3DYTA

Crystal structure of snx9px-bar (230-595), c2221
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
366
structure length
355
Chain Sequence
b'EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-9
publication title Structure and plasticity of endophilin and sorting nexin 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 128
structure length 355
sequence length 366
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
A PF10456 BAR_3_WASP_bdg WASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3dytA02
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3dytA01
2X3WA 2AR5A 2ETTA 2D1LA 3IQ2A 2Z0VA 3Q84A 2RAJA 2DYBA 4HASA 3HAHA 4I1QA 2Z0OA 1XTNA 5C5BB 2Z0NA 4OXWA 1O7KA 2RAKA 2V14A 2Q12A 4WPEA 1KMDA 2EFKA 1I4DA 2CZOA 1WDZA 3LUIA 3QNIA 4PQPA 4DYLA 3SYVA 2X3VA 4NSWA 2REAA 4DCNC 2V6VA 2V0OA 2CSKA 4AVMA 3QE6A 3M3WA 4BNEA 2IWLX 4ON3A 2C08A 1XTEA 2I4KA 1OCSA 4WPCA 4P2IA 1OCUA 3HAJA 3OK8A 1H6HA 1Y2OA 2WWEA 4ATMA 2RAIA 1GD5A 2EFLA 4AKVA 2REDA 3G9GA 2YKTA 3CAZA 4P2JA 1I49A 3HAIA 4AZ9A 4IKBA 4PZGA 3QWEA 4IKBB 1I4TA 2YPSA 1URUA 2Q13A 3HPBA 1ZWWA 3HPCX 2D4CA 2FICA 3I2WA 1X03A 1I4LA 5C5BA 4PQOA 4FZSA 2L73A 3DYTA 3ABHA 1X04A 3FOGA 2ELBA 3LLLA 4IKDA 4BGJA 3Q0KA 3SOGA 1KQ6A 3P0CA 4NQIA 4H8SA 3PLTA 3ACOA 2X3XA
chains in the Genus database with same CATH superfamily
2YIBA 4HYBA 3T4AG 2Z8YA 3IQ2A 2RT6A 3D4ZA 4R5IA 4JWIA 2Z0NA 3D4YA 2F7PA 1TQWA 4E3CA 1HTYA 1I4DA 4EZUA 1E2UA 2PMRA 3OHXM 3I04A 4HR1A 3VEBA 3EJUA 3DDFA 2CSKA 3BUPA 1SUFA 1SU8A 4BNEA 3CV5A 3DX0A 2C08A 2KHOA 4EZNA 1R33A 1GNLA 1Y2OA 4IWOA 3ER8C 2WWEA 2NCZA 1GD5A 2REDA 2EX3B 3I01A 2YKTA 3O3MB 3CAZA 1DKZA 4HY9A 4JL9A 3BUBA 1I4TA 3EJQA 1DKXA 3HPCX 3I2WA 2MI7A 1X03A 4EZXA 3FD9A 1UPXA 4PQOA 4AZ7A 2L73A 2QKWA 2WYIA 3VKHA 4IKDA 3D2EA 4BGJA 3PLTA 3EJPA 2YL5A 2EWFA 1GNTA 2X3WA 4R5LA 2YIVX 3KDRA 2ALWA 1OAOA 3BLBA 2Z0VA 3Q84A 3LMFA 1TQVA 3HAHA 1HXKA 1OA0A 4JWDA 5FLEX 1XTNA 1DKYA 1PS3A 4F01A 4AZGA 4FM3A 