3DZ6B

Human adometdc with 5'-[(4-aminooxybutyl)methylamino]-5'deoxy-8-ethyladenosine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
56
Chain Sequence
HFFEGTEKLLEVWFSRGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Design of Inhibitors of Human S-Adenosylmethionine Decarboxylase: Studies of Adenine C8 Substitution in Structural Analogues of S-Adenosylmethionine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase beta chain
total genus 8
structure length 56
sequence length 63
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 3dz6B01
3DZ2B 3EP7B 5TVOB 3EP8B 1I79B 3DZ3B 1I7CB 3DZ6B 3EP3B 3EP5B 3EP6B 1I7MB 3EP4B 3EP9B 3DZ5B 1JENB 3EPAB 3EPBB 1I7BB 3H0VB 1MHMB 3H0WB 3DZ4B 3DZ7B 1I72B
chains in the Genus database with same CATH superfamily
3NT4A 2NQTA 4XQ9A 3Q0EA 3QVTA 1Q2XA 3IJPA 3UUWA 1GADO 1VKOA 4QX6A 3Q2IA 1H9AA 3DZ7B 3KSDO 3QVSA 4MIYA 1GL3A 3WBFA 1RM0A 1EBUA 2I5PO 4MVJI 3EP7B 1FF9A 1RYEA 3DMTC 5A05A 1XYGA 2DPGA 3NT2A 3WBBA 4F3YA 2IXAA 4RL6A 3ZCXA 2B4RO 1H9BA 1YL6A 5C7OO 3QVXA 3OHSX 3BTSA 3H0VB 2BH9A 4R3NA 1JN0A 3JSAA 2GZ1A 3NTQA 4XQEA 3E6AA 2VYVA 3DB2A 2PH5A 1GPDG 1NQ5A 3OQBA 3DZ3B 3NT5A 1B7GO 3DZ6B 3B1KA 3EP5B 4XQCA 3KV3O 3WGYA 2PKQP 1CERA 1DAPA 4O59O 1GR0A 5EERA 1U1IA 4TVBA 1TB4A 4GQAA 1NBOA 3L6OO 3EVNA 3BTUA 3DOCA 4LGVA 2O4UX 3UW3A 4II7A 1I79B 3HSKA 5JYAA 1XEAA 3O9ZA 1RM3A 4PG6A 1NQOA 4INAA 2CVOA 3VAZA 4NHEA 2HO5A 4LRTB 1OBFO 3EPBB 4N54A 1MB4A 3IWDB 2CZCA 3IWCB 3CEAA 4DPKA 5AQ1A 3V1YA 3ZDFA 1P1HA 2VYND 1S7CA 2EJWA 1EVJA 4EW6A 1LC3A 2R00A 2GYYA 1VSUA 4DIBA 4DBVO 3B20A 3IDSA 1T4BA 3DBVO 2YV3A 1JENB 3OA2A 1HDGO 2Q49A 4H3VA 4R51A 1TVEA 3TZ6A 4WNIA 4YWJA 2VYNA 1YWGO 1MHMB 3EUWA 4R5HA 4MVJF 2H63A 1I32A 1P1FA 1TLTA 4KOAA 4R5MA 3MTJA 2D2IA 1P1IA 3PWSA 3INGA 1VC2A 3GDOA 3LC1O 3PYLA 3CINA 1H6CA 1YDWA 3C1AA 4K9DA 5JY6A 3EP8B 3GFGA 3TW3A 1PQUA 4MVJM 1I7MB 4MVJP 3DAPA 4O8JA 3HXLA 2YYYA 3STHA 3RC7A 3VOSA 4LRSB 5GZ3A 5C7LO 2HKIA 1P1JA 5T73A 4XQGA 2FPNA 1H94A 3WYCA 2DUUA 1ML3A 2GZ3A 2OZPA 4AK1A 4O89A 3RBVA 1OFGA 1J5PA 3M2TA 3RC1A 1DC4A 5EIOA 3I23A 2X5KO 5A03A 3K2BA 1P9LA 3RVDA 2G17A 3H0WB 2R00C 1I72B 1QXSA 3QW2A 3RCBA 3CMCO 5JW6A 1DRUA 4MIEA 3FHLA 4R41A 3RC2A 1MC4A 3CIFA 2QZ9A 3EP6B 3ZJXA 1PR3A 3EP9B 4R3WA 3KSZO 5M6DA 4HADA 1T4DA 1H2HA 3MOIA 4P8RA 5GZ1A 4XB2A 4HKTA 4Z0HO 1DC6A 3IP3A 3TUXA 2XF8A 4FB5A 4DPLA 4CLQA 3DZ2B 1DC5A 4GMFA 3B1JA 