3DZ1A

Crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
b'SLKLTPEAAGTFAIAPTPFHDDGKIDDVSIDRLTDFYAEVGCEGVTVLGILGEAPKLDAAEAEAVATRFIKRAKSMQVIVGVSAPGFAAMRRLARLSMDAGAAGVMIAPPPSLRTDEQITTYFRQATEAIGDDVPWVLQDYPLTLSVVMTPKVIRQIVMDSASCVMLKHEDWPGLEKITTLRGFQKDGSLRPLSILCGNGGLFLDFEMERGADGAMTGYCFPDMLVDVVKLSKAGQRDLAHNLFDAHLPLIRYEHQQGVGLSVRKYVLKKRGLLSSSAQRKPGASLTDTAREEVDYLLSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
molecule tags Lyase
source organism Rhodopseudomonas palustris
publication title Crystal structure of Dihydrodipicolinate Synthase from Rhodopseudomonas palustris at 1.87A resolution
rcsb
total genus 109
structure length 301
sequence length 301
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3dz1A00
2OJPA 3DKJA 1AW5A 2Z2UA 2TMDA 2WKJA 3CEPA 5E0KA 3RK8A 3NPUA 3AO0A 3BGJA 3W9ZA 3W2KA 3A23A 5KITA 2V0TA 2RDUA 4U28A 3M7WA 3TAKA 3G1AA 4O12A 4M6VA 3LM7A 3I7RA 3NQGA 3TW7A 1T96A 4UFMA 4IX0A 2V30A 1IIGA 3S1WA 2OMAA 5FESA 1XM3A 2A1YA 2WSQA 3CWNA 2G97A 3TC6A 2CFFA 1WAUA 4NXKA 1W31A 3OA3A 1TREA 2YW4A 1SPQA 4UNKA 4E2DA 4L4MA 3STEA 4JTEA 5I3FA 3C6CA 4FX6M 5DCDA 3O06A 2A4AA 3EXRA 4AVFA 5EMUA 1JRCA 2CZEA 2P0OA 3T55A 4OT7A 1FCQA 2XN1A 5G1TA 5KZEA 5E1QA 2Y7GA 4E0CA 4IX2A 2XN2A 3GXPA 1G67A 2BX7A 4S2CA 1K8ZA 2H8ZA 1DVJA 3MI2A 2ZRYA 5F4WA 3GDKA 1BWLA 4UC5A 3W7IA 5G1YA 3W85A 2W6RA 4UIOA 4GE8A 2W0UA 2CLKA 4NJHA 3S5ZA 3NQ6A 2A21A 3W3OA 5G5IA 2QCNA 1VJIA 1X8FA 2O7QA 3HMJG 3W2MA 4OBTA 3EWWA 3EXTA 3NL5A 1Z48A 3QMSA 3VNDA 4ADUA 4BI6A 4JTIA 4LWWA 3WJWA 1I2PA 1O4UA 5HWMA 1KLZA 3HGOA 3G24A 3UPWA 3ZS4A 3TJLA 3EWBX 1QNVA 2WO5A 5BOOA 3W07A 3I7SA 3QPYA 5CZ0A 4EIVA 1A50A 4C1LA 4W9TA 4AF0A 5DY3A 2E6FA 3BGGA 2ZRXA 3FYPA 4AEOA 1LOQA 3S1XA 2ZZ1A 3BG9A 1LOSA 1KW1A 4ZQMA 5K4XA 4HN4A 1FY6A 2C15A 1P5BA 3O63A 1Q45A 3NVTA 3HF3A 3E9AA 3TKFA 2ZZ7A 3CT7A 4DO4A 3BLEA 1IXPA 2HMCA 5FEXA 4OGZA 1TPVA 3I7QA 3TIMA 1IXOA 1VRDA 1DBTA 3P5YA 1MZHA 1FWTA 5KSWA 3Q37A 3UZJA 4JY9A 2FPTA 3TMLA 3N2MA 2VFHA 3FJLA 2PRLA 2J27A 1O5KA 2Z6IA 3S8HA 5GVJA 4LRTA 1TPWA 3IIOA 4PEKA 1EEPA 4JDYA 2ZTJA 3TSMA 4DF0A 5K3VA 1LTDA 3PUOA 3LDVA 4FIRA 1QOQA 4RXFA 4O4WA 1Z44A 2BZNA 4LT9A 1TPC1 4JTJA 4JTLA 3S1VA 4CNPA 3UWVA 1OJXA 4N02A 2FQIA 4IGHA 1F73A 5ABTA 1S5WA 3DENA 1Y0EA 1YADA 1LRQA 2X1RA 3FOKA 2VEKA 3H54A 1QPNA 1OYAA 1I4NA 2CW6A 1EUAA 2QJGA 1RQBA 4IPJA 1EIXA 3G0SA 3U6WA 2FFCA 2X1UA 4FEZA 4RK8A 1KV5A 1EP2A 1EWDA 1GVSA 3DGRA 5J5DA 1S5VA 4K7YA 4MKNA 2WNQA 4GUJA 1TTJA 1KFLA 5F1VA 1MXSA 3HJZA 3P5ZA 4O53A 5HR7A 5EY5A 3LRKA 4LC6A 3T7VA 1VHNA 2YXGA 3BPWA 4EF8A 2CLFA 4FNPA 4XBKA 3GYEA 3NQ7A 3HGSA 1R2SA 4GBUA 5AHFA 3E96A 4BWLA 2G95A 1OX4A 1NSJA 1QPOA 5F2IA 2B7NA 3U2OA 3W73A 1AK5A 5AFDA 1VR6A 4JR5A 1XFBA 4IMDA 4O13A 3TNOA 2ZZ6A 3FIGA 4M5PA 3R89A 4O11A 3S42A 3NA8A 3EKZA 2WNZA 4OE7A 3WK1A 1VGAA 3EX2A 4OV9A 3IGSA 1FQ0A 4LS0A 4Y90A 1OYBA 4AHQA 1MSSA 4Y6GA 3W7JA 3N3MA 1FXPA 3HGJA 5E93A 3W74A 4BI7A 5D37A 4O50A 2BTMA 1Q6RA 1OFRA 2YFOA 3TXVA 3L21A 2GQAA 3LLFA 4MOZA 3LRLA 1W3NA 1WX0A 4A22A 3PBWA 5HUOA 5C5YA 4HT3A 3CLMA 1L9WA 1SR9A 4A21A 3ELFA 1B57A 5BNKA 1XUZA 4IQLA 1TYGA 2CLIA 3W7KA 1A5AA 3LHTA 4RLIA 1EA0A 1FX6A 1KM3A 4MY9A 3DKLA 2ZCGA 1KLYA 1EPXA 2ZZ5A 1SSDA 5FEWA 4BI5A 3OEXA 4XBSA 3I68A 3NQCA 3PG8A 2RFGA 5BMXA 2X16A 1OF8A 3QC3A 5U4NA 3QMRA 3W1MA 2VFIA 1GOXA 4O1DA 1N8FA 3LCFA 1KA9F 3M1ZA 4MPQA 1OYCA 1FDZA 3EKLA 2P10A 5CKSA 3O05A 4FHAA 1LYXA 3G1DA 3LLDA 4GJ1A 3CU2A 1I45A 1AMKA 2HS8A 2C19A 3KVJA 3LERA 3F4WA 3TC7A 5AN7A 1QFEA 2ZA3A 1ICSA 2Y63A 2OCZA 4JY8A 3MHFA 3SIZA 4UMAA 3WK3A 4ONVA 4O0ZA 2DZXA 3O8AA 3EXSA 4Z1AA 2DZUA 4O0KA 3HO8A 3NL3A 1JCJA 5CPOA 1XBZA 3TK7A 1UUMA 3GKFA 3PVFA 1YDVA 2W79A 3LXCA 1GG1A 3BLFA 2OT0A 3N34A 1GJPA 1TRIA 2NXHA 4K37A 3DFOA 3MWAA 5EA9A 4O1AA 3CIWA 4FXSA 3ATYA 3BV4A 4WY0A 3MP4A 1H1ZA 1TMHA 1UBSA 1WBJA 1G4EA 3B03A 1KV8A 3WK2A 5L6UA 3W88A 1FBAA 1M5WA 3TXZA 1VCFA 3V1PA 1W1ZA 5C54A 3O6DA 1H5YA 4JICA 4PCFA 4N9DA 1XI3A 2QCFA 3L68A 3PSVA 5D04C 3DFTA 5I3KA 3OHIA 3VI2A 1JUKA 3GDMA 3C2OA 4DXVA 2FLIA 5D2YA 4LY8A 3M44A 3EB2A 2X30A 3NZ1A 3G1YA 4TMBA 3PM6A 2NLIA 3LCIA 4AF0B 4GUHA 3W83A 1X7FA 1TPH1 4PL1A 3LI0A 5LZLA 4UNLA 1BWKA 2FDSA 1RQEA 2YFNA 3IRDA 2NV2A 3FYOA 1AL8A 3NAVA 2ZRWA 6ALDA 4NUWA 3PC0A 1SW3A 3LI1A 1XBVA 1TTIA 4UFLA 2FPYA 1FWWA 5D2VA 5LKYA 2J9XA 4FX8A 4MLRA 4MJZA 3JS3A 4YMZA 1H7RA 3V75A 3VE7A 3TV8A 4NX0A 3B06A 4Z0SA 4MZYA 1R47A 4KWWA 4LS1A 4A2RA 2DORA 4J9JA 1KTNA 5MHBA 3EX1A 3C56A 3LV6A 4M7TA 5TBOA 4UFIA 4R7JA 5G4EA 2ZA2A 3TQVA 3DFPA 3L0GA 2YPIA 4POCA 4X9SA 3LV5A 4P2VA 1QDSA 4I7WA 1EWEA 1WYIA 5AOUA 1I2QA 4O17A 4QIUA 1PS9A 4JTHA 3W1PA 2FB2A 3GZ3A 3UNDA 4JTSA 2ZYFA 4NZJA 1OF6A 3S0CA 3ZR4A 1I2OA 1TV5A 4RXGA 3RLUA 3C8FA 2ZFAA 4GUGA 3R13A 1VS1A 5LNWA 4JTTA 3GXTA 1TTQA 3TU9A 4DF2A 3G0XA 3W2JA 4KKXA 4JX5A 1XBXA 3NQ2A 4EVZA 1W5MA 2WOQA 1GTEA 4Z08A 5D30A 1AW1A 3L0NA 4HNTA 3UPBA 2QEZA 1NAL1 2OZ0A 2ZBTA 4DQWA 3IVUA 3WJZA 3BO9A 2I9EA 3GB6A 1YXCA 1Z41A 1B3OA 4UMBA 4AWTA 5K2ZA 1W8SA 2JGYA 3MO7A 2ZA1A 2V2CA 3OBKA 5D2XA 1YDNA 2ATSA 3UYCA 2GJLA 3HGRA 2ZZ2A 3DFSA 2VEIA 3IGUA 1YTKA 4UTIA 4HSOA 2NUYA 3GR8A 1PHQA 1IXNA 2HS6A 3W1NA 2J6XA 