3NBMA 1VCNA 2R1TB 4OBWA 3RK0A 1AMNA 2R00A 5IMSA 1N0UA 3NXSA 2XZTA 1UXKA 2ECOA 3BUSA 4IIEA 4WZ6A 4GWGA 4P7GA 5EP2A 2BTEA 4Z9YA 1JU3A 1KYIA 3DWIA 1OFUX 1QH8B 1Z4OA 4EZIA 1I10A 1DPGA 2DCMA 2VHJA 3OFKA 1RQPA 1EFLA 1XCGB 4LYHA 5E6SB 2R4UA 5BSRA 3W8NA 3WL8A 1XWIA 2G07A 1XMQB 5KYUB 2C5SA 2XA2A 4MWTA 3K6SA 2EW8A 3IUQA 3LG2A 4QBHA 1JFFB 2RHDA 1QC5B 3AYZB 3GT7A 1HQYE 4MTCA 4XAQA 1CQIA 3EXAA 4KGXA 2NXWA 1YB2A 3T3DA 3E22A 1CUAA 1Z47A 2UYYA 2ZTLA 3NRBA 3C7AA 3Q3GE 1REQB 4B3TB 2HA4A 2WWRA 1ZDMA 2OY0A 1AK2A 2QM3A 2WSLA 2Y0DA 4XIFA 5AKHA 5JIBA 1OLXB 1KK3A 3O8QA 4KP7A 2IX3A 2HDHA 4A0QA 4E6PA 3AIKA 3ZJTA 1GSHA 4S24A 2C0QA 1DIGA 4ZV4A 1OKKA 3WYEA 2Y99A 4XRRA 1KBQA 1QH1A 1FYEA 1ORHA 3PD0A 2FA9A 3LK7A 4BMCA 1IXZA 1SCQA 2ZIXB 4DV5B 4Q1AA 3D6JA 1M76A 3GLGB 2VH5R 5JQGA 4J9VA 1FPQA 4RIGA 5BNWA 4BYGA 5BMVA 2VK1A 3VZPA 5IVKA 1Z28A 4EJSC 3VV3A 5FTKA 1GPH1 4EL0A 1C1DA 1YIDA 1QS0A 3ITNA 1IY9A 2NTYC 1S89A 5JCJD 3QE4A 5HWSA 1AURA 2BM8A 4DDVA 4LCJA 4NAVA 5LWHA 1THZA 1P0MA 3NKLA 2WSMA 3TR5A 3FOWA 3PJEA 5KO2A 2CXHA 3DMYA 2VH1A 2VUUA 3V6MA 1M72A 5DBHX 1E9BA 1MX9A 4R9NA 3WLHA 3DKIA 2QAGA 4FCWA 1USVA 4O33A 2R79A 5G1NA 3V1TC 1IL0A 1MZPA 4P3YA 4D5GA 3M1IA 3FPLA 3UG7A 2LXNA 3TPCA 1P6XA 2YHSA 1IHDA 1PFQA 4FQ5A 3PP8A 4OQQA 4HB4A 2AQKA 5EJ8A 1GPYA 1YUNA 1J8FA 1VSTA 1CLEA 1NOJA 4URUR 4NABA 4C05A 1VC2A 4ZI7F 2ZBFA 3H18A 2Z0MA 4PZ0A 1A9YA 2OA0A 3RYTC 1KMCA 3K0AA 4JT9A 4LZWA 4R9SA 2GBLC 4EJSB 3DXZA 3ADCA 1YC2A 1K7YA 5KWJA 3ZVNA 1F0KA 1R8XA 3CY6A 4G86A 4J0QA 4LOKA 4PLYA 5LNK6 1PFWA 3KR1A 2CEAA 1MW9X 3PE6A 4KFTA 4LRQA 4P4NA 2PZAA 2AG6A 2ZS9A 4PINA 1NYRA 4WFKA 2Z8YA 4B73A 5DBGA 5BXQC 3IEVA 3B3JA 3RYCB 1O03A 3AR7A 1UBKS 3U7RA 4OQFA 3S4YA 4AZWA 5FO1A 4RSMA 1JTVA 4TL6A 4TTQA 5EG5A 3UFBA 1QTQA 2FPMA 1BHJA 3IS3A 1P6UA 1ZRNA 4O0LA 2BLLA 4QEKA 1WP9A 4R1UA 4ZQEA 5AW5A 1M6WA 2KQUA 1WVIA 4EITA 4LJ4A 5FA6A 4R84A 2I6TA 3GBVA 3PKIA 2Z8XA 1FU4A 3I32A 4HS9A 5ECYA 5B58C 2X3UA 1UQRA 2W2NA 4AG3A 2OC9A 4I9GA 3T95A 5HVNA 1NW5A 3K9NA 4MVWA 4PLWA 3EJWA 3E82A 3ZVMA 1K8YB 1LRJA 4EDHA 3BB4A 3HY6A 3ENZA 1VQ1A 5K3SA 5HX7A 3QVMA 4NQRA 4WJLA 2B1IA 1ZONA 1NXWA 1T9BA 4DQXA 4UHJA 1E2LA 1P1BA 2P0AA 2OZVA 4WNYA 3SC3A 4GKAA 2EP7A 5LXTF 4CQMA 3UJNA 1L7OA 4KHZA 4F93B 2PSJA 4PVDA 3ZWCA 3RABA 1P4SA 4RYDA 2UDPA 4I8XA 5TB5A 1SU8A 1YH3A 4BNIA 3IVXA 1MVOA 3DZJA 3OCCA 2P9BA 3R3ZA 3TZHA 1IWOA 2NV2B 3MM4A 3ZU2A 4ZEMA 2DBRA 3EPPA 3OEWA 4OJQA 4OLHA 1DGQA 3RVNA 2A0FA 3ZLBA 5F7OA 1F0YA 1RYDA 3R3VA 2GN9A 1MA3A 2W6MA 2BEUB 4DM7A 2QN6A 5K0CA 3UMCA 3RUIA 1T4BA 1WSWA 2PLRA 4DQUA 3I39X 4HF7A 3ZW9A 2HWUA 2K2WA 4D6YA 2W6IA 2G4CA 5B7GA 1J0CA 1J25A 3EIHA 3S0JA 1QVAA 2A9RA 3PC8C 4UQOA 1ZO8A 1BOFA 1GGHA 2J0QA 3FHOA 1MMFB 2X6TA 5LQCA 4B9AA 1E79D 5JANA 3R0ZA 3NASA 2M6RA 1LQUA 2WWVD 1SKYE 3V5NA 4G36A 1RFGE 1CF4A 3UMJA 4B81A 5C52B 3SFVA 1C2YA 3GD5A 4UU0A 1U5CA 3G5AA 3HDGA 3MC1A 1VPWA 1FDIA 1KO7A 1O7JA 3VNRA 1C7ZA 3U3OA 4UXIA 2YY6A 4AIRA 4JYMA 4XRGA 1QP8A 4A6DA 5JSZB 1VLJA 2VAWA 3VR2D 4O3MA 3UFXA 