2Q12A 2F1BA 2YI8A 2PY6A 4WPEA 4R5KA 3D52A 2WYHA 1R34A 3LUIA 2ND1A 4EZQA 2WINM 4IWQA 1GN9A 4DYLA 2YL6A 4NSWA 3LVTA 4DCNC 2V6VA 3VEAA 3BUQA 4F00A 3QE6A 2GAFD 2IWLX 4ON3A 1QWNA 3O3NB 4AZCB 2I4KA 1OCSA 4WPCA 4EZVA 3DDGA 3DX2A 3HAJA 4IW0A 3CZSA 3RPMA 1U00A 3EJSA 2RAIA 3ERCC 4AKVA 4JWCA 1QWUA 3RV1A 3CVRA 4R5GA 1YWMA 2ZXQA 2ND0A 1SU7A 4EZYA 2GA9D 2FYVA 2O0I1 3BVWA 3HAIA 1O7DC 4JNEA 2F7RA 4IKBB 2Q13A 1O7DB 3BVVA 5C5BA 4FZSA 2YIAA 3DYTA 4EZZA 3ABHA 4AZHA 1QX1A 3FOGA 1KQ6A 5KBPA 3DPOA 4H8SA 2F7QA 3T47A 4B9QA 3DX4A 4R5JA 2ETTA 2D1LA 3O3OB 3L3OM 4PO2A 2RAJA 2DYBA 4HASA 4E81A 4I1QA 2GF4A 3RV0A 2JNSA 5C5BB 5FIGA 4UDXX 1JQKA 2RAKA 2V14A 4IM3A 1KMDA 3D50A 2OW7A 2EFKA 4JN4A 3T48A 1WDZA 4PQPA 3SYVA 1W9MA 1TQTA 3CKDA 4IM2A 2YI9A 2X5CA 2REAA 2V0OA 1HWWA 3L3PA 3B53X 2N3KA 3M3WA 4EZTA 4AZBA 4D8JA 4AZCA 3I39X 4H6HA 3DPPA 3OK8A 4M0MA 2YL9A 4ATMA 5E84A 3UITA 2EFLA 3EJRA 4KIKA 2OO2A 4IM0A 3QA8A 3D2FA 2OW6A 2JNKA 1I49A 2OBLA 4JNFA 1MJGA 3BUIA 4IKBA 3F7WA 1URUA 5TKYA 4EZOA 2FICA 3BVTA 2LXYA 1TQUA 1I4LA 3C7NA 3DX3A 3B52X 1X04A 4KIKB 3LLLA 1TQSA 3P0CA 2F18A 3ACOA 2X3XA 1E1DA 1ZYLA 2LM0A 2AR5A 3GI7A 1R5EA 3BVXA 3DX1A 3OWGA 3ER9B 2Z0OA 4UDYX 4EZRA 1OA1A 4OXWA 1O7KA 2OBMA 2F7OA 2F1AA 4EZSA 4H6IA 3KAVA 3T46A 4NPHA 3EJTA 2CZOA 3QNJA 4EZWA 3QNIA 2X3VA 4HR1B 4FZOA 2QXLA 3D51A 4AVMA 2OZNB 1XTEA 3B51X 4P2IA 4IWPA 1OCUA 1H6HA 4EZPA 3KAWA 3G9GA 3CZNA 1SU6A 3T49A 4P2JA 4AZ9A 4PZGA 3QWEA 1LQ7A 2YPSA 2YLAA 3BUDA 3HPBA 1ZWWA 2D4CA 3DPQA 3ZEDA 4FZPA 4JLCA 2YL8A 4AZ6A 4AZ5A 4AZIA 4JWEA 3BVUA 2ELBA 4G6QA 3Q0KA 3SOGA 1E9VA 4NQIA 2QFFA 2YLLA 3A98A
chains in the Genus database with same CATH topology
2X3WA 2AR5A 2ETTA 2D1LA 3IQ2A 2Z0VA 3Q84A 2RAJA 2DYBA 4HASA 3HAHA 4I1QA 2Z0OA 1XTNA 5C5BB 2Z0NA 4OXWA 1O7KA 2RAKA 2V14A 2Q12A 4WPEA 1KMDA 2EFKA 1I4DA 2CZOA 1WDZA 3LUIA 3QNIA 4PQPA 4DYLA 3SYVA 2X3VA 4NSWA 2REAA 4DCNC 2V6VA 2V0OA 2CSKA 4AVMA 3QE6A 3M3WA 4BNEA 2IWLX 4ON3A 2C08A 1XTEA 2I4KA 1OCSA 4WPCA 4P2IA 