3DZEA

Crystal structure of bovine coupling factor b bound with cadmium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
176
structure length
176
Chain Sequence
SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
molecule keywords ATP synthase subunit s, mitochondrial
molecule tags Electron transport
source organism Bos taurus
total genus 65
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3dzeA00
4U09A 4GLPA 1YRGA 3C6OB 2XWTC 4Z79A 4R5DA 4YEBB 2O6RA 4PKIG 1U0ND 1IO0A 3ULAA 4K17A 2P1OB 1K5GC 4WP6A 3CIGA 2RA8A 4LXSA 1OTOA 4LI1A 3OGMB 4J4LA 4R6AA 4MN8B 4Z94G 4L3FA 2UZXA 4R6FA 4FDWA 4R09A 3RGZA 3W3JA 5HZLB 2WQXA 5GQRK 5A5CA 2FT3A 2ELLA 1O6VA 3ULVA 4C2AB 2JQDA 4FD0A 4LXRA 5IJDA 3W3KA 2Z65A 2Q4GW 1M10B 3RFEA 2Z64A 4B8CD 5GS2B 5CMPA 2BNHA 1FT8A 3TSRE 2O6QA 3E2JA 5IYXC 5AWDA 4Z8GA 2OMXA 3RW6A 4P91A 1DFJI 2RR6A 1JL5A 1WWLA 1OOKG 3WPFA 4U7LA 1XECA 3RFSA 3ZYNA 4H09A 5AZ5A 2P1QB 4ECOA 5B4PA 3M19A 1XKUA 1P8VA 4MQWX 3G3BA 3RFJA 3G39A 3M18A 2Z62A 4GT6A 3ULUA 3PMHG 5D3IA 1ZIWA 3RJ0A 4KNGA 1KOOA 4V2EA 1K5DC 2XOTA 1OGQA 4NKGA 4Z64C 3C6NB 3E4GA 2WQWA 3G06A 1Z7XW 4R58A 3UL8A 4LSAA 4ARRA 2ASTB 1FO1A 2IFGA 3ZYJA 2Z82A 4R6GA 3KJ4A 4QBZA 4PEQB 3W3LA 1DS9A 4KXFB 4RWTC 4XSQA 1XWDC 3P72A 3E3ZA 2OMVA 4WYKA 4XGOA 3FXIA 2WQUA 3RGXA 4KT1A 1QYYA 4V2DA 1M0ZA 5FTTB 3O6NA 4P8SA 3WPGA 4XOSA 4Y61B 5HDHA 2BEXA 4PQ8A 4UFRA 4BSSA 4LSXC 2R9UA 4FMZA 2ID5A 3UN9A 4CP6A 1A9NA 3W3MA 3WPEA 1P8TA 4CC4C 2JE0A 2A0ZA 3A79B 4PSJA 1W8AA 4L3AA 3WPDA 5GMGA 3ZYIA 3OGLB 4LSCA 2V9SA 1FS2A 1PGVA 3REZA 3WPCA 4AY9X 4BSRA 1GWBA 1D0BA 2P1MB 5AWBA 3W3NA 4Q3GA 3BZ5A 3C6PB 4IM6A 5GMHA 4V2CA 3CVRA 3E6JA 4R08A 4FHOA 3WPHA 4C2BB 3W3GA 2JE1A 1FQVA 1OTMA 5GMFA 1A4YA 1OZNA 4TZHA 4CILA 4QC0A 4HQ1A 3ZYOA 2Z7XA 5LFNA 4J0MA 4Q3IA 3WPBA 3WPIA 4CNMA 3O53A 1G9UA 4FCGA 1XEUA 4LSXA 2V9TB 2P1NB 2P1PB 4RCWA 5AWCA 4R07A 3RIZA 1M9LA 2CA6A 4OQTA 3OJAB 1H6UA 4CC4A 3UL7A 