1TSIA 3HIJA 3L9CA 1QCWA 1SO5A 3TW6A 1W3TA 5G2WA 1CI1A 3G1SA 5HJLA 1Q6LA 4QSHA 4UTKA 3SJ3A 4NQ1A 3OVRA 4AWSA 3PAJA 2WJZA 4O28A 4NJIA 4UXDA 3IVTA 2CLLA 3MP3A 4UTLA 3KRSA 3GVGA 3P84A 4DO5A 1OX6A 3BLIA 1OK6A 2NX3A 5DXYA 3C2FA 3L66A 3H53A 3IGXA 3LCLA 3UWUA 1OFDA 4O8RA 2B7PA 2A2IA 1TV8A 4O15A 1KFJA 1VCVA 4NJGA 1W56A 1PHWA 1SU5A 4WOQA 4ORIA 3LOTA 5D02A 1ZAIA 4LRSA 2ZTKA 3T4CA 4HPXA 5BMWA 3STFA 3TAOA 1I8JA 4FNUA 4UTHA 3P82A 1KM6A 2A0NA 4PODA 2V2DA 2PRHA 1A5CA 4GWEA 3TJXA 2R14A 1DQWA 1WA3A 2NWRA 1JCYA 4NXSA 1TIMA 3VKJA 2V5LA 3W23A 5FF0A 3PF3A 3JR2A 3THAA 2H6RA 1G7UA 5DELA 2ZDRA 1D9EA 3B04A 3SZ8A 4K6AA 2RDTA 4NU7A 5DBUA 3CQ0A 2CLEA 3CIXA 3PB2A 3USBA 1SZFA 5CZSA 1J4EA 3W7EA 1K7XA 3A22A 3DFNA 2C16A 3WJSA 3PG9A 4O52A 1CX9A 1L6YA 1S3HA 2FB3A 3HOJA 4XUGA 3DI0A 3G1HA 1YTEA 4OV4A 2Y7FA 1OABA 5C6MA 1EP3A 3KRUA 2H3BA 1XL9A 3N73A 2ISWA 4K7VA 2CLOA 2QCHA 3W1AA 2V81A 3MHGA 2NV1A 1FCBA 1QO2A 3LX9A 4KWVA 4IOTA 2NZLA 2BWGA 4P61A 4H3DA 2G96A 4Z1DA 1UB3A 5CSSA 3A24A 1TRDA 3R12A 1T0OA 2PC4A 4Q32A 1SQ7A 1GZGA 3QMTA 2QAPA 5TIMA 1NF0A 2VFFA 1NF7A 1PV8A 4GFSA 1K03A 1JCXA 1GVOA 3EEGA 1GYNA 5J5RA 1UCWA 4HIBA 4ZMGA 2CLMA 3W2NA 1PE1A 3UZ5A 1JQVA 3S1UA 4EWND 1VCGA 1WDWA 1KM2A 4ZQRA 1KTBA 3MMTA 3R2GA 3MBDA 3SW6A 5I3IA 3EWZA 3LCWA 3W1LA 4NZFA 3TFXA 2V2HA 4JGDA 5KZDA 3CM4A 3NEVA 5K7JA 5KINA 2Y6ZA 1F74A 3P80A 1KFBA 3C2RA 2IQTA 1OK4A 3S9YA 4EOUA 3L5LA 5D38A 1R30A 5CZJA 5KTLA 3EX6A 3O6YX 2UV8G 5CPLA 2CZ5A 4QISA 1RV8A 5HWNA 4LS2A 1KM1A 3G1FA 1GTHA 4ADSA 1L6SA 3RFAA 1OFOA 8TIMA 5K9XA 5BW6A 2ZRVA 5FEZA 4OU1A 4CNNA 1QOPA 3ABSA 4QITA 4TX9A 1VH7A 1SO6A 3W75A 4NX5A 1P0NA 3NQEA 2AQWA 5F2MA 1LROA 1H60A 4Z0JA 1PVNA 3LBCA 5I3JA 3QSTA 4JIPA 3OVPA 5AHEA 3STCA 1JVNA 5I3GA 3NQ8A 5D2TA 2XN0A 1Q3NA 3MJYA 1RD5A 3F4NA 1MO0A 5G2HA 1FWRA 1M7PA 3SGUA 1W37A 3QW4B 4LVBA 4X3ZA 3EWYA 3N2XA 1R2RA 1TPB1 1SZNA 4A29A 4ZQOA 3OVQA 2PE4A 3C0JA 3LXBA 3A21A 1W5NA 4O54A 1B4KA 3NR0A 4LUIA 4UR7A 3P8JA 4YWIA 1JR1A 2E77A 3TROA 1OX4B 2Q3OA 1ZCOA 1E51A 2VFDA 4LV9A 1JCLA 1F76A 2O7SA 4HHPA 3UXAA 3NXFA 4MFEA 1TPUA 1W54A 2OT1A 5FI8A 4RCXA 3G3DA 1P4CA 1HO1A 1VYPX 2I1OA 4PA8A 1GVQA 1HO4A 1G4PA 3LHWA 3B0VC 4CQAA 1MEWA 3L67A 3M6YA 3NQFA 1JCMP 2DZWA 1PCKA 1L2UA 4Q33A 4DBEA 3QFEA 3NOEA 5F4XA 4LTSA 1DL3A 2V9DA 4LVFA 5D2WA 3BG3A 2VEPA 3VFLA 3TQKA 2GPTA 2Y85A 3P67A 1RQHA 4O57A 5DBTA 3EWXA 2F7FA 4O16A 1XDLA 3MI3A 4G1KA 4UTWA 1JULA 5LNRA 1RVGA 2Y88A 3L5MA 5D33A 2A6LA 4DO6A 3GXNA 1S5TA 1F6KA 4AH7A 3WFAA 1KFKA 1FWSA 3IIPA 5FF7A 1J5TA 5SWUA 3W7LA 3ABRA 2JKEA 1O94A 3LRMA 3R8RA 1YXDA 1DQXA 3MYPA 3FKKA 4CCDA 4FNTA 1PIIA 3FEMA 5F1UA 1A53A 3T40A 3GAKA 1VHCA 2BLEA 1HG3A 3UWWA 1ONRA 1TQJA 1GWJA 1LORA 2I14A 4I9AA 2C0AA 2GVGA 5FEPA 5LHEA 4K39A 2A7RA 5DLCA 1OFBA 4NT0A 1ME8A 2A7NA 1H50A 1GVFA 3M5YA 3PBUA 3STGA 4O19A 1QAPA 2E09A 2EHHA 3PBYA 4TU1A 3W7DA 4YCPA 1VC4A 1ML1A 1OX5A 3E02A 3TCEA 2WV8A 1TJPA 1C8VA 3F03K 3B05A 1ZHAA 1H62A 3F1QA 7TIMA 3I6RA 3O6CA 3BG5A 3GX9A 3QSRA 2DZTA 2QCGA 2NWSA 4QM1A 1H51A 3LGEA 3FJ6A 3GDLA 2Q8ZA 1FDYA 1K8XA 1VLWA 4RZ4A 3C2EA 5LGXA 1H7OA 3W2UA 4LOCA 3C2VA 3PSWA 1K02A 4MVAA 4A3UA 2NXGA 5KMYA 4DF1A 3SR7A 3THQA 2CWNA 4S2BA 4CQ8A 4MZ8A 2X1SA 4IMEA 4Z1CA 2E6DA 3TA6A 2Y70A 2ISVA 2GJNA 3WJYA 3P61A 5AB3A 3CEUA 3S5OA 4N9BA 3IEBA 4XKYA 3LTSA 2JKPA 4QNEA 4BR1A 1IXQA 3G0UA 4UTWC 4CCEA 4MUZA 3RNDA 3E0IA 4PC8A 3O15A 3LHYA 4NVTA 4UUIA 3SI9A 4AB4A 4IXXA 1B4EA 5HULA 4M19A 4NNCA 3P8IA 4WUIA 2Y89A 3DAQA 1K8YA 1VYSX 1XCFA 3BK0A 5AHLA 1BTMA 2GVLA 4XQ6A 1WOAA 4UCGA 1N7KA 1YLVA 3ANYA 2Y7DA 4FNRA 4ZL1A 1LCOA 3LCXA 1X1ZA 5DCEA 4QNWA 3LTPA 2QCMA 3IVSA 4N9EA 4UTTC 1GT8A 4UTUA 1ADOA 3ZWSA 3AJXA 3M0ZA 1KFEA 3W71A 1XKYA 2DZVA 5CPMA 4AMAA 5K4ZA 3M16A 3WK0A 4QQ3A 5HNRA 4FNQA 4UTMA 2VC6A 3HPZA 3P74A 3WJXA 1C29A 5LGZA 4DPQA 4MJMA 1H7PA 3PUDA 4IPIA 1WV2A 4WXZA 1F2JA 4O10A 1VLIA 1P1XA 3W86A 1PCWA 1RR2A 2BXVA 3UWYA 3DU0A 3NYZA 3M5VA 3TX9A 2Z0IA 3L65A 4KFOA 2P1FA 1R46A 5HWJA 4K38A 5LNSA 3KHJA 1UASA 2AGKA 5CG7A 5DN1A 1SZEA 4OHQA 3JRKA 4ORMA 2Y61A 3LHVA 3PR2A 3QQ0A 1LBMA 1LZOA 1L6WA 5IBXA 4AHOA 3I65A 4MZ1A 3NG3A 1ZNNA 1XUUA 4ALDA 2H3DA 4JN6A 1T8XA 5HR6A 2H8XA 3M5ZA 4JTUA 4FX7A 4ZZ9A 2GUUA 3PY2A 3PUEA 1FWNA 2A6NA 4GXMA 4OWGA 1SO3A 1AW2A 5C55A 1K7EA 3LCHA 3KX6A 3QQ1A 3M43A 4JTKA 1SW0A 2QJIA 5KZMA 1F05A 1TPDA 1T99A 1TTPA 3TSBA 5CPNA 3W7PA 4M6QA 4PL2A 3UY7A 1KFCA 3G3MA 2FJKA 3NGJA 1O5XA 4LVAA 3W76A 3UQNA 4ZQNA 3A9IA 4XTDA 1UJPA 1DORA 4WY0B 1W5OA 1QO5A 4X2RA 4UTJA 1LBLA 3W1XA 1OG0A 3CPRA 3P62A 1LLWA 4TIMA 2DJXA 3NNTA 3TE9A 3CTLA 4TO8A 1ZFJA 3DH7A 2Q8LA 1EP1A 2QAFA 1V5XA 4WXYA 3INPA 4JYEA 1YYAA 1SZGA 1D3HA 4DPPA 3MHUA 1Z42A 3QZEA 3SSJA 4HNUA 3GLCA 4UR8A 1G6CA 3PB0A 1QPQA 3Q94A 1DKWA 1WBHA 5K9DA 3W1QA 2DP3A 5AYZA 3Q2DA 1VPXA 5LNVA 1WQ5A 1LP6A 3E49A 3ZWTA 3TDFA 1OVDA 3MI6A 4WD0A 3N9RA 1W3IA 3NM3A 2R94A 3M47A 1TB3A 2RDWA 3N9SA 4RX0A 4IXHA 4DEFA 1KBIA 3BARA 4IMFA 4WZHA 3RMJA 2X2GA 3TR2A 4O18A 1NVMA 1AG1O 3G1XA 4UFHA 3M5XA 3CB8A 5G2IA 1SFLA 1ZJIA 4MLJA 3ATZA 1JCNA 1TV7A 3DFQA 3W7RA 2Y7EA 3TQ0A 4IJBA 5AHNA 3SGZA 3QF0A 1GYLA 3D0CA 2BSLA 3KFTA 2E5DA 3HG3A 1W0MA 2GOUA 3N19B 4EF9A 2Q3RA 1YPFA 2VFEA 