3DYTA

Crystal structure of snx9px-bar (230-595), c2221
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
366
structure length
355
Chain Sequence
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title Structure and plasticity of endophilin and sorting nexin 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 128
structure length 355
sequence length 366
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3dytA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3dytA01
1XTNA 3LUIA 2V0OA 2Z0VA 4DCNC 3Q0KA 2Q12A 1Y2OA 3M3WA 3QE6A 4BGJA 1OCSA 2DYBA 4PQOA 4OXWA 2RAKA 4AVMA 4ON3A 3HAHA 2CSKA 4NSWA 3IQ2A 4P2JA 1I4TA 1KMDA 2IWLX 3ACOA 3HAIA 4WPEA 2Z0NA 1KQ6A 2EFLA 3HPBA 4IKDA 2AR5A 3HAJA 3QWEA 3Q84A 2ETTA 1H6HA 1URUA 4ATMA 2YPSA 2Q13A 2YKTA 2C08A 4FZSA 2RAIA 4H8SA 2CZOA 2RAJA 1X04A 1I4LA 1WDZA 3PLTA 4I1QA 2WWEA 4AKVA 1GD5A 2Z0OA 2REAA 4NQIA 2D1LA 4BNEA 2X3VA 3ABHA 3HPCX 4DYLA 2D4CA 2X3XA 2REDA 2V14A 3CAZA 4HASA 1I4DA 3SYVA 2I4KA 4IKBA 5C5BB 1ZWWA 4AZ9A 1I49A 1X03A 1OCUA 2EFKA 4PQPA 4IKBB 4PZGA 3LLLA 3QNIA 3FOGA 2V6VA 1O7KA 2X3WA 3SOGA 2FICA 3OK8A 3I2WA 4WPCA 1XTEA 2L73A 3P0CA 3DYTA 3G9GA 5C5BA 4P2IA 2ELBA
chains in the Genus database with same CATH superfamily
3KDRA 2YLAA 4NPHA 1LQ7A 2EWFA 3L3PA 4EZXA 2YIBA 3LVTA 4DCNC 2Q12A 1Y2OA 2QFFA 3A98A 1SU6A 3ERCC 1OCSA 4EZRA 4AVMA 2ND0A 4H6IA 3VKHA 3RV1A 2CSKA 1PS3A 1I4TA 1QWNA 3VEAA 1TQWA 3DDGA 4R5IA 2F18A 3T46A 3HPBA 4AZ7A 2LXYA 3O3OB 1H6HA 2OBLA 1SUFA 1U00A 2YKTA 2C08A 3T47A 2EX3B 4EZNA 4AZCA 2YI8A 3PLTA 5KBPA 4IWOA 2WWEA 2WYHA 3B52X 4IW0A 3ABHA 1HWWA 4KIKB 1OA0A 1R34A 2X3XA 2V14A 3D52A 4HASA 1I4DA 4IKBA 5C5BB 1GN9A 4AZ9A 1OCUA 4AZHA 2EFKA 2QXLA 5FIGA 4AZ6A 3L3OM 1O7KA 3SOGA 3CKDA 3OK8A 4WPCA 3I04A 4E81A 2GA9D 3D2EA 3P0CA 3G9GA 4H6HA 4P2IA 2F1AA 2ELBA 4JWDA 3LUIA 3KAWA 3O3MB 4IWPA 4EZSA 2GAFD 3DX4A 3Q0KA 4R5LA 4HR1A 3BVXA 3ER8C 3VEBA 4PQOA 3T49A 2F7PA 3CZSA 3CVRA 3HAHA 3DX1A 4FM3A 1TQSA 3ER9B 2JNKA 1ZYLA 1DKZA 1KMDA 4WPEA 3HAIA 2EFLA 3BVTA 2AR5A 3Q84A 1GNTA 3QA8A 4R5JA 1E1DA 1R33A 3CZNA 2ZXQA 4FZSA 2YL9A 4UDXX 1I4LA 2LM0A 1HXKA 3LMFA 2FYVA 4PO2A 3GI7A 4EZVA 2Z8YA 3KAVA 3QNJA 2OBMA 3BUDA 3RV0A 4R5GA 4HYBA 3DX2A 4JNFA 3BVWA 1O7DC 1I49A 1X03A 2F1BA 4PQPA 4PZGA 4JWCA 1YWMA 2JNSA 1DKYA 2MI7A 4JN4A 3FOGA 2X3WA 3ZEDA 1XTEA 3EJRA 4EZQA 4M0MA 2V0OA 3DDFA 4EZPA 2YIAA 3M3WA 3EJSA 1SU8A 2DYBA 4OXWA 4IM0A 4AZ5A 2RAKA 4ON3A 3D2FA 3T48A 4F01A 4NSWA 