3DZ6B

Human adometdc with 5'-[(4-aminooxybutyl)methylamino]-5'deoxy-8-ethyladenosine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
56
Chain Sequence
b'HFFEGTEKLLEVWFSRGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine decarboxylase beta chain
publication title New Insights into the Design of Inhibitors of Human S-Adenosylmethionine Decarboxylase: Studies of Adenine C8 Substitution in Structural Analogues of S-Adenosylmethionine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 8
structure length 56
sequence length 63
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 3dz6B01
1MHMB 3EP8B 3EP3B 3DZ3B 1I79B 3EP5B 3DZ5B 1I7BB 3DZ2B 3EP9B 3EPBB 1I7CB 1I72B 3DZ6B 3DZ7B 3H0VB 3H0WB 1I7MB 3EPAB 5TVOB 3EP6B 3DZ4B 3EP7B 1JENB 3EP4B
chains in the Genus database with same CATH superfamily
4MIEA 3LC7O 2PKQP 2VYVD 1SZJG 1P1JA 4KOAA 3TUTA 1LC0A 1U8FO 3V1YA 1P1KA 3EPBB 4YDRA 4XQ9A 3RCBA 3IJPA 4O8JA 4DPMA 2BHLA 5AVOA 4R5HA 1PQUA 3EUWA 5EESA 3B20A 3EC7A 3LC1O 3EP7B 1DAPA 1BRMA 1JENB 1MB4A 4TVBA 3DBVO 1S7CA 4WNIA 1NX6A 3QW2A 3ZCXA 1GADO 1GPDG 1U1IA 3DZ5B 4MIYA 4MKZA 1IHXA 3TUXA 1TB4A 1P1FA 2PKQO 1EVJA 3L6OO 1VKNA 3WB9A 1E77A 1JKFA 4JN6B 1NQAO 3WGZA 1MHMB 3HQ4O 4MVJP 4PG7A 3EP3B 3E9MA 2Q4EA 4O63O 1DC4A 4N54A 3NTRA 3GFGA 2G17A 5C7IO 4MVJA 4NHEA 1RM0A 4PG4A 1EBFA 4PLPA 3ZJXA 1B7GO 1GCUA 3NT4A 3QVTA 1DPGA 1E7YA 5T73A 2AXQA 3E18A 1RYDA 3PZRA 3RVDA 4XQGA 4RL6A 1QMHA 5GZ1A 2VYNA 2POQX 3JSAA 3NTQA 3QV1A 4L9RA 5CEFA 3DZ6B 5AQ1A 2DAPA 1CF2O 4R4JA 4MVJG 2D2IA 1FF9A 5A05A 1DBVO 3WGQA 2R00A 4PG5A 2X5KO 5GZ3A 2CVOA 2P2SA 4ZHSA 1VC2A 1GAEO 4EW6A 3PQVA 2VYVA 5C7LO 2CZCA 3DOCA 5BNTA 1H6DA 3DZ7B 3DMTC 1JN0A 2DUUA 2GLXA 3K9QO 3INGA 3EPAB 3NTOA 4HADA 4H3VA 2GYYA 1UYJA 4MVJF 1DRWA 4XQEA 5GZ6A 1VSVA 3FD8A 3RC1A 1GR0A 4HKTA 3H9EO 1GD1O 1NQ5A 1CERA 4LRSB 2I3GA 3LC2O 5A03A 3EP6B 3MOIA 1PS8A 1YS4A 4BOYA 3B1KA 2OZPA 4L8VA 2HJSA 1J0XO 1ML3A 3Q0EA 1VM6A 1RYEA 3QY9A 1TVEA 3PWSA 3PWKA 4LGVA 3GDOA 4DPKA 4DBVO 3CEAA 1JKIA 1LA2A 3NT2A 1I33A 4Z0HO 3IWDB 5EINA 1XEAA 3BTUA 1ZNQO 3CMCO 3V5NA 3E5RA 1RM3A 2FPNA 1NPTO 3PYXA 3DZ2B 4AK1A 3BTSA 4IQ8A 5EIOA 1YL6A 4XQCA 1T4DA 3OA2A 3F4LA 3KGDA 1GYPA 2B4TO 2G82A 1P9LA 1P1HA 4INAA 3I23A 1EBUA 3L0DA 4R51A 1QXSA 2B4RO 2PH5A 1OFGA 4II7A 1ZH8A 3WBFA 1I79B 3EVNA 4MJLA 2X0NA 3EP9B 1Q7GA 1DRVA 2I5PO 1E7MA 3L4SO 2NVWA 3H0WB 3OHSX 1H2HA 4WOJA 3CIFA 3PYMA 3GPDG 