4XR4A 3FD8A 1H6DA 1QKIA 3MZ0A 1NPTO 1J0XO 2X5JO 3E9MA 1A7KA 2DAPA 3V5NA 4MKZA 4MVJE 2DC1A 1ARZA 3GPDG 3F4LA 1OZAA 3PFWO 4LSMA 3DMTA 4XRGA 4ZHSA 1JKFA 3QVWA 4YDRA 1JKIA 4L8VA 3GNQA 4MVJH 1PU2A 5A04A 1YL7A 3BIOA 2PKQO 3WGZA 3L0DA 3TV1A 3V2UA 3DO5A 1VKNA 3Q1LA 4GPD1 2PKRA 3PYMA 3DTYA 1RM5A 1DRWA 3PWKA 1NWHA 3EC7A 1GYPA 3H9EO 4L9RA 4IQ8A 3E5RA 3ABIA 2X0NA 1CF2O 2HJSA 5KVSA 1K3TA 1UYJA 1I7CB 1ZNQO 5JYEA 2AXQA 2B4TO 1QMHA 1DIHA 2BHLA 3LC2O 3U3XA 1PS8A 1NWCA 1GAEO 1YL5A 5J9GA 4PG5A 1F06A 3PYXA 3K73O 4MVJA 4PLPA 4MINA 2GLXA 2GZ2A 1E7MA 3LVFO 4MKXA 2O48X 4ZICA 5BNTA 3OA0A 4MIOA 2I3AA 1BRMA 5CEFA 2GD1O 3KGDA 5A02A 5DDIP 3LC7O 2EP7A 1VM6A 1LC0A 3HJAA 1VSVA 1ZH8A 3WGQA 5JYFA 3Q2KA 3PZBA 1IHXA 2NVWA 3PQVA 5TVOB 3WGOA 2POQX 1H6BA 3IWBB 1QMIA 1E5LA 3DR3A 3EP4B 3EZYA 4DPMA 4O63O 3K9QO 5AVOA 1Q7GA 3WYBA 1DPGA 1NVMB 1RM4A 5GZ6A 3E1KA 2P2SA 1C3VA 2EP5A 4BOYA 1E5QA 1LA2A 5C7IO 1DC3A 3DZ4B 3C8MA 1RYDA 3QV1A 4JN6B 4MVJG 5EINA 1IHYA 4MJLA 1U8FO 3Q11A 4R54A 1TA4A 2VYVD 1NQAO 3DZ5B 3EPAB 1GCUA 1PQPA 3HQ4O 3KUXA 5EESA 1DRVA 1E77A 5KVQA 3NTRA 1H93A 1EBFA 3BTVA 5A06A 3WB9A 1NX6A 3QY9A 2Q22A 4PG7A 4R4JA 1E7YA 3E18A 4WOJA 1SZJG 2Q4EA 4WNCA 1DBVO 3HNPA 1GYQA 4PG4A 2DBVO 2I3GA 3EP3B 3NTOA 3E82A 1GD1O 3PZRA 1I33A 4IQ0A 1YS4A 4XB1A 4MVJD 2IXBA 3L4SO 1CRWG 4GMGA 1I7BB 1DSSG 4PG8A 2G82A 3RC9A 3TUTA 1P1KA 1H6AA 3CPSA
chains in the Genus database with same CATH topology
3EP5A 3EP6A 3DZ2B 3DZ6A 3EP3A 3DZ2A 3EP7B 3DZ3A 1MSVA 5TVOB 3EP8A 3EP8B 1I79B 3DZ4A 3DZ7A 1MHMA 3DZ3B 1TMIA 3EP7A 5TVOA 1I7CB 3DZ6B 3EP3B 3EP5B 3EP6B 1I7MB 1TLUA 3EP4B 3EP9B 3DZ5B 1JENB 3EPAB 1I72A 1VR7A 3H0WA 1JL0A 3EPBB 3EPBA 3H0VA 1I7BA 2IIIA 3DZ5A 3EPAA 3EP4A 1I7BB 3H0VB 1I7CA 1MHMB 3H0WB 3DZ4B 1I79A 3DZ7B 1I72B 1JENA 3EP9A 1I7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZ2 B;  3EP7 B;  5TVO B;  3EP8 B;  1I79 B;  3DZ3 B;  1I7C B;  3DZ6 B;  3EP3 B;  3EP5 B;  3EP6 B;  1I7M B;  3EP4 B;  3EP9 B;  3DZ5 B;  1JEN B;  3EPA B;  3EPB B;  1I7B B;  3H0V B;  1MHM B;  3H0W B;  3DZ4 B;  3DZ7 B;  1I72 B; 
#chains in the Genus database with same CATH topology