1OCUA 3HAJA 3OK8A 1H6HA 1Y2OA 2WWEA 4ATMA 2RAIA 1GD5A 2EFLA 4AKVA 2REDA 3G9GA 2YKTA 3CAZA 4P2JA 1I49A 3HAIA 4AZ9A 4IKBA 4PZGA 3QWEA 4IKBB 1I4TA 2YPSA 1URUA 2Q13A 3HPBA 1ZWWA 3HPCX 2D4CA 2FICA 3I2WA 1X03A 1I4LA 5C5BA 4PQOA 4FZSA 2L73A 3DYTA 3ABHA 1X04A 3FOGA 2ELBA 3LLLA 4IKDA 4BGJA 3Q0KA 3SOGA 1KQ6A 3P0CA 4NQIA 4H8SA 3PLTA 3ACOA 2X3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3W A;  2AR5 A;  2ETT A;  2D1L A;  3IQ2 A;  2Z0V A;  3Q84 A;  2RAJ A;  2DYB A;  4HAS A;  3HAH A;  4I1Q A;  2Z0O A;  1XTN A;  5C5B B;  2Z0N A;  4OXW A;  1O7K A;  2RAK A;  2V14 A;  2Q12 A;  4WPE A;  1KMD A;  2EFK A;  1I4D A;  2CZO A;  1WDZ A;  3LUI A;  3QNI A;  4PQP A;  4DYL A;  3SYV A;  2X3V A;  4NSW A;  2REA A;  4DCN C;  2V6V A;  2V0O A;  2CSK A;  4AVM A;  3QE6 A;  3M3W A;  4BNE A;  2IWL X;  4ON3 A;  2C08 A;  1XTE A;  2I4K A;  1OCS A;  4WPC A;  4P2I A;  1OCU A;  3HAJ A;  3OK8 A;  1H6H A;  1Y2O A;  2WWE A;  4ATM A;  2RAI A;  1GD5 A;  2EFL A;  4AKV A;  2RED A;  3G9G A;  2YKT A;  3CAZ A;  4P2J A;  1I49 A;  3HAI A;  4AZ9 A;  4IKB A;  4PZG A;  3QWE A;  4IKB B;  1I4T A;  2YPS A;  1URU A;  2Q13 A;  3HPB A;  1ZWW A;  3HPC X;  2D4C A;  2FIC A;  3I2W A;  1X03 A;  1I4L A;  5C5B A;  4PQO A;  4FZS A;  2L73 A;  3DYT A;  3ABH A;  1X04 A;  3FOG A;  2ELB A;  3LLL A;  4IKD A;  4BGJ A;  3Q0K A;  3SOG A;  1KQ6 A;  3P0C A;  4NQI A;  4H8S A;  3PLT A;  3ACO A;  2X3X A; 
#chains in the Genus database with same CATH topology
 2YIB A;  4HYB A;  3T4A G;  2Z8Y A;  3IQ2 A;  2RT6 A;  3D4Z A;  4R5I A;  4JWI A;  2Z0N A;  3D4Y A;  2F7P A;  1TQW A;  4E3C A;  1HTY A;  1I4D A;  4EZU A;  1E2U A;  2PMR A;  3OHX M;  3I04 A;  4HR1 A;  3VEB A;  3EJU A;  3DDF A;  2CSK A;  3BUP A;  1SUF A;  1SU8 A;  4BNE A;  3CV5 A;  3DX0 A;  2C08 A;  2KHO A;  4EZN A;  1R33 A;  1GNL A;  1Y2O A;  4IWO A;  3ER8 C;  2WWE A;  2NCZ A;  1GD5 A;  2RED A;  2EX3 B;  3I01 A;  2YKT A;  3O3M B;  3CAZ A;  1DKZ A;  4HY9 A;  4JL9 A;  3BUB A;  1I4T