4F2PA 2UYHA 1XLWA 1WSDA 4EABA 1ND5A 4A6XA 3I9OA 2KPOA 4PX3A 3IAUA 5KZMB 3SXJA 13PKA 1YMQA 1ZW6A 2BI4A 1PNRA 5IJZA 2J87A 2W2QA 2MSWA 2I66A 3PEVA 2RH5A 4NYMQ 2ASVA 2ZI7A 4JEMA 4LUCA 3ZJUA 4BV2A 2QHXA 2WF7A 2FPSA 3G6KA 3I01M 4JIGA 4Y98A 2GPTA 5HYVA 1RC1A 2HJWA 5BR1A 3EZGA 4CF6A 4L9SA 1NJ8A 3BCRA 2V8OA 1ZRMA 2JHCA 1V1RB 2A5YB 2Y9PB 3ASVA 3CGGA 3PS9A 4GXQA 2HHJA 1CSEE 4JVSB 1Y1SA 1FQJA 1IHUA 1KMHA 2BFAA 1OB2A 5JJLA 2EV9A 1OZ0A 3SZOA 3IVCA 2XEXA 1PT6A 1XRRA 3DAHA 3JD0A 3PEFA 3PR2B 4RAQA 3ZXSA 2Z6UA 2OXRA 5CA0F 3KJQA 3GGOA 3A6GA 2AKAB 3MCUA 1U6IA 2EF1A 5P21A 3RUCA 1HNXB 2I22A 1YIAA 5JO9A 4RKEA 3LUCA 4JAVC 4OP2A 5CXUA 4LYAA 3FHJA 1Q12A 4G0QA 3UWPA 3IA7A 1SD2A 2VA9A 1BDHA 2X4LA 2MDTA 1X1BA 3GFPA 5CFMA 3DD5A 1P7WA 3R3HA 3I73A 4P4SA 2HA2A 1TD9A 4IYRA 1B0UA 2JVIA 2PK3A 2JLZA 3KJGA 3LW8A 4OJMX 3MJRA 4P1ZA 5DYNA 3V8PA 3OUUA 5C1OA 1XXHE 1P5JA 1JMVA 3FCXA 3GUUA 4UHHA 2ZTHA 5KHLB 3PX7A 1JHZA 2CWWA 3L93A 4WV3A 4IRMA 1DUSA 4JEIA 4F5YA 3GA7A 3VKVA 4YQYA 4F72A 3DHVA 4FGKA 4CG3A 2FR8C 3STXA 1EBFA 2V7UA 3EMDA 1HG1A 2NYRA 1QC5A 1I80A 3RPEA 4AJPA 1YF3A 5L9AA 4M6WA 2EIHA 1UJNA 2OBFA 5EJ5A 2DR2A 3K9FC 1X9IA 2GN4A 3CNHA 3UJPA 2X6RA 1NZJA 3TSCA 4P6VF 3V4OA 3Q87B 4O4HF 3TF5A 4DT1A 4C21A 4YX9A 1W7AA 3W1VA 3ONEA 5EXXA 4LBZA 2EJTA 4Q7EA 3DOIA 2FMUA 4M3NA 4WNAB 1ORRA 5G1OA 1A4IA 2ZAGA 4PRLA 4E5YA 3NMUF 4Z4IA 1GPDG 2DU8A 4G85A 2QS9A 3DDUA 4L95C 5EI5A 1U8AA 2A33A 3T41A 4DQ0A 4EW2A 1KI7A 1US8A 5FPHA 2VP5A 2ZRCA 3IV9A 5E4FA 2Q7DA 3ZDEA 1KZHA 2BYTA 3NDRA 1RWNA 4MUNA 1GARA 1GT91 3U4QB 3IFSA 2ZRKA 3EY4A 1SCUB 3VSBA 2P8SA 4YA6A 4H1WA 5J58A 1OUMA 5K6AA 2JH8A 2XOKD 3BQ9A 4PFSA 4R0NA 1FTNA 2QN3A 4ZYYA 3W7BA 1V5EA 1NVKA 1Z37A 3CZAA 3HV0A 2FSPA 4EECA 4GNRA 1L7QA 2IYUA 3QZUA 4BUCA 1MNAA 1L8XA 3DO6A 1IY1A 1BH2A 3CR3C 3RGGA 3UJ7A 4C5AA 3HI6A 4IICA 3V7YA 1ENOA 1JLLB 1CNFA 1KI8A 1MQ9A 4B9EA 1FFXA 1VE9A 1E1CA 2OO5A 1DBSA 1J33A 3IAHA 3UT5B 3QLVA 1GTMA 1EVKA 1JR3E 4FGWA 3THYB 3LX5A 2QRQA 2ZUBA 2C88A 3NHKA 4RK6A 1ZD1A 4ZMRA 2A3NA 4R6XA 3ZY5A 1VPTA 1XZDA 5LQMA 1CEEA 1SM4A 3EIEA 3Q6IA 4B3XA 3B5JA 3CWCA 1RJWA 2RBEA 1CUEA 2AG1A 1KYXA 3BXHA 4YECA 1P8JA 5CJJA 4MA4A 3EPLA 1PUXA 2GETA 3MBOA 3QXJA 1Z29A 4IDNA 5KYGA 3UT0A 3GGJA 1XHFA 1WVGA 5A62A 2EERA 4OXIA 5E38A 5HFAA 3ASUA 4YRGA 3LHDA 3F74A 3AERB 1QVVA 4P4GA 3IEMA 1G3QA 5G1PA 5I9MA 2B1JA 2PAFA 5AUOB 2JD1A 1K89A 3B2EA 4ARSA 3K0CC 2EATA 4J2TA 4X1KB 3ORRA 1G5FA 3CVVA 2X8WA 3WMXA 3G2PA 2PS1A 4MAFA 4H7KA 4D80A 2Y1FA 3A8TA 1H0RA 1ZC4A 1Q44A 2EQ5A 2NZYA 4JZYA 1RRFA 5C1IA 4MMYB 5DGCA 4PCVA 5DKFA 1OPRA 1QDEA 1R6UA 2ZSHA 2CLFB 3QRWA 3ELUA 3U09A 4KVAA 3WTCA 2DRIA 2B4AA 4Z2AA 2IYLD 3A6EA 1MH1A 2HTEA 3C16C 4R01A 1JVBA 1SURA 2OL4A 3ELWA 3IPYA 5ALOA 3TLCA 4E5PA 3S40A 1NVBA 1VKZA 1ZH0A 4LFCB 1PG5A 2R9VA 3IT0A 1LK7A 2X0DA 4AJLA 4BE4A 5KVSA 4YAFA 3VR4A 1N2XA 2ZCJA 3KLOA 1E18A 2C83A 4XM2A 3NCTA 2VYCA 1ISGA 5KYYB 2ZUDA 2OCAA 4I3GA 1NTRA 5D6OA 1AVTA 3NO4A 3OKFA 4PO9A 1F4PA 2MOKA 1BU8A 1FNBA 2BGKA 3ORSA 4B33A 