1HTYA 4AZCB 4P2JA 2X5CA 4D8JA 2Z0NA 4UDYX 4JNEA 1KQ6A 4AZIA 4IKDA 3QWEA 2YIVX 1URUA 2YPSA 2YLLA 3F7WA 4H8SA 4FZOA 4IM2A 2PY6A 3D50A 3DPPA 3BUPA 3O3NB 4AKVA 1GD5A 3EJTA 4F00A 2Z0OA 2REAA 4AZBA 5FLEX 4B9QA 4BNEA 2X3VA 2F7QA 4DYLA 2D4CA 1OA1A 3CAZA 4HY9A 1UPXA 2YL8A 1R5EA 3LLLA 3B51X 2N3KA 2F7RA 3BUQA 3D51A 2RT6A 1MJGA 2GF4A 3BUBA 2NCZA 4HR1B 1JQKA 1TQUA 3BVVA 3EJUA 4KIKA 3DYTA 3EJQA 3D4YA 5C5BA 4IM3A 3DPQA 3OWGA 1E2UA 1XTNA 1TQTA 2O0I1 2KHOA 2Z0VA 1QWUA 3I39X 3FD9A 3QE6A 4BGJA 2OW6A 3I01A 4EZTA 3CV5A 4EZZA 4G6QA 3BLBA 3RPMA 4JWIA 1TQVA 3DPOA 4EZOA 3IQ2A 4AZGA 2ND1A 3B53X 2IWLX 3ACOA 4FZPA 3BVUA 2QKWA 3T4AG 4R5KA 2ALWA 3HAJA 4E3CA 2ETTA 1W9MA 4ATMA 4EZUA 2Q13A 4EZWA 4JWEA 1SU7A 4JLCA 2RAIA 3BUIA 2CZOA 2RAJA 1X04A 3UITA 2OZNB 1WDZA 4I1QA 3C7NA 5E84A 4EZYA 3D4ZA 3EJPA 1OAOA 4NQIA 2WINM 2D1LA 3DX0A 4JL9A 3HPCX 1O7DB 2YI9A 2REDA 2YL5A 3SYVA 2I4KA 1ZWWA 2PMRA 2F7OA 2OW7A 2YL6A 4IKBB 1GNLA 2WYIA 3QNIA 4IWQA 2V6VA 2OO2A 2FICA 1DKXA 3I2WA 1QX1A 3DX3A 5TKYA 2L73A 3OHXM 1E9VA
chains in the Genus database with same CATH topology
1XTNA 3LUIA 2V0OA 2Z0VA 4DCNC 3Q0KA 2Q12A 1Y2OA 3M3WA 3QE6A 4BGJA 1OCSA 2DYBA 4PQOA 4OXWA 2RAKA 4AVMA 4ON3A 3HAHA 2CSKA 4NSWA 3IQ2A 4P2JA 1I4TA 1KMDA 2IWLX 3ACOA 3HAIA 4WPEA 2Z0NA 1KQ6A 2EFLA 3HPBA 4IKDA 2AR5A 3HAJA 3QWEA 3Q84A 2ETTA 1H6HA 1URUA 4ATMA 2YPSA 2Q13A 2YKTA 2C08A 4FZSA 2RAIA 4H8SA 2CZOA 2RAJA 1X04A 1I4LA 1WDZA 3PLTA 4I1QA 2WWEA 4AKVA 1GD5A 2Z0OA 2REAA 4NQIA 2D1LA 4BNEA 2X3VA 3ABHA 3HPCX 4DYLA 2D4CA 2X3XA 2REDA 2V14A 3CAZA 4HASA 1I4DA 3SYVA 2I4KA 4IKBA 5C5BB 1ZWWA 4AZ9A 1I49A 1X03A 1OCUA 2EFKA 4PQPA 4IKBB 4PZGA 3LLLA 3QNIA 3FOGA 2V6VA 1O7KA 2X3WA 3SOGA 2FICA 3OK8A 3I2WA 4WPCA 1XTEA 2L73A 3P0CA 3DYTA 3G9GA 5C5BA 4P2IA 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTN A;  3LUI A;  2V0O A;  2Z0V A;  4DCN C;  3Q0K A;  2Q12 A;  1Y2O A;  3M3W A;  3QE6 A;  4BGJ A;  1OCS A;  2DYB A;  4PQO A;  4OXW A;  2RAK A;  4AVM A;  4ON3 A;  3HAH A;  2CSK A;  4NSW A;  3IQ2 A;  4P2J A;  1I4T A;  1KMD A;  2IWL X;  3ACO A;  3HAI A;  4WPE A;  2Z0N A;  1KQ6 A;  2EFL A;  3HPB A;  4IKD A;  2AR5 A;  3HAJ A;  3QWE A;  3Q84 A;  2ETT A;  1H6H A;  1URU A;  4ATM A;  2YPS A;  2Q13 A;  2YKT A;  2C08 A;  4FZS A;  2RAI A;  4H8S A;  2CZO A;  2RAJ A;  1X04 A;  1I4L A;  1WDZ A;  3PLT A;  4I1Q A;  2WWE A;  4AKV A;  1GD5 A;  2Z0O A;  2REA A;  4NQI A;  2D1L A;  4BNE A;  2X3V A;  3ABH A;  3HPC X;  4DYL