3DZEA

Crystal structure of bovine coupling factor b bound with cadmium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
176
structure length
176
Chain Sequence
SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 65
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3dzeA00
2Z82A 3WPFA 3CIYA 4CC4C 4GT6A 1FS2A 4ARRA 1O6VA 4R6JA 3WPEA 1WWLA 1OTNA 1DS9A 3UN9A 2O6RA 2O6QA 4R6GA 2V70A 4BSRA 3RGZA 2ID5A 3RW6A 1XECA 3REZA 3W3LA 2P1QB 4RCAB 2RA8A 2V9TB 2ELLA 3W3JA 1G9UA 1SQ0B 3OGKB 4C2AB 5AWCA 4KNGA 4KT1A 2IFGA 4V2DA 3WN4A 4RWTC 4Q3GA 3O53A 4QBZA 1OGQA 3W3MA 5AWBA 2WQUA 1DFJI 4CILA 2XWTC 5B4PA 2Z65A 2P1MB 5FTTB 1K5GC 2FT3A 3CIGA 1A9NA 3WPCA 3RIZA 3E2JA 2Y5QA 3OJAA 4CP6A 4FS7A 4Z64C 3P72A 3CVRA 4ECOA 4PEQB 3ULUA 1O6SA 2OMVA 1OOKG 1Z7XW 2OMTA 2UZYA 1A4YA 4TZHA 4FDWA 4LXSA 2OMWA 4PKIG 5IJBA 4U7LA 2CA6A 3M19A 4Q3IA 4V2EA 4R09A 2Z7XA 4KXFB 3ULVA 4CC4A 4Y61B 4P91A 3G3AA 2P1PB 5B0TA 3G39A 4K17A 4ARNA 4B8CD 4UFRA 4MN8B 1QYYA 5CMPA 3G06A 1GWBA 5AZ5A 4P8SA 5D3IA 4FCGA 5IJDA 4NKHA 4LXRA 4I6JB 3RGXA 5GMHA 4RCWA 4R58A 3ZYIA 1KOHA 1M0ZA 2Z63A 4Q62A 4J4LA 5HZLB 4WYKA 4BSSA 4PSJA 2XOTA 4OQTA 5CMNA 2OMUA 5GS2B 1IO0A 3W3GA 2Z64A 3DZEA 4L3FA 3UL9A 1LTXA 5GMGA 2WQWA 3RJ0A 2V9SA 3E6JA 4V2CA 2Z62A 4Z79A 2WQXA 1XCDA 4R0AA 3RW7A 2ASTB 4CNCA 5HDHA 4AY9X 4ECNA 3VQ1A 4MQWX 1M9LA 4U09A 2P1OB 4H09A 1FQVA 4AW4A 2OMYA 1O6TA 3ZYOA 2O6SA 4G8AA 3OJAB 1P8TA 4R08A 1ZIWA 2OMZA 3G04C 4R5DA 3WPGA 4C2BB 4FHOA 4GLPA 4LSXC 3M18A 1M9SA 1YRGA 3C6PB 4M7EC 3PMHG 3C6OB 3O6NA 3RFEA 1DCEA 1FO1A 4FD0A 4U08A 2Q4GW 4LI2A 1M10B 5GQRK 4Z94G 4LI1A 4IM6A 2ASSB 5AWDA 1P9AG 2Z66A 2WFHA 4NKGA 2JQDA 3C6NB 1K5DC 3W3KA 3RFJA 4WP6A 3OGMB 2JE0A 2JE1A 1FT8A 2Z7XB 1PGVA 3WPBA 3E4GA 1D0BA 4QC0A 3ZYNA 3WPIA 5A5CA 3JB9j 4FMZA 4XSQA 1H6UA 5GMFA 3GOZA 4J0MA 1P8VA 1OZNA 4R6FA 1JL5A 5IJCA 5IYXC 2RR6A 1W8AA 4BSUA 5AWAA 4QXEA 3WPDA 3W3NA 2P1NB 3E3ZA 4R07A 4EZGA 3UL8A 3BZ5A 3G3BA 1XWDC 4HQ1A 1XEUA 1OTMA 4LSCA 5LFNA 3SB4A 4U06A 4Z8GA 1H6TA 4PQ8A 4BV4R 3RFSA 3TSRE 4PERA 3FXIA 3VQ2A 4Z61C 4YEBB 3WPHA 3ZYJA 2BNHA 5GS0A 3OGLB 4LSXA 4L3AA 3ULAA 2UZXA 4M7EA 2R9UA 4CNMA 4XGOA 2OMXA 3KJ4A 4XOSA 2Z81A 5B0NA 1KOOA 4R5CA 3UL7A 2WQVA 4R6AA 1XKUA 1OTOA 2BEXA 4LSAA 3A79B 1U0ND 2A0ZA