2ZSBA 2IHYA 1ZUWA 1A72A 1PFVA 3FPHA 4IDGA 4XVRA 5ECDA 1D9ZA 3W1WA 3WV4A 5L3RA 1MTZA 4D74A 2JIQA 3KKNA 4ZZIA 3ZNQA 1QIFA 1TE2A 1G6Q1 2MYUA 3GAMA 4G0UA 4OEHA 3OWOA 1SKUA 2FZWA 4HGQA 5GTDA 2V4MA 3FMIA 1S4QA 2WSBA 4R7ZA 1BX0A 1U0LA 4TKUB 3A1WA 3WQHA 3MJFA 1Q83A 1SZJG 4JBIA 4O4HA 5BQPA 2WWYA 2HMWA 3MJHA 4QRHA 3T5CA 2BEUA 3IHKA 5I7HA 3R9XB 2O3RA 3OM8A 1B6SA 4N7BA 1CQWA 4ENRA 5GJBA 3R24A 4AP6A 4U39A 2CE7A 4B8WA 3R3WA 1T9ZA 3DNMA 4W5JA 3KEQA 1Z73A 3M1LA 2HOQA 1GG5A 1OZHA 3FI9A 4WKCA 3I4CA 3RWOA 1QG2A 4Z4QA 1QGDA 1L9KA 2QTHA 2YZMA 4BLQA 1YRLA 5JCPA 3WLIA 4CVNA 4JLWA 4XLTA 4M0EA 1LH0A 1LPPA 2YFQA 3V55A 5DGXA 1ZM9A 3GYGA 1GHTA 2AI2A 2HF9A 3I42A 3LT5A 1KO4A 4BFXA 2C9YA 3OMLA 5B7PA 1Z7EA 4ICIA 2GPAA 3MMNA 4EG5A 4RSGA 3TNLA 2YY7A 3W9UA 4H08A 1C7QA 3QYAA 4PAOA 1ZVQA 4W7IA 1YZGA 4KYVA 2GM4A 2P27A 3I0NA 3DAPA 4BGVA 3WNQA 3PUXA 2O5RA 4QDTA 3A0UA 3SFTA 2VCYA 4EFNA 2ISSD 2AXEA 1NXTA 4IVPA 3GWZA 4LV6A 5AW9A 5H81A 3ZHUA 4RX1A 4GT1A 1F1JA 4TT3A 3RRJA 2HT6A 2CVHA 3BGIA 1HGXA 5AW8A 2AEFA 3BMCA 3PG5A 3U7IA 4IMIB 2GM9A 4I6JA 3T9DA 1ARZA 1G6HA 3CF4G 5CLGA 2IV7A 1QIKA 2DBQA 4U7WA 1GQSA 3IO5A 3RAPR 1U8EA 2CZQA 5FF9A 4E70A 1CY1A 1DXOA 1GQOA 1DAPA 4TM7A 2WFMA 1TMOA 1IWPB 1A8QA 3H8SA 1NQAO 4O5OA 4EF5A 3F2IA 3I92A 2HNAA 4XWYA 5EHIA 4ZCMA 4MEBA 3MT8A 2EKZA 4YRFA 3RSCA 1SA0B 4EY6A 5AVTA 5EJ7A 3AK4A 1PYDA 4L85A 5P8WA 2PD3A 2Q1XA 3ABRB 2XWSA 3MOSA 4LDAA 2WILA 3F67A 4RSRA 1OCEA 2GBFA 3K16A 3E3LA 3VU3A 1IY8A 4FMPA 1NYQA 1CJSA 3H1FA 3SDZA 4DMRA 4OP1A 1H94A 5KWEA 1C30B 1S2GA 4F45A 4UUQA 2IYEA 4KMRA 1LUAA 2VTKA 4M1OA 3P4YA 4ZO6A 2QX4A 3QPUA 3THOA 2BUCA 3IBTA 4A6EA 4N0EA 1T2UA 8LDHA 3DBLB 1XXHA 1BD3A 3NHWA 4O4LF 2Z4RA 1HDYA 2Y2VA 1XDDA 4ZT2A 1KXZA 3QU9A 1APBA 3REQA 3A1NA 3NUGA 4EYKA 5JJIA 1RWXA 3AUKA 1E59A 1RKQA 5EJIA 4MX8A 3TQFA 5HS4A 2ZANA 3CS3A 4UEQA 5KYUA 3V48A 4RM2A 2XBLA 2JJ1D 1UFVA 2QUKA 3GQBB 2DFPA 2I2AA 2VPTA 5TS2A 2Q5LA 5DCUA 5HKKD 1NKSA 3ABZA 2ILVA 5AW7A 5CHEA 2GEUA 3DVAB 1OXTA 4DR2B 4A36A 1CHNA 4PQFA 3JATB 1XV5A 2AFIB 4BO1A 3CTPA 2R5FA 4D6XA 3EGVA 3GRFA 4WCDA 4ARUA 5DF1A 2GNAA 1P1HA 3VTKA 2X5XA 2C61A 4GS5A 3RNOA 3GUYA 4C7JA 4P7JA 4UNRA 1UWKA 1A27A 1KMNA 2H00A 1IONA 1J2RA 1CVIA 4HNAA 3R7LA 3DMRA 2VJMB 1GUFA 1KYYA 3WG9A 4QQKA 4RESA 1U1FA 3MT9A 3WYBA 1C3LA 3FB4A 3L7LA 5EJMA 3OO1A 1UDRA 1KY5A 5D3ZA 3ETHA 1QBGA 4PAMA 1B8PA 3LUAA 3BE5A 3FPJA 3U39A 1E5VA 4BU0A 3PCRB 2YV2A 5HXAA 5JSQA 4BNGA 2HV9A 3KD2A 4AJOA 1EWQA 2R8ZA 1CUVA 1E58A 3AEKB 4GG1A 3RT1A 1X2EA 3UEOA 1ZR2A 3PA6A 4EGJA 3WA6A 1J23A 3FSEA 5LA6A 4M1ZA 1Z2CA 3KQMA 4D0GA 2BTOA 3WOHA 2C98A 2GS9A 3DMFA 3RSFA 5SZHB 4YWJA 3PXDA 1ZHOA 5DX0A 2NT3A 3A9SA 4LIPD 1T5IA 1PNQA 1V3UA 1T3ZA 2WF9A 3DUFB 4UM9D 3H13A 1HA3A 3BILA 3VU9B 3GELA 4GI1A 3X2FA 3ADDA 2BJWA 5HQJA 2QA5A 1QCZA 2VOJA 2AMFA 3VH2A 2O8FB 2OCPA 1M0TA 1PYOA 4Y6QA 2Z9DA 1OHHA 5ED4A 2RBGA 2AE1A 4K5QA 1K06A 4RCYA 4Q9AA 2IQIA 3LUDA 1BROA 1N6HA 2JFVA 3L6CA 4IMPA 4LG1A 2CYAA 2TECE 4K6HA 3ZTYA 2Y9MB 1UDAA 3P5BA 2XYGA 1L7BA 