4M7EC 4AW4A 3SB4A 2OMTA 3DZEA 3UL9A 2Z7XB 2WQVA 5CMNA 2OMZA 4R6JA 3CIYA 4CNCA 1KOHA 3G04C 4BSUA 1DCEA 1O6TA 4I6JB 4U08A 5AWAA 2Z63A 4RCAB 3VQ1A 3RW7A 4PERA 2ASSB 2WFHA 1SQ0B 3JB9j 2OMWA 3VQ2A 4Z61C 4U06A 1M9SA 2O6SA 5GS0A 4Q62A 3G3AA 1XCDA 4ECNA 3WN4A 2OMUA 5B0TA 4ARNA 2Z66A 1OTNA 3GOZA 4BV4R 1O6SA 5B0NA 4R0AA 4LI2A 4R5CA 4QXEA 5IJCA 1LTXA 2OMYA 3OGKB 2Z81A 4M7EA 4G8AA 2Y5QA 2V70A 4EZGA 5IJBA 1H6TA 1P9AG 3OJAA 2UZYA 4NKHA 4FS7A
chains in the Genus database with same CATH superfamily
4U09A 4GLPA 1YRGA 3C6OB 2XWTC 4Z79A 4R5DA 4YEBB 2O6RA 4PKIG 1U0ND 1IO0A 3ULAA 4K17A 2P1OB 1K5GC 4WP6A 3CIGA 2RA8A 4LXSA 1OTOA 4LI1A 3OGMB 4J4LA 4R6AA 4MN8B 4Z94G 4L3FA 2UZXA 4R6FA 4FDWA 4R09A 3RGZA 3W3JA 5HZLB 2WQXA 5GQRK 5A5CA 2FT3A 2ELLA 1O6VA 3ULVA 4C2AB 2JQDA 4FD0A 4LXRA 4NZTM 5IJDA 3W3KA 2Z65A 2Q4GW 1M10B 3RFEA 2Z64A 4B8CD 5GS2B 5CMPA 2BNHA 1FT8A 3TSRE 2O6QA 3E2JA 5IYXC 5AWDA 4Z8GA 2OMXA 3RW6A 4P91A 1DFJI 2RR6A 1JL5A 1WWLA 1OOKG 3WPFA 4U7LA 1XECA 3RFSA 3ZYNA 4H09A 5AZ5A 2P1QB 4ECOA 5B4PA 3M19A 1XKUA 1P8VA 4MQWX 3G3BA 3RFJA 3G39A 3M18A 2Z62A 4GT6A 3ULUA 3PMHG 5D3IA 1ZIWA 3RJ0A 4KNGA 1KOOA 4V2EA 1K5DC 2XOTA 1OGQA 4NKGA 4Z64C 3C6NB 3E4GA 2WQWA 3G06A 1Z7XW 4R58A 3UL8A 4LSAA 4ARRA 2ASTB 1FO1A 2IFGA 3ZYJA 2Z82A 4R6GA 3KJ4A 4QBZA 4PEQB 3W3LA 1DS9A 4KXFB 4RWTC 4NZRM 4XSQA 1XWDC 3P72A 3E3ZA 2OMVA 4WYKA 4XGOA 3FXIA 2WQUA 3RGXA 4KT1A 1QYYA 4V2DA 1M0ZA 5FTTB 3O6NA 4P8SA 3WPGA 4XOSA 4Y61B 5HDHA 2BEXA 4PQ8A 4UFRA 4BSSA 4LSXC 2R9UA 4FMZA 2ID5A 3UN9A 4CP6A 1A9NA 3W3MA 3WPEA 1P8TA 4CC4C 2JE0A 2A0ZA 3A79B 4PSJA 1W8AA 4L3AA 3WPDA 5GMGA 3ZYIA 3OGLB 4LSCA 2V9SA 1FS2A 1PGVA 3REZA 3WPCA 4AY9X 4BSRA 1GWBA 1D0BA 2P1MB 5AWBA 3W3NA 4Q3GA 3BZ5A 3C6PB 4IM6A 5GMHA 4V2CA 3CVRA 3E6JA 4R08A 4FHOA 3WPHA 4C2BB 3W3GA 2JE1A 1FQVA 1OTMA 5GMFA 1A4YA 1OZNA 4TZHA 4CILA 4QC0A 4HQ1A 3ZYOA 2Z7XA 5LFNA 4J0MA 4Q3IA 3WPBA 3WPIA 4CNMA 3O53A 1G9UA 4FCGA 1XEUA 