chains in the Genus database with same CATH superfamily
2Z82A 3WPFA 3CIYA 4CC4C 4GT6A 1FS2A 4ARRA 1O6VA 4R6JA 3WPEA 1WWLA 1OTNA 1DS9A 3UN9A 2O6RA 2O6QA 4R6GA 2V70A 4BSRA 3RGZA 2ID5A 3RW6A 1XECA 3REZA 3W3LA 2P1QB 4RCAB 2RA8A 2V9TB 2ELLA 3W3JA 1G9UA 1SQ0B 3OGKB 4C2AB 5AWCA 4KNGA 4KT1A 2IFGA 4V2DA 3WN4A 4RWTC 4Q3GA 3O53A 4QBZA 1OGQA 3W3MA 5AWBA 2WQUA 1DFJI 4CILA 2XWTC 5B4PA 2Z65A 2P1MB 5FTTB 1K5GC 2FT3A 3CIGA 1A9NA 3WPCA 3RIZA 3E2JA 2Y5QA 3OJAA 4CP6A 4FS7A 4Z64C 3P72A 3CVRA 4ECOA 4PEQB 3ULUA 1O6SA 2OMVA 1OOKG 1Z7XW 2OMTA 2UZYA 1A4YA 4TZHA 4FDWA 4LXSA 2OMWA 4PKIG 5IJBA 4U7LA 2CA6A 3M19A 4Q3IA 4V2EA 4R09A 2Z7XA 4KXFB 3ULVA 4CC4A 4Y61B 4P91A 3G3AA 2P1PB 5B0TA 3G39A 4K17A 4ARNA 4B8CD 4UFRA 4MN8B 1QYYA 5CMPA 3G06A 1GWBA 5AZ5A 4P8SA 5D3IA 4FCGA 5IJDA 4NKHA 4LXRA 4I6JB 3RGXA 5GMHA 4RCWA 4R58A 3ZYIA 1KOHA 1M0ZA 2Z63A 4Q62A 4J4LA 5HZLB 4WYKA 4BSSA 4PSJA 2XOTA 4OQTA 5CMNA 2OMUA 5GS2B 1IO0A 3W3GA 2Z64A 3DZEA 4L3FA 3UL9A 1LTXA 5GMGA 2WQWA 3RJ0A 2V9SA 3E6JA 4V2CA 2Z62A 4Z79A 2WQXA 1XCDA 4R0AA 3RW7A 2ASTB 4CNCA 5HDHA 4AY9X 4ECNA 3VQ1A 4MQWX 1M9LA 4U09A 2P1OB 4H09A 1FQVA 4AW4A 2OMYA 1O6TA 3ZYOA 2O6SA 4G8AA 3OJAB 1P8TA 4R08A 1ZIWA 2OMZA 3G04C 4R5DA 3WPGA 4C2BB 4FHOA 4GLPA 4LSXC 3M18A 1M9SA 1YRGA 3C6PB 4M7EC 3PMHG 3C6OB 3O6NA 3RFEA 1DCEA 1FO1A 4FD0A 4U08A 2Q4GW 4LI2A 1M10B 5GQRK 4Z94G 4LI1A 4IM6A 2ASSB 5AWDA 1P9AG 2Z66A 2WFHA 4NKGA 2JQDA 3C6NB 1K5DC 3W3KA 3RFJA 4WP6A 3OGMB 2JE0A 2JE1A 1FT8A 2Z7XB 1PGVA 3WPBA 3E4GA 1D0BA 4QC0A 3ZYNA 3WPIA 5A5CA 3JB9j 4FMZA 4XSQA 4NZRM 1H6UA 5GMFA 3GOZA 4J0MA 1P8VA 1OZNA 4R6FA 1JL5A 5IJCA 5IYXC 2RR6A 1W8AA 4BSUA 5AWAA 4QXEA 3WPDA 3W3NA 2P1NB 3E3ZA 4R07A 4EZGA 3UL8A 3BZ5A 3G3BA 1XWDC 4HQ1A 1XEUA 1OTMA 4LSCA 5LFNA 3SB4A 4U06A 4Z8GA 1H6TA 4NZTM 4PQ8A 4BV4R 3RFSA 3TSRE 4PERA 3FXIA 3VQ2A 4Z61C 4YEBB 3WPHA 3ZYJA 2BNHA 5GS0A 3OGLB 4LSXA 4L3AA 3ULAA 2UZXA 4M7EA 2R9UA 4CNMA 4XGOA 2OMXA 3KJ4A 4XOSA 2Z81A 5B0NA 1KOOA 4R5CA 3UL7A 2WQVA 4R6AA 1XKUA 1OTOA 2BEXA 4LSAA 3A79B 1U0ND 2A0ZA