3WLPA 5JPCA 5AOBA 1LB1B 3WAKA 3D59A 4X65B 4N3CA 1NBME 1ZOOA 3F1LA 3PFNA 4FFBB 5BVGB 2W22A 4F56A 1DDGA 2EZTA 2FW1A 3OJOA 5G53C 1M2JA 4EAQA 1NNI1 2NVBA 5BURA 3KYDA 5CX1B 5ALZA 1Q2UA 4I6GA 1XKLA 1FZTA 4FFLA 1Y1LA 5CURA 5TJHA 2ONKA 3IULA 4Y9SA 3T7KA 2JGDA 2NAPA 1PL7A 1I7SB 3DLTA 4EY7A 2XMBA 1PGPA 1ZIDA 2R6AA 4MAMA 4TKLA 3BA6A 4LJSA 4HH1A 2H11A 1XYVA 3DL0A 5K0LA 4D96A 4EW6A 1E0KA 5HJEA 2ZJ7A 3KCQA 2LNDA 3AF0A 3HB5X 3W04A 4GPTA 3MTJA 1EDZA 4BO2A 2C2YA 1RBZA 2ZUWA 3T61A 3BXGA 5GIOE 1KJ8A 1UM9B 5KTOA 3BH0A 4BOYA 1DBPA 1TK9A 1JNXX 1N1EA 1L5HB 2J41A 4KN8A 3KLNA 4NAHA 5ALGA 1Q0RA 4ABYA 5L45A 2FE1A 5ELLA 2H1HA 2VBIA 4EKNB 1FZQA 5KVVA 3HMQA 1LDMA 2B3DA 1I6LA 1JI3A 3DS8A 1DC6A 4MIKA 4N9QA 1DCMA 5DNYB 2FPXA 1DP4A 2HWWA 4XGKA 4QU9A 5F7XA 3P96A 4K6OA 3B9RA 2C29D 1B3RA 2PMKA 1GITA 5ECWA 4BS9A 5JS1A 1UWVA 3DONA 4HLDA 2CFRA 3AIMA 1LTHR 4RQUA 3TGWA 4CF3A 1JKJA 1M5UA 2OO7A 1JR3A 2O7VA 3QPAA 2I3AA 1SEVA 4Y67A 1GQYA 1AE1A 3WP0A 4XB2A 4LS3A 4X45A 3SS7X 4NOJA 1QCDA 1CUYA 5JARA 2CL0X 3ON5A 4C0KA 3R9XA 4PFQA 3KALA 1A50B 2FCRA 2JLWA 3S70A 5BOVA 4ENUA 3NYWA 3U17A 6REQA 2ZWMA 4I66A 1KEEA 2YNMC 3FTEA 5JRDS 2GKSA 4BV3A 3DQQA 1TAHA 4KIWA 1Q0LA 2NNWB 4C88A 4M9CA 1M7HA 4O29A 2YR0A 5DT9A 4PX5A 2NO0A 1Z9BA 4G1UC 2CJFA 2NTNA 1C8KA 1WCIA 2CFIA 2H4FA 2GT1A 3MB8A 3NIDB 1PR9A 1L5GB 3WXMA 5B2EA 3V8VA 3QLVC 4JKIA 2Q6TA 2P2LA 3B3FA 4OBXA 5AT1A 3S1AA 1X86B 3RWMB 4YCMA 4U3JB 1E2UA 5FPYA 2WWTA 4ENQA 1N34B 4L4XA 2HYIC 1Z4KA 1U9IC 2XMZA 5AOCA 1QIDA 1CF2O 1S2NA 4JH0A 4AJHA 2R25B 3P9QA 5HSGA 2IS6A 3WL4A 3MIIA 4EFKA 3AJEA 1BJKA 3OG9A 4PZUA 3WTBA 2QBYB 3PC7A 5FNZA 4D4JA 4OI1A 2ZETA 5LDGA 3UB4A 2CNWA 3VHQA 2HCTA 4CFSA 3GGDA 2PN1A 3IPLA 3I53A 4BP3A 2QN2A 2CV2A 2VRNA 1NA5A 4B6QA 2HY7A 4B3RB 4YGYA 3MLBA 1DC7A 2B5OA 1B0ZA 4N8EA 5JSYA 4KRFA 2GOYA 1T43A 3CWQA 1OBHA 3JQGA 1QXSA 2GK4A 1DKQA 4RJJA 4CCSA 1A1SA 1KR2A 1LBIA 4RTJA 4KR3A 3H1AA 3O75A 2COUA 5KC9A 1K0UA 3EF0A 4RETA 1DIBA 2GCOB 4G2TA 3UXYA 2FP3A 4DMLA 3ZGZA 2ZYHA 4NFLA 4RANA 5AWFC 1PGJA 1XQ6A 2ZULA 4E88A 4CEJA 3HFGA 4LYGA 4IDOA 2OUKA 4QGHA 4BPBA 1ZGGA 3UXMA 3RBXA 3MMSA 1H6DA 2I6SA 1DMSA 1TF7A 2W2OA 3VZSA 3QWFA 4WBNF 2V0CA 2HXGA 3T34A 3UHJA 1EXDA 3VSAA 8ADHA 4DSNA 1EHIA 3KR0A 4ZEVA 1TA4A 5CLJA 2GA8A 1O6BA 4H2DA 3JRXA 1I5EA 5J43A 2OE2A 3AOEC 3FX2A 1LCIA 3IELA 3H5NA 4JYPA 4YCSA 3G5UA 3PVCA 1QKJA 3OZUA 1E3LA 2D2EA 1AD2A 2NTJA 1MT3A 4KH1A 1PJ8A 1RRMA 4CDNA 2C96A 2YHIA 5FWYB 4E2FA 4WLVA 1L7AA 4Q4LA 1BKDR 5K2MA 4ZVLA 3WRXA 5JAZA 2PZBA 3OPQA 5B4TA 2IYTA 3FNFA 4BRZA 1UBNA 4E32A 5FI5A 3I64A 3ND6A 1T91A 4AQDA 4A4DA 3SP1A 5KOJB 4B3IA 1WVMA 1ZQ9A 4LJ8A 4LJAA 4DCGA 4DJFC 2VWQA 2GI4A 1CZHA 3K0SA 1JGTA 4J3JA 1DBRA 3BWXA 2CNLA 3MFQA 4G09A 4BP8A 2BC9A 4CEHB 1K97A 3HDYA 3RRFA 3EZLA 1L4FA 3NAGA 4Z7NB 1MB2A 2JIOA 3FYDA 4DEXA 4N12A 4B80A 2K7ZA 3CINA 1L7XA 1N6NA 2BF4A 4IIYA 4F0JA 5A2GA 1ANKA 1FYXA 1JR4A 5EHQA 3P9RA 2ZBGA 5FWNA 2PDAA 3K4QA 1ZN8A 1GILA 4LZJA 4G9EA 2H7VA 1T2DA 2OAP1 4U9HS 4Y9UA 4ZO8A 2YZKA 