4LSXA 2V9TB 2P1NB 2P1PB 4RCWA 5AWCA 4R07A 3RIZA 1M9LA 2CA6A 4OQTA 3OJAB 1H6UA 4CC4A 3UL7A 4M7EC 4AW4A 3SB4A 2OMTA 3DZEA 3UL9A 2Z7XB 2WQVA 5CMNA 2OMZA 4R6JA 3CIYA 4CNCA 1KOHA 3G04C 4BSUA 1DCEA 1O6TA 4I6JB 4U08A 5AWAA 2Z63A 4RCAB 3VQ1A 3RW7A 4PERA 2ASSB 2WFHA 1SQ0B 3JB9j 2OMWA 3VQ2A 4Z61C 4U06A 1M9SA 2O6SA 5GS0A 4Q62A 3G3AA 1XCDA 4ECNA 3WN4A 2OMUA 5B0TA 4ARNA 2Z66A 1OTNA 3GOZA 4BV4R 1O6SA 5B0NA 4R0AA 4LI2A 4R5CA 4QXEA 5IJCA 1LTXA 2OMYA 3OGKB 2Z81A 4M7EA 4G8AA 2Y5QA 2V70A 4EZGA 5IJBA 1H6TA 1P9AG 3OJAA 2UZYA 4NKHA 4FS7A
chains in the Genus database with same CATH topology
4U09A 4GLPA 1YRGA 3C6OB 2XWTC 4Z79A 4R5DA 4YEBB 2O6RA 4PKIG 1U0ND 1IO0A 3ULAA 4K17A 2P1OB 1K5GC 4WP6A 3CIGA 2RA8A 4LXSA 1OTOA 4LI1A 3OGMB 4J4LA 4R6AA 4MN8B 4Z94G 4L3FA 2UZXA 4R6FA 4FDWA 4R09A 3RGZA 3W3JA 5HZLB 2WQXA 5GQRK 5A5CA 2FT3A 2ELLA 1O6VA 3ULVA 4C2AB 2JQDA 4FD0A 4LXRA 5IJDA 3W3KA 2Z65A 2Q4GW 1M10B 3RFEA 2Z64A 4B8CD 5GS2B 5CMPA 2BNHA 1FT8A 3TSRE 2O6QA 3E2JA 5IYXC 5AWDA 4Z8GA 2OMXA 3RW6A 4P91A 1DFJI 2RR6A 1JL5A 1WWLA 1OOKG 3WPFA 4U7LA 1XECA 3RFSA 3ZYNA 4H09A 5AZ5A 2P1QB 4ECOA 5B4PA 3M19A 1XKUA 1P8VA 4MQWX 3G3BA 3RFJA 3G39A 3M18A 2Z62A 4GT6A 3ULUA 3PMHG 5D3IA 1ZIWA 3RJ0A 4KNGA 1KOOA 4V2EA 1K5DC 2XOTA 1OGQA 4NKGA 4Z64C 3C6NB 3E4GA 2WQWA 3G06A 1Z7XW 4R58A 3UL8A 4LSAA 4ARRA 2ASTB 1FO1A 2IFGA 3ZYJA 2Z82A 4R6GA 3KJ4A 4QBZA 4PEQB 3W3LA 1DS9A 4KXFB 4RWTC 4XSQA 1XWDC 3P72A 3E3ZA 2OMVA 4WYKA 4XGOA 3FXIA 2WQUA 3RGXA 4KT1A 1QYYA 4V2DA 1M0ZA 5FTTB 3O6NA 4P8SA 3WPGA 4XOSA 4Y61B 5HDHA 2BEXA 4PQ8A 4UFRA 4BSSA 4LSXC 2R9UA 4FMZA 2ID5A 3UN9A 4CP6A 1A9NA 3W3MA 3WPEA 1P8TA 4CC4C 2JE0A 2A0ZA 3A79B 4PSJA 1W8AA 4L3AA 3WPDA 5GMGA 3ZYIA 3OGLB 4LSCA 2V9SA 1FS2A 1PGVA 3REZA 3WPCA 4AY9X 4BSRA 1GWBA 1D0BA 2P1MB 5AWBA 3W3NA 4Q3GA 3BZ5A 3C6PB 4IM6A 5GMHA 4V2CA 3CVRA 3E6JA 4R08A 4FHOA 3WPHA 4C2BB 3W3GA 2JE1A 1FQVA 1OTMA 5GMFA 1A4YA 1OZNA 4TZHA 4CILA 4QC0A 4HQ1A 