3BTVA 2Q22A 3B1JA 4WNCA 1YDWA 4QX6A 3PZBA 3EP5B 1I7BB 3KSZO 4PG6A 3QVWA 1RM5A 2GZ1A 3Q11A 2XF8A 3O9ZA 2YYYA 3TW3A 4ZICA 1J5PA 2DPGA 1GYQA 2IXBA 2O4UX 1H94A 3QVSA 3WGOA 4R3NA 5KVSA 4R41A 1A7KA 3ABIA 5JYAA 4O59O 2PKRA 3RBVA 1Q2XA 3C1AA 1NWHA 1H6BA 3MZ0A 3DTYA 4GQAA 1I7CB 1I72B 3CPSA 3K2BA 2GZ2A 1DSSG 1H9AA 4PG8A 3VAZA 4CLQA 3DZ4B 1H6AA 3DMTA 3HSKA 2GZ3A 3HJAA 5KVQA 1H93A 2X5JO 3BIOA 3DZ3B 1CRWG 3E6AA 4XR4A 4XB2A 1DIHA 4MVJM 3V2UA 4DIBA 3U3XA 3FHLA 4LRTB 1GL3A 1QKIA 3HXLA 3KV3O 3QVXA 5J9GA 4DPLA 1YL5A 4MVJI 5TVOB 3PFWO 3Q1LA 1HDGO 4LSMA 4FB5A 3IWCB 3MTJA 2QZ9A 1NVMB 1H6CA 3EZYA 4O89A 3Q2KA 2YV3A 3KUXA 1DC6A 5JY6A 5DDIP 3E82A 3DO5A 3E1KA 3WGYA 5M6DA 3K73O 5A06A 4MVJE 3IWBB 3DB2A 1PU2A 3RC2A 1QMIA 3M2TA 1YL7A 3EP4B 5EERA 3HNPA 3TV1A 3CINA 1XYGA 5A02A 1TLTA 3RC7A 1VKOA 1PR3A 1TA4A 1MC4A 4MINA 2R00C 3RC9A 3VOSA 3IDSA 1K3TA 5C7OO 1DC3A 1OBFO 2GD1O 3LVFO 3Q2IA 3WBBA 1P1IA 1T4BA 1NBOA 3UW3A 4K9DA 1NWCA 3EP8B 4R54A 5JYEA 2EP5A 3GNQA 1RM4A 2IXAA 3DAPA 4GMGA 1DRUA 4XB1A 4R3WA 1ARZA 3WYBA 1E5LA 4R5MA 2DBVO 4MVJD 2H63A 2HKIA 2Q49A 4XRGA 1PQPA 3NT5A 4MVJH 3TZ6A 3OA0A 3PYLA 2EP7A 1DC5A 2DC1A 5JW6A 1IHYA 1LC3A 1OZAA 4F3YA 4YWJA 2BH9A 3OQBA 3KSDO 1E5QA 3UUWA 3WYCA 2VYND 3C8MA 3DR3A 2EJWA 3ZDFA 1VSUA 5A04A 1C3VA 4IQ0A 4GMFA 1NQOA 4P8RA 3STHA 2O48X 3IP3A 4MIOA 3H0VB 4MKXA 1F06A 1I32A 2HO5A 1I7MB 2I3AA 5JYFA 4GPD1 1YWGO 2NQTA 1H9BA
chains in the Genus database with same CATH topology
3EP7A 1JENA 3EP4A 1MHMB 5TVOA 3EP8B 1MHMA 3DZ3B 3EP3B 3EP4B 1MSVA 1TMIA 3EP8A 1I79B 3EP5B 3EP3A 1I79A 3DZ5B 1I7BB 3DZ3A 3EP5A 3DZ2B 3EP9B 1JL0A 3DZ5A 1I7BA 1I7CB 1VR7A 1I72B 3EPBB 3DZ6B 3DZ2A 3EP9A 1I7CA 3DZ7B 3EPBA 3H0VB 1I72A 3H0WB 3DZ7A 3DZ6A 1I7MB 2IIIA 3H0VA 3H0WA 3EPAB 5TVOB 3EP6B 1I7MA 3DZ4B 3EP7B 3EPAA 1TLUA 3DZ4A 1JENB 3EP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHM B;  3EP8 B;  3EP3 B;  3DZ3 B;  1I79 B;  3EP5 B;  3DZ5 B;  1I7B B;  3DZ2 B;  3EP9 B;  3EPB B;  1I7C B;  1I72 B;  3DZ6 B;  3DZ7 B;  3H0V B;  3H0W B;  1I7M B;  3EPA B;  5TVO B;  3EP6 B;  3DZ4 B;  3EP7 B;  1JEN B;  3EP4 B; 
#chains in the Genus database with same CATH topology
