3DYTA

Crystal structure of snx9px-bar (230-595), c2221
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
366
structure length
355
Chain Sequence
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title Structure and plasticity of endophilin and sorting nexin 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 128
structure length 355
sequence length 366
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3dytA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3dytA01
4H8SA 1XTNA 4FZSA 3HPCX 4I1QA 4AVMA 2I4KA 4DCNC 3QE6A 4AKVA 3M3WA 3HAJA 3FOGA 1XTEA 2FICA 3ABHA 3Q0KA 2Z0VA 1ZWWA 2RAKA 2Z0OA 1WDZA 4PQOA 1KQ6A 1O7KA 4AZ9A 3OK8A 4HASA 1X03A 2Q13A 3LUIA 2CSKA 1URUA 3LLLA 3QNIA 3DYTA 2Q12A 4IKBB 4P2IA 2D1LA 5C5BA 2X3WA 4PQPA 2RAJA 4NSWA 3SYVA 3I2WA 2V0OA 2V14A 3G9GA 2C08A 2Z0NA 1X04A 4BGJA 1Y2OA 2YPSA 5C5BB 3CAZA 2REDA 4BNEA 1I4TA 2EFKA 3HAHA 4IKDA 3SOGA 3Q84A 1GD5A 2WWEA 4DYLA 4PZGA 2IWLX 4OXWA 2AR5A 4ATMA 4NQIA 2ETTA 2V6VA 2CZOA 2D4CA 2YKTA 3ACOA 3HAIA 4ON3A 2DYBA 2ELBA 1H6HA 4WPCA 2REAA 1KMDA 2X3VA 1OCSA 4WPEA 3IQ2A 1I4DA 1OCUA 3P0CA 2RAIA 3PLTA 2X3XA 4IKBA 2EFLA 4P2JA 1I49A 3HPBA 1I4LA 3QWEA 2L73A
chains in the Genus database with same CATH superfamily
3BVUA 4H8SA 3DX4A 2GAFD 4R5KA 4EZUA 4I1QA 4AVMA 3QE6A 4EZSA 3GI7A 4AKVA 2YLAA 3HAJA 4JWEA 2YL6A 1HWWA 4IWOA 3ABHA 4AZHA 4IWQA 1ZWWA 3CZSA 4EZNA 3EJTA 1OAOA 3RV1A 1WDZA 4AZ9A 3EJSA 2Q13A 3LUIA 2CSKA 4EZXA 1DKZA 3DX0A 3L3PA 2FYVA 2YI8A 1OA1A 1E1DA 3I2WA 4NPHA 2V0OA 1TQSA 3I04A 3BUIA 1HTYA 3ER8C 4EZRA 1Y2OA 3LMFA 2QKWA 2REDA 2F7QA 1I4TA 4F00A 4PZGA 2F18A 2OW6A 4NQIA 2QXLA 3OWGA 2CZOA 2D4CA 2OBMA 3DX2A 2GF4A 2F7PA 5KBPA 5E84A 4H6HA 2ND1A 2O0I1 5FLEX 2EX3B 4EZWA 1I4DA 4EZZA 3D51A 1QWNA 3DPPA 1QX1A 4HY9A 2EFLA 4P2JA 4EZOA 2L73A 1GN9A 1XTNA 4FZSA 3HPCX 3I39X 4AZCA 2I4KA 3DX3A 4AZBA 4R5JA 4M0MA 3Q0KA 3O3MB 1O7DC 3T49A 4IWPA 4AZCB 2PMRA 3QNJA 4JWIA 4PQOA 3QA8A 3ER9B 3LLLA 3QNIA 3BVVA 1R33A 3DYTA 3VKHA 2Q12A 2YLLA 5C5BA 4IW0A 2X3WA 2RAJA 4NSWA 3SYVA 4AZ7A 3KDRA 2YL8A 3RPMA 2C08A 2WYHA 4R5IA 5FIGA 2F7RA 2YL5A 4E81A 5C5BB 3BUPA 3CAZA 3DX1A 4PO2A 1ZYLA 2MI7A 3Q84A 2YIVX 4JLCA 4DYLA 4FZPA 4OXWA 4ATMA 2ETTA 2F1BA 3D4YA 2OW7A 4JWCA 4EZQA 3ACOA 3A98A 3DPOA 4EZPA 3C7NA 2X3VA 1KMDA 1OCSA 3IQ2A 3O3NB 1TQVA 2RAIA 4IKBA 3BUBA 2NCZA 1I49A 1I4LA 3BLBA 3D52A 2OBLA 3EJQA 4EZYA 4UDYX 2OZNB 3BVXA 3FOGA 1XTEA 1GNLA 2JNSA 3EJUA 3T47A 2Z0VA 4EZTA 1SU6A 1DKYA 