3ZYOA 2Z7XA 5LFNA 4J0MA 4Q3IA 3WPBA 3WPIA 4CNMA 3O53A 1G9UA 4FCGA 1XEUA 4LSXA 2V9TB 2P1NB 2P1PB 4RCWA 5AWCA 4R07A 3RIZA 1M9LA 2CA6A 4OQTA 3OJAB 1H6UA 4CC4A 3UL7A 4M7EC 4AW4A 3SB4A 2OMTA 3DZEA 3UL9A 2Z7XB 2WQVA 5CMNA 2OMZA 4R6JA 3CIYA 4CNCA 1KOHA 3G04C 4BSUA 1DCEA 1O6TA 4I6JB 4U08A 5AWAA 2Z63A 4RCAB 3VQ1A 3RW7A 4PERA 2ASSB 2WFHA 1SQ0B 3JB9j 2OMWA 3VQ2A 4Z61C 4U06A 1M9SA 2O6SA 5GS0A 4Q62A 3G3AA 1XCDA 4ECNA 3WN4A 2OMUA 5B0TA 4ARNA 2Z66A 1OTNA 3GOZA 4BV4R 1O6SA 5B0NA 4R0AA 4LI2A 4R5CA 4QXEA 5IJCA 1LTXA 2OMYA 3OGKB 2Z81A 4M7EA 4G8AA 2Y5QA 2V70A 4EZGA 5IJBA 1H6TA 1P9AG 3OJAA 2UZYA 4NKHA 4FS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U09 A;  4GLP A;  1YRG A;  3C6O B;  2XWT C;  4Z79 A;  4R5D A;  4YEB B;  2O6R A;  4PKI G;  1U0N D;  1IO0 A;  3ULA A;  4K17 A;  2P1O B;  1K5G C;  4WP6 A;  3CIG A;  2RA8 A;  4LXS A;  1OTO A;  4LI1 A;  3OGM B;  4J4L A;  4R6A A;  4MN8 B;  4Z94 G;  4L3F A;  2UZX A;  4R6F A;  4FDW A;  4R09 A;  3RGZ A;  3W3J A;  5HZL B;  2WQX A;  5GQR K;  5A5C A;  2FT3 A;  2ELL A;  1O6V A;  3ULV A;  4C2A B;  2JQD A;  4FD0 A;  4LXR A;  5IJD A;  3W3K A;  2Z65 A;  2Q4G W;  1M10 B;  3RFE A;  2Z64 A;  4B8C D;  5GS2 B;  5CMP A;  2BNH A;  1FT8 A;  3TSR E;  2O6Q A;  3E2J A;  5IYX C;  5AWD A;  4Z8G A;  2OMX A;  3RW6 A;  4P91 A;  1DFJ I;  2RR6 A;  1JL5 A;  1WWL A;  1OOK G;  3WPF A;  4U7L A;  1XEC A;  3RFS A;  3ZYN A;  4H09 A;  5AZ5 A;  2P1Q B;  4ECO A;  5B4P A;  3M19 A;  1XKU A;  1P8V A;  4MQW X;  3G3B A;  3RFJ A;  3G39 A;  3M18 A;  2Z62 A;  4GT6 A;  3ULU A;  3PMH G;  5D3I A;  1ZIW A;  3RJ0 A;  4KNG A;  1KOO A;  4V2E A;  1K5D C;  2XOT A;  1OGQ A;  4NKG A;  4Z64 C;  3C6N B;  3E4G A;  2WQW A;  3G06 A;  1Z7X W;  4R58 A;  3UL8 A;  4LSA A;  4ARR A;  2AST B;  1FO1 A;  2IFG A;  3ZYJ A;  2Z82 A;  4R6G A;  3KJ4 A;  4QBZ A;  4PEQ B;  3W3L A;  1DS9 A;  4KXF B;  4RWT C;  4XSQ A;  1XWD C;  3P72 A;  3E3Z A;  2OMV A;  4WYK A;  4XGO A;  3FXI A;  2WQU A;  3RGX A;  4KT1 A;  1QYY A;  4V2D A;  1M0Z A;  5FTT B;  3O6N A;  4P8S A;  3WPG A;  4XOS A;  4Y61 B;  5HDH A;  2BEX A;  4PQ8 A;  4UFR A;  4BSS A;  4LSX C;  2R9U A;  4FMZ A;  2ID5 A;  3UN9 A;  4CP6 A;  1A9N A;  3W3M A;  3WPE A;  1P8T A;  4CC4 C;  2JE0 A;  2A0Z A;  3A79 B;  4PSJ A;  1W8A A;  4L3A A;  3WPD A;  5GMG A;  3ZYI A;  3OGL B;  4LSC A;  2V9S A;  1FS2 A;  1PGV A;  3REZ A;  3WPC A;  4AY9 X;  4BSR A;  1GWB A;  1D0B A;  2P1M B;  5AWB A;  3W3N A;  4Q3G A;  3BZ5 A;  3C6P B;  4IM6 A;  5GMH A;  4V2C A;  3CVR A;  3E6J A;  4R08 A;  4FHO A;  3WPH A;  4C2B B;  3W3G A;  2JE1 A;  1FQV A;  1OTM A;  5GMF A;  1A4Y A;  1OZN A;  4TZH A;  4CIL A;  4QC0 A;  4HQ1 A;  3ZYO A;  2Z7X A;  5LFN A;  4J0M A;  4Q3I A;  3WPB A;  3WPI A;  4CNM A;  3O53 A;  1G9U A;  4FCG A;  1XEU A;  4LSX A;  2V9T B;  2P1N B;  2P1P B;  4RCW A;  5AWC A;  4R07 A;  3RIZ A;  1M9L A;  2CA6 A;  4OQT A;  3OJA B;  1H6U A;  4CC4 A;  3UL7 A;  4M7E C;  4AW4 A;  3SB4 A;  2OMT A;  3DZE A;  3UL9 A;  2Z7X B;  2WQV A;  5CMN A;  2OMZ A;  4R6J A;  3CIY A;  4CNC A;  1KOH A;  3G04 C;  4BSU A;  1DCE A;  1O6T A;  4I6J B;  4U08 A;  5AWA A;  2Z63 A;  4RCA B;  3VQ1 A;  3RW7 A;  4PER A;  2ASS B;  2WFH A;  1SQ0 B;  3JB9 j;  2OMW A;  3VQ2 A;  4Z61 C;  4U06 A;  1M9S A;  2O6S A;  5GS0 A;  4Q62 A;  3G3A A;  1XCD A;  4ECN A;  3WN4 A;  2OMU A;  5B0T A;  4ARN A;  2Z66 A;  1OTN A;  3GOZ A;  4BV4 R;  1O6S A;  5B0N A;  4R0A A;  4LI2 A;  4R5C A;  4QXE A;  5IJC A;  1LTX A;  2OMY A;  3OGK B;  2Z81 A;  4M7E A;  4G8A A;  2Y5Q A;  2V70 A;  4EZG A;  5IJB A;  1H6T A;  1P9A G;  3OJA A;  2UZY A;  4NKH A;  4FS7 A; 
#chains in the Genus database with same CATH topology