A;  3EJQ A;  1DKX A;  3HPC X;  3I2W A;  2MI7 A;  1X03 A;  4EZX A;  3FD9 A;  1UPX A;  4PQO A;  4AZ7 A;  2L73 A;  2QKW A;  2WYI A;  3VKH A;  4IKD A;  3D2E A;  4BGJ A;  3PLT A;  3EJP A;  2YL5 A;  2EWF A;  1GNT A;  2X3W A;  4R5L A;  2YIV X;  3KDR A;  2ALW A;  1OAO A;  3BLB A;  2Z0V A;  3Q84 A;  3LMF A;  1TQV A;  3HAH A;  1HXK A;  1OA0 A;  4JWD A;  5FLE X;  1XTN A;  1DKY A;  1PS3 A;  4F01 A;  4AZG A;  4FM3 A;  2Q12 A;  2F1B A;  2YI8 A;  2PY6 A;  4WPE A;  4R5K A;  3D52 A;  2WYH A;  1R34 A;  3LUI A;  2ND1 A;  4EZQ A;  2WIN M;  4IWQ A;  1GN9 A;  4DYL A;  2YL6 A;  4NSW A;  3LVT A;  4DCN C;  2V6V A;  3VEA A;  3BUQ A;  4F00 A;  3QE6 A;  2GAF D;  2IWL X;  4ON3 A;  1QWN A;  3O3N B;  4AZC B;  2I4K A;  1OCS A;  4WPC A;  4EZV A;  3DDG A;  3DX2 A;  3HAJ A;  4IW0 A;  3CZS A;  3RPM A;  1U00 A;  3EJS A;  2RAI A;  3ERC C;  4AKV A;  4JWC A;  1QWU A;  3RV1 A;  3CVR A;  4R5G A;  1YWM A;  2ZXQ A;  2ND0 A;  1SU7 A;  4EZY A;  2GA9 D;  2FYV A;  2O0I 1;  3BVW A;  3HAI A;  1O7D C;  4JNE A;  2F7R A;  4IKB B;  2Q13 A;  1O7D B;  3BVV A;  5C5B A;  4FZS A;  2YIA A;  3DYT A;  4EZZ A;  3ABH A;  4AZH A;  1QX1 A;  3FOG A;  1KQ6 A;  5KBP A;  3DPO A;  4H8S A;  2F7Q A;  3T47 A;  4B9Q A;  3DX4 A;  4R5J A;  2ETT A;  2D1L A;  3O3O B;  3L3O M;  4PO2 A;  2RAJ A;  2DYB A;  4HAS A;  4E81 A;  4I1Q A;  2GF4 A;  3RV0 A;  2JNS A;  5C5B B;  5FIG A;  4UDX X;  1JQK A;  2RAK A;  2V14 A;  4IM3 A;  1KMD A;  3D50 A;  2OW7 A;  2EFK A;  4JN4 A;  3T48 A;  1WDZ A;  4PQP A;  3SYV A;  1W9M A;  1TQT A;  3CKD A;  4IM2 A;  2YI9 A;  2X5C A;  2REA A;  2V0O A;  1HWW A;  3L3P A;  3B53 X;  2N3K A;  3M3W A;  4EZT A;  4AZB A;  4D8J A;  4AZC A;  3I39 X;  4H6H A;  3DPP A;  3OK8 A;  4M0M A;  2YL9 A;  4ATM A;  5E84 A;  3UIT A;  2EFL A;  3EJR A;  4KIK A;  2OO2 A;  4IM0 A;  3QA8 A;  3D2F A;  2OW6 A;  2JNK A;  1I49 A;  2OBL A;  4JNF A;  1MJG A;  3BUI A;  4IKB A;  3F7W A;  1URU A;  5TKY A;  4EZO A;  2FIC A;  3BVT A;  2LXY A;  1TQU