4MY1A 4XTIA 2WPBA 3LHUA 3W7MA 3T78A 3TH6A 4MYAA 1B9BA 1LM1A 1TQXA 3NPVA 4FO4A 3LTYA 1TJRA 2YW3A 3MW7A 3CWOX 3UY8A 3P7YA 1YPIA 2ZZ3A 2E6AA 2VEMA 5F4SA 3H55A 2FIQA 2A5HA 3UWQA 4IMCA 3S5NA 2G5WA 5EYWA 4L4LA 2XFWA 2A7PA 1KM0A 2DJLA 1FCVA 4JX6A 1NEYA 3FFSA 3FKRA 4GUIA 1JQXA 3KAOA 2V82A 4GC4A 2EAWA 2VOMA 5L9FA 3P60A 3MUXA 4PFMA 2NXIA 3OIXA 3W84A 3DBPA 1O60A 5DXXA 2OX1A 4BWLC 3HG2A 5CGQA 4AXKA 2QCCA 3KVLA 4ZVJA 2B0MA 3EX4A 5H91A 1X1OA 2B7OA 1FDJA 3G22A 4RZ5A 4R34A 3MP5A 4ADTA 2HTMA 2E1DA 3NO5A 3W72A 5TQLA 3KVMA 2VKZG 3IIXA 4E38A 1FUYA 2YR1A 1LBFA 2VENA 1K7FA 2YX0A 2DU2A 4MFDA 3W1UA 1D3GA 3UWZA 3B0PA 1DJNA 4CNOA 1GVRA 2J88A 1OFQA 4LVDA 3DI1A 1P0KA 3NPWA 3W87A 4O1CA 1KTCA 4K8HA 3K30A 4CQ9A 3W7GA 1KM4A 3N14A 1H7WA 1TO3A 1JJKA 3GIYA 3MYOA 4ZQPA 5F2GA 3CHVA 1OFPA 4Z1BA 3HG5A 3UXDA 3W6YA 3W1RA 4JYDA 2H90A 3NPXA 4LU0A 5I3HA 4UTTA 4N6FA 3C4UA 1THFD 2CLHA 4OQVA 5AC7A 1SUXA 3BW2A 2PRMA 3QRHA 5AYXA 2NUXA 1H7XA 2NUWA 1FCUA 3RU6A 4JS3A 3ABOA 5EBUA 3QEZA 1MEHA 3QPZA 1ZALA 2R91A 1DJQA 3SFKA 5LHFA 2J24A 2QCDA 2YCEA 3C3NA 2ALDA 3GNNA 3Q58A 3U8GA 4O14A 3LXAA 2C1HA 1H61A 2JKAA 4LNYA 3O07A 4WY0F 3IIVA 4PH6A 2WQPA 4M6PA 3S6DA 4B5NA 4XWUA 5A5WA 1A5BA 2EPHA 1W5PA 2QKFA 4Y96A 3GDTA 3HG4A 5T26A 1ZENA 1JUEA 4O1BA 3G8RA 2WNNA 4RZ6A 1YDOA 3G8EA 4LW7A 3GR7A 3LHZA 1DOSA 3O16A 4NNAA 2JGQA 1H63A 1QWGA 4JTGA 5IM51 4C1KA 4H4IA 3PULA 3TSDA 4H6KA 2ZRZA 3W1TA 1ZAJA 2QUVA 5CZTA 3E12A 3DZ1A 4DELA 1JUBA 1WXJA 1LRTA 1DV7A 3W7CA 4FB7A 1AL7A 1G4SA 2QDGA 4M7SA 4GUFA 5DY2A 2EF9A 3HQ1A 1FXQA 1YTDA 3W2LA 3C61A 3HB9A 4Y9AA 1F7BA 2C14A 4GNJA 5HQEA 4YLWA 2E5BA 1Q6QA 5AHMA 2YYTA 4MIMA 2GVJA 4YCOA 2VFGA 4RV8A 4XKYB 2ABAA 5A8GA 4FXRA 1BKSA 1IF2A 4FNSA 2E6YA 4TR9A 3W70A 2V8ZA 1ICQA 2QJHA 4LUJA 1YXYA 1J2WA 4YXGA 1ME7A 2C13A 4HNVA 3PWAA 3PS7A 1TCDA 3DHDA 2DZSA 2EGZA 4HPJA 2ISSA 1PL9A 3KRZA 4RJEA 4AWUA 3FLUA 1RZMA 1C9DA 2FTPA 1QR7A 2B4GA 3LCGA 5F2LA 2E5CA 5AHIA 5D09A 1OHLA 3OG3A 1KBJA 2C18A 3HPXA 1EB3A 4I7VA 4Y8FA 4CLMA 3L0KA 5BRBA 2ZQ0A 3W7HA 3GK0A 3HPSA 3G18A 5FF4A 1H1YA 3GNDA 2WSRA 3SECA 1ME9A 2DZPA 4XZ9A 5EKYA 2Z1BA 4S1FA 1JRBA 3RLVA 1M6JA 3P81A 5K9CA 5LNUA 4BFAA 3BVJA 1X6UA 1U83A 4JIQA 3TFCA 2QCEA 1TPFA 1EUNA 4JNMA 3QJAA 3HBLA 3NQAA 1G7VA 1LDCA 1XXXA 4WOZA 3VCRA 2TPSA 3B8DA 4PTNA 4QAIA 3GKAA 2PURA 4R53A 3S5YA 1N55A 4LC8A 4N4PA 4NJKA 4HKPA 4Q4KA 3EWUA 2YDAA 2EKCA 4JEQA 1O95A 4TMCA 1GQNA 1IGSA 1HTIA 2GQ9A 3A5FA 3T44A 3FA5A 1GPWA 1CW2A 1M7OA 5FF2A 1H7NA 2E68A 1NFBA 1OFAA 3BW3A 1HFBA 1SO4A 2TYSA 3L5AA 5U7SA 2TSYA 3LB0A 4K36A 5D32A 3VE9A 2B7QA 1UUOA 2R8WA 1F6PA 3NQVA 2NX1A 2ATMA 3NZRA 3CC1A 3EX3A 1A5SA 3W22A 2QUUA 3ABQA 4JD4A 1ALDA 4YL2A 3PBVA 1EX5A 2QCLA 4ZQCA 4MY8A 2Z6JA 2X1TA 5DCBA 4D2JA 5EL1A 3LBMA 5HMSA 2KZHA 4U4MA 3DXIA 2ABBA 2D73A 3A5VA 2V5BA 1LLZA 4DBDA 2HSAA 3KVKA 4E2BA 2ZZ4A 4LV4A 4JDBA 1LRNA 3GAYA 4JXCA 1RPXA 4MYXA 4CCCA 3M9YA 3UD6A 3NQDA 4ICNA 3GDRA 2LLEA 2CZDA 3NQMA 3M41A 2C6QA 2F84A 5AYYA 4N4QA 4KFNA 3L2IA 1GG0A 3QM3A 1WOBA 2WSYA 6TIMA 3QH2A 3SY5A 3ZFHA 2CZFA 4IUOA 2QCDB 4A2SA 2CU0A 4JX4A 1HUVA 4N6EA 2FPVA 1ZAHA 4GRSA 2PCQA 4R33A 5D03A 2RH9A 3RF9A 4RR4A 2VELA 1SSGA 3NL2A 4JYFA 5HUPA 1LOLA 2Y62A 4HNNA 1U5JA 4N2YA 3KOFA 3NM1A 3FS2A 3IIZA 2QF7A 1R2TA 4WQ6A 5FF3A 1QPRA 5AC8A 1OFEA 1W5QA 1I2RA 2GQ8A 3TUUA 4BK9A 4K8EA 3QW3A 1XDMA 1TPEA 4FIQA 4AAJA 1K3UA 2A85A 4IWWA 5EPDA 3TMQA 1XBYA 3B4UA 2C3ZA 2YZRA 5LSMA 2J9YA 4KFPA 4X22A 3O1NA 4AHPA 3KXQA 3MBFA 4HSNA 4RKAA 4JTFA 3DHFA 2YSWA 5H2ZA 1GEQA 1Q6OA 2JK2A 2ZRUA 1QMLA 2QDHA 3R5EA 4NJJA 5D05A 1XC4A 2AAMA 1I2NA 1SFJA 5HINA 2QUTA 3NL6A 4UFJA 3W7QA 3C52A 4LVGA 1G4TA 4UMCA 5C2XA 5AC6A 4WX2A 1SW7A 1ICPA 5IBXC 2YGYA 2J9ZA 1VQTA 4IMGA 3IV3A 1DHPA 2TRSA 3W7OA 4O4VA 4FF7A 4NNBA 5CSRA 1G69A 1KM5A 4UFKA 1VZWA 2RKXA 3W7NA 1VYRA 2RHGA 1ZY9A 1F5ZA 3BW4A 1MEIA 1V7YA 3G1VA 2JBMA 1IIHA 4WJEA 5G4WA 4I7UA 1BEUA 2NX9A 3QYQA 4ML9A 1HL2A 3B0UX 4BF9A 2VXNA 3NDOA 4N9CA 4QJ1A 3YPIA 2YYUA 2QR6A
chains in the Genus database with same CATH superfamily
1XLJA 2OJPA 1UJQA 3VM5A 1H1NA 2Z2UA 4XISA 2TMDA 1E9IA 2CEQA 3AO0A 3BGJA 3REQA 1T41A 2V0TA 2XSAA 4HOXA 4O12A 3M0IA 3E38A 1XQLA 3MZNA 4MSSA 3NQGA 5CG0A 2Z00A 1E1CA 3PZNA 3NZGA 3AQUA 2QJMA 3S1WA 1LL4A 2QLYA 3TC6A 2CFFA 1WAUA 4NXKA 4AZ7A 1SM9A 1ZLPA 2IQ0A 1MDRA 4E2DA 1B90A 2XGZA 3APYA 2POTA 3E2SA 3PHAA 3BAKA 2NSXA 5M17A 1G01A 3ZSSA 4AVFA 5EMUA 2CZEA 2WJDA 3GNOA 5CZKA 1J0KA 3BLOA 4OT7A 1V0NA 2RGMA 2BY3A 4YVXA 5KZEA 3QN3A 1KWGA 4IX2A 2XN2A 3OGRA 3GXPA 1G67A 3QOMA 2CKRA 2ZRYA 4KEUA 3SFWA 4Q7IA 6XIMA 4UIOA 4GE8A 1UR2A 2YZ5A 3QOKA 4QCFA 1CLKA 3HMJG 3FA3A 1OC7A 4PE8A 1DWFM 4Q8PA 4OBTA 4AYSA 2BNJA 1Z48A 5REQB 3UZYA 3VNDA 2ISDA 3KOXA 4LWWA 3WJWA 4RNHA 4BQ3A 1HNYA 1IR2A 3AI0A 4YVPA 3G24A 3UPWA 1NWUA 2XH4A 2Y8KA 3TJLA 3A9BA 4CD6A 4WJ8A 4QSFA 2PTYA 3VD7A 4AF0A 5DY3A 2YCLB 3PTMA 2ZRXA 4PUNA 3VGDA 5HNUA 4WR3A 1LOQA 1UP0A 3S1XA 1FWEC 1FH8A 1F3XA 4B91A 1DWHM 1FY6A 2BHYA 3A47A 1UP2A 5I79A 3SCPA 3O63A 1FWJC 1Q45A 2DGAA 3E9AA 3HF3A 2ZZ7A 2GDUA 1ISWA 4WRHA 1IXPA 2ON3A 1ZGDA 3LBOA 3TOPA 3KBNA 3TIMA 1VRDA 3GE7A 3P6LA 3ZOAA 1W9VA 2DT3A 4JY9A 3TMLA 3KS6A 3NCOA 4NI3A 