 4MIE A;  3LC7 O;  2PKQ P;  2VYV D;  1SZJ G;  1P1J A;  4KOA A;  3TUT A;  1LC0 A;  1U8F O;  3V1Y A;  1P1K A;  3EPB B;  4YDR A;  4XQ9 A;  3RCB A;  3IJP A;  4O8J A;  4DPM A;  2BHL A;  5AVO A;  4R5H A;  1PQU A;  3EUW A;  5EES A;  3B20 A;  3EC7 A;  3LC1 O;  3EP7 B;  1DAP A;  1BRM A;  1JEN B;  1MB4 A;  4TVB A;  3DBV O;  1S7C A;  4WNI A;  1NX6 A;  3QW2 A;  3ZCX A;  1GAD O;  1GPD G;  1U1I A;  3DZ5 B;  4MIY A;  4MKZ A;  1IHX A;  3TUX A;  1TB4 A;  1P1F A;  2PKQ O;  1EVJ A;  3L6O O;  1VKN A;  3WB9 A;  1E77 A;  1JKF A;  4JN6 B;  1NQA O;  3WGZ A;  1MHM B;  3HQ4 O;  4MVJ P;  4PG7 A;  3EP3 B;  3E9M A;  2Q4E A;  4O63 O;  1DC4 A;  4N54 A;  3NTR A;  3GFG A;  2G17 A;  5C7I O;  4MVJ A;  4NHE A;  1RM0 A;  4PG4 A;  1EBF A;  4PLP A;  3ZJX A;  1B7G O;  1GCU A;  3NT4 A;  3QVT A;  1DPG A;  1E7Y A;  5T73 A;  2AXQ A;  3E18 A;  1RYD A;  3PZR A;  3RVD A;  4XQG A;  4RL6 A;  1QMH A;  5GZ1 A;  2VYN A;  2POQ X;  3JSA A;  3NTQ A;  3QV1 A;  4L9R A;  5CEF A;  3DZ6 B;  5AQ1 A;  2DAP A;  1CF2 O;  4R4J A;  4MVJ G;  2D2I A;  1FF9 A;  5A05 A;  1DBV O;  3WGQ A;  2R00 A;  4PG5 A;  2X5K O;  5GZ3 A;  2CVO A;  2P2S A;  4ZHS A;  1VC2 A;  1GAE O;  4EW6 A;  3PQV A;  2VYV A;  5C7L O;  2CZC A;  3DOC A;  5BNT A;  1H6D A;  3DZ7 B;  3DMT C;  1JN0 A;  2DUU A;  2GLX A;  3K9Q O;  3ING A;  3EPA B;  3NTO A;  4HAD A;  4H3V A;  2GYY A;  1UYJ A;  4MVJ F;  1DRW A;  4XQE A;  5GZ6 A;  1VSV A;  3FD8 A;  3RC1 A;  1GR0 A;  4HKT A;  3H9E O;  1GD1 O;  1NQ5 A;  1CER A;  4LRS B;  2I3G A;  3LC2 O;  5A03 A;  3EP6 B;  3MOI A;  1PS8 A;  1YS4 A;  4BOY A;  3B1K A;  2OZP A;  4L8V A;  2HJS A;  1J0X O;  1ML3 A;  3Q0E A;  1VM6 A;  1RYE A;  3QY9 A;  1TVE A;  3PWS A;  3PWK A;  4LGV A;  3GDO A;  4DPK A;  4DBV O;  3CEA A;  1JKI A;  1LA2 A;  3NT2 A;  1I33 A;  4Z0H O;  3IWD B;  5EIN A;  1XEA A;  3BTU A;  1ZNQ O;  3CMC O;  3V5N A;  3E5R A;  1RM3 A;  2FPN A;  1NPT O;  3PYX A;  3DZ2 B;  4AK1 A;  3BTS A;  4IQ8 A;  5EIO A;  1YL6 A;  4XQC A;  1T4D A;  3OA2 A;  3F4L A;  3KGD A;  1GYP A;  2B4T O;  2G82 A;  1P9L A;  1P1H A;  4INA A;  3I23 A;  1EBU A;  3L0D A;  4R51 A;  1QXS A;  2B4R O;  2PH5 A;  1OFG A;  4II7 A;  1ZH8 A;  3WBF A;  1I79 B;  3EVN A;  4MJL A;  2X0N A;  3EP9 B;  1Q7G A;  1DRV A;  2I5P O;  1E7M A;  3L4S O;  2NVW A;  3H0W B;  3OHS X;  1H2H A;  4WOJ A;  3CIF A;  3PYM A;  3GPD G;  3BTV A;  2Q22 A;  3B1J A;  4WNC A;  1YDW A;  4QX6 A;  3PZB A;  3EP5 B;  1I7B B;  3KSZ O;  4PG6 A;  3QVW A;  1RM5 A;  2GZ1 A;  3Q11 A;  2XF8 A;  3O9Z A;  2YYY A;  3TW3 A;  4ZIC A;  1J5P A;  2DPG A;  1GYQ A;  2IXB A;  2O4U X;  1H94 A;  3QVS A;  3WGO A;  4R3N A;  5KVS A;  4R41 A;  1A7K A;  3ABI A;  5JYA A;  4O59 