1NY6A 1XZJA 2A30A 3LI2A 3NJRA 4FVTA 4UUNA 3T06B 4DQLA 4NXMB 4UBMA 5BQFA 4PHGA 4RLHA 3TGPA 1QTRA 4JC8A 2NO5A 2W83A 1VXRA 4E12A 4Z51A 1GPMA 5BNIA 2OBLA 3A05A 2RK3A 2ZIFA 1M2VB 4YVFA 3R74A 2IW1A 5JAQA 1A04A 2X8AA 2RHMA 1H4QA 3NWEA 2OHIA 2QN1A 3EZNA 3HJFA 1W4ZA 2Y68A 3WRVA 1IG3A 3SC4A 1F8GA 5DNAA 2D8AA 3V4SA 1G9XA 4OKNA 4YT5A 2I1LA 5TPWA 4R3NA 1JIIA 3IUNA 3JD2A 1DUVG 2TMKA 3SHFA 2ZUFA 3E70C 3IIIA 7GPBA 4LWPA 5LBIA 3L8MA 3WK7A 1N2CB 3NGMA 1K3FA 5DLDA 3LCRA 3LT2A 5G40A 2PUVA 1SUCA 3WMRA 3WLTA 3CW9A 3D64A 3OPNA 1FVOA 1MOQA 4LAFA 2JIRA 1WAMA 1VCMA 3I3OA 4ETIA 3W90A 1EVIA 3VYVA 4AZ3A 4R1TA 1CRWG 2YXNA 3QVWA 3S8MA 1TIBA 4CMIB 1L4GA 1FY2A 3GC6A 3HSKA 3JCZA 4YQEA 1CS0B 4QTUB 4B2IA 4FOTA 3GPLA 3ORQA 5BWBA 5EN4A 1FRQA 3GUZA 3E7XA 1G0OA 3KJIA 1N7GA 5EWLB 4UTOA 1IH8A 4NICA 1L4UA 1Y6RA 5JXHA 3ZCVA 5KNCA 4GLJA 4MPDA 4ZEXA 2O8CB 3GJ5A 4BX0A 3NFRA 4GLFA 3REQB 3HYTA 2EGUA 2GEVA 3U56A 1G2PA 1AGNA 4NDAA 1YCDA 2AI3A 3LT4A 1T2CA 3R7AA 4ZZ1A 2PUTA 1CR6A 2Q99A 1GPAA 3A6LA 3KO8A 4QPDA 4ZT5A 3UB3A 1P7VA 2PPLA 3OY7A 2ZR0A 3H3FA 4FB4A 4TS1A 1Z0KA 1RJEA 3O2QB 1IRIA 2XHZA 3AT1A 1QAQA 3PHGA 1CDEA 2CFTA 4J1SA 3EXEA 1ESMA 4RVNA 1V4BA 2NOAA 1BRMA 2J09A 3AERA 5F2EA 4A5OA 2Q46A 5C1PA 4CIWA 1DT5A 2RONA 1PHPA 3QELA 4HWOA 2NWQA 4KDRA 4K9DA 4KI0A 4C30A 3GEIA 3LUPA 3QKRA 4DAOA 4U7PB 2E9SA 3L7YA 1KYTA 4G01B 4BLUA 1EBBA 1DFIA 5LMCA 1Y42X 4BFYA 4OQPA 1K2WA 3HWRA 2B61A 2F00A 3OQMA 3EFOB 3TIXB 1U0JA 3TRKA 4C89A 1RQGA 3OECA 1EKXA 2YIDA 3JZDA 1SUSA 5EEHA 4M7OA 2YNMA 3JAWB 2B6HA 4PCLA 2CNKA 1P5HA 1EINA 1P0FA 4HRAA 4KE6A 3AUJB 4A9AA 4B0PA 5BWOA 1IJKA 2PL9A 2BCGY 4HVAA 1CZOA 3WLKX 3UJBA 4CIYA 5EIBC 2YKGA 4IGAA 4AWAA 1SQ0A 4BO8A 1RCTE 3JVIA 2NPIA 3QMMA 3DHWC 1ZISA 2V6JA 2W6OA 3AHEA 2I76A 2J5XA 2VLIA 5IN5A 3ZDZB 4E03A 2AF3C 2CXXA 4Z1OA 2OHHA 2Q2WA 4KV9A 3WICA 1OB5A 1VL6A 1U8XX 4G4SP 4G1FA 3UA4A 4FCCA 4DDMA 4ZQHA 1NVGA 2XCLA 3HCFA 4NOKA 5JADA 1TNDA 3I04A 4L8WB 3VU9A 1U98A 3LCJA 4C6RA 2EZ9A 4R1OA 1PL8A 3DHYA 3Q0IA 1RLMA 4LX0A 3L5KA 2RK4A 2YV3A 1JDTA 5CU7A 5K01A 1NE7A 4YY3B 2G1KA 4PWYA 2ZWPA 3H97A 4RMIA 4JZKA 5CM9C 2QJWA 2V4ZA 3LF1A 5CH8A 5CXSA 3SZGA 3SIXA 5CFQA 1ODIA 1KEZA 3O47A 3PITA 2P79A 1R12A 4O4HB 1F17A 1GRNA 3GLRA 4P7BA 3TB6A 1B73A 5LZ2A 1FYDA 1TQHA 2I0FA 2IUSA 3BGDA 4H7FA 5FBQB 3RFTA 1V1JA 2YQZA 3QUAA 3E9MA 3FVWA 3FGNA 3Q3JB 1V11A 3DOFA 1R0BA 1T6ZA 3A31A 3IP9A 4EGSA 1ZL0A 1W1WA 3GPDG 4GQAA 4R8SA 2XUHA 1KMMA 2OYSA 1YR7A 2FSSA 3BRCA 3MTQA 4CEIB 1YQWA 3QF4B 5JNTA 4KXWA 2ZDHA 2ANBA 1XVVA 3B1JA 2RARA 3D1JA 4L3VA 3WYAA 3IQZA 2Z2JA 1XI2A 3NTQA 4OFXA 4QREA 4EB6A 5EQTA 5JYEA 3S1AB 4MYCA 4A26A 4PYQA 2HRZA 4KB5A 1W36C 2PQ0A 5F3DA 4GRIA 1F9EA 3VYSB 4WA8A 2B98A 5K4GA 2ADMA 5DTMA 1V8FA 2QGFA 2JCSA 3DKVA 1I7DA 1ISPA 1XTSA 3F90A 2IEAA 1JVNA 3UTDA 1JXMA 1PLJA 5LCXA 1O87A 1T9DA 3ZV3A 5J63A 2F9MA 5EP4A 1DAMA 4AO6A 3HM2A 3HXOA 3ADOA 1FBNA 2GRJA 4AJKA 1UZMA 3AHCA 3UVEA 4ZYWA 3D0OA 4Q1BA 2EFGA 5CTJA 1RQLA 2Z6QA 5A3VA 2R96A 3ANMA 2JCYA 1OTHA 4LNUA 3RVJA 