 4U09 A;  4GLP A;  1YRG A;  3C6O B;  2XWT C;  4Z79 A;  4R5D A;  4YEB B;  2O6R A;  4PKI G;  1U0N D;  1IO0 A;  3ULA A;  4K17 A;  2P1O B;  1K5G C;  4WP6 A;  3CIG A;  2RA8 A;  4LXS A;  1OTO A;  4LI1 A;  3OGM B;  4J4L A;  4R6A A;  4MN8 B;  4Z94 G;  4L3F A;  2UZX A;  4R6F A;  4FDW A;  4R09 A;  3RGZ A;  3W3J A;  5HZL B;  2WQX A;  5GQR K;  5A5C A;  2FT3 A;  2ELL A;  1O6V A;  3ULV A;  4C2A B;  2JQD A;  4FD0 A;  4LXR A;  4NZT M;  5IJD A;  3W3K A;  2Z65 A;  2Q4G W;  1M10 B;  3RFE A;  2Z64 A;  4B8C D;  5GS2 B;  5CMP A;  2BNH A;  1FT8 A;  3TSR E;  2O6Q A;  3E2J A;  5IYX C;  5AWD A;  4Z8G A;  2OMX A;  3RW6 A;  4P91 A;  1DFJ I;  2RR6 A;  1JL5 A;  1WWL A;  1OOK G;  3WPF A;  4U7L A;  1XEC A;  3RFS A;  3ZYN A;  4H09 A;  5AZ5 A;  2P1Q B;  4ECO A;  5B4P A;  3M19 A;  1XKU A;  1P8V A;  4MQW X;  3G3B A;  3RFJ A;  3G39 A;  3M18 A;  2Z62 A;  4GT6 A;  3ULU A;  3PMH G;  5D3I A;  1ZIW A;  3RJ0 A;  4KNG A;  1KOO A;  4V2E A;  1K5D C;  2XOT A;  1OGQ A;  4NKG A;  4Z64 C;  3C6N B;  3E4G A;  2WQW A;  3G06 A;  1Z7X W;  4R58 A;  3UL8 A;  4LSA A;  4ARR A;  2AST B;  1FO1 A;  2IFG A;  3ZYJ A;  2Z82 A;  4R6G A;  3KJ4 A;  4QBZ A;  4PEQ B;  3W3L A;  1DS9 A;  4KXF B;  4RWT C;  4NZR M;  4XSQ A;  1XWD C;  3P72 A;  3E3Z A;  2OMV A;  4WYK A;  4XGO A;  3FXI A;  2WQU A;  3RGX A;  4KT1 A;  1QYY A;  4V2D A;  1M0Z A;  5FTT B;  3O6N A;  4P8S A;  3WPG A;  4XOS A;  4Y61 B;  5HDH A;  2BEX A;  4PQ8 A;  4UFR A;  4BSS A;  4LSX C;  2R9U A;  4FMZ A;  2ID5 A;  3UN9 A;  4CP6 A;  1A9N A;  3W3M A;  3WPE A;  1P8T A;  4CC4 C;  2JE0 A;  2A0Z A;  3A79 B;  4PSJ A;  1W8A A;  4L3A A;  3WPD A;  5GMG A;  3ZYI A;  3OGL B;  4LSC A;  2V9S A;  1FS2 A;  1PGV A;  3REZ A;  3WPC A;  4AY9 X;  4BSR A;  1GWB A;  1D0B A;  2P1M B;  5AWB A;  3W3N A;  4Q3G A;  3BZ5 A;  3C6P B;  4IM6 A;  5GMH A;  4V2C A;  3CVR A;  3E6J A;  4R08 A;  4FHO A;  3WPH A;  4C2B B;  3W3G A;  2JE1 A;  1FQV A;  1OTM A;  5GMF A;  1A4Y A;  1OZN A;  4TZH A;  4CIL A;  4QC0 A;  4HQ1 A;  3ZYO A;  2Z7X A;  5LFN A;  4J0M A;  4Q3I A;  3WPB A;  3WPI A;  4CNM A;  3O53 A;  1G9U A;  4FCG A;  1XEU A;  4LSX