3DYTA

Crystal structure of snx9px-bar (230-595), c2221
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
366
structure length
355
Chain Sequence
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and plasticity of endophilin and sorting nexin 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Sorting nexin-9
total genus 128
structure length 355
sequence length 366
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3dytA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3dytA01
2X3XA 2V6VA 4AKVA 2DYBA 2X3VA 2CSKA 1OCUA 4AZ9A 3FOGA 3LUIA 1OCSA 2YPSA 2FICA 4IKBA 3QWEA 4H8SA 1URUA 1ZWWA 3LLLA 2EFLA 3ACOA 2Q12A 4FZSA 4HASA 4PZGA 4AVMA 4OXWA 1KQ6A 2C08A 2D4CA 2L73A 4P2JA 3I2WA 2Q13A 4I1QA 2YKTA 3SOGA 1X04A 2Z0OA 3IQ2A 2V14A 1XTNA 4NSWA 2IWLX 4DYLA 3HAJA 4P2IA 3SYVA 2ETTA 3G9GA 2D1LA 2Z0NA 3CAZA 2V0OA 3DYTA 5C5BA 3Q84A 1XTEA 2X3WA 2RAIA 2WWEA 2ELBA 1GD5A 3HPBA 4PQOA 4ON3A 1WDZA 3ABHA 4PQPA 3QNIA 1X03A 5C5BB 2RAJA 1I4TA 4BGJA 4IKDA 1Y2OA 2REDA 3HAHA 1I4LA 1O7KA 3QE6A 3HAIA 2I4KA 3PLTA 1KMDA 1I49A 2Z0VA 2AR5A 3HPCX 4WPEA 2REAA 2RAKA 4NQIA 4IKBB 1I4DA 4ATMA 4BNEA 3OK8A 3M3WA 4DCNC 4WPCA 3P0CA 2CZOA 1H6HA 3Q0KA 2EFKA
chains in the Genus database with same CATH superfamily
2X3XA 2YIAA 4EZZA 2V6VA 1QX1A 4AKVA 2X3VA 2YIVX 4PO2A 3DPPA 3FOGA 3BVXA 3UITA 5TKYA 1OCSA 2FICA 4EZWA 4H8SA 3VEBA 2WINM 4AZCA 3LLLA 3ACOA 4HR1A 4FZSA 4HASA 4EZSA 3EJPA 4JNEA 2D4CA 3I2WA 4EZPA 4IWQA 2Z0OA 3IQ2A 2GA9D 2IWLX 3HAJA 4P2IA 2QKWA 2D1LA 2ND0A 2V0OA 4AZ6A 3D50A 3BVVA 3Q84A 4UDYX 3I04A 2JNSA 4AZ5A 2ELBA 2YI9A 3D4ZA 3HPBA 3L3PA 4ON3A 1WDZA 3ABHA 4PQPA 1GNTA 2RAJA 2YI8A 3BVWA 1I4TA 4EZYA 3O3OB 4JNFA 1Y2OA 3I39X 4HR1B 3BUPA 3BVUA 1HTYA 3RV0A 3BUDA 4IWOA 1KMDA 1I49A 2ND1A 3L3OM 1TQUA 2LM0A 2YL8A 1TQWA 2REAA 5KBPA 4R5LA 3VEAA 3F7WA 3T48A 4JWCA 4NQIA 2F18A 3OHXM 3B53X 3C7NA 3KAVA 4IM2A 4FZPA 3P0CA 3LVTA 1TQVA 3CZSA 2QFFA 3BUBA 3D52A 1YWMA 4AZ7A 1TQTA 1URUA 4E81A 1QWUA 2EFLA 3T49A 4PZGA 4AVMA 1KQ6A 3ER9B 4IM3A 2OZNB 3KDRA 4I1QA 1DKYA 4AZCB 2V14A 1XTNA 4NSWA 4EZTA 4EZUA 3QA8A 3SYVA 2O0I1 4EZVA 3KAWA 2F7OA 3CAZA 5C5BA 3QNJA 1XTEA 4PQOA 5C5BB 4JN4A 5FIGA 1PS3A 4BGJA 1GN9A 3T4AG 3LMFA 4R5JA 1E2UA 1UPXA 3O3NB 3HAHA 1I4LA 1O7KA 3DX2A 4UDXX 2QXLA 2YL6A 3BLBA 2YLAA 4IW0A 2JNKA 4JWDA 2F7QA 3DX0A 3O3MB 4IKBB 4AZIA 1I4DA 4ATMA 4IWPA 4BNEA 4F00A 3DPOA 1U00A 3ERCC 1H6HA 4FM3A 1JQKA 2CSKA 1OCUA 3LUIA 2YPSA 4IKBA 3QWEA 2YL9A 2ZXQA 