1Y1TA 1DARA 2V98A 3O1LA 3CHYA 3L8YA 4RHUA 2F4NA 4BQFA 5B53A 4ZCIA 5JAIA 1PWEA 3ZJYA 2I1QA 3D4OA 2VDQB 1TCUA 2GAOA 2PU5A 2HQSA 2QL9A 1O5TA 1UK8A 1OLSB 1T4CB 1UMBA 1GAJA 2DECA 2IITA 4Q24A 3HDTA 3QI2A 3W2HA 4AJJA 1G8JA 1IUOA 2G63A 3AKDA 3PNSA 4ROSA 2GASA 5EPEA 3D6AA 4R1QA 3HKEB 3S68A 4NCXA 2PKQO 4S0ZA 3HP4A 4KJXA 4ZAZA 4AQ7A 2QPAA 3TDMA 4H7EA 3K9GA 4XYMA 3ZHCA 4C4YA 3HUEA 2CNNA 2BMJA 1YGYA 5G41A 4JNCA 3TXAA 4DWOA 4Z49A 4MPRA 2GLTA 2JFUA 5KX5F 3VPXA 1B6RA 1IZZA 4FOOA 2O3QA 5E7QA 2FWBA 3U7JA 2EF0A 3U7FB 1EFPB 4IIHA 4U0JA 4YRRA 3AR9A 4L9RA 3WBKA 4HMOA 4PWZA 1XEAA 2OXCA 3C8MA 3WISA 1U3CA 4GBMA 2Q27A 4PN3A 7ADHA 4FHZA 5AHKA 4TSKA 4UVGA 2JA2A 1QYXA 1TZKA 4M49A 2QRPA 3W8EA 4C04A 1AZTA 1W47A 3A36A 3VX3A 5D84A 4IEEA 3TD2A 3QX7A 5E8RA 2QRZA 3OFND 2G3YA 3AVQA 3HB9A 4D8WA 1NN1A 3D7MA 3K05A 3N0XA 4LOIA 3K5HA 1MEEA 5FADA 1U2ZA 3QBVA 1JEAA 4RGQA 4YRMA 4J3FA 3JYNA 3S6JA 2CL5A 4ZQFA 2GPNA 1SUIA 2EFCB 3GQBA 5BNZA 2ZKLA 3C1OA 4HEJA 2BMDA 2N9UA 2WHRA 1DFHA 1HORA 1ZKMA 3KDSE 4JS0A 1UKYA 3GGSA 4K9LA 2GD2A 5DM1A 2J85A 3R7DA 3DFMA 2PBFA 3ZYZA 3OT4A 4YXFA 1TUEA 2JF0A 5F12A 1FJGB 1P8AA 3FG9A 3CUSA 1DKOA 4RNDB 4BP9A 1L8OA 3KSUA 4GU5A 4DXDA 5AUPB 5CFRA 1RIFA 1ECLA 1T8UA 3P26A 4TOIA 1MRNA 3GJZA 1BEEA 4DM3A 1W36D 2HJSA 4UHCA 2QUAA 3JVUA 4P33A 1FSZA 3EVZA 3QFRA 4XYBA 4A3SA 5KTTA 1Q11A 4RD2A 1JJAA 3FTPA 4RK4A 3PKJA 2VOEA 4E11A 4OI2A 2C94A 3LGSA 4OHMA 3V4FA 5COQA 3F6EX 1QZ3A 2PKQP 1E9DA 3BSWA 3IVRA 5KWVA 3ICEA 3FTDA 1NF2A 1UMCB 4BNKA 2I3DA 2O4UX 3HWSA 4C9BA 1CUFA 1ZGJA 4RFLA 4EJ0A 2AK2A 2JGIA 1QPGA 4XDGA 1J0DA 3HWWA 3H9BA 3O0DA 3WKAA 5A4MS 1JHDA 1Z2NX 5HIMA 2Q5HA 3UBTA 3SIPA 2ZIGA 1QO0A 1VI5A 2XNKA 3TQQA 3R6GA 1XMXA 3ZZNA 1OAAA 1OBCA 1ZXBA 1NBHA 2BW0A 3K53A 1PVOA 1YA8A 3PTLA 3A6DA 5GONA 4MKGA 1WIWA 5MFZA 3KD3A 1I2CA 3ZDFA 2PT7A 1JQ5A 4O1MA 5DE3A 3WLAA 4CNQA 4YALA 4YR7A 1AN9A 4U7TB 2QZZA 2Z83A 3H5WA 3KKKA 2IDMA 1AA9A 1DAGA 1V7ZA 1VBMA 1K8RA 4GEGA 1QVRA 4LBYA 1UC4B 4PYIA 4L8GA 1V9SA 2YJ6A 4JSTA 1K2VN 4FE7A 5K3CA 1U11A 4DWWA 3O9ZA 2Y4OA 1YR8A 6PFKA 3PVZA 1D5WA 1I6MA 1UBHS 1OREA 1ZCBA 3WGKA 5F76A 4B34A 3E7PA 3UHOA 4CG2A 1OWMA 2C4UA 3HJGA 3O8RA 4S35A 4ZHQB 4C0BA 3NWOA 3QW2A 5H80A 1JE1A 4AJEA 5AR1A 1Y9DA 2H0QA 4I4TF 2F67A 2AV6A 1QB7A 4IV0A 4AS2A 3IQXA 4LF8B 3Q0TA 2QJRA 4JFRA 3RAGA 3MCWA 1D2RA 1LLDA 3OE4A 3ZU3A 5I7VA 5BR4A 3CF4A 4BJ3A 2PVSA 1H8EA 3PDCA 4GF5A 3ENVA 1HYQA 5LLTA 1O89A 3NWJA 1G7RA 2WABA 2O05A 2MINA 5FFFA 2CMDA 2ZSIA 4XQCA 2AMLA 1Y5NA 1AKRA 2VDWA 3EIWA 1SXQA 3U31A 3DCNA 4N5NA 3KU4A 3P0FA 4X1YA 1Z68A 4R9VA 5DW0A 1UFKA 2FR1A 5CG1A 5F5NA 5KKNB 1M5RA 1QZXA 3ZDAA 1N5MA 2H1IA 3WZMA 1U0RA 4NR0A 5NULA 2X19A 3AR8A 3NZEA 3PCTA 3ETLA 4QDZA 3UFXB 3FYTA 3DULA 1KAHA 3DZ8A 3OEYA 1EGQA 2HXYA 1QH1B 1LSJA 3L7JA 4MUGA 1E1QD 1M8PA 1VA4A 2H2IA 4FYWA 4M21A 5T6BA 1GRRA 3ZOKA 3DEJA 2VJYA 3N2YA 4UFOA 1DRJA 4LRWA 2OYRA 4YT8A 3H2KA 2JK0A 3KLPX 2WJVA 3SYKA 1BGVA 3WYGA 4BO6A 2HQRA 3I6BA 4INOA 1YFJA 2ZG6A 4FONA 1L5ZA 2M6KA 5ALDA 3NM6B 2IXTA 