chains in the Genus database with same CATH topology
2Z82A 3WPFA 3CIYA 4CC4C 4GT6A 1FS2A 4ARRA 1O6VA 4R6JA 3WPEA 1WWLA 1OTNA 1DS9A 3UN9A 2O6RA 2O6QA 4R6GA 2V70A 4BSRA 3RGZA 2ID5A 3RW6A 1XECA 3REZA 3W3LA 2P1QB 4RCAB 2RA8A 2V9TB 2ELLA 3W3JA 1G9UA 1SQ0B 3OGKB 4C2AB 5AWCA 4KNGA 4KT1A 2IFGA 4V2DA 3WN4A 4RWTC 4Q3GA 3O53A 4QBZA 1OGQA 3W3MA 5AWBA 2WQUA 1DFJI 4CILA 2XWTC 5B4PA 2Z65A 2P1MB 5FTTB 1K5GC 2FT3A 3CIGA 1A9NA 3WPCA 3RIZA 3E2JA 2Y5QA 3OJAA 4CP6A 4FS7A 4Z64C 3P72A 3CVRA 4ECOA 4PEQB 3ULUA 1O6SA 2OMVA 1OOKG 1Z7XW 2OMTA 2UZYA 1A4YA 4TZHA 4FDWA 4LXSA 2OMWA 4PKIG 5IJBA 4U7LA 2CA6A 3M19A 4Q3IA 4V2EA 4R09A 2Z7XA 4KXFB 3ULVA 4CC4A 4Y61B 4P91A 3G3AA 2P1PB 5B0TA 3G39A 4K17A 4ARNA 4B8CD 4UFRA 4MN8B 1QYYA 5CMPA 3G06A 1GWBA 5AZ5A 4P8SA 5D3IA 4FCGA 5IJDA 4NKHA 4LXRA 4I6JB 3RGXA 5GMHA 4RCWA 4R58A 3ZYIA 1KOHA 1M0ZA 2Z63A 4Q62A 4J4LA 5HZLB 4WYKA 4BSSA 4PSJA 2XOTA 4OQTA 5CMNA 2OMUA 5GS2B 1IO0A 3W3GA 2Z64A 3DZEA 4L3FA 3UL9A 1LTXA 5GMGA 2WQWA 3RJ0A 2V9SA 3E6JA 4V2CA 2Z62A 4Z79A 2WQXA 1XCDA 4R0AA 3RW7A 2ASTB 4CNCA 5HDHA 4AY9X 4ECNA 3VQ1A 4MQWX 1M9LA 4U09A 2P1OB 4H09A 1FQVA 4AW4A 2OMYA 1O6TA 3ZYOA 2O6SA 4G8AA 3OJAB 1P8TA 4R08A 1ZIWA 2OMZA 3G04C 4R5DA 3WPGA 4C2BB 4FHOA 4GLPA 4LSXC 3M18A 1M9SA 1YRGA 3C6PB 4M7EC 3PMHG 3C6OB 3O6NA 3RFEA 1DCEA 1FO1A 4FD0A 4U08A 2Q4GW 4LI2A 1M10B 5GQRK 4Z94G 4LI1A 4IM6A 2ASSB 5AWDA 1P9AG 2Z66A 2WFHA 4NKGA 2JQDA 3C6NB 1K5DC 3W3KA 3RFJA 4WP6A 3OGMB 2JE0A 2JE1A 1FT8A 2Z7XB 1PGVA 3WPBA 3E4GA 1D0BA 4QC0A 3ZYNA 3WPIA 5A5CA 3JB9j 4FMZA 4XSQA 1H6UA 5GMFA 3GOZA 4J0MA 1P8VA 1OZNA 4R6FA 1JL5A 5IJCA 5IYXC 2RR6A 1W8AA 4BSUA 5AWAA 4QXEA 3WPDA 3W3NA 2P1NB 3E3ZA 4R07A 4EZGA 3UL8A 3BZ5A 3G3BA 1XWDC 4HQ1A 1XEUA 1OTMA 4LSCA 5LFNA 3SB4A 4U06A 4Z8GA 1H6TA 4PQ8A 4BV4R 3RFSA 3TSRE 4PERA 3FXIA 3VQ2A 4Z61C 4YEBB 3WPHA 3ZYJA 2BNHA 5GS0A 3OGLB 4LSXA 4L3AA 3ULAA 2UZXA 4M7EA 