3DPQA 4JL9A 4KIKA 4FZOA 4R5KA 1GNLA 1OAOA 2C08A 2L73A 4H6IA 2YLLA 4P2JA 1R34A 2Q13A 2YKTA 3SOGA 2N3KA 3CVRA 3B52X 1MJGA 3EJRA 1OA0A 4DYLA 1SU6A 3BVTA 1SU7A 2NCZA 1E1DA 3CKDA 2Z0NA 3D51A 4G6QA 3EJSA 2X3WA 1E9VA 2ALWA 3T46A 1GD5A 1DKXA 4NPHA 3QNIA 4IM0A 2GF4A 3I01A 3GI7A 4KIKB 2OO2A 3BUQA 4H6HA 4E3CA 4EZQA 4AZHA 3DDGA 2OW7A 3FD9A 1SUFA 3HAIA 2I4KA 3PLTA 3DX3A 3DX4A 3D2FA 3HPCX 2RAKA 2LXYA 2WYHA 3BUIA 1DKZA 1O7DB 3EJUA 3OWGA 3DX1A 2YL5A 5E84A 3OK8A 2MI7A 4JLCA 3M3WA 2FYVA 2RT6A 3CV5A 3Q0KA 1R33A 2PY6A 4AZBA 2DYBA 4R5IA 3D4YA 4AZ9A 4EZRA 1QWNA 1ZWWA 2Q12A 2OBMA 3B51X 4OXWA 1X04A 4AZGA 2PMRA 3CZNA 1LQ7A 1ZYLA 2X5CA 1SU8A 2GAFD 2ETTA 3G9GA 2KHOA 2YIBA 3DYTA 3DDFA 2RAIA 1TQSA 1HWWA 2WWEA 2Z8YA 3RPMA 1X03A 4HY9A 3EJQA 3VKHA 4JWIA 2F1AA 4HYBA 1OA1A 2F1BA 1O7DC 4IKDA 4D8JA 2REDA 4F01A 4R5GA 3QE6A 4M0MA 4EZNA 4EZXA 2Z0VA 3A98A 1W9MA 2AR5A 2OBLA 4WPEA 3T47A 1R5EA 1HXKA 2WYIA 3ZEDA 3EJTA 2F7RA 3ER8C 2EWFA 3RV1A 2F7PA 3D2EA 4JWEA 4DCNC 4WPCA 4B9QA 4EZOA 2CZOA 5FLEX 2OW6A 2EX3B 2EFKA
chains in the Genus database with same CATH topology
2X3XA 2V6VA 4AKVA 2DYBA 2X3VA 2CSKA 1OCUA 4AZ9A 3FOGA 3LUIA 1OCSA 2YPSA 2FICA 4IKBA 3QWEA 4H8SA 1URUA 1ZWWA 3LLLA 2EFLA 3ACOA 2Q12A 4FZSA 4HASA 4PZGA 4AVMA 4OXWA 1KQ6A 2C08A 2D4CA 2L73A 4P2JA 3I2WA 2Q13A 4I1QA 2YKTA 3SOGA 1X04A 2Z0OA 3IQ2A 2V14A 1XTNA 4NSWA 2IWLX 4DYLA 3HAJA 4P2IA 3SYVA 2ETTA 3G9GA 2D1LA 2Z0NA 3CAZA 2V0OA 3DYTA 5C5BA 3Q84A 1XTEA 2X3WA 2RAIA 2WWEA 2ELBA 1GD5A 3HPBA 4PQOA 4ON3A 1WDZA 3ABHA 4PQPA 3QNIA 1X03A 5C5BB 2RAJA 1I4TA 4BGJA 4IKDA 1Y2OA 2REDA 3HAHA 1I4LA 1O7KA 3QE6A 3HAIA 2I4KA 3PLTA 1KMDA 1I49A 2Z0VA 2AR5A 3HPCX 4WPEA 2REAA 2RAKA 4NQIA 4IKBB 1I4DA 4ATMA 4BNEA 3OK8A 3M3WA 4DCNC 4WPCA 3P0CA 2CZOA 1H6HA 3Q0KA 2EFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X A;  2V6V A;  4AKV A;  2DYB A;  2X3V A;  2CSK A;  1OCU A;  4AZ9 A;  3FOG A;  3LUI A;  1OCS A;  2YPS A;  2FIC A;  4IKB A;  3QWE A;  4H8S A;  1URU A;  1ZWW A;  3LLL A;  2EFL A;  3ACO A;  2Q12 A;  4FZS A;  4HAS A;  4PZG A;  4AVM A;  4OXW A;  1KQ6 A;  2C08 A;  2D4C A;  2L73 A;  4P2J A;  3I2W A;  2Q13 A;  4I1Q A;  2YKT A;  3SOG A;  1X04 A;  2Z0O A;  3IQ2 A;  2V14 A;  1XTN A;  4NSW A;  2IWL X;  4DYL A;  3HAJ A;  4P2I A;  3SYV A;  2ETT A;  3G9G A;  2D1L A;  2Z0N A;  3CAZ A;  2V0O A;  3DYT A;  5C5B A;  3Q84 A;  1XTE A;  2X3W A;  2RAI A;  2WWE A;  2ELB A;  1GD5 A;  3HPB A;  4PQO A;  4ON3 A;  1WDZ A;  