1R3YA 2WQDA 2VFHA 3QFWA 2J27A 1O5KA 2P53A 4P7QA 3SQSA 1TJ2A 4LRTA 3IIOA 4TXEA 2ZTJA 3TSMA 4DF0A 1LTDA 2PTWA 3PUOA 4MB4A 3N6JA 2Q09A 4MWAE 1Z44A 2BZNA 4WDUA 5A8OA 4PMUA 3UWVA 2CNCA 3IUHA 1PJ9A 2Z26A 4AC1X 3QHOA 1LL7A 5CSYA 2X1RA 1FHUA 2VEKA 3H54A 1QPNA 1EUAA 2QJGA 3BJTA 2VDHA 3OW1A 2PDCA 1XYZA 2Y5SA 5CBJA 1CGYA 2B81A 4CD5A 1TTJA 2V68A 1EL3A 5HOSA 4QG9A 4GYJA 3PZQA 5HR7A 5JMUA 3OLEA 4F4RA 3QV7A 4S3GA 3A6OA 5FOOA 3BPWA 4YJ5A 1NJJA 4RE2A 4H9UA 2FMNA 4EANA 5I6SA 1JF5A 4LX4A 2G95A 3B97A 8XIAA 1PIGA 3NYDA 5AFDA 1VR6A 2V38A 4DN1A 3TNOA 4KEVA 4DHGA 3R89A 2NVCA 4O11A 3MY9A 1YNQA 2WNZA 3WK1A 4QBXA 3F4DA 2WMKA 4AHQA 2OQHA 3TA9A 3L7RA 3N3MA 3HGJA 1FWCC 2GGGA 2YFOA 3QGVA 4A22A 2DUZA 3PBWA 2Q6ZA 5C5YA 1HIZA 3T6CA 1EXBA 3CLMA 1L9WA 4Q4RA 4F2UA 3B8UA 1ZP3A 3EDFA 4IQLA 1TYGA 5DEZA 2QJJA 4AIBA 3SCQA 1KM3A 2BY1A 1EPXA 1XYMA 1SSDA 2UY5A 4BI5A 4LYRA 1TWSA 1KGXA 5U4NA 1R9XA 3WNLA 1Q6FA 4W8LA 1KA9F 2P10A 1CWYA 1CGWA 2D3LA 4GJ1A 3TLQA 4C91A 1AMKA 1O12A 1BKHA 1NM9A 1ICSA 1ZJHA 4HNCA 3TOYA 3O8AA 4O0KA 3CPUA 2PB1A 3ITTA 1XBZA 3TK7A 2VCAA 3PJWA 4W8BA 3BZGA 4DJDD 3PVFA 3LXCA 1LQ0A 4XUYA 1GJPA 2NXHA 4LYPA 4K37A 5EA9A 1L2QA 2IXVA 3FJ4A 3CIWA 3WLMA 4FXSA 1W2VA 4DJED 3UCQA 4WY0A 1HL9A 4ERAA 1H1ZA 1TMHA 4JEJA 1WBJA 3B03A 4S3JA 1KV8A 2ZX9A 4DUWA 3OZYA 1NDVA 1W1ZA 4DJFC 4C6IA 2YA2A 1XI3A 3TYZA 1G94A 4GYPA 4I6KA 3KZPA 3OHIA 4C5YA 3TZNA 1R3VA 5DRIA 5D2YA 3EB2A 3NZ1A 1BYCA 2NLIA 3LCIA 4AF0B 3S6TA 3W81A 3KBJA 4KERA 2QJNA 2HNEA 4HCHA 1RQEA 1R0MA 2X40A 3TWBA 5CQ1A 1XIMA 2ZX8A 5H6HA 1LL6A 3LI1A 2UY4A 4AZIA 3IAPA 3SJNA 1E0WA 3VMPA 3S83A 3MS8A 4XSMA 1RA5A 4IJCA 1E55A 1KCLA 4X0NA 4ATWA 1VEMA 1F61A 4FX8A 4MJZA 4YMZA 3V75A 4PBFA 4NAFA 2AAAA 4MNMA 1HP5A 1VFSA 3C0LA 4Z0SA 1NQKA 4KWWA 1QPKA 3MVIA 3N11A 1M7XA 3CV1A 5MHBA 2GL5A 4FXJA 5CCZA 4R7JA 3BUVA 3QY8A 1V02E 1XD0A 1DIOA 4A6GA 3I4EA 4O17A 1PS9A 3W1PA 3WCZA 3GZ3A 3RDKA 1A3HA 1X38A 3H8AA 2VRKA 1LG1A 2IMRA 4RXGA 4GUGA 4FP1A 3GXTA 1TTQA 2VR4A 4GD0A 1OT2A 1E4NA 4LUSB 1W5MA 1GTEA 1VRXA 1K77A 3L0NA 1VEOA 4W5ZA 3CMFA 2QEZA 2P8CA 5ECVA 2ZBTA 3EB4A 4JOMA 4JHZA 1PSCA 4DQWA 4NG3A 2FHFA 3IVUA 2C7FA 3BO9A 3GB6A 4UMBA 3GU2A 5E0CA 4CN4A 2ZA1A 1E43A 3BLPX 3OBKA 3UYCA 1OEPA 1YTKA 2VQTA 4UTIA 3GR8A 2XZ7A 4GLEA 1IXNA 2J6XA 3L9CA 3P0XA 1QCWA 3TW6A 1W3TA 2ZDSA 4UTKA 4E6MA 3PAJA 2WJZA 4O28A 5M5DA 3IVTA 3PBMA 4UR9A 3GNRA 1BSIA 4DWSD 1OX6A 2CBJA 4QRNA 2QV5A 3C2FA 2J7BA 4J2PA 4A3YA 3L66A 2R9RA 4UQAA 3RRAA 3UWUA 1YEYA 4H6RA 3S4TA 2TODA 4JHOA 1PHWA 2HQAA 4WOQA 1ZAIA 4LRSA 3TCSA 2ZTKA 5B7YA 3P82A 1ECQA 2A0NA 2PRHA 4MM1A 1C7SA 5CC6A 2W5FA 2NWRA 4LF1A 1XWYA 2DVUA 1TIMA 3VKJA 5EB8A 4AQLA 2V5LA 4HHLA 5FF0A 4XZHA 1DJHA 1HX0A 1E1EA 3M7SA 1D9EA 3B04A 2XU2A 3H22A 1W9PA 3PZVA 3ZT5A 5DBUA 3O9NA 3CQ0A 3E2RA 2CLEA 1XH1A 2CIPA 1Q2RA 6TAAA 4I3GA 3EA1A 2V63A 3DFNA 1NOFA 3PG9A 1CX9A 1L6YA 1US2A 2FB3A 1JD9A 3HOJA 3DI0A 1R7OA 1RCQA 1TKKA 3QQWA 1POJA 3N25A 2CLOA 2QCHA 4L4OA 1TA3B 3WDQA 2NV1A 3A3XA 1FCBA 1UD2A 4IOTA 1DJWA 3PPCA 3GXDA 5A69A 5CSSA 1TRDA 3R12A 1T0OA 1SQ7A 3KOZA 2MANA 5TIMA 2ZUTA 4Q8OA 1YE6A 4QXIA 3CS2A 2YL8A 4GFSA 2WHLA 4GVGA 1GYNA 1UCWA 3A13A 4HNLA 2PGFA 2CLMA 1TX2A 1OSEA 2HCVA 3S1UA 2QS8A 1VCGA 4HA0A 4ZQRA 1KTBA 3R8GA 4GZJA 4NRRA 1EHNA 3EWZA 3W1LA 2VZUA 3E6EA 1E6NA 3TYDA 4GO8A 2G3IA 5K7JA 3MZ2A 3C2RA 2IQTA 1HKIA 2PF0A 1OK4A 1NDZA 2YB4A 2W9MA 2DQXA 4J3ZA 3AOFA 2VNCA 5TD4A 2ZUNA 5KTLA 3O6YX 3CV7A 1KM1A 2VVNA 3G1FA 4A4AA 3OP2A 4LUSA 1FTXA 1OFOA 8TIMA 1X97A 1X6NA 3KBMA 3SUSA 1EC8A 4OU1A 3FHAA 4CNNA 1QOPA 3ABSA 2OR2A 2VZOA 2WHMA 2ACQA 2D2JA 1NFPA 4FALA 3C3UA 5A94A 4Z0JA 3FDGA 2RGLA 3BAWA 3H7RA 1H0IA 3QSTA 3OVPA 2BHZA 3SB0A 1JVNA 3WLRA 5EMLA 3PWGA 1RD5A 1MO0A 3EYPA 4LVBA 4GO9A 1TPB1 4PFHA 1V3KA 3SN1A 3UJEA 2I5GA 3C0JA 3LXBA 1ISXA 2AMXA 4O54A 3NR0A 4UR7A 1VF8A 1MRQA 1JR1A 8A3HA 4RNIA 3RUBL 4GHRA 1F76A 1EFZA 1W54A 4RCXA 3G3DA 5HMDA 4MGGA 1CNVA 2ACRA 1GVQA 1WDPA 3CJPA 3GTHA 2VX7A 2BHUA 1MEWA 3WDJA 3NQFA 4JIIX 4F0LA 2XH7A 4Q33A 3O7UA 4V1XA 5HNTA 2VZTA 4PBEA 1DL3A 1O5RA 4CEXC 4JCMA 1DXEA 1OGGA 3BG3A 4Q8NA 4O57A 1GOMA 3MI3A 1JULA 5LNRA 2ALRA 1MW3A 3L5MA 1UOZA 1WCGA 1XH0A 1F6KA 4B4HA 4QX4A 4LPCA 3IIPA 4UWMA 1XLEA 2Z7KA 1JPIA 1J5TA 3WYZA 3LRMA 3R8RA 1YXDA 5M2FX 3MYPA 3FKKA 3COTA 4C6BA 4ZGYA 1YE4A 3FEMA 1A53A 4QS5A 1BTCA 3UWWA 4IT1A 3ARTA 4I9AA 2C0AA 2GVGA 5FEPA 1KNWA 1MXGA 3ORWA 2P3ZA 3LN3A 2PI6A 4K39A 1SJDA 4MWAD 3V5CA 2V3DA 3CBWA 1A0EA 1ME8A 2F8QA 3WZ0E 2ZE0A 5CBIA 3M5YA 4PUJA 3KHDA 1MI3A 1QAPA 2C8NA 1S2VA 3W7DA 1YPXA 4PMVA 1ML1A 3E02A 3TCEA 2WV8A 4J3VA 2OEKA 1C8VA 3F03K 1H62A 1RALA 7TIMA 3I6RA 4IG2B 2QCGA 4GNKB 4QM1A 4MMWA 2HPMA 3GDLA 1K8XA 4J3UA 1SR0A 1GVEA 5LGXA 1K9DA 4I5XA 2NXGA 4IZGA 5CLTA 4DF1A 1U1UA 2CWNA 3CASA 4MZ8A 7A3HA 2W91A 3BWWA 3TN4A 3TA6A 2ISVA 1Y65A 3CH9A 1HT6A 3P61A 3BAJA 4ZSUA 5AB3A 3CEUA 3TYUA 4DBWA 4XKYA 1O66A 2JKPA 1RK5A 3LTSA 4QNEA 1IXQA 1Q2SA 4MUZA 4B9YA 3PPFA 5DF0A 3VIJA 4PC8A 2VDGA 5A6JA 4LEQA 1K1DA 1U5HA 4WLCA 3SI9A 3AICA 2PP0A 1OWQA 4KRTA 4NNCA 4QLKA 4WUIA 4AD0A 1KGUA 1E15A 1WOAA 4H00A 3V4BA 1YLVA 3BOLA 4LAOA 5CAKA 4ZL1A 1PZ3A 1LCOA 1WKFA 2Z7GA 3LCXA 4HOWA 4ZCWA 5DCEA 