2R9UA 4CNMA 4XGOA 2OMXA 3KJ4A 4XOSA 2Z81A 5B0NA 1KOOA 4R5CA 3UL7A 2WQVA 4R6AA 1XKUA 1OTOA 2BEXA 4LSAA 3A79B 1U0ND 2A0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z82 A;  3WPF A;  3CIY A;  4CC4 C;  4GT6 A;  1FS2 A;  4ARR A;  1O6V A;  4R6J A;  3WPE A;  1WWL A;  1OTN A;  1DS9 A;  3UN9 A;  2O6R A;  2O6Q A;  4R6G A;  2V70 A;  4BSR A;  3RGZ A;  2ID5 A;  3RW6 A;  1XEC A;  3REZ A;  3W3L A;  2P1Q B;  4RCA B;  2RA8 A;  2V9T B;  2ELL A;  3W3J A;  1G9U A;  1SQ0 B;  3OGK B;  4C2A B;  5AWC A;  4KNG A;  4KT1 A;  2IFG A;  4V2D A;  3WN4 A;  4RWT C;  4Q3G A;  3O53 A;  4QBZ A;  1OGQ A;  3W3M A;  5AWB A;  2WQU A;  1DFJ I;  4CIL A;  2XWT C;  5B4P A;  2Z65 A;  2P1M B;  5FTT B;  1K5G C;  2FT3 A;  3CIG A;  1A9N A;  3WPC A;  3RIZ A;  3E2J A;  2Y5Q A;  3OJA A;  4CP6 A;  4FS7 A;  4Z64 C;  3P72 A;  3CVR A;  4ECO A;  4PEQ B;  3ULU A;  1O6S A;  2OMV A;  1OOK G;  1Z7X W;  2OMT A;  2UZY A;  1A4Y A;  4TZH A;  4FDW A;  4LXS A;  2OMW A;  4PKI G;  5IJB A;  4U7L A;  2CA6 A;  3M19 A;  4Q3I A;  4V2E A;  4R09 A;  2Z7X A;  4KXF B;  3ULV A;  4CC4 A;  4Y61 B;  4P91 A;  3G3A A;  2P1P B;  5B0T A;  3G39 A;  4K17 A;  4ARN A;  4B8C D;  4UFR A;  4MN8 B;  1QYY A;  5CMP A;  3G06 A;  1GWB A;  5AZ5 A;  4P8S A;  5D3I A;  4FCG A;  5IJD A;  4NKH A;  4LXR A;  4I6J B;  3RGX A;  5GMH A;  4RCW A;  4R58 A;  3ZYI A;  1KOH A;  1M0Z A;  2Z63 A;  4Q62 A;  4J4L A;  5HZL B;  4WYK A;  4BSS A;  4PSJ A;  2XOT A;  4OQT A;  5CMN A;  2OMU A;  5GS2 B;  1IO0 A;  3W3G A;  2Z64 A;  3DZE A;  4L3F A;  3UL9 A;  1LTX A;  5GMG A;  2WQW A;  3RJ0 A;  2V9S A;  3E6J A;  4V2C A;  2Z62 A;  4Z79 A;  2WQX A;  1XCD A;  4R0A A;  3RW7 A;  2AST B;  4CNC A;  5HDH A;  4AY9 X;  4ECN A;  3VQ1 A;  4MQW X;  1M9L A;  4U09 A;  2P1O B;  4H09 A;  1FQV A;  4AW4 A;  2OMY A;  1O6T A;  3ZYO A;  2O6S A;  4G8A A;  3OJA B;  1P8T A;  4R08 A;  1ZIW A;  2OMZ A;  3G04 C;  4R5D A;  3WPG A;  4C2B B;  4FHO A;  4GLP A;  4LSX C;  3M18 A;  1M9S A;  1YRG A;  3C6P B;  4M7E C;  3PMH G;  3C6O B;  3O6N A;  3RFE A;  1DCE A;  1FO1 