3ABH A;  4PQP A;  3QNI A;  1X03 A;  5C5B B;  2RAJ A;  1I4T A;  4BGJ A;  4IKD A;  1Y2O A;  2RED A;  3HAH A;  1I4L A;  1O7K A;  3QE6 A;  3HAI A;  2I4K A;  3PLT A;  1KMD A;  1I49 A;  2Z0V A;  2AR5 A;  3HPC X;  4WPE A;  2REA A;  2RAK A;  4NQI A;  4IKB B;  1I4D A;  4ATM A;  4BNE A;  3OK8 A;  3M3W A;  4DCN C;  4WPC A;  3P0C A;  2CZO A;  1H6H A;  3Q0K A;  2EFK A; 
#chains in the Genus database with same CATH topology
 2X3X A;  2YIA A;  4EZZ A;  2V6V A;  1QX1 A;  4AKV A;  2X3V A;  2YIV X;  4PO2 A;  3DPP A;  3FOG A;  3BVX A;  3UIT A;  5TKY A;  1OCS A;  2FIC A;  4EZW A;  4H8S A;  3VEB A;  2WIN M;  4AZC A;  3LLL A;  3ACO A;  4HR1 A;  4FZS A;  4HAS A;  4EZS A;  3EJP A;  4JNE A;  2D4C A;  3I2W A;  4EZP A;  4IWQ A;  2Z0O A;  3IQ2 A;  2GA9 D;  2IWL X;  3HAJ A;  4P2I A;  2QKW A;  2D1L A;  2ND0 A;  2V0O A;  4AZ6 A;  3D50 A;  3BVV A;  3Q84 A;  4UDY X;  3I04 A;  2JNS A;  4AZ5 A;  2ELB A;  2YI9 A;  3D4Z A;  3HPB A;  3L3P A;  4ON3 A;  1WDZ A;  3ABH A;  4PQP A;  1GNT A;  2RAJ A;  2YI8 A;  3BVW A;  1I4T A;  4EZY A;  3O3O B;  4JNF A;  1Y2O A;  3I39 X;  4HR1 B;  3BUP A;  3BVU A;  1HTY A;  3RV0 A;  3BUD A;  4IWO A;  1KMD A;  1I49 A;  2ND1 A;  3L3O M;  1TQU A;  2LM0 A;  2YL8 A;  1TQW A;  2REA A;  5KBP A;  4R5L A;  3VEA A;  3F7W A;  3T48 A;  4JWC A;  4NQI A;  2F18 A;  3OHX M;  3B53 X;  3C7N A;  3KAV A;  4IM2 A;  4FZP A;  3P0C A;  3LVT A;  1TQV A;  3CZS A;  2QFF A;  3BUB A;  3D52 A;  1YWM A;  4AZ7 A;  1TQT A;  1URU A;  4E81 A;  1QWU A;  2EFL A;  3T49 A;  4PZG A;  4AVM A;  1KQ6 A;  3ER9 B;  4IM3 A;  2OZN B;  3KDR A;  4I1Q A;  1DKY A;  4AZC B;  2V14 A;  1XTN A;  4NSW A;  4EZT A;  4EZU A;  3QA8 A;  3SYV A;  2O0I 1;  4EZV A;  3KAW A;  2F7O A;  3CAZ A;  5C5B A;  3QNJ A;  1XTE A;  4PQO A;  5C5B B;  4JN4 A;  5FIG A;  1PS3 A;  4BGJ A;  1GN9 A;  3T4A G;  3LMF A;  4R5J A;  1E2U A;  1UPX A;  3O3N B;  3HAH A;  1I4L A;  1O7K A;  3DX2 A;  4UDX X;  2QXL A;  2YL6 A;  3BLB A;  2YLA A;  4IW0 A;  2JNK A;  4JWD A;  2F7Q A;  3DX0 A;  3O3M B;  4IKB B;  4AZI A;  1I4D A;  4ATM A;  4IWP A;  4BNE A;  4F00 A;  3DPO A;  1U00 A;  3ERC C;  1H6H A;  4FM3 A;  1JQK A;  2CSK A;  1OCU A;  3LUI A;  2YPS A;  4IKB A;  3QWE A;  2YL9 A;  2ZXQ A;  3DPQ A;  4JL9 A;  4KIK A;  4FZO A;  4R5K A;  1GNL A;  1OAO A;  2C08 A;  2L73 A;  4H6I A;  2YLL A;  4P2J A;  1R34 A;  2Q13 A;  2YKT A;  3SOG A;  2N3K A;  3CVR A;  3B52 X;  1MJG A;  3EJR A;  1OA0 A;  4DYL A;  1SU6 A;  