5M3WA 2QCMA 4UTTC 1GT8A 4HU8A 2A3BA 3VKDA 3CYJA 4US5A 2AL2A 3WF1A 1P6CA 5GNXA 1RP8A 3M16A 1OZQA 4ZO6A 1BVWA 4P7LA 4UTMA 5DMYA 1E1FA 2DVTA 5A6BD 2PDWA 3WJXA 5JH1A 3V0UA 3CHCA 3RPTA 3AS2A 4MJMA 1DPMA 1DWIM 4F8XA 5CPSA 3N9KA 1UBPC 1RR2A 4B16A 3AUJA 4CU6A 1V3HA 4X60A 2Z0IA 1LQAA 3L65A 2O55A 5LNSA 1H3GA 2OWWA 3CHDA 2AGKA 5DN1A 4OHQA 3VX0A 4IPNB 3ARXA 3VDHA 3SQLA 3GVWA 1BSLA 1ECEA 3BAYA 3KCJA 1EZ2A 4HA1A 4K2SA 3RJYA 1LBMA 2FZBA 3QYSA 3NG3A 4TVUA 1UOKA 1XUUA 4MDPA 5T8GA 2ZX6A 2Z1WA 4GXMA 3GUWA 5C55A 1YMYA 2VT0A 2CBUA 2DSWA 3WNKA 1UZHA 3FEQA 4JKLA 5KZMA 1TPDA 1TTPA 5CPNA 1ITCA 3W7PA 3VOIA 4H8NA 4LVAA 2CZVA 1UD4A 3TVAA 3UQNA 1N8WA 2INEA 4DJEA 3UFYA 1GPFA 2O9OA 3GSMA 4X2RA 1Q6GA 2J75A 3LYEA 1LBLA 3CZEA 1OG0A 3EPMA 3FAWA 5EBAA 4B3LA 3WH5A 1ONEA 5DT7A 3U0HA 1XIBA 4DAFA 1W1A1 3RPDA 1EP1A 2W67A 4NYYA 2BOGX 4QE1A 2DFAA 4S3KA 3WBEA 1EIBA 1G6CA 4JFVA 1QPQA 3KOWA 4JNYA 3Q94A 2FTWA 2YL5A 3TJ4A 1B5TA 3TYBA 5K9DA 2ZOXA 5JIWA 4EAYA 2DP3A 1UWUA 5AYZA 4H1ZA 3DESA 3IANA 2YA1A 4TTUA 2BGSA 4CN1A 1LP6A 1ZBVA 1RSCA 3DBNA 2HE8A 4L6DA 1UR0A 3MI6A 3U4AA 3OGVA 3C0SA 3GIQA 2R94A 6REQA 3GYCA 2RDWA 4XIMA 2OGYA 4IXHA 1IEVA 2J13A 1M04A 2VC5A 4IMFA 2X2GA 4ASTA 3EB3A 4O18A 1A4LA 3LSCA 2PDQA 1R87A 3ITXA 3W7RA 2D0HA 1X39A 1PIFA 2RAGA 2NVAA 3TQ0A 1E9ZB 4E8CA 5AHNA 3SGZA 2J79A 1GYLA 3E3HA 1H5VA 2BSLA 3KFTA 3WX7A 4F48A 5AVHA 4EF9A 2A3EA 3UJSA 4DI9A 2VFEA 3W7MA 3T78A 3TH6A 1B9BA 4C6PA 1PUDA 2EPOA 2PA6A 1DP0A 3SRHA 4UOZA 4D8AA 2YW3A 3O6AA 3P7YA 4AC7C 4AX6A 2E9LA 1OIFA 1TV3A 3K13A 1Q66A 3ZIZA 4B5XA 2ZVIA 2FVMA 3DFYA 3U7BA 3EA2A 2PZNA 4L4LA 2XFWA 4GQGA 3VOFA 1E9YB 3BE7A 3ITLA 4S3FA 1NEYA 5JUVA 1DIDA 1U30A 3FKRA 4QGCA 1XV8A 2PLKA 4GUIA 3OJGA 3QY7A 1O60A 4JQ1A 1RJRA 4YYCA 4QFUA 3SN4A 1UD6A 2Y4SA 1KB3A 5I78A 2DQWA 2D20A 3LPFA 3MU7A 3RM9A 1EH9A 4ILSA 2PGEA 1LWHA 2B7OA 4BZYA 4P7NA 3E5BA 2BBFA 4LUYA 1IWPA 4ADTA 2HTMA 3VNIA 1CXKA 3P14A 4XD5A 2VQUA 1VJZA 2POZA 1FUYA 3VGHA 2YR1A 3EOLA 3L2MA 1W1B1 2YX0A 2FHBA 3AYRA 1D3GA 3SDOA 3LGGA 4HPHA 4JIEA 5AC5A 3HM7A 4ZO7A 1P0KA 3NPWA 1ZQ5A 1BVNP 4K8HA 5M03A 1MMFA 1VAHA 2D2HA 4D8ZA 2GK1B 3W7GA 1Q8JA 4HHHA 2P5NA 2Y5JA 1TO3A 1JJKA 3GIYA 3R11A 4Z1BA 1AQHA 3W0KA 2J6VA 3UXDA 1AZ2A 4GVIA 4LU0A 5I3HA 3HPAA 3IJ9A 3GWQA 2IKGA 3B4YA 5C9WA 1THFD 2ZIDA 4OQVA 4IISA 1SUXA 5AYXA 3QRHA 4QTGA 3JZEA 1H7XA 4XKMA 3W37A 4HPGA 1KXHA 4F66A 1DJQA 3I3EA 3SFKA 4JPGA 5LHFA 1P0DA 2J24A 3C3NA 3U8GA 3AU2A 4O14A 3SQMA 4L61A 3IJ8A 4B5SA 2CXEA 4CQDA 3VKBA 4LNYA 4WKHA 1TVNA 4HK7A 4M6PA 1JI2A 1MW1A 3PNUA 2WLYA 4EPDC 4NZ5A 3DC8A 4Y96A 3F4CA 5T26A 3SUUA 1FWHC 2G4FA 3DG6A 2O92A 3N4EA 3G8EA 1PPIA 4E4UA 2R82A 5CGMA 3O16A 3W27A 5AYIA 1HP4A 1VFUA 2DPEA 3FXGA 4H4IA 4LXFA 4BQ5A 3T2QA 5C2CA 2QUVA 4Q4MA 3WENA 1AJ2A 1ONWA 3W7CA 2HRWA 3JW7A 5M1TA 3M6DA 3KTSA 4GPNA 3R0DA 3T0AA 4M7SA 3RM8A 2W92A 4R9XA 1V0MA 4Q4OA 4RPQA 4WGHA 2EF9A 5JIPA 3ZT6A 4OKDA 4Y9AA 1F7BA 4GNJA 5HQEA 4U5IA 1Z8AA 3PTQA 2J7FA 3EMQA 1DJIA 3DHUA 3KBWA 2VRJA 1JDFA 3W70A 4TR9A 5LA1A 1ICQA 2QJHA 4YXGA 3RU8X 4DUXA 3PWAA 3PS7A 3DHDA 4DBSA 2Q8XA 4F40A 4K3ZA 4LJ3A 1PWMA 2ISSA 2QMKA 4HPJA 3KRZA 3H2EA 4ROPA 2VRQA 3V18A 3LCGA 3WQ4A 1K9FA 5EMYA 5I23A 4L9XA 1PTAA 3DDMA 2VCBA 3OG3A 2C18A 4MHBA 4Y8FA 1AD4A 3L0KA 4H9YA 2ZQ0A 1E5NA 3HPSA 5FF4A 3CL6A 1RCXB 1WZMA 1E1CB 1KR1A 4TV5A 2Z1BA 2D23A 4JN8A 4HYWA 5IOBA 2E8ZA 1SMAA 3CH0A 5FSDC 4G1NA 2ZUMA 4W89A 3K8LA 4JIQA 3TYEA 3TFCA 1TPFA 1EUNA 3ANUA 3HBLA 2WB5A 4M1BA 1TWWA 1Z7AA 1AUSL 4YWSA 4NJKA 2QF8A 3RLHA 1E3XA 1E4IA 4EXQA 1REQA 2EKCA 4TMCA 4Y9PA 1QI2A 4BF7A 3C86A 3EAUA 2XFRA 3T44A 2BVDA 1XYCA 4KRUA 5CH9A 1B3ZA 4KH2A 2TYSA 1DYSA 3GG8A 3UETA 2IPWA 1N2VA 4K36A 3T0DA 2NT1A 3TLLA 1W1YA 4LY4A 2DSUA 3POHA 4GQBA 4GQRA 1YDYA 1QI0A 1A5SA 3D3AA 5BXSA 1EX5A 4MY8A 2Z6JA 4D2JA 1QW9A 2KZHA 1XLGA 2ABBA 1KXVA 3A5VA 2WC7A 2C71A 3POCA 3KVKA 4LV4A 3WY1A 3HURA 1LRNA 3GAYA 2WVTA 4ZFMA 3RM4A 3UD6A 3NQDA 3GDRA 2CZDA 1XIJA 2ZXQA 2WPGA 3RMEA 4MB3A 3KRBA 2GFTA 2WZIA 5DANA 1WOBA 3N12A 1E9LA 4NAEA 1XIFA 3LQLA 3QH2A 1EJTC 3ZFHA 2CZFA 4A2SA 4JX4A 1N8IA 2PCQA 3CWHA 3VZZA 2RH9A 2X2YA 4D1IA 1KR0A 2VI0A 4Q8TA 4RR4A 1JZ3A 2EEXA 3VILA 5A6SA 4XZIA 4H19A 2Z1KA 5FA5A 4PTWA 3RR4A 2QF7A 4HU4A 4WQ6A 5FF3A 1KKRA 1W5QA 3QXBA 7CGTA 1I2RA 1XDMA 1TPEA 2A85A 4IWWA 5EPDA 1PB0A 3OBEA 2YZRA 2OQLA 3GC4A 4A3RA 4AHPA 1FP8A 3KXQA 3WQCA 4BCEA 5J04A 3MCNA 2YA0A 1GEQA 1NP2A 5I24A 2JK2A 5D05A 1XC4A 2AAMA 2QUTA 4QJ3B 3WKZA 3KDNA 4HCLA 1SW7A 4N7QA 1ICPA 3VD5A 2YGYA 3DERA 2YCIX 2J9ZA 1VQTA 3IAQA 3UJRA 1UH4A 2TRSA 4FF7A 3CUXA 3H2CA 2MNRA 3AYSA 1CGUA 1FWDC 5CSRA 3AZSA 5A6KA 2RKXA 3JUGA 4GQ0A 1QXLA 3VKCA 3RHGA 4WJEA 1O6IA 4L9YA 3N2TA 1RJQA 3T4WA 3XISA 4ZTXA 3BGAA 3ITOA 1C8QA 4C60A 5MKGB 2CPUA 4JN7A 3QR3A 2OSYA 1JPMA 1AW5A 3A4WA 3CEPA 4IIEA 3M07A 1MXDA 3W2KA 2EG6A 5FJPA 3TW9A 3M0YA 2IS7A 4U28A 3M7WA 3JVAA 4M6VA 2I5IA 1EPVA 1T96A 4HGXA 4GYFA 1OC6A 1T5AA 2OMAA 2IPGA 1UKPA 1XM3A 2XSBA 2WSQA 3LU2A 3HFYA 4WEVX 1S38A 3U4FA 3CHFA 3FN9A 1J0HA 4L4MA 5E70A 1UG6A 2XGBA 3VGBA 2IXUA 4FX6M 4GGHA 2A4AA 2CYGA 2J74A 5FAJA 3T55A 2XN1A 2DT2A 5G1TA 3UEQA 1KO0A 2Y7GA 4YTUA 4PMYA 1DVJA 3F4VA 5T9CE 3FVDA 2B31A 2NQZA 