4R5GA 3CZNA 2RAKA 2Z0OA 3T4AG 4UDXX 1O7KA 2N3KA 3OK8A 2GA9D 2PY6A 1X03A 3DPQA 4HASA 4F01A 1URUA 1JQKA 1GNTA 1SUFA 3DDGA 4P2IA 4HR1A 3ERCC 4PQPA 4EZVA 3CKDA 3G9GA 3FD9A 3RV0A 2Z0NA 3BVTA 1TQUA 4AZIA 3UITA 2KHOA 2YPSA 4JNFA 4HR1B 3BVWA 4BNEA 4IM2A 2EFKA 3HAHA 2YIAA 4IKDA 3SOGA 1GD5A 2WWEA 3B51X 2Z8YA 3BUQA 1SU8A 2IWLX 1E9VA 4JN4A 4JNEA 4HYBA 4KIKA 2YKTA 1LQ7A 1R5EA 4WPCA 2REAA 1PS3A 1O7DB 2YI9A 3B52X 3KAVA 3EJRA 1QWUA 2ZXQA 1OCUA 4KIKB 3P0CA 3BUDA 3PLTA 2X3XA 1HXKA 3O3OB 3QWEA 1E2UA 4R5LA 3VEBA 1SU7A 4FM3A 3LVTA 4DCNC 3F7WA 3DDFA 3ZEDA 1DKXA 3D50A 3T48A 1OA0A 2RT6A 3M3WA 1TQTA 2FICA 2EWFA 1TQWA 2LM0A 2LXYA 4B9QA 4JWDA 4AZ5A 1KQ6A 2OO2A 4D8JA 3EJPA 4FZOA 2ND0A 1MJGA 3CV5A 1YWMA 4IM0A 4IKBB 3OHXM 2D1LA 2ALWA 3I01A 2V14A 3KAWA 3D2FA 2QFFA 3T46A 2F7OA 2WYIA 4JL9A 1X04A 3CVRA 4BGJA 1W9MA 1UPXA 4H6IA 4AZ6A 1R34A 3D2EA 2YL9A 2AR5A 1U00A 2V6VA 2X5CA 2WINM 3HAIA 4ON3A 2JNKA 2DYBA 2ELBA 3L3OM 1H6HA 4WPEA 3B53X 2F1AA 3VEAA 4E3CA 2YIBA 4IM3A 5TKYA 3D4ZA 3HPBA 4AZGA 4G6QA
chains in the Genus database with same CATH topology
4H8SA 1XTNA 4FZSA 3HPCX 4I1QA 4AVMA 2I4KA 4DCNC 3QE6A 4AKVA 3M3WA 3HAJA 3FOGA 1XTEA 2FICA 3ABHA 3Q0KA 2Z0VA 1ZWWA 2RAKA 2Z0OA 1WDZA 4PQOA 1KQ6A 1O7KA 4AZ9A 3OK8A 4HASA 1X03A 2Q13A 3LUIA 2CSKA 1URUA 3LLLA 3QNIA 3DYTA 2Q12A 4IKBB 4P2IA 2D1LA 5C5BA 2X3WA 4PQPA 2RAJA 4NSWA 3SYVA 3I2WA 2V0OA 2V14A 3G9GA 2C08A 2Z0NA 1X04A 4BGJA 1Y2OA 2YPSA 5C5BB 3CAZA 2REDA 4BNEA 1I4TA 2EFKA 3HAHA 4IKDA 3SOGA 3Q84A 1GD5A 2WWEA 4DYLA 4PZGA 2IWLX 4OXWA 2AR5A 4ATMA 4NQIA 2ETTA 2V6VA 2CZOA 2D4CA 2YKTA 3ACOA 3HAIA 4ON3A 2DYBA 2ELBA 1H6HA 4WPCA 2REAA 1KMDA 2X3VA 1OCSA 4WPEA 3IQ2A 1I4DA 1OCUA 3P0CA 2RAIA 3PLTA 2X3XA 4IKBA 2EFLA 4P2JA 1I49A 3HPBA 1I4LA 3QWEA 2L73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H8S A;  1XTN A;  4FZS A;  3HPC X;  4I1Q A;  4AVM A;  2I4K A;  4DCN C;  3QE6 A;  4AKV A;  3M3W A;  3HAJ A;  3FOG A;  1XTE A;  2FIC A;  3ABH A;  3Q0K A;  2Z0V A;  1ZWW A;  2RAK A;  2Z0O A;  1WDZ A;  4PQO A;  1KQ6 A;  1O7K A;  4AZ9 A;  3OK8 A;  4HAS A;  1X03 A;  2Q13 A;  3LUI A;  2CSK A;  1URU A;  3LLL A;  3QNI A;  3DYT A;  2Q12 A;  4IKB B;  4P2I A;  2D1L A;  5C5B A;  2X3W A;  4PQP A;  2RAJ A;  4NSW A;  3SYV A;  3I2W A;  2V0O A;  2V14 A;  3G9G A;  2C08 A;  2Z0N A;  1X04 A;  4BGJ A;  1Y2O A;  2YPS A;  5C5B B;  3CAZ A;  2RED A;  4BNE A;  1I4T A;  2EFK A;  3HAH A;  4IKD A;  3SOG A;  3Q84 A;  1GD5 A;  2WWE