3BVT A;  1SU7 A;  2NCZ A;  1E1D A;  3CKD A;  2Z0N A;  3D51 A;  4G6Q A;  3EJS A;  2X3W A;  1E9V A;  2ALW A;  3T46 A;  1GD5 A;  1DKX A;  4NPH A;  3QNI A;  4IM0 A;  2GF4 A;  3I01 A;  3GI7 A;  4KIK B;  2OO2 A;  3BUQ A;  4H6H A;  4E3C A;  4EZQ A;  4AZH A;  3DDG A;  2OW7 A;  3FD9 A;  1SUF A;  3HAI A;  2I4K A;  3PLT A;  3DX3 A;  3DX4 A;  3D2F A;  3HPC X;  2RAK A;  2LXY A;  2WYH A;  3BUI A;  1DKZ A;  1O7D B;  3EJU A;  3OWG A;  3DX1 A;  2YL5 A;  5E84 A;  3OK8 A;  2MI7 A;  4JLC A;  3M3W A;  2FYV A;  2RT6 A;  3CV5 A;  3Q0K A;  1R33 A;  2PY6 A;  4AZB A;  2DYB A;  4R5I A;  3D4Y A;  4AZ9 A;  4EZR A;  1QWN A;  1ZWW A;  2Q12 A;  2OBM A;  3B51 X;  4OXW A;  1X04 A;  4AZG A;  2PMR A;  3CZN A;  1LQ7 A;  1ZYL A;  2X5C A;  1SU8 A;  2GAF D;  2ETT A;  3G9G A;  2KHO A;  2YIB A;  3DYT A;  3DDF A;  2RAI A;  1TQS A;  1HWW A;  2WWE A;  2Z8Y A;  3RPM A;  1X03 A;  4HY9 A;  3EJQ A;  3VKH A;  4JWI A;  2F1A A;  4HYB A;  1OA1 A;  2F1B A;  1O7D C;  4IKD A;  4D8J A;  2RED A;  4F01 A;  4R5G A;  3QE6 A;  4M0M A;  4EZN A;  4EZX A;  2Z0V A;  3A98 A;  1W9M A;  2AR5 A;  2OBL A;  4WPE A;  3T47 A;  1R5E A;  1HXK A;  2WYI A;  3ZED A;  3EJT A;  2F7R A;  3ER8 C;  2EWF A;  3RV1 A;  2F7P A;  3D2E A;  4JWE A;  4DCN C;  4WPC A;  4B9Q A;  4EZO A;  2CZO A;  5FLE X;  2OW6 A;  2EX3 B;  2EFK A; 
#chains in the Genus database with same CATH homology
 2X3X A;  2V6V A;  4AKV A;  2DYB A;  2X3V A;  2CSK A;  1OCU A;  4AZ9 A;  3FOG A;  3LUI A;  1OCS A;  2YPS A;  2FIC A;  4IKB A;  3QWE A;  4H8S A;  1URU A;  1ZWW A;  3LLL A;  2EFL A;  3ACO A;  2Q12 A;  4FZS A;  4HAS A;  4PZG A;  4AVM A;  4OXW A;  1KQ6 A;  2C08 A;  2D4C A;  2L73 A;  4P2J A;  3I2W A;  2Q13 A;  4I1Q A;  2YKT A;  3SOG A;  1X04 A;  2Z0O A;  3IQ2 A;  2V14 A;  1XTN A;  4NSW A;  2IWL X;  4DYL A;  3HAJ A;  4P2I A;  3SYV A;  2ETT A;  3G9G A;  2D1L A;  2Z0N A;  3CAZ A;  2V0O A;  3DYT A;  5C5B A;  3Q84 A;  1XTE A;  2X3W A;  2RAI A;  2WWE A;  2ELB A;  1GD5 A;  3HPB A;  4PQO A;  4ON3 A;  1WDZ A;  3ABH A;  4PQP A;  3QNI A;  1X03 A;  5C5B B;  2RAJ A;  1I4T A;  4BGJ A;  4IKD A;  1Y2O A;  2RED A;  3HAH A;  1I4L A;  1O7K A;  3QE6 A;  3HAI A;  2I4K A;  3PLT A;  1KMD A;  1I49 A;  2Z0V A;  2AR5 A;  3HPC X;  4WPE A;  2REA A;  2RAK A;  4NQI A;  4IKB B;  1I4D A;  4ATM A;  4BNE A;  3OK8 A;  3M3W A;  4DCN C;  4WPC A;  3P0C A;  2CZO A;  1H6H A;  3Q0K A;  2EFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...