5G1YA 2W6RA 3FAXA 2W0UA 4IFRA 2OFJA 1GK8A 4X0VA 4GBDA 3NQ6A 2OZTA 3S6OA 2A21A 1E6QM 3W3OA 3PUGA 1X8FA 4XSLA 4W8AA 4O0QA 1KRCC 1HKJA 2O7QA 5BROA 2WCSA 1AH3A 4AZHA 2PWVA 2D22A 3LA4A 3QMSA 1TIWA 3CL8A 4G7EA 3GG0A 5HWMA 1KLZA 2GUYA 1QHPA 3WFZA 4Q8WA 3WD2A 2NW0A 3ME3A 2ACUA 4V28A 3ZZ1A 2PWDA 3I7SA 2PCEA 5CZ0A 1CIUA 5A8NA 4ERGA 4B92A 1RUSA 4H04A 2ZZ1A 1LOSA 1WP6A 5K4XA 4WCJA 4HN4A 1FRBA 4KGJA 2WCAA 3GHSA 1P5BA 5BXRA 2O4MA 1IQ8A 4JQ4A 4DO4A 1OCNA 2HMCA 2YL6A 4H2HA 3RO8A 1XF0A 1TPVA 1IXOA 2PBGA 2BGNE 1I0DA 3Q65A 1NDWA 4WDTA 3Q37A 3EDEA 3EOUA 3N2MA 1Q5MA 2PRLA 2Z6IA 3LM3A 4B15A 1TPWA 3T0TA 1E56A 1PYMA 4JDYA 3VDGA 2F9RA 1EA9C 2PDMA 4C6LA 3LDVA 4L6HA 3W01A 3WDIA 3SGGA 3UR7A 1TPC1 2Z25A 2DVXA 4JTLA 3S1VA 4PSPA 4CNPA 3GXMA 2G37A 2P50A 3MUCA 2IPFA 4JHMA 2WKGA 3DENA 3EA3A 1YADA 2DW7A 3FOKA 1C90A 4HCDA 1I4NA 2CW6A 3AS0A 1EIXA 4OUIA 3U6WA 2X1UA 4FEZA 1L6FA 3J7HA 1GVSA 4DLMA 4MKNA 1RLCL 1UKOA 4A3HA 2OKTA 5F1VA 1MXSA 3JZUA 3P5ZA 4RUBA 1YX1A 3RPMA 4JIHA 3GIPA 2OZ8A 3CZLA 2YXGA 4GIYA 3SBFA 4XAYA 4EF8A 1MNZA 3GYEA 3NQ7A 3HGSA 1R2SA 4GBUA 1GQKA 1XYBA 5HPCA 1QPOA 5F2IA 1XQKA 4PEEA 4IL0A 1AK5A 4JR5A 1U22A 2WWCA 3HV8A 2PDUA 4GK8A 4Y9MA 1PTDA 2FZDA 2ZZ6A 3HMCA 3WLIA 3I4KA 3S42A 3CUJA 1XICA 3BURA 4OE7A 1XH2A 3EX2A 3IGSA 1FQ0A 3VFCA 1NWSA 1HGWA 1MSSA 3W7JA 3VD4A 3GNXA 2PDFA 4O50A 4EPKA 2DIJA 5LIUX 2BTMA 3WL1A 4WVXA 3UR8A 1OFRA 3LLFA 3LRLA 2XPKA 5LYRA 4D72A 4KCVA 3W02A 1WUFA 5HUOA 4NZ1A 4MKSA 1J2BA 1SR9A 3ALFA 1B57A 3AS3A 1XUZA 1UW9A 3LHTA 3CQKA 3R94A 4RLIA 1V3LA 4PCSA 4MY9A 1KLYA 4IFKB 1KBBA 1OC5A 2ZZ5A 2IKJA 4OZOA 3UYIA 4AIOA 2X42A 1F4HA 2VURA 3I68A 3PG8A 2RFGA 4GC3A 3GD6A 3QC3A 2HROA 3ERPA 3EDJA 2VFIA 1J8VA 1GOXA 1UA3A 1IEWA 3LCFA 4MPQA 2VEFA 3EKLA 3V35A 4R7OA 3WLHA 3O05A 4FHAA 5REQA 1LYXA 1I45A 2C19A 2PD9A 3EOEA 3W6LA 3VIIA 3H24A 2Z4GA 2ZA3A 1SVDA 2Y63A 3WK3A 1JYXA 3EXSA 4Z1AA 3APGA 3HO8A 1TVLA 3NL3A 3S2JA 5HJXA 4H7CA 3V5OA 5CPOA 4LAKA 2PF8A 4Y8EA 4ZSTA 4XX6A 1YDVA 3BLFA 3V7PA 1IT0A 3N34A 1RK6A 1PBGA 2P8BA 4O1AA 3WEOA 1F4AA 1VJSA 4PYSA 2A3LA 2WC3A 3C2YA 3WUEA 1QUMA 4PSRA 3BV4A 2WC4A 2VGGA 3MUAA 4LAMA 1FBAA 1M5WA 1C8XA 4YTTA 4N9DA 4C6KA 4E5TA 2PZ0A 2QCFA 3L68A 4PUUA 3PSVA 2JF7A 1JUKA 3WEZA 2R1LA 4B4FA 3C2OA 1EYWA 3D46A 3EWDA 3M44A 2X30A 2FDMA 4TMBA 4OUEA 4QROA 1TUXA 4GUHA 3W83A 1X7FA 1TPH1 5LZLA 1IZCA 4BHYA 2YFNA 2NV2A 3NAVA 4KRZA 2ZRWA 4EPBC 4HNOA 4D6DA 2JQXA 4BJHA 1TTIA 4UFLA 3WH9A 2FPYA 3GM8A 1FWWA 1VFTA 5D2VA 4RV3A 5FAGA 3QTPA 4DX3A 4L65A 4AZ5A 2EJ1A 4KQNA 4CNSA 1AZ1A 1R47A 5HA7A 3PNZA 4L7ZA 3HQOA 1Q6EA 1KTNA 2PTDA 3LV6A 4KPLA 2E28A 4GI4A 3VMNA 3L0GA 4POCA 3GRIA 2WLZA 1ITUA 4I7WA 4XZMX 2VOTA 4S3DA 4RNJA 1UH3A 5GQBA 3UNDA 3QC0A 4F79A 1E0VA 1ITQA 3TR9A 3S0CA 1R85A 1TV5A 1NIUA 4FSAA 4QHRA 1KBKA 3MCOA 3TU9A 3W2JA 1DJXA 2WMJA 4JX5A 1XBXA 4J40A 1ELSA 4Z08A 3PN8A 4ZE4A 4YNGA 3RO6A 1LT8A 1NAL1 5CJ5A 3S5SA 1Y5WA 3F7JA 4LUTA 1MRAA 1YXCA 1Z41A 1B3OA 4AWTA 5K2ZA 3LD5A 1WPCA 2D0FA 2V2CA 3TTSA 1YDNA 3HGRA 1QNOA 9XIAA 1Q7QA 3NWRA 3TN5A 3DFSA 1OG6A 1C8YA 4HSOA 3Q67A 2HS6A 2VGBA 1TSIA 2EJAA 2XIOA 1SO5A 2YBVA 5HJLA 1UKTA 5BU9A 3NIYA 3SJ3A 4D6IA 5I2UA 4NJIA 1B0IA 1XSIA 1NFGA 3GVGA 4I5UA 4PMXA 6PTDA 5E09A 3BLIA 2NX3A 5DXYA 2EXOA 3OZPA 3H53A 3IGXA 4H8VA 5DX7A 3WQGA 1TV8A 4O15A 1XFCA 1W56A 3RCMA 1X7IA 2IQDA 3WH8A 4Q4QA 2H9AA 1KCKA 4AG0A 3T4CA 3STFA 4UTHA 4N0RA 4RDZA 4F0SA 1KM6A 4GWEA 3MA8A 3LGDA 4JQ2A 3GFXA 4NXSA 1UWRA 5IFTA 1UROA 2JEQA 2YDRA 3THAA 3WDRA 2J4GA 1K9EA 2OYKA 3GTXA 4K6AA 5FL1A 4KBXA 4J2MA 2RDTA 4NU7A 2QPUA 4AVNA 3N13A 3USBA 1VD6A 1EEXA 5CZSA 4XAGA 4JTQA 3UG5A 3W7EA 5ENLA 5FJJA 2C16A 4XAFA 2GGIA 2Y24A 1S3HA 3N2BA 1YTEA 2Y7FA 3DYMA 3AXMA 2H3BA 4B5UA 3N73A 4M80A 1A47A 4D6EA 2V81A 3B8WA 1HN1A 4KWVA 4H3DA 2VL4A 4W84A 2FGBA 4G9PA 1UB3A 4Q32A 1GZGA 2QAPA 1NF0A 2VFFA 1PV8A 1JCXA 2GJXA 4HIBA 2YLAA 2ISFA 1TUFA 1JQVA 3VOHA 4EWND 3R10A 1J93A 4DUOA 1KM2A 1WZKA 1C9WA 4NZFA 1PX3A 4C7DA 2V2HA 4JGDA 5KZDA 3VYLA 5KINA 2Y6ZA 3WBAA 3USZA 4HA3A 4JQAA 3CQJA 4HJWA 4PGLA 3S9YA 4HBKA 3L5LA 5D38A 4H2CA 2AL2B 3EX6A 2BG5A 4M29A 5J8LA 5HWNA 4ADSA 3RFAA 1J9YA 1J96A 5K9XA 5BW6A 2ZRVA 3N17A 4ERIA 4QITA 1XLDA 5LIYX 1JZ8A 3UJ2A 3W75A 4NX5A 2O9TA 4LBUA 3DECA 5F2MA 1AH4A 1U2YA 2Z29A 3REQB 3LBCA 2WCGA 1KQZA 5I3JA 3NXLA 3T0BA 5I02A 2CHRA 1Q3NA 4DJDA 3MCMA 4US6A 1WKEA 1FWRA 3BSGA 3QW4B 1R2RA 3N2XA 4MB1A 4H01A 3A21A 2W4XA 4Q8QA 3VNLA 1BF2A 4YWIA 1EXPA 1GW9A 2PD5A 1JNEA 2R1MA 1JXJA 4HHPA 2O7SA 3UXAA 2R1KA 5I5RA 2W61A 1UPMB 5D9MA 5FI8A 3KP0A 4LYKA 4NI8A 2ESCA 1P4CA 2F61A 3RRXA 2GUBA 4TVDA 1HO1A 2AMGA 4IUGA 2I1OA 4C1NB 1ZZMA 4RW3A 4MDOA 2ZUVA 3LHWA 3B0VC 4HPNA 1CLVA 1JCMP 2DZWA 1XLBA 1FWFC 2Z2AA 5HAOA 4DBEA 2FJUB 3QFEA 1FH7A 5F4XA 2RDXA 2IUZA 2YCJA 1R86A 1ZJAA 5TNVA 5D2WA 1XLAA 4JFUA 2Y85A 1BXNA 5DBTA 1AD1A 3NGFA 2F7FA 1V0LA 4O16A 1V77A 3VU2A 4BEQA 4UTWA 4KCUA 1EJUC 4DY1A 1RVGA 5I77A 1V6WA 3GXNA 1S5TA 3DEQA 3WFAA 1KFKA 1FWSA 5FF7A 5SWUA 5HQMA 5CLWA 1DJGA 3WNPA 3K1DA 2CBIA 5C71A 3VNKA 1DQXA 2E9BA 4PTVA 1RA0A 1EDGA 1WDRA 3T40A 1VHCA 1T40A 4LEFA 4YYFA 1TQJA 3L4YA 1GWJA 3WBYA 4PUWA 3U2EA 5LHEA 3B40A 1OGSA 4GACA 2A7RA 3MDWA 2XINA 