4TX1A 2MSEB 4X6UA 3NC1C 1YUMA 3I1YA 3KYIB 3NEJA 4KN6A 1E5XA 4G1VA 3KB6A 4F3KA 1H4VB 2OBMA 4NJOA 2JJ2A 2VL7A 3G9UA 1IYZA 4TMVA 4WN9A 3U9SA 3WXBA 3EZXA 4MGKR 3ZNOA 5A4IS 5JS6A 3ZDBA 3PD7A 4LDRA 5EZSA 3OD5A 3M9WA 2YWCA 3AW8A 1OGYA 5HJ2A 2DWUA 5JJCA 1I36A 5CR9A 3W05A 2XCUA 4JOSA 1TPYA 2GDZA 2VLBA 4WMLA 3BXPA 4U2GA 3TG2A 1XO1A 1XIVA 3HFSA 3Q11A 3R3YA 4DMGA 1RYMA 1WF3A 1XK6A 2GYUA 5LU8A 3RVRA 1WOMA 2I4MA 1PW5A 2PV0A 3IEPA 2V96A 4WKOA 3TJMA 2YWGA 1V4NA 1ID1A 3ZQ6A 2PUAA 4BWFB 1OVMA 3AVYA 1SBNE 4J0DA 4NBTA 1CZNA 1Q19A 3TOZA 4D02A 5HZMA 2F90A 3PNKA 2WE7A 3H1PA 3CM0A 5BR7A 3DFUA 5AW0A 1OX4A 1MC1A 2DTEA 1RLIA 1JQDA 3A4IA 3M4JA 4Q82A 1YO6A 2BGJA 1EZ1A 1BXKA 4EB6B 4NYJQ 4AWXA 3LRPA 5F5LA 1AKTA 2VRCD 2OBXA 1YRHA 4NENA 3KSRA 2EQBA 4C01A 2NXEA 4MO2A 5A9SB 1CE8B 1TLTA 1Y4AE 1CD5A 5IVIA 1KNQA 1FF9A 2Z2XA 2ZI6A 3SC6A 4HQKA 1UBCA 4Q3EA 2QBYA 4RPGA 1OXMA 4WESB 1Y9EA 3A37A 2VYFA 3RC1A 3P2IA 3TQTA 1F2VA 1Z15A 3AF3A 5J1TB 2YC4C 4OHVA 1ESEA 2BZGA 3I01A 3NT4A 1J20A 1D4AA 2RG7A 2DPMA 4QDJA 4QEZA 1N57A 1VPEA 4FIDA 3N5KA 2YZNA 1ZGBA 5E1DA 5HIJA 3U9TA 4LZAA 2ZJOA 5HM6A 3CB2A 1D8AA 2AOUA 5T8KC 1HEUA 3WFIA 4F4FA 5KTPA 5DZSA 1I32A 3DO8A 4HDMB 4KGZA 5KAMA 1DS6A 5LZ8A 3GLFB 2VUSA 5EZ5A 1U31A 1DKMA 5EMHA 3BHIA 4ME6A 4EW1A 3CG4A 3SFZA 1RPAA 3QEMA 4M8KA 1W8IA 4XE5A 1B0PA 2VXOA 3IAS6 3WGUA 4IZHA 4YMIA 1V8DA 2JLYA 4C3VA 4XJXA 1C3EA 2AVNA 2YUIA 3INNA 4O4IF 1YS7A 3E3NA 1Z0DA 4OQLA 1Y9ZA 3FYCA 3KP1A 4N8SA 2VZ9A 1TUIA 4NCBA 2WEKA 4B3MB 1ZK2A 2QP9X 4Q34A 2H07A 4HSEA 4PHCA 1LWOA 1FS6A 3KLBA 3PPXA 1ZD3A 3BXZA 4HWTA 5DK6A 4DIBA 1XLTC 2VF5X 4HDKB 5I9LA 5HBGA 2O4CA 4HWRA 1XNHA 3MXOA 1GZSA 1Y3HA 3D2LA 3UJAA 3N6XA 4PNEA 4JJ8A 3LGAA 4CT0A 3KB2A 1LZLA 5CK4A 5D3QA 7YASA 3PDUA 1M0WA 4J7CA 3FDJA 2VK2A 2FK7A 1BS9A 2ZRHA 2ZWOA 1INLA 3SLRA 3OZVA 2QF7A 3CX3A 4KLZA 4RCVA 4UZEA 4AKTA 1NUQA 1CKEA 3S2YA 4NYIQ 2LIPA 1U1CA 2Z3ZA 4KDEA 3VDMA 1FSFA 4UAGA 4KIUA 1V35A 2FE4A 4URZR 1C4KA 1E32A 3S1LA 3WGHA 4FKMA 4JOBA 5DISB 4U00A 1VG9B 3T9EA 1A9OA 4P3KA 5BSVA 5CCXA 4X61A 3HZOA 4KWIA 3Q8KA 2GYYA 3W5IA 1L4YA 1L5YA 4MV3A 1BO6A 2VPWA 3JARA 4MW9A 5IZCA 1L5FA 1NV8A 1XTPA 3O31A 4YV7A 1HDRA 1MJFA 4FFNA 2BEWB 2C5FA 5HG0A 5HKLA 3TNJA 2FGKA 2QJOA 4LGMA 4MWOA 5FULA 4BN0A 4Y30A 3K32A 4E31A 5HKOA 1UXHA 3AUSA 1C9DB 5BN4A 1DVRA 1Y63A 2RHCA 2WKPA 3AF4A 3FOEC 2AKEA 3AL3A 2OXEA 1RI3A 4AVYA 3PTAA 1T3TA 2VHXA 3M6VA 1Z22A 5I7FA 2Z3WA 2ES4A 2VWGA 1OA0A 2ZP1A 4NBNA 4MLPA 2VIIA 4HZGA 1KGSA 1B16A 4IIGA 3ZN2A 3DWGA 1P75A 2O9JA 3OPYB 4Z0HO 1UIMA 1YZNA 4I3HA 4F1JA 5BV0A 5EKXA 3U7QA 4Y2SA 5LDHA 4P98A 3J7AC 4JCOA 1UZAA 4L2IA 1XMOB 4J0IA 3W6UA 1L4NA 1KBOA 1W1UA 2BBOA 2BWJA 3KC2A 3IE0A 1DFGA 1PU2A 4MV0A 3GRPA 2PZFA 1OI7A 3T4EA 4E3WA 5LP6F 4NNJA 1QE3A 3D8RA 3CCFA 3ID6C 3OU2A 3WNBA 4PXYA 2CVQA 1TQ8A 2QT9A 3K30A 1IDOA 5FPTA 4UDYX 3M33A 2YVLA 5C5CA 3ZDRA 1SCBA 2F1HA 3E2MA 3GLHE 4CQJA 2O2CA 4Z3KA 1DHRA 1ACLA 1MABA 2PGLA 4G1BA 3QTTA 4BO4A 4Q39A 5DRYA 1IU9A 1NU8A 1QNLA 1BGWA 5ERYA 4ZHQA 