A;  2V9T B;  2P1N B;  2P1P B;  4RCW A;  5AWC A;  4R07 A;  3RIZ A;  1M9L A;  2CA6 A;  4OQT A;  3OJA B;  1H6U A;  4CC4 A;  3UL7 A;  4M7E C;  4AW4 A;  3SB4 A;  2OMT A;  3DZE A;  3UL9 A;  2Z7X B;  2WQV A;  5CMN A;  2OMZ A;  4R6J A;  3CIY A;  4CNC A;  1KOH A;  3G04 C;  4BSU A;  1DCE A;  1O6T A;  4I6J B;  4U08 A;  5AWA A;  2Z63 A;  4RCA B;  3VQ1 A;  3RW7 A;  4PER A;  2ASS B;  2WFH A;  1SQ0 B;  3JB9 j;  2OMW A;  3VQ2 A;  4Z61 C;  4U06 A;  1M9S A;  2O6S A;  5GS0 A;  4Q62 A;  3G3A A;  1XCD A;  4ECN A;  3WN4 A;  2OMU A;  5B0T A;  4ARN A;  2Z66 A;  1OTN A;  3GOZ A;  4BV4 R;  1O6S A;  5B0N A;  4R0A A;  4LI2 A;  4R5C A;  4QXE A;  5IJC A;  1LTX A;  2OMY A;  3OGK B;  2Z81 A;  4M7E A;  4G8A A;  2Y5Q A;  2V70 A;  4EZG A;  5IJB A;  1H6T A;  1P9A G;  3OJA A;  2UZY A;  4NKH A;  4FS7 A; 
#chains in the Genus database with same CATH homology
 4U09 A;  4GLP A;  1YRG A;  3C6O B;  2XWT C;  4Z79 A;  4R5D A;  4YEB B;  2O6R A;  4PKI G;  1U0N D;  1IO0 A;  3ULA A;  4K17 A;  2P1O B;  1K5G C;  4WP6 A;  3CIG A;  2RA8 A;  4LXS A;  1OTO A;  4LI1 A;  3OGM B;  4J4L A;  4R6A A;  4MN8 B;  4Z94 G;  4L3F A;  2UZX A;  4R6F A;  4FDW A;  4R09 A;  3RGZ A;  3W3J A;  5HZL B;  2WQX A;  5GQR K;  5A5C A;  2FT3 A;  2ELL A;  1O6V A;  3ULV A;  4C2A B;  2JQD A;  4FD0 A;  4LXR A;  5IJD A;  3W3K A;  2Z65 A;  2Q4G W;  1M10 B;  3RFE A;  2Z64 A;  4B8C D;  5GS2 B;  5CMP A;  2BNH A;  1FT8 A;  3TSR E;  2O6Q A;  3E2J A;  5IYX C;  5AWD A;  4Z8G A;  2OMX A;  3RW6 A;  4P91 A;  1DFJ I;  2RR6 A;  1JL5 A;  1WWL A;  1OOK G;  3WPF A;  4U7L A;  1XEC A;  3RFS A;  3ZYN A;  4H09 A;  5AZ5 A;  2P1Q B;  4ECO A;  5B4P A;  3M19 A;  1XKU A;  1P8V A;  4MQW X;  3G3B A;  3RFJ A;  3G39 A;  3M18 A;  2Z62 A;  4GT6 A;  3ULU A;  3PMH G;  5D3I A;  1ZIW A;  3RJ0 A;  4KNG A;  1KOO A;  4V2E A;  1K5D C;  2XOT A;  1OGQ A;  4NKG A;  4Z64 C;  3C6N B;  3E4G A;  2WQW A;  3G06 A;  1Z7X W;  4R58 