4I90A 3OTRA 2GSHA 4D6GA 4F0MA 1QOXA 2QHAA 4FPSA 3H2OA 1S1RA 1EBGA 3RLGA 3STGA 3NURA 2WJEA 4O19A 3PBYA 4U2ZA 4UB9A 1VC4A 2Z1VA 3A3WA 3MPGA 2E3ZA 2ICSA 1UIPA 4IQDA 4J5NA 3B05A 3F1QA 1FKWA 6REQB 3WQ5A 2V69A 5LIXX 2NWSA 1XX1A 1I0BA 1FDYA 4ZOAA 4GQQA 1VLWA 3B8TA 3QZAA 3C2EA 4HTBA 1VFMA 2ACSA 3PSWA 1S46A 1K02A 4MVAA 4PUKA 5C9RA 1EBHA 1JD7A 3UG8A 4JKMA 2BY2A 2Y70A 5D9OA 4TX6A 1J12A 1E0XA 1XYAA 4BR1A 2CKSA 4UTWC 3DHPA 3E0IA 3DOPA 1NELA 3O15A 3LHYA 2JIWA 3N18A 3R0KA 4XG1A 4IXXA 1A5NC 2F6XA 3H6OA 4RNFA 3DAQA 4AEFA 1K8YA 1Y8BA 2J62A 1XC6A 4HMDA 3E0VA 2GVLA 1EHAA 4JNZA 2PFHA 4IP5A 1XG4A 1WE5A 1B3XA 5CJNA 3IRSA 3WN6A 3ANYA 2Y7DA 4FNRA 3UF9A 4KIRA 2PWEA 4EXAA 3CT2A 4WSHA 1ADOA 3M0ZA 1JF6A 2DSKA 1XKYA 5CPMA 3ZJ6A 5K4ZA 3WK0A 3K4WA 4FNQA 3VTRA 1GJWA 1XIHA 2VC6A 2PDHA 4F0HA 3P74A 4PULA 3FDKA 1ZBKA 2FVLA 3KWXA 4DPQA 3CGTA 3KOYA 1WV2A 1F2JA 4MTVA 1W9UA 1PTGA 3W86A 5AVNA 4HYVA 4QE4A 4TVCA 1PCWA 1V93A 4HA4A 1ITXA 2BXVA 2VO5A 1WZLA 3M5VA 3TX9A 4W85A 2QPXA 5E9AA 2P1FA 1R46A 2HBVA 4UQEA 4L4PA 4DRSA 1GHRA 3VUPA 4B2DD 1TWDA 2FYMA 2BVTA 4M81A 2Z1XA 4Z17A 2H3DA 2FZ8A 5CSUA 5HR6A 3M5ZA 3SURA 1NTHA 2GUUA 2ZICA 2A6NA 4OWGA 1SO3A 1AW2A 1JFHA 4DWSB 2CITA 4NYUA 3LLXA 4KEMA 4JTKA 1CXFA 3V5FA 1T99A 5H1WA 2PWFA 3N4FA 1HJSA 3TSBA 4BS0A 4PL2A 3A4AA 5CEWA 2FJKA 3NGJA 2YLLA 4FLQA 1IR1A 4Y7EA 3UCCA 3CHEA 1GOOA 7TAAA 3L4TA 1IEQA 1DORA 3CMJA 4WY0B 1QO5A 4KEZA 4UTJA 4W87A 3KLLA 1OD0A 3GH4A 2D69A 2DH2A 1GUVA 4J28A 1LLWA 4TIMA 3NNTA 2QDEA 3TE9A 1K4HA 2OX4A 3CTLA 4TO8A 2XIJA 4NAEB 4JTRA 2Q8LA 5HK4A 1V5XA 1H49A 4JYEA 1W3LA 1V3JA 4WK9A 1YYAA 2YBUA 3MHUA 2ZADA 3QZEA 4HNUA 3SCSA 5I3DA 3AYVA 1B3YA 1DKWA 2WK2A 3W1QA 4ZENA 3Q2DA 2DW6A 1CXIA 4I5RA 1EOKA 3ZWTA 3TDFA 4LANA 3V16A 1E71M 5LXEA 3QTGA 1EF2A 1TB3A 3UVIA 1PKNA 2A79A 1TVPA 2BOEX 3BARA 4QDPA 3G1XA 4UFHA 2PDIA 3EMCA 3CB8A 1JCNA 1TV7A 1DWAM 1JYVA 1OM0A 1S3TC 4Z2IA 2OYMA 3HA1A 3MUIA 4Q4PA 3ZT7A 1U1HA 3HG3A 1GVYA 1X98A 1TELA 4IGSA 4GNVA 2QUMA 4GXWA 5B7ZA 1YPFA 1EQPA 3GS6A 3ZO9A 3DG3A 4MYAA 2GVEA 3I10A 3SCWA 4RL3A 1JGMA 3LTYA 3KZSA 5MKGA 3CWOX 1P0BA 1YPIA 1F8IA 1B1YA 4GI9A 2VEMA 5F4SA 4YTQA 3R43A 3NTYA 3L4ZA 4DNHA 4Z2GA 4A8LA 2PGRA 4ATLA 1D8CA 4XZNX 4IMCA 3S5NA 4B5VA 5C9ZA 1DJYA 1IT8A 3GHRA 2VJXA 2G5WA 5EYWA 5JBDA 1W6TA 3HFTA 3MJMA 1M53A 4GX8A 2EAWA 3P60A 2WXDM 1J5SA 4PFMA 2IKHA 3W84A 4AY1A 3DBPA 4BWLC 1ISVA 4QAWA 1FKXA 5MF5A 1ZS2A 1VKFA 3EX4A 4WF7A 5H91A 1S5NA 4RZ5A 4TUFA 4DYKA 2QQ6A 5TQLA 3L4WA 2VC7A 3U57A 4GMEA 3W1UA 1CEOA 1P7TB 2J8GA 1MW2A 2PDLA 3FVMA 3B0PA 3AFBA 4UOJA 4LH8A 2J88A 4HMCA 5A6BA 2J7CA 1J11A 4O1CA 2X8RA 2X7VA 5I07A 3CK5A 4CQ9A 3GU9A 1GGOA 1PZ1A 1KM4A 1Q85A 2PLCA 3EDKA 6CGTA 4ZQPA 5F2GA 3CHVA 2ZXDA 5HBFA 4HOZA 5BOEA 4QEEA 4FA3A 3W6YA 1E0UA 1UIOA 3MTWA 1C92A 3NPXA 4X61A 1JDAA 4AU0A 3IJIA 3NSXA 4N6FA 1UD3A 4K8GA 2CLHA 4C6OA 1KBLA 3GVRA 5GJNA 2GDQA 3RU6A 3BAIA 3QEZA 1MWOA 3TTEA 2R91A 2ZWZA 3GXFA 3AZRA 3Q58A 1XCWA 2YCLA 4AZGA 4M3PA 3VA8A 2PWGA 4EWJA 4Q22A 1H61A 1TA3A 3IIVA 4B5NA 4XWUA 1W5PA 2QKFA 3XINA 1VIWA 3GDTA 2Q71A 1EJSC 4O1BA 3ARVA 4O1EA 3EOOA 3M0JA 3FGCB 2QGHA 3RX3A 1RY8A 3EZ4A 3LHZA 1DOSA 4E4FA 1PKYA 4J7RA 4NNAA 2E8YA 1M41A 1A0CA 3WQWA 2O9PA 1KC7A 5HPOA 4RE0A 4D6FA 4H6KA 3W1TA 4IPLA 1O5QA 4D8LA 4P5UA 5CZTA 3E12A 3DZ1A 4DELA 1WXJA 4FB7A 3U5YA 1AL7A 3M64A 2Z2BA 4JFWA 3S1GA 3CQHA 1DHKA 3PTKA 2YXOA 1SMDA 4Q3MA 4LFYA 4ICCX 1YTDA 3PK7A 1PYFA 3KE0A 2C14A 2E5BA 3ARSA 3VIOA 4QP0A 3FSTA 2EKGA 2VFGA 4RV8A 5C8BB 3VIMA 3OBAA 5A8GA 2PDXA 1IF2A 1J2WA 2VZVA 4BQ2A 3LNPA 4HNVA 1TCDA 4XB3A 5FJUA 4H9VA 3GG1A 2EGZA 1PL9A 4RJEA 4AWUA 1KCXA 3T1GA 2WAGA 1RZMA 1E3ZA 3ARWA 4S3CA 3FYYA 2E5CA 5AHIA 5D09A 4H7VA 4G2DA 2QDDA 3PTDA 3W7HA 1IZKA 3GK0A 2PLJA 5E5CA 1H1YA 2GWNA 5AZ1A 1YBQB 2WSRA 5CAHA 3F5JA 1QW7A 3M0MA 3W25A 4XZ9A 2IKIA 3RLVA 3P81A 5K9CA 4BFAA 1L6GA 4WDWA 2QCEA 4JNMA 2HV5A 3WF0A 3ES8A 4S3AA 1LDCA 1XXXA 4J35A 2TPSA 3B8DA 4QAIA 1QWKA 3WQDA 4Q7NA 4Q4KA 4XD3A 5FL0A 3A4JA 5GNZA 3EWUA 1O95A 2DSVA 2YBTA 4B90A 1GQNA 1HTIA 7REQA 4GVHA 1WKDA 3FA5A 1J0YA 4ROQA 1CW2A 4REQA 1H7NA 2E68A 3FJNA 1SO4A 3NUKA 2VYOA 5I06A 2WZHA 3WLKX 3VE9A 2B7QA 2R8WA 1F6PA 4X63A 3LZ5A 1OINA 2NX1A 5CPQA 2ATMA 3NZRA 1EOMA 3EX3A 4FLRA 1X8CA 2QUUA 4JD4A 4YL2A 3GHTA 4Q8UA 4H6QA 3KEHA 3AXKA 4AZCA 2XSXA 1E40A 2F38A 3LBMA 3VKAA 2WYSA 4NSBA 3TYAA 5CBBA 2VMFA 4DBDA 4C6CA 4OOUA 1JPHA 4JDBA 4AZBA 1Y7VA 1UR1A 3M9YA 4ICNA 2J7DA 4PMNA 2NQ5A 8CGTA 3NQMA 4QQUA 1CENA 2C6QA 4NASA 4GCAA 1XJBA 4N4QA 1HKVA 3N29A 1GG0A 3QM3A 1X1NA 2WSYA 4C5ZA 3KCLA 1IHIA 3QGAC 2CU0A 4N6EA 3OZOA 3WF3A 4GIEA 1XRTA 1W9BM 3VUSA 1SSGA 3NL2A 3WNOA 2YDSA 4JYFA 3R0UA 4HNNA 2FGLA 3IIZA 1UWIA 4QG8A 4AFYA 1LWJA 2GQ8A 3V0SA 4BK9A 4FIQA 4AAJA 4HK6A 1K3UA 4IM4A 4NAFB 1BG9A 3TMQA 2C3ZA 2DV0A 1E70M 1CXHA 2AGTA 4JTFA 3DHFA 2YSWA 5H2ZA 3WL0A 1ENUA 3ARYA 2GGJA 3WNMA 4DZHA 3E2QA 4KWUA 3T08A 2OEJA 1SFJA 5HINA 3W7QA 3C52A 2C91A 3CO8A 4WX2A 2VCCA 2R24A 5IBXC 4ZR8A 4D6HA 3IV3A 4RDVA 4Z42C 4FS9A 4O4VA 3CQIA 3UXIA 4NNBA 4C6FA 5GPRA 2ZX7A 1YBQA 4KW2A 1G69A 1KM5A 4UFKA 2WM1A 5EFDA 1ZY9A 1AJZA 5EFFA 4GI6A 3ZM8A 1MEIA 1V7YA 3CO4A 3G1VA 4ECLA 2JBMA 5G4WA 5KZ6A 