A;  1I4L A;  3C7N A;  3DX3 A;  3B52 X;  1X04 A;  4KIK B;  3LLL A;  1TQS A;  3P0C A;  2F18 A;  3ACO A;  2X3X A;  1E1D A;  1ZYL A;  2LM0 A;  2AR5 A;  3GI7 A;  1R5E A;  3BVX A;  3DX1 A;  3OWG A;  3ER9 B;  2Z0O A;  4UDY X;  4EZR A;  1OA1 A;  4OXW A;  1O7K A;  2OBM A;  2F7O A;  2F1A A;  4EZS A;  4H6I A;  3KAV A;  3T46 A;  4NPH A;  3EJT A;  2CZO A;  3QNJ A;  4EZW A;  3QNI A;  2X3V A;  4HR1 B;  4FZO A;  2QXL A;  3D51 A;  4AVM A;  2OZN B;  1XTE A;  3B51 X;  4P2I A;  4IWP A;  1OCU A;  1H6H A;  4EZP A;  3KAW A;  3G9G A;  3CZN A;  1SU6 A;  3T49 A;  4P2J A;  4AZ9 A;  4PZG A;  3QWE A;  1LQ7 A;  2YPS A;  2YLA A;  3BUD A;  3HPB A;  1ZWW A;  2D4C A;  3DPQ A;  3ZED A;  4FZP A;  4JLC A;  2YL8 A;  4AZ6 A;  4AZ5 A;  4AZI A;  4JWE A;  3BVU A;  2ELB A;  4G6Q A;  3Q0K A;  3SOG A;  1E9V A;  4NQI A;  2QFF A;  2YLL A;  3A98 A; 
#chains in the Genus database with same CATH homology
 2X3W A;  2AR5 A;  2ETT A;  2D1L A;  3IQ2 A;  2Z0V A;  3Q84 A;  2RAJ A;  2DYB A;  4HAS A;  3HAH A;  4I1Q A;  2Z0O A;  1XTN A;  5C5B B;  2Z0N A;  4OXW A;  1O7K A;  2RAK A;  2V14 A;  2Q12 A;  4WPE A;  1KMD A;  2EFK A;  1I4D A;  2CZO A;  1WDZ A;  3LUI A;  3QNI A;  4PQP A;  4DYL A;  3SYV A;  2X3V A;  4NSW A;  2REA A;  4DCN C;  2V6V A;  2V0O A;  2CSK A;  4AVM A;  3QE6 A;  3M3W A;  4BNE A;  2IWL X;  4ON3 A;  2C08 A;  1XTE A;  2I4K A;  1OCS A;  4WPC A;  4P2I A;  1OCU A;  3HAJ A;  3OK8 A;  1H6H A;  1Y2O A;  2WWE A;  4ATM A;  2RAI A;  1GD5 A;  2EFL A;  4AKV A;  2RED A;  3G9G A;  2YKT A;  3CAZ A;  4P2J A;  1I49 A;  3HAI A;  4AZ9 A;  4IKB A;  4PZG A;  3QWE A;  4IKB B;  1I4T A;  2YPS A;  1URU A;  2Q13 A;  3HPB A;  1ZWW A;  3HPC X;  2D4C A;  2FIC A;  3I2W A;  1X03 A;  1I4L A;  5C5B A;  4PQO A;  4FZS A;  2L73 A;  3DYT A;  3ABH A;  1X04 A;  3FOG A;  2ELB A;  3LLL A;  4IKD A;  4BGJ A;  3Q0K A;  3SOG A;  1KQ6 A;  3P0C A;  4NQI A;  4H8S A;  3PLT A;  3ACO A;  2X3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...