A;  2D4C A;  2X3X A;  2RED A;  2V14 A;  3CAZ A;  4HAS A;  1I4D A;  3SYV A;  2I4K A;  4IKB A;  5C5B B;  1ZWW A;  4AZ9 A;  1I49 A;  1X03 A;  1OCU A;  2EFK A;  4PQP A;  4IKB B;  4PZG A;  3LLL A;  3QNI A;  3FOG A;  2V6V A;  1O7K A;  2X3W A;  3SOG A;  2FIC A;  3OK8 A;  3I2W A;  4WPC A;  1XTE A;  2L73 A;  3P0C A;  3DYT A;  3G9G A;  5C5B A;  4P2I A;  2ELB A; 
#chains in the Genus database with same CATH topology
 3KDR A;  2YLA A;  4NPH A;  1LQ7 A;  2EWF A;  3L3P A;  4EZX A;  2YIB A;  3LVT A;  4DCN C;  2Q12 A;  1Y2O A;  2QFF A;  3A98 A;  1SU6 A;  3ERC C;  1OCS A;  4EZR A;  4AVM A;  2ND0 A;  4H6I A;  3VKH A;  3RV1 A;  2CSK A;  1PS3 A;  1I4T A;  1QWN A;  3VEA A;  1TQW A;  3DDG A;  4R5I A;  2F18 A;  3T46 A;  3HPB A;  4AZ7 A;  2LXY A;  3O3O B;  1H6H A;  2OBL A;  1SUF A;  1U00 A;  2YKT A;  2C08 A;  3T47 A;  2EX3 B;  4EZN A;  4AZC A;  2YI8 A;  3PLT A;  5KBP A;  4IWO A;  2WWE A;  2WYH A;  3B52 X;  4IW0 A;  3ABH A;  1HWW A;  4KIK B;  1OA0 A;  1R34 A;  2X3X A;  2V14 A;  3D52 A;  4HAS A;  1I4D A;  4IKB A;  5C5B B;  1GN9 A;  4AZ9 A;  1OCU A;  4AZH A;  2EFK A;  2QXL A;  5FIG A;  4AZ6 A;  3L3O M;  1O7K A;  3SOG A;  3CKD A;  3OK8 A;  4WPC A;  3I04 A;  4E81 A;  2GA9 D;  3D2E A;  3P0C A;  3G9G A;  4H6H A;  4P2I A;  2F1A A;  2ELB A;  4JWD A;  3LUI A;  3KAW A;  3O3M B;  4IWP A;  4EZS A;  2GAF D;  3DX4 A;  3Q0K A;  4R5L A;  4HR1 A;  3BVX A;  3ER8 C;  3VEB A;  4PQO A;  3T49 A;  2F7P A;  3CZS A;  3CVR A;  3HAH A;  3DX1 A;  4FM3 A;  1TQS A;  3ER9 B;  2JNK A;  1ZYL A;  1DKZ A;  1KMD A;  4WPE A;  3HAI A;  2EFL A;  3BVT A;  2AR5 A;  3Q84 A;  1GNT A;  3QA8 A;  4R5J A;  1E1D A;  1R33 A;  3CZN A;  2ZXQ A;  4FZS A;  2YL9 A;  4UDX X;  1I4L A;  2LM0 A;  1HXK A;  3LMF A;  2FYV A;  4PO2 A;  3GI7 A;  4EZV A;  2Z8Y A;  3KAV A;  3QNJ A;  2OBM A;  3BUD A;  3RV0 A;  4R5G A;  4HYB A;  3DX2 A;  4JNF A;  3BVW A;  1O7D C;  1I49 A;  1X03 A;  2F1B A;  4PQP A;  4PZG A;  4JWC A;  1YWM A;  2JNS A;  1DKY A;  2MI7 A;  4JN4 A;  3FOG A;  2X3W A;  3ZED A;  1XTE A;  3EJR A;  4EZQ A;  4M0M A;  2V0O A;  3DDF A;  4EZP A;  2YIA A;  3M3W A;  3EJS A;  1SU8 A;  2DYB A;  4OXW A;  4IM0 A;  4AZ5 A;  2RAK A;  4ON3 A;  3D2F A;  3T48 A;  4F01 A;  4NSW A;  1HTY A;  4AZC B;  4P2J A;  2X5C A;  4D8J A;  2Z0N A;  4UDY X;  4JNE A;  1KQ6 A;  4AZI A;  4IKD A;  3QWE A;  2YIV X;  1URU A;  2YPS A;  2YLL A;  3F7W A;  4H8S A;  4FZO A;  4IM2 A;  2PY6 A;  3D50 A;  3DPP