2P6PA 1NZFA 4M98A 2J6HA 4KL8S 1TKCA 2QG4A 3GP8A 1CJBA 2WU0A 2BDTA 2VXCA 3IBSA 3T3IA 1IOWA 5JFTA 1A9TA 4DV1B 1ABEA 2BISA 1U2TA 1Y4ZA 1VLQA 4ZK2A 3ROTA 2F6RA 3CSSA 4BZZA 2NV6A 4RE5A 3OIWA 1NXXA 1TLFA 4YXWA 1CPYA 3WP1B 3B36A 1WBDA 5TY0A 3C74A 2PLFA 3Q7TA 4ITUA 1GKKA 2ZB2A 2B4QA 3G2MA 5AQ1A 4DMCA 4J43A 2X2PA 4MQBA 5D85A 3AZOA 4HFNA 2E0IA 1KJYA 5C35A 1YFLA 1PD0A 3E7FA 1HFEL 1M33A 1C29B 1NX9A 4G5SA 3NAMA 4HDRB 4PZ9A 4YAIA 1MG0A 3L4KA 2IIPA 2I7XA 1RHRA 1RLUA 2PXCA 5I4CA 3S8YA 5KHOC 1JSZA 2QX6A 3WMGA 3UMYA 5I7EA 3AUAA 5DTEA 3IVMA 1C4XA 5KSYA 4W1QA 2IUFA 4P4UA 4LHZA 1BHO1 4M8LA 5CFOA 1COWD 3GX1A 3TZCA 4CIVA 2E4ZA 1HQKA 2NP6A 3ENWA 3FF1A 5JBNA 2AC7A 1NR7A 1Q7EA 3RFCA 2D2VA 4R1PA 2GKOA 4F5ZA 4ZMBA 5LB4A 4R8VA 1DC4A 4L0QA 3DL2A 4AX8A 3K0HA 5IP5A 1R4NA 2FPPB 3M6FA 2JKYA 2YOFA 3MK31 4RZUA 2NUAA 3N70A 5I9NA 1YU6A 1H2FA 3EWSA 3PZRA 3DLPX 3QPVA 5KQSA 2XSZA 5L51A 2XZOA 4B47A 4V3CA 1SA0A 4JXKA 4Q4DA 4L4SA 2W6NA 3AEUA 4NDNE 4FS3A 4X7PA 4WJZA 2OYCA 3RSSA 3U62A 1H42A 3O3OB 2QR3A 3HJCA 3I1FA 2XNDD 3GA5A 1FUYB 1SBTA 2HCBA 3Q2IA 1QNFA 4YDHB 4A6PA 3AFOA 3KFLA 2OD7A 1L5NA 1VRWA 4PEVA 4WCVA 5HUHA 3KSAC 4RZHA 1LU9A 1NPTO 1OGJA 5IABA 4YBRA 1KTVA 2DLNA 3EXG1 1E20A 3L7IA 2RE8A 3O8BA 1R37A 1VL1A 3O8OB 5EJGA 1DLIA 3EARA 3ZQUA 1OBFO 3BJZA 4L5IA 2CF5A 5LYJB 1WUYA 4ZU6X 2HBRA 3ZGXA 5F64A 3AF6A 1GLGA 2DBYA 3FDZA 3EB9A 3AB3A 2CXOA 3EZ7A 1JDJA 2Q9UA 1YXMA 1C1DB 5TEVA 2FWMX 1C0PA 2NAFA 4PLHA 4ARZA 4BRSA 2PX2A 2ZUUA 1ULAA 5IM4A 2VXYA 4RPIA 1FJHA 5B1HA 5BN3B 3G17A 1PN3A 3K8QA 4NV3A 2G76A 3E4DA 3OX2A 3STUA 4BNDA 5MGNA 1X0VA 3IOMA 3ZHYA 2HH9A 3GHYA 3KHSA 3AESA 1KDTA 4HQLA 2BDEA 3ESBA 1WY7A 2VFAA 2GUGA 3E2IA 2O8EA 2WU1A 1GSIA 4Q9NA 1WNFA 3HEBA 4QXAA 1DU4A 2QAGB 1KOGA 3KSMA 4EYGA 2NZWA 2VAVA 1Z16A 3OZEA 5FTWA 3UV3A 4B1FA 3B5IA 4AMZA 4CV1A 2WYWA 1VJRA 3ABSB 3EXFB 1SXJB 3PLRA 4OHXA 5JD3A 1J7JA 1I5OA 4DHWA 2GO7A 3BOSA 5DOVA 5IJ0B 2JHPA 1Y98A 3EGDB 1KAGA 1YQDA 1YHYA 3KWMA 3P94A 1YQEA 3L4SO 1JHQA 1WZNA 1ZYUA 3E3AA 4BGUA 4CF7A 1H2EA 5DTRA 1N8SA 2AQHA 2QSYA 3HPQA 3H16A 1Z6XA 1BCRB 2ZIWB 4HK4A 2P78A 5G2OA 2IT1A 3NNNA 4FDAA 3RYIA 3T8YA 3ZWYA 4EB8A 4FIZA 4M38A 3VSDA 3GEEA 1J00A 4Q48A 5HIKA 3L7DA 4CBVA 4EHIA 3TQSA 1Y6JA 3OQJA 2FVXA 1YD7A 3ICVA 1A97A 1XTTA 4X8OA 1RRPA 2PRKA 3GPBA 3R4VA 3M2TA 1IQPA 4CKCA 5TQJA 4ZOCA 2O2EA 4F2GA 3AVXA 1X80A 5M34A 3GRAA 1O96B 3RIGA 4DOMA 4OOFA 4YRIA 4L5AA 2IS4A 1XTJA 5DRTA 1EDBA 1XELA 2W2PA 5EP1A 3KKOA 4NJEA 2R6R1 1E2NA 1NTOA 2XGSA 2CLHB 4A03A 4RO0A 2VRWA 2FUKA 3HY3A 1RLTA 4R9UC 1VE7A 4ZCLA 4JOCA 5KNDD 3O8CA 4HDSA 1AS0A 5H16A 4IDFA 4NENB 1O6CA 1DWPA 4X85A 4EPXA 4AF7A 4TUYB 4F38A 1X7XA 4RDXA 2C5GA 1KI9A 2P6UA 4PTYA 1QX3A 3T9CA 4GP6A 3TNDA 5IF9A 2XXAB 2RAUA 3NHLA 5ALUA 1WHSA 1CQIB 3HU2A 1B0AA 2W93A 4QYTA 1QG0A 2DQKA 3FDXA 1JR3D 2D1QA 2GGSA 2P8JA 4JJ4A 5HHTA 2WJ3A 1ZPDA 1XQ9A 4UCQA 1Y82A 3ZV7A 4E94A 4UCXA 1A77A 2IHTA 1GCUA 3LGXA 4JVLA 2A0XA 1LC3A 3YASA 3E48A 1AO3A 5DNUA 4CWAA 1ZH6A 4RZ3A 5CNMA 2BFCB 1SC3A 1C7IA