A;  4FD0 A;  4U08 A;  2Q4G W;  4LI2 A;  1M10 B;  5GQR K;  4Z94 G;  4LI1 A;  4IM6 A;  2ASS B;  5AWD A;  1P9A G;  2Z66 A;  2WFH A;  4NKG A;  2JQD A;  3C6N B;  1K5D C;  3W3K A;  3RFJ A;  4WP6 A;  3OGM B;  2JE0 A;  2JE1 A;  1FT8 A;  2Z7X B;  1PGV A;  3WPB A;  3E4G A;  1D0B A;  4QC0 A;  3ZYN A;  3WPI A;  5A5C A;  3JB9 j;  4FMZ A;  4XSQ A;  1H6U A;  5GMF A;  3GOZ A;  4J0M A;  1P8V A;  1OZN A;  4R6F A;  1JL5 A;  5IJC A;  5IYX C;  2RR6 A;  1W8A A;  4BSU A;  5AWA A;  4QXE A;  3WPD A;  3W3N A;  2P1N B;  3E3Z A;  4R07 A;  4EZG A;  3UL8 A;  3BZ5 A;  3G3B A;  1XWD C;  4HQ1 A;  1XEU A;  1OTM A;  4LSC A;  5LFN A;  3SB4 A;  4U06 A;  4Z8G A;  1H6T A;  4PQ8 A;  4BV4 R;  3RFS A;  3TSR E;  4PER A;  3FXI A;  3VQ2 A;  4Z61 C;  4YEB B;  3WPH A;  3ZYJ A;  2BNH A;  5GS0 A;  3OGL B;  4LSX A;  4L3A A;  3ULA A;  2UZX A;  4M7E A;  2R9U A;  4CNM A;  4XGO A;  2OMX A;  3KJ4 A;  4XOS A;  2Z81 A;  5B0N A;  1KOO A;  4R5C A;  3UL7 A;  2WQV A;  4R6A A;  1XKU A;  1OTO A;  2BEX A;  4LSA A;  3A79 B;  1U0N D;  2A0Z A; 
#chains in the Genus database with same CATH topology
 2Z82 A;  3WPF A;  3CIY A;  4CC4 C;  4GT6 A;  1FS2 A;  4ARR A;  1O6V A;  4R6J A;  3WPE A;  1WWL A;  1OTN A;  1DS9 A;  3UN9 A;  2O6R A;  2O6Q A;  4R6G A;  2V70 A;  4BSR A;  3RGZ A;  2ID5 A;  3RW6 A;  1XEC A;  3REZ A;  3W3L A;  2P1Q B;  4RCA B;  2RA8 A;  2V9T B;  2ELL A;  3W3J A;  1G9U A;  1SQ0 B;  3OGK B;  4C2A B;  5AWC A;  4KNG A;  4KT1 A;  2IFG A;  4V2D A;  3WN4 A;  4RWT C;  4Q3G A;  3O53 A;  4QBZ A;  1OGQ A;  3W3M A;  5AWB A;  2WQU A;  1DFJ I;  4CIL A;  2XWT C;  5B4P A;  2Z65 A;  2P1M B;  5FTT B;  1K5G C;  2FT3 A;  3CIG A;  1A9N A;  3WPC A;  3RIZ A;  3E2J A;  2Y5Q A;  3OJA A;  4CP6 A;  4FS7 A;  4Z64 C;  3P72 A;  3CVR A;  4ECO A;  4PEQ B;  3ULU A;  1O6S A;  2OMV A;  1OOK G;  1Z7X W;  2OMT A;  2UZY A;  1A4Y A;  4TZH A;  4FDW A;  4LXS A;  2OMW A;  4PKI G;  5IJB A;  4U7L A;  2CA6 A;  3M19 A;  4Q3I A;  4V2E A;  4R09 A;  2Z7X A;  4KXF B;  3ULV A;  4CC4 A;  4Y61 B;  4P91 A;  3G3A A;  2P1P