A;  3UL8 A;  4LSA A;  4ARR A;  2AST B;  1FO1 A;  2IFG A;  3ZYJ A;  2Z82 A;  4R6G A;  3KJ4 A;  4QBZ A;  4PEQ B;  3W3L A;  1DS9 A;  4KXF B;  4RWT C;  4XSQ A;  1XWD C;  3P72 A;  3E3Z A;  2OMV A;  4WYK A;  4XGO A;  3FXI A;  2WQU A;  3RGX A;  4KT1 A;  1QYY A;  4V2D A;  1M0Z A;  5FTT B;  3O6N A;  4P8S A;  3WPG A;  4XOS A;  4Y61 B;  5HDH A;  2BEX A;  4PQ8 A;  4UFR A;  4BSS A;  4LSX C;  2R9U A;  4FMZ A;  2ID5 A;  3UN9 A;  4CP6 A;  1A9N A;  3W3M A;  3WPE A;  1P8T A;  4CC4 C;  2JE0 A;  2A0Z A;  3A79 B;  4PSJ A;  1W8A A;  4L3A A;  3WPD A;  5GMG A;  3ZYI A;  3OGL B;  4LSC A;  2V9S A;  1FS2 A;  1PGV A;  3REZ A;  3WPC A;  4AY9 X;  4BSR A;  1GWB A;  1D0B A;  2P1M B;  5AWB A;  3W3N A;  4Q3G A;  3BZ5 A;  3C6P B;  4IM6 A;  5GMH A;  4V2C A;  3CVR A;  3E6J A;  4R08 A;  4FHO A;  3WPH A;  4C2B B;  3W3G A;  2JE1 A;  1FQV A;  1OTM A;  5GMF A;  1A4Y A;  1OZN A;  4TZH A;  4CIL A;  4QC0 A;  4HQ1 A;  3ZYO A;  2Z7X A;  5LFN A;  4J0M A;  4Q3I A;  3WPB A;  3WPI A;  4CNM A;  3O53 A;  1G9U A;  4FCG A;  1XEU A;  4LSX A;  2V9T B;  2P1N B;  2P1P B;  4RCW A;  5AWC A;  4R07 A;  3RIZ A;  1M9L A;  2CA6 A;  4OQT A;  3OJA B;  1H6U A;  4CC4 A;  3UL7 A;  4M7E C;  4AW4 A;  3SB4 A;  2OMT A;  3DZE A;  3UL9 A;  2Z7X B;  2WQV A;  5CMN A;  2OMZ A;  4R6J A;  3CIY A;  4CNC A;  1KOH A;  3G04 C;  4BSU A;  1DCE A;  1O6T A;  4I6J B;  4U08 A;  5AWA A;  2Z63 A;  4RCA B;  3VQ1 A;  3RW7 A;  4PER A;  2ASS B;  2WFH A;  1SQ0 B;  3JB9 j;  2OMW A;  3VQ2 A;  4Z61 C;  4U06 A;  1M9S A;  2O6S A;  5GS0 A;  4Q62 A;  3G3A A;  1XCD A;  4ECN A;  3WN4 A;  2OMU A;  5B0T A;  4ARN A;  2Z66 A;  1OTN A;  3GOZ A;  4BV4 R;  1O6S A;  5B0N A;  4R0A A;  4LI2 A;  4R5C A;  4QXE A;  5IJC A;  1LTX A;  2OMY A;  3OGK B;  2Z81 A;  4M7E A;  4G8A A;  2Y5Q A;  2V70 A;  4EZG A;  5IJB A;  1H6T A;  1P9A G;  3OJA A;  2UZY A;  4NKH A;  4FS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...