4I7UA 3VXGA 3XIMA 2NX9A 4ML9A 4NY2A 1R3RA 2EO7A 3VC6A 4I9MA 1Q4WA 3YPIA 2YYUA 3FA4A 1IT7A 2QR6A 4G7FA 3G77A 3DKJA 3IK2A 3S46A 4E8DA 4LUTB 3RK8A 4PCPA 1REQB 3W9ZA 3ZSTA 3A23A 5KITA 4MAZA 3M0XA 3TAKA 4IF2A 2GGHA 2UY3A 3H23A 3LM7A 7REQB 3I7RA 4BQ4A 1PX4A 4UFMA 2WSKA 5CC7A 1C93A 4AD1A 1IIGA 4IFKA 4GA8A 3CWNA 1F9CA 2G97A 3OA3A 3PZGA 1TREA 2YW4A 1XLFA 1SPQA 4UNKA 2YDQA 1AQMA 1J6OA 1PAMA 1RBAA 3STEA 5CPTA 1V4YA 5I3FA 5DCDA 3EXRA 3QV6A 4QLJA 1XRSA 1FCQA 3IV8A 2PMQA 4E0CA 3WD1A 2BX7A 4S2CA 1K8ZA 2H8ZA 3MI2A 4W7VA 4ACZB 4LGXA 1Q63A 1TX0A 1BWLA 4UC5A 3W7IA 3W85A 3KUMA 2J8FA 4F2BA 2CLKA 3LNMA 4NJHA 1P6WA 2QCNA 1VJIA 4UQCA 1DXFA 1BYDA 3EWWA 1XRVA 3EXTA 3NL5A 3AU6A 4ADUA 1C91A 2A3CA 4BI6A 4JTIA 3L12A 2WW5A 3HGOA 2OKOA 2DT1A 1S1PA 2NSOA 2OG9A 1WDSA 2VX6A 3EWBX 2DZAA 4YU1A 2WO5A 4J1OA 1MDLA 1W3KA 3W53A 1I1XA 2JALA 3QPYA 7XIMA 1ONXA 4C1LA 4W9TA 3VC5A 5CC3A 2REQA 2E6FA 3BGGA 2WBGA 3BV7A 4AEOA 5A1AA 4A3QA 1GNXA 2MUCA 3QZ6A 3BG9A 1R3SA 1KW1A 2GZXA 4ZQMA 4JTDA 3MV11 3BSMA 2C15A 1XISA 3TKFA 1XLHA 3CT7A 4W5UA 3BLEA 1HKMA 5FEXA 1DQUA 4QE5A 2DUAA 3BTNA 3I7QA 4KWOA 1SJCA 4GVFA 1A5UA 4GI8A 1DBTA 3QLLA 4UCFA 4YPJA 5IXEA 5KSWA 4YHEA 3NDZA 1VFHA 1A5KC 4AEEA 1V6VA 4JAWA 1JIBA 3B8VA 1V6XA 3S8HA 4XZWA 1NWTA 3MO4A 2QIIA 5FSEC 2PC8A 1EEPA 4GISA 4PEKA 4GH1A 5K3VA 3AHXA 2BASA 4LNCA 3WDPP 4IQJA 3KL0A 3TNBA 4FIRA 3PZ9A 4DJEC 1QOQA 4RXFA 4O4WA 3LUTA 3OLDA 3WQ6A 4R3UA 1OJXA 4N02A 3I3DA 3NO1A 2FQIA 2WKLA 1Q65A 3ZVIA 1RXOB 1F73A 1I1WA 5ABTA 1WKYA 1Y0EA 3IJLA 4W88A 1LRQA 4AZ6A 4HZ7A 1OGBA 3CZKA 3CZGA 4NKCA 1OYAA 4PB3A 1YQ2A 4IPJA 3G0SA 3IJ6A 1T8QA 4PRRA 4XD6A 2C0HA 4IL2A 2FH8A 4RK8A 7ENLA 1KV5A 4K7YA 2WHJA 2WNQA 4NL1A 4IHCA 1UQYA 3VNMA 1KFLA 3G1RA 3PPGA 3HJZA 3VIHA 4LC6A 4Q8VA 2NQHA 1VHNA 1FHLA 4FNPA 4H9XA 3GW0A 3E96A 2JE8A 4BWLA 1NSJA 3OPSA 4PBGA 4QJ5B 2J7EA 2B7NA 3U2OA 3W73A 2BGQA 2OYLA 3VGFA 2I56A 2CCRA 1XFBA 4IMDA 2XYLA 4S23A 3CZ8A 3S2CA 3NA8A 4LYQA 3EKZA 4Y90A 1OYBA 3AMGA 3IARA 4QEHA 2QUNA 3T8LA 2G50A 1J0IA 5AYBA 4BI7A 5D37A 3BOFA 4B3KA 3TXVA 3L21A 2P88A 2GQAA 4MOZA 5ABGA 1W3NA 1WX0A 3H4WA 5A6TC 1I60A 1UWAA 2EBNA 3GO2A 3H7VA 3TTOA 4A21A 1R38A 1CECA 2WWDA 3W7KA 4AYGA 1FX6A 1AJ0A 3DKLA 4IJRA 4ACYA 5A3HA 5FEWA 1QI3A 4XBSA 1V3IA 3NQCA 4HP5A 5BMXA 2BB0A 1OF8A 3QMRA 2G0WA 3W1MA 2PS2A 4O1DA 3TQPA 1FDZA 5DFAA 1I6NA 3LLDA 4TOQA 3LERA 3NZQA 1XSKA 5AN7A 1QFEA 3Q4DA 3U2ZA 4R88A 2CERA 2XGIA 2OCZA 4UMAA 4ONVA 3FV9A 2VUYA 4O0ZA 3URQA 1UWSA 2Y1HA 4R5EA 3NSMA 4JKKA 1QT1A 1ADDA 2REQB 2NT0A 4DJFD 3GKFA 4M56A 3CMGA 2W79A 4AD2A 1GG1A 4A35A 4GH3A 2OT0A 1IV8A 3DFOA 3MWAA 3K1GA 1GOWA 1KFWA 3ATYA 3W29A 2XIMA 1OD8A 2AL1A 4H6EA 5L6UA 3BLLA 1K6WA 3BLDA 3V1PA 1K9TA 3AALA 6A3HA 4CGTA 3ZMRA 1XR2A 5D04C 3DFTA 6XIAA 3WBWA 3NQBA 2VUNA 4DXVA 4PTMA 4Q4SA 4LY8A 5A95A 2FVKA 3ARZA 4ZOCA 3VNZA 4PL1A 1BWKA 1RVKA 2FDSA 3IRDA 1J01A 1OIMA 2GJRA 1MNSA 2CC0A 3DCPA 4DVOA 3PC0A 1V08A 4GABA 4ZTYA 3SAZA 2Y5EA 2V5DA 3RR1A 4W7WA 3MMWA 2WANA 5LKYA 4X2PA 2J9XA 2WNWA 3TEVA 3JS3A 4MWAC 3TV8A 4NX0A 2CHNA 3B06A 4PN2A 3T2OA 2DIKA 4K68A 4LS1A 4J9JA 2FKPA 1XHGA 1CDGA 1UR8A 2HWGA 4UZSA 2WMIB 4UFIA 3H12A 5G4EA 2RJGA 3DFPA 2YPIA 1QNQA 3OO2A 4WSKA 3LV5A 4P2VA 2Q01A 5A2BA 1EWEA 4QIUA 4GZ7A 3WLLA 4MG4A 1SGJA 3I6TA 1OF6A 1RJPA 3ZR4A 1I2OA 4RDWA 4AD5A 3C8FA 5AZ0A 5FJRA 1G0CA 3R13A 4B5TA 4JTTA 4DI8A 1N82A 1MUWA 4PMRA 1KD0A 4GXPA 4KKXA 4EVZA 1AW1A 2XG9A 3UPBA 4KF1A 4JFTA 4MPKA 3GW3A 2V5JA 1Q7MA 2WVUA 1W1TA 4E3VA 2GSEA 5D9PA 1UUQA 3VDBA 2I9EA 1HKKA 2V3GA 3S3GA 3SN0A 1W8SA 2JGYA 4GY1A 1X96A 4H9ZA 5D2XA 2GJLA 3SSZA 2G8ZA 2ZKMX 3PWIA 2VEIA 3IGUA 2QNEA 1FHVA 4CQBA 1PHQA 3W1NA 1W9XA 3PFRA 3LPGA 1DTNA 1CI1A 2PDJA 4NQ1A 3OVRA 2NLYA 4ZA0A 1QJWA 3AC0A 3UZZA 1H4PA 3QHNA 4A8IA 3ARRA 3P84A 4DO5A 4HD5A 1OK6A 3UZWA 1HZYA 4AXNA 2PP1A 3HJEA 2Z24A 3LCLA 2B7PA 4E3TA 4Q8MA 1EF3A 3WMSA 1FFQA 4LBRA 1SU5A 3LOTA 4J3SA 3CAQA 2TAAA 4M6UA 3TAOA 1I8JA 1W91A 1TMQA 1A5CA 1JL8A 1ZB5A 1UZ4A 3KS5A 2R14A 1DQWA 1WA3A 4QS6A 1QBBA 1JCYA 2XISA 1Z89A 3W23A 3PF3A 5G1MA 1MW0A 5DQPA 4LAZA 2H6RA 1UR4A 4Q7BA 4OECA 3UPMA 3CIXA 3PB2A 3R79A 1GONA 3GTFA 2F2HA 1GQJA 2VWTA 2P76A 3A22A 3BOXA 3WJSA 4K1WA 5B80A 4ZXOA 4O52A 3G1HA 4OV4A 1OABA 3KRUA 5DT5A 3DGBA 3GDBA 2XH2A 5HJYA 1XLKA 3SUVA 1XL9A 3L4XA 2HXTA 4FF5A 3W1AA 4PUDA 1VBHA 2NZLA 2BWGA 4NILA 3UR5A 4I9TA 2OELA 1NOWA 7ODCA 4NF7A 2PC4A 1RPKA 1CZ1A 4C6MA 3BMXA 5GNYA 2VWSA 3ES7A 3AMLA 4MNLA 1R8LA 5J5RA 3WMLA 3G5EA 4C6NA 4ZMGA 5LA0A 1PE1A 1GOIA 3OQ8A 3BJSA 3T0CA 1WDWA 3WFLA 3LMYA 5PTDA 5I3IA 3T09A 3QR0A 3TFXA 3N4AA 2KAUC 3CUHA 2NQ9A 3SCNA 2ZWYA 3T9PA 3NEVA 4E2VA 2OO0A 3VGEA 1R9YA 4DWSC 4C6DA 1W1VA 1QTWA 4LB3A 1Q4NX 3VD3A 2D3NA 4MJ4A 2CZ5A 1ISZA 4QISA 1RV8A 4DM1A 2OLSA 4WJXA 1EJ7L 2E9MA 1GTHA 1US3A 5FEZA 4TX9A 1VH7A 1J10A 2X0HA 1P0NA 3NQEA 1HJVA 1XLCA 3S2LA 3W28A 5EGRA 4J3TA 4IQEA 1CGVA 5AHEA 3STCA 1DWGM 3QKZA 2XN0A 3E2VA 3MJYA 1B30A 1M7PA 3SGUA 3FK4A 4ZQOA 3AROA 4MNKA 1RHCA 1W5NA 2PDYA 1B4KA 4LUIA 3VZYA 1VENA 1QASA 3G6MA 3TROA 1OX4B 2PLMA 2HE5A 4ZO8A 1ZCOA 4ICMA 1JCLA 3ZYZA 3BL3A 1NY1A 4MFEA 1ODZA 3DG7A 1TPUA 1ZU8A 2OT1A 3GR4A 3TP4A 5HXMA 1EYEA 5LIWX 1VYPX 2DH3A