B;  5B0T A;  3G39 A;  4K17 A;  4ARN A;  4B8C D;  4UFR A;  4MN8 B;  1QYY A;  5CMP A;  3G06 A;  1GWB A;  5AZ5 A;  4P8S A;  5D3I A;  4FCG A;  5IJD A;  4NKH A;  4LXR A;  4I6J B;  3RGX A;  5GMH A;  4RCW A;  4R58 A;  3ZYI A;  1KOH A;  1M0Z A;  2Z63 A;  4Q62 A;  4J4L A;  5HZL B;  4WYK A;  4BSS A;  4PSJ A;  2XOT A;  4OQT A;  5CMN A;  2OMU A;  5GS2 B;  1IO0 A;  3W3G A;  2Z64 A;  3DZE A;  4L3F A;  3UL9 A;  1LTX A;  5GMG A;  2WQW A;  3RJ0 A;  2V9S A;  3E6J A;  4V2C A;  2Z62 A;  4Z79 A;  2WQX A;  1XCD A;  4R0A A;  3RW7 A;  2AST B;  4CNC A;  5HDH A;  4AY9 X;  4ECN A;  3VQ1 A;  4MQW X;  1M9L A;  4U09 A;  2P1O B;  4H09 A;  1FQV A;  4AW4 A;  2OMY A;  1O6T A;  3ZYO A;  2O6S A;  4G8A A;  3OJA B;  1P8T A;  4R08 A;  1ZIW A;  2OMZ A;  3G04 C;  4R5D A;  3WPG A;  4C2B B;  4FHO A;  4GLP A;  4LSX C;  3M18 A;  1M9S A;  1YRG A;  3C6P B;  4M7E C;  3PMH G;  3C6O B;  3O6N A;  3RFE A;  1DCE A;  1FO1 A;  4FD0 A;  4U08 A;  2Q4G W;  4LI2 A;  1M10 B;  5GQR K;  4Z94 G;  4LI1 A;  4IM6 A;  2ASS B;  5AWD A;  1P9A G;  2Z66 A;  2WFH A;  4NKG A;  2JQD A;  3C6N B;  1K5D C;  3W3K A;  3RFJ A;  4WP6 A;  3OGM B;  2JE0 A;  2JE1 A;  1FT8 A;  2Z7X B;  1PGV A;  3WPB A;  3E4G A;  1D0B A;  4QC0 A;  3ZYN A;  3WPI A;  5A5C A;  3JB9 j;  4FMZ A;  4XSQ A;  4NZR M;  1H6U A;  5GMF A;  3GOZ A;  4J0M A;  1P8V A;  1OZN A;  4R6F A;  1JL5 A;  5IJC A;  5IYX C;  2RR6 A;  1W8A A;  4BSU A;  5AWA A;  4QXE A;  3WPD A;  3W3N A;  2P1N B;  3E3Z A;  4R07 A;  4EZG A;  3UL8 A;  3BZ5 A;  3G3B A;  1XWD C;  4HQ1 A;  1XEU A;  1OTM A;  4LSC A;  5LFN A;  3SB4 A;  4U06 A;  4Z8G A;  1H6T A;  4NZT M;  4PQ8 A;  4BV4 R;  3RFS A;  3TSR E;  4PER A;  3FXI A;  3VQ2 A;  4Z61 C;  4YEB B;  3WPH A;  3ZYJ A;  2BNH A;  5GS0 A;  3OGL B;  4LSX A;  4L3A A;  3ULA A;  2UZX A;  4M7E A;  2R9U A;  4CNM A;  4XGO A;  2OMX A;  3KJ4 A;  4XOS A;  2Z81 A;  5B0N A;  1KOO A;  4R5C A;  3UL7 A;  2WQV A;  4R6A A;  1XKU A;  1OTO A;  2BEX A;  4LSA A;  3A79 B;  1U0N D;  2A0Z A; 
#chains in the Genus database with same CATH homology