A;  4DYL A;  4PZG A;  2IWL X;  4OXW A;  2AR5 A;  4ATM A;  4NQI A;  2ETT A;  2V6V A;  2CZO A;  2D4C A;  2YKT A;  3ACO A;  3HAI A;  4ON3 A;  2DYB A;  2ELB A;  1H6H A;  4WPC A;  2REA A;  1KMD A;  2X3V A;  1OCS A;  4WPE A;  3IQ2 A;  1I4D A;  1OCU A;  3P0C A;  2RAI A;  3PLT A;  2X3X A;  4IKB A;  2EFL A;  4P2J A;  1I49 A;  3HPB A;  1I4L A;  3QWE A;  2L73 A; 
#chains in the Genus database with same CATH topology
 3BVU A;  4H8S A;  3DX4 A;  2GAF D;  4R5K A;  4EZU A;  4I1Q A;  4AVM A;  3QE6 A;  4EZS A;  3GI7 A;  4AKV A;  2YLA A;  3HAJ A;  4JWE A;  2YL6 A;  1HWW A;  4IWO A;  3ABH A;  4AZH A;  4IWQ A;  1ZWW A;  3CZS A;  4EZN A;  3EJT A;  1OAO A;  3RV1 A;  1WDZ A;  4AZ9 A;  3EJS A;  2Q13 A;  3LUI A;  2CSK A;  4EZX A;  1DKZ A;  3DX0 A;  3L3P A;  2FYV A;  2YI8 A;  1OA1 A;  1E1D A;  3I2W A;  4NPH A;  2V0O A;  1TQS A;  3I04 A;  3BUI A;  1HTY A;  3ER8 C;  4EZR A;  1Y2O A;  3LMF A;  2QKW A;  2RED A;  2F7Q A;  1I4T A;  4F00 A;  4PZG A;  2F18 A;  2OW6 A;  4NQI A;  2QXL A;  3OWG A;  2CZO A;  2D4C A;  2OBM A;  3DX2 A;  2GF4 A;  2F7P A;  5KBP A;  5E84 A;  4H6H A;  2ND1 A;  2O0I 1;  5FLE X;  2EX3 B;  4EZW A;  1I4D A;  4EZZ A;  3D51 A;  1QWN A;  3DPP A;  1QX1 A;  4HY9 A;  2EFL A;  4P2J A;  4EZO A;  2L73 A;  1GN9 A;  1XTN A;  4FZS A;  3HPC X;  3I39 X;  4AZC A;  2I4K A;  3DX3 A;  4AZB A;  4R5J A;  4M0M A;  3Q0K A;  3O3M B;  1O7D C;  3T49 A;  4IWP A;  4AZC B;  2PMR A;  3QNJ A;  4JWI A;  4PQO A;  3QA8 A;  3ER9 B;  3LLL A;  3QNI A;  3BVV A;  1R33 A;  3DYT A;  3VKH A;  2Q12 A;  2YLL A;  5C5B A;  4IW0 A;  2X3W A;  2RAJ A;  4NSW A;  3SYV A;  4AZ7 A;  3KDR A;  2YL8 A;  3RPM A;  2C08 A;  2WYH A;  4R5I A;  5FIG A;  2F7R A;  2YL5 A;  4E81 A;  5C5B B;  3BUP A;  3CAZ A;  3DX1 A;  4PO2 A;  1ZYL A;  2MI7 A;  3Q84 A;  2YIV X;  4JLC A;  4DYL A;  4FZP A;  4OXW A;  4ATM A;  2ETT A;  2F1B A;  3D4Y A;  2OW7 A;  4JWC A;  4EZQ A;  3ACO A;  3A98 A;  3DPO A;  4EZP A;  3C7N A;  2X3V A;  1KMD A;  1OCS A;  3IQ2 A;  3O3N B;  1TQV A;  2RAI A;  4IKB A;  3BUB A;  2NCZ A;  1I49 A;  1I4L A;  3BLB A;  3D52 A;  2OBL A;  3EJQ A;  4EZY A;  4UDY X;  2OZN B;  3BVX A;  3FOG A;  1XTE A;  1GNL A;  2JNS A;  3EJU A;  3T47 A;  2Z0V A;  4EZT A;  1SU6 A;  1DKY A;  4R5G A;  3CZN A;  2RAK A;  2Z0O A;  3T4A G;  4UDX X;  1O7K A;  2N3K A;  3OK8 A;  2GA9 D;  2PY6 A;  1X03 A;  3DPQ A;  4HAS A;  4F01 A;  1URU A;  1JQK A;  1GNT A;  1SUF A;  3DDG A;  4P2I A;  4HR1 A;  