O;  2PKR A;  3RBV A;  1Q2X A;  3C1A A;  1NWH A;  1H6B A;  3MZ0 A;  3DTY A;  4GQA A;  1I7C B;  1I72 B;  3CPS A;  3K2B A;  2GZ2 A;  1DSS G;  1H9A A;  4PG8 A;  3VAZ A;  4CLQ A;  3DZ4 B;  1H6A A;  3DMT A;  3HSK A;  2GZ3 A;  3HJA A;  5KVQ A;  1H93 A;  2X5J O;  3BIO A;  3DZ3 B;  1CRW G;  3E6A A;  4XR4 A;  4XB2 A;  1DIH A;  4MVJ M;  3V2U A;  4DIB A;  3U3X A;  3FHL A;  4LRT B;  1GL3 A;  1QKI A;  3HXL A;  3KV3 O;  3QVX A;  5J9G A;  4DPL A;  1YL5 A;  4MVJ I;  5TVO B;  3PFW O;  3Q1L A;  1HDG O;  4LSM A;  4FB5 A;  3IWC B;  3MTJ A;  2QZ9 A;  1NVM B;  1H6C A;  3EZY A;  4O89 A;  3Q2K A;  2YV3 A;  3KUX A;  1DC6 A;  5JY6 A;  5DDI P;  3E82 A;  3DO5 A;  3E1K A;  3WGY A;  5M6D A;  3K73 O;  5A06 A;  4MVJ E;  3IWB B;  3DB2 A;  1PU2 A;  3RC2 A;  1QMI A;  3M2T A;  1YL7 A;  3EP4 B;  5EER A;  3HNP A;  3TV1 A;  3CIN A;  1XYG A;  5A02 A;  1TLT A;  3RC7 A;  1VKO A;  1PR3 A;  1TA4 A;  1MC4 A;  4MIN A;  2R00 C;  3RC9 A;  3VOS A;  3IDS A;  1K3T A;  5C7O O;  1DC3 A;  1OBF O;  2GD1 O;  3LVF O;  3Q2I A;  3WBB A;  1P1I A;  1T4B A;  1NBO A;  3UW3 A;  4K9D A;  1NWC A;  3EP8 B;  4R54 A;  5JYE A;  2EP5 A;  3GNQ A;  1RM4 A;  2IXA A;  3DAP A;  4GMG A;  1DRU A;  4XB1 A;  4R3W A;  1ARZ A;  3WYB A;  1E5L A;  4R5M A;  2DBV O;  4MVJ D;  2H63 A;  2HKI A;  2Q49 A;  4XRG A;  1PQP A;  3NT5 A;  4MVJ H;  3TZ6 A;  3OA0 A;  3PYL A;  2EP7 A;  1DC5 A;  2DC1 A;  5JW6 A;  1IHY A;  1LC3 A;  1OZA A;  4F3Y A;  4YWJ A;  2BH9 A;  3OQB A;  3KSD O;  1E5Q A;  3UUW A;  3WYC A;  2VYN D;  3C8M A;  3DR3 A;  2EJW A;  3ZDF A;  1VSU A;  5A04 A;  1C3V A;  4IQ0 A;  4GMF A;  1NQO A;  4P8R A;  3STH A;  2O48 X;  3IP3 A;  4MIO A;  3H0V B;  4MKX A;  1F06 A;  1I32 A;  2HO5 A;  1I7M B;  2I3A A;  5JYF A;  4GPD 1;  1YWG O;  2NQT A;  1H9B A; 
#chains in the Genus database with same CATH homology
 3EP7 A;  1JEN A;  3EP4 A;  1MHM B;  5TVO A;  3EP8 B;  1MHM A;  3DZ3 B;  3EP3 B;  3EP4 B;  1MSV A;  1TMI A;  3EP8 A;  1I79 B;  3EP5 B;  3EP3 A;  1I79 A;  3DZ5 B;  1I7B B;  3DZ3 A;  3EP5 A;  3DZ2 B;  3EP9 B;  1JL0 A;  3DZ5 A;  1I7B A;  1I7C B;  1VR7 A;  1I72 B;  3EPB B;  3DZ6 B;  3DZ2 A;  3EP9 A;  1I7C A;  3DZ7 B;  3EPB A;  3H0V B;  1I72 A;  3H0W B;  3DZ7 A;  3DZ6 A;  1I7M B;  2III A;  3H0V A;  3H0W A;  3EPA B;  5TVO B;  3EP6 B;  1I7M A;  3DZ4 B;  3EP7 B;  3EPA A;  1TLU A;  3DZ4 A;  1JEN B;  3EP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...