 3NT4 A;  2NQT A;  4XQ9 A;  3Q0E A;  3QVT A;  1Q2X A;  3IJP A;  3UUW A;  1GAD O;  1VKO A;  4QX6 A;  3Q2I A;  1H9A A;  3DZ7 B;  3KSD O;  3QVS A;  4MIY A;  1GL3 A;  3WBF A;  1RM0 A;  1EBU A;  2I5P O;  4MVJ I;  3EP7 B;  1FF9 A;  1RYE A;  3DMT C;  5A05 A;  1XYG A;  2DPG A;  3NT2 A;  3WBB A;  4F3Y A;  2IXA A;  4RL6 A;  3ZCX A;  2B4R O;  1H9B A;  1YL6 A;  5C7O O;  3QVX A;  3OHS X;  3BTS A;  3H0V B;  2BH9 A;  4R3N A;  1JN0 A;  3JSA A;  2GZ1 A;  3NTQ A;  4XQE A;  3E6A A;  2VYV A;  3DB2 A;  2PH5 A;  1GPD G;  1NQ5 A;  3OQB A;  3DZ3 B;  3NT5 A;  1B7G O;  3DZ6 B;  3B1K A;  3EP5 B;  4XQC A;  3KV3 O;  3WGY A;  2PKQ P;  1CER A;  1DAP A;  4O59 O;  1GR0 A;  5EER A;  1U1I A;  4TVB A;  1TB4 A;  4GQA A;  1NBO A;  3L6O O;  3EVN A;  3BTU A;  3DOC A;  4LGV A;  2O4U X;  3UW3 A;  4II7 A;  1I79 B;  3HSK A;  5JYA A;  1XEA A;  3O9Z A;  1RM3 A;  4PG6 A;  1NQO A;  4INA A;  2CVO A;  3VAZ A;  4NHE A;  2HO5 A;  4LRT B;  1OBF O;  3EPB B;  4N54 A;  1MB4 A;  3IWD B;  2CZC A;  3IWC B;  3CEA A;  4DPK A;  5AQ1 A;  3V1Y A;  3ZDF A;  1P1H A;  2VYN D;  1S7C A;  2EJW A;  1EVJ A;  4EW6 A;  1LC3 A;  2R00 A;  2GYY A;  1VSU A;  4DIB A;  4DBV O;  3B20 A;  3IDS A;  1T4B A;  3DBV O;  2YV3 A;  1JEN B;  3OA2 A;  1HDG O;  2Q49 A;  4H3V A;  4R51 A;  1TVE A;  3TZ6 A;  4WNI A;  4YWJ A;  2VYN A;  1YWG O;  1MHM B;  3EUW A;  4R5H A;  4MVJ F;  2H63 A;  1I32 A;  1P1F A;  1TLT A;  4KOA A;  4R5M A;  3MTJ A;  2D2I A;  1P1I A;  3PWS A;  3ING A;  1VC2 A;  3GDO A;  3LC1 O;  3PYL A;  3CIN A;  1H6C A;  1YDW A;  3C1A A;  4K9D A;  5JY6 A;  3EP8 B;  3GFG A;  3TW3 A;  1PQU A;  4MVJ M;  1I7M B;  4MVJ P;  3DAP A;  4O8J A;  3HXL A;  2YYY A;  3STH A;  3RC7 A;  3VOS A;  4LRS B;  5GZ3 A;  5C7L O;  2HKI A;  1P1J A;  5T73 A;  4XQG A;  2FPN A;  1H94 A;  3WYC A;  2DUU A;  1ML3 A;  2GZ3 A;  2OZP A;  4AK1 A;  4O89 A;  3RBV A;  1OFG A;  1J5P A;  3M2T A;  3RC1 A;  1DC4 A;  5EIO A;  3I23 A;  2X5K O;  5A03 A;  3K2B A;  1P9L A;  3RVD A;  2G17 A;  3H0W B;  2R00 C;  1I72 B;  1QXS A;  3QW2 A;  3RCB A;  3CMC O;  5JW6 A;  1DRU A;  4MIE A;  3FHL A;  4R41 A;  3RC2 A;  1MC4 A;  3CIF A;  2QZ9 A;  3EP6 B;  3ZJX A;  1PR3 A;  3EP9 B;  4R3W A;  3KSZ O;  5M6D A;  4HAD A;  1T4D A;  1H2H A;  3MOI A;  4P8R A;  5GZ1 A;  4XB2 A;  4HKT A;  4Z0H O;  1DC6 A;  3IP3 A;  3TUX A;  2XF8 A;  4FB5 A;  4DPL A;  4CLQ A;  3DZ2 B;  1DC5 A;  4GMF A;  3B1J A;  4XR4 A;  3FD8 A;  1H6D A;  1QKI A;  3MZ0 A;  1NPT O;  1J0X O;  2X5J O;  3E9M A;  1A7K A;  2DAP A;  3V5N A;  4MKZ A;  4MVJ E;  2DC1 A;  1ARZ A;  3GPD G;  3F4L A;  1OZA A;  3PFW O;  4LSM A;  3DMT A;  4XRG A;  4ZHS A;  1JKF A;  3QVW A;  4YDR A;  1JKI A;  4L8V A;  3GNQ A;  4MVJ H;  1PU2 A;  5A04 A;  1YL7 A;  3BIO A;  2PKQ O;  3WGZ A;  3L0D A;  3TV1 A;  3V2U A;  3DO5 A;  1VKN A;  3Q1L A;  4GPD 1;  2PKR A;  3PYM A;  3DTY A;  1RM5 A;  1DRW A;  3PWK A;  1NWH A;  3EC7 A;  1GYP A;  3H9E O;  4L9R A;  4IQ8 A;  3E5R A;  3ABI A;  2X0N A;  1CF2 O;  2HJS A;  5KVS A;  1K3T A;  1UYJ A;  1I7C B;  1ZNQ O;  5JYE A;  2AXQ A;  2B4T O;  1QMH A;  1DIH A;  2BHL A;  3LC2 O;  3U3X A;  1PS8 A;  1NWC A;  1GAE O;  1YL5 A;  5J9G A;  4PG5 A;  1F06 A;  3PYX A;  3K73 O;  4MVJ A;  4PLP A;  4MIN A;  2GLX A;  2GZ2 A;  1E7M A;  3LVF O;  4MKX A;  2O48 X;  4ZIC A;  5BNT A;  3OA0 A;  4MIO A;  2I3A A;  1BRM A;  5CEF A;  2GD1 O;  3KGD A;  5A02 A;  5DDI P;  3LC7 O;  2EP7 A;  1VM6 A;  1LC0 A;  3HJA A;  1VSV A;  1ZH8 A;  3WGQ A;  5JYF A;  3Q2K A;  3PZB A;  1IHX A;  2NVW A;  3PQV A;  5TVO B;  3WGO A;  2POQ X;  1H6B A;  3IWB B;  1QMI A;  1E5L A;  3DR3 A;  3EP4 B;  3EZY A;  4DPM A;  4O63 O;  3K9Q O;  5AVO A;  1Q7G A;  3WYB A;  1DPG A;  1NVM B;  1RM4 A;  5GZ6 A;  3E1K A;  2P2S A;  1C3V A;  2EP5 A;  4BOY A;  1E5Q A;  1LA2 A;  5C7I O;  1DC3 A;  3DZ4 B;  3C8M A;  1RYD A;  3QV1 A;  4JN6 B;  4MVJ G;  5EIN A;  1IHY A;  4MJL A;  1U8F O;  3Q11 A;  4R54 A;  1TA4 A;  2VYV D;  1NQA O;  3DZ5 B;  3EPA B;  1GCU A;  1PQP A;  3HQ4 O;  3KUX A;  5EES A;  1DRV A;  1E77 A;  5KVQ A;  3NTR A;  1H93 A;  1EBF A;  3BTV A;  5A06 A;  3WB9 A;  1NX6 A;  3QY9 A;  2Q22 A;  4PG7 A;  4R4J A;  1E7Y A;  3E18 A;  4WOJ A;  1SZJ G;  2Q4E A;  4WNC A;  1DBV O;  3HNP A;  1GYQ A;  4PG4 A;  2DBV O;  2I3G A;  3EP3 B;  3NTO A;  3E82 A;  1GD1 O;  3PZR A;  1I33 A;  4IQ0 A;  1YS4 A;  4XB1 A;  4MVJ D;  2IXB A;  3L4S O;  1CRW G;  4GMG A;  1I7B B;  1DSS G;  4PG8 A;  2G82 A;  3RC9 A;  3TUT A;  1P1K A;  1H6A A;  3CPS A; 
#chains in the Genus database with same CATH homology
 3EP5 A;  3EP6 A;  3DZ2 B;  3DZ6 A;  3EP3 A;  3DZ2 A;  3EP7 B;  3DZ3 A;  1MSV A;  5TVO B;  3EP8 A;  3EP8 B;  1I79 B;  3DZ4 A;  3DZ7 A;  1MHM A;  3DZ3 B;  1TMI A;  3EP7 A;  5TVO A;  1I7C B;  3DZ6 B;  3EP3 B;  3EP5 B;  3EP6 B;  1I7M B;  1TLU A;  3EP4 B;  3EP9 B;  3DZ5 B;  1JEN B;  3EPA B;  1I72 A;  1VR7 A;  3H0W A;  1JL0 A;  3EPB B;  3EPB A;  3H0V A;  1I7B A;  2III A;  3DZ5 A;  3EPA A;  3EP4 A;  1I7B B;  3H0V B;  1I7C A;  1MHM B;  3H0W B;  3DZ4 B;  1I79 A;  3DZ7 B;  1I72 B;  1JEN A;  3EP9 A;  1I7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...