A;  3BUP A;  3O3N B;  4AKV A;  1GD5 A;  3EJT A;  4F00 A;  2Z0O A;  2REA A;  4AZB A;  5FLE X;  4B9Q A;  4BNE A;  2X3V A;  2F7Q A;  4DYL A;  2D4C A;  1OA1 A;  3CAZ A;  4HY9 A;  1UPX A;  2YL8 A;  1R5E A;  3LLL A;  3B51 X;  2N3K A;  2F7R A;  3BUQ A;  3D51 A;  2RT6 A;  1MJG A;  2GF4 A;  3BUB A;  2NCZ A;  4HR1 B;  1JQK A;  1TQU A;  3BVV A;  3EJU A;  4KIK A;  3DYT A;  3EJQ A;  3D4Y A;  5C5B A;  4IM3 A;  3DPQ A;  3OWG A;  1E2U A;  1XTN A;  1TQT A;  2O0I 1;  2KHO A;  2Z0V A;  1QWU A;  3I39 X;  3FD9 A;  3QE6 A;  4BGJ A;  2OW6 A;  3I01 A;  4EZT A;  3CV5 A;  4EZZ A;  4G6Q A;  3BLB A;  3RPM A;  4JWI A;  1TQV A;  3DPO A;  4EZO A;  3IQ2 A;  4AZG A;  2ND1 A;  3B53 X;  2IWL X;  3ACO A;  4FZP A;  3BVU A;  2QKW A;  3T4A G;  4R5K A;  2ALW A;  3HAJ A;  4E3C A;  2ETT A;  1W9M A;  4ATM A;  4EZU A;  2Q13 A;  4EZW A;  4JWE A;  1SU7 A;  4JLC A;  2RAI A;  3BUI A;  2CZO A;  2RAJ A;  1X04 A;  3UIT A;  2OZN B;  1WDZ A;  4I1Q A;  3C7N A;  5E84 A;  4EZY A;  3D4Z A;  3EJP A;  1OAO A;  4NQI A;  2WIN M;  2D1L A;  3DX0 A;  4JL9 A;  3HPC X;  1O7D B;  2YI9 A;  2RED A;  2YL5 A;  3SYV A;  2I4K A;  1ZWW A;  2PMR A;  2F7O A;  2OW7 A;  2YL6 A;  4IKB B;  1GNL A;  2WYI A;  3QNI A;  4IWQ A;  2V6V A;  2OO2 A;  2FIC A;  1DKX A;  3I2W A;  1QX1 A;  3DX3 A;  5TKY A;  2L73 A;  3OHX M;  1E9V A; 
#chains in the Genus database with same CATH homology
 1XTN A;  3LUI A;  2V0O A;  2Z0V A;  4DCN C;  3Q0K A;  2Q12 A;  1Y2O A;  3M3W A;  3QE6 A;  4BGJ A;  1OCS A;  2DYB A;  4PQO A;  4OXW A;  2RAK A;  4AVM A;  4ON3 A;  3HAH A;  2CSK A;  4NSW A;  3IQ2 A;  4P2J A;  1I4T A;  1KMD A;  2IWL X;  3ACO A;  3HAI A;  4WPE A;  2Z0N A;  1KQ6 A;  2EFL A;  3HPB A;  4IKD A;  2AR5 A;  3HAJ A;  3QWE A;  3Q84 A;  2ETT A;  1H6H A;  1URU A;  4ATM A;  2YPS A;  2Q13 A;  2YKT A;  2C08 A;  4FZS A;  2RAI A;  4H8S A;  2CZO A;  2RAJ A;  1X04 A;  1I4L A;  1WDZ A;  3PLT A;  4I1Q A;  2WWE A;  4AKV A;  1GD5 A;  2Z0O A;  2REA A;  4NQI A;  2D1L A;  4BNE A;  2X3V A;  3ABH A;  3HPC X;  4DYL A;  2D4C A;  2X3X A;  2RED A;  2V14 A;  3CAZ A;  4HAS A;  1I4D A;  3SYV A;  2I4K A;  4IKB A;  5C5B B;  1ZWW A;  4AZ9 A;  1I49 A;  1X03 A;  1OCU A;  2EFK A;  4PQP A;  4IKB B;  4PZG A;  3LLL A;  3QNI A;  3FOG A;  2V6V A;  1O7K A;  2X3W A;  3SOG A;  2FIC A;  3OK8 A;  3I2W A;  4WPC A;  1XTE A;  2L73 A;  3P0C A;  3DYT A;  3G9G A;  5C5B A;  4P2I A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...