3ERC C;  4PQP A;  4EZV A;  3CKD A;  3G9G A;  3FD9 A;  3RV0 A;  2Z0N A;  3BVT A;  1TQU A;  4AZI A;  3UIT A;  2KHO A;  2YPS A;  4JNF A;  4HR1 B;  3BVW A;  4BNE A;  4IM2 A;  2EFK A;  3HAH A;  2YIA A;  4IKD A;  3SOG A;  1GD5 A;  2WWE A;  3B51 X;  2Z8Y A;  3BUQ A;  1SU8 A;  2IWL X;  1E9V A;  4JN4 A;  4JNE A;  4HYB A;  4KIK A;  2YKT A;  1LQ7 A;  1R5E A;  4WPC A;  2REA A;  1PS3 A;  1O7D B;  2YI9 A;  3B52 X;  3KAV A;  3EJR A;  1QWU A;  2ZXQ A;  1OCU A;  4KIK B;  3P0C A;  3BUD A;  3PLT A;  2X3X A;  1HXK A;  3O3O B;  3QWE A;  1E2U A;  4R5L A;  3VEB A;  1SU7 A;  4FM3 A;  3LVT A;  4DCN C;  3F7W A;  3DDF A;  3ZED A;  1DKX A;  3D50 A;  3T48 A;  1OA0 A;  2RT6 A;  3M3W A;  1TQT A;  2FIC A;  2EWF A;  1TQW A;  2LM0 A;  2LXY A;  4B9Q A;  4JWD A;  4AZ5 A;  1KQ6 A;  2OO2 A;  4D8J A;  3EJP A;  4FZO A;  2ND0 A;  1MJG A;  3CV5 A;  1YWM A;  4IM0 A;  4IKB B;  3OHX M;  2D1L A;  2ALW A;  3I01 A;  2V14 A;  3KAW A;  3D2F A;  2QFF A;  3T46 A;  2F7O A;  2WYI A;  4JL9 A;  1X04 A;  3CVR A;  4BGJ A;  1W9M A;  1UPX A;  4H6I A;  4AZ6 A;  1R34 A;  3D2E A;  2YL9 A;  2AR5 A;  1U00 A;  2V6V A;  2X5C A;  2WIN M;  3HAI A;  4ON3 A;  2JNK A;  2DYB A;  2ELB A;  3L3O M;  1H6H A;  4WPE A;  3B53 X;  2F1A A;  3VEA A;  4E3C A;  2YIB A;  4IM3 A;  5TKY A;  3D4Z A;  3HPB A;  4AZG A;  4G6Q A; 
#chains in the Genus database with same CATH homology
 4H8S A;  1XTN A;  4FZS A;  3HPC X;  4I1Q A;  4AVM A;  2I4K A;  4DCN C;  3QE6 A;  4AKV A;  3M3W A;  3HAJ A;  3FOG A;  1XTE A;  2FIC A;  3ABH A;  3Q0K A;  2Z0V A;  1ZWW A;  2RAK A;  2Z0O A;  1WDZ A;  4PQO A;  1KQ6 A;  1O7K A;  4AZ9 A;  3OK8 A;  4HAS A;  1X03 A;  2Q13 A;  3LUI A;  2CSK A;  1URU A;  3LLL A;  3QNI A;  3DYT A;  2Q12 A;  4IKB B;  4P2I A;  2D1L A;  5C5B A;  2X3W A;  4PQP A;  2RAJ A;  4NSW A;  3SYV A;  3I2W A;  2V0O A;  2V14 A;  3G9G A;  2C08 A;  2Z0N A;  1X04 A;  4BGJ A;  1Y2O A;  2YPS A;  5C5B B;  3CAZ A;  2RED A;  4BNE A;  1I4T A;  2EFK A;  3HAH A;  4IKD A;  3SOG A;  3Q84 A;  1GD5 A;  2WWE A;  4DYL A;  4PZG A;  2IWL X;  4OXW A;  2AR5 A;  4ATM A;  4NQI A;  2ETT A;  2V6V A;  2CZO A;  2D4C A;  2YKT A;  3ACO A;  3HAI A;  4ON3 A;  2DYB A;  2ELB A;  1H6H A;  4WPC A;  2REA A;  1KMD A;  2X3V A;  1OCS A;  4WPE A;  3IQ2 A;  1I4D A;  1OCU A;  3P0C A;  2RAI A;  3PLT A;  2X3X A;  4IKB A;  2EFL A;  4P2J A;  1I49 A;  3HPB A;  1I4L A;  3QWE A;  2L73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...