 2Z82 A;  3WPF A;  3CIY A;  4CC4 C;  4GT6 A;  1FS2 A;  4ARR A;  1O6V A;  4R6J A;  3WPE A;  1WWL A;  1OTN A;  1DS9 A;  3UN9 A;  2O6R A;  2O6Q A;  4R6G A;  2V70 A;  4BSR A;  3RGZ A;  2ID5 A;  3RW6 A;  1XEC A;  3REZ A;  3W3L A;  2P1Q B;  4RCA B;  2RA8 A;  2V9T B;  2ELL A;  3W3J A;  1G9U A;  1SQ0 B;  3OGK B;  4C2A B;  5AWC A;  4KNG A;  4KT1 A;  2IFG A;  4V2D A;  3WN4 A;  4RWT C;  4Q3G A;  3O53 A;  4QBZ A;  1OGQ A;  3W3M A;  5AWB A;  2WQU A;  1DFJ I;  4CIL A;  2XWT C;  5B4P A;  2Z65 A;  2P1M B;  5FTT B;  1K5G C;  2FT3 A;  3CIG A;  1A9N A;  3WPC A;  3RIZ A;  3E2J A;  2Y5Q A;  3OJA A;  4CP6 A;  4FS7 A;  4Z64 C;  3P72 A;  3CVR A;  4ECO A;  4PEQ B;  3ULU A;  1O6S A;  2OMV A;  1OOK G;  1Z7X W;  2OMT A;  2UZY A;  1A4Y A;  4TZH A;  4FDW A;  4LXS A;  2OMW A;  4PKI G;  5IJB A;  4U7L A;  2CA6 A;  3M19 A;  4Q3I A;  4V2E A;  4R09 A;  2Z7X A;  4KXF B;  3ULV A;  4CC4 A;  4Y61 B;  4P91 A;  3G3A A;  2P1P B;  5B0T A;  3G39 A;  4K17 A;  4ARN A;  4B8C D;  4UFR A;  4MN8 B;  1QYY A;  5CMP A;  3G06 A;  1GWB A;  5AZ5 A;  4P8S A;  5D3I A;  4FCG A;  5IJD A;  4NKH A;  4LXR A;  4I6J B;  3RGX A;  5GMH A;  4RCW A;  4R58 A;  3ZYI A;  1KOH A;  1M0Z A;  2Z63 A;  4Q62 A;  4J4L A;  5HZL B;  4WYK A;  4BSS A;  4PSJ A;  2XOT A;  4OQT A;  5CMN A;  2OMU A;  5GS2 B;  1IO0 A;  3W3G A;  2Z64 A;  3DZE A;  4L3F A;  3UL9 A;  1LTX A;  5GMG A;  2WQW A;  3RJ0 A;  2V9S A;  3E6J A;  4V2C A;  2Z62 A;  4Z79 A;  2WQX A;  1XCD A;  4R0A A;  3RW7 A;  2AST B;  4CNC A;  5HDH A;  4AY9 X;  4ECN A;  3VQ1 A;  4MQW X;  1M9L A;  4U09 A;  2P1O B;  4H09 A;  1FQV A;  4AW4 A;  2OMY A;  1O6T A;  3ZYO A;  2O6S A;  4G8A A;  3OJA B;  1P8T A;  4R08 A;  1ZIW A;  2OMZ A;  3G04 C;  4R5D A;  3WPG A;  4C2B B;  4FHO A;  4GLP A;  4LSX C;  3M18 A;  1M9S A;  1YRG A;  3C6P B;  4M7E C;  3PMH G;  3C6O B;  3O6N A;  3RFE A;  1DCE A;  1FO1 A;  4FD0 A;  4U08 A;  2Q4G W;  4LI2 A;  1M10 B;  5GQR K;  4Z94 G;  4LI1 A;  4IM6 A;  2ASS B;  5AWD A;  1P9A G;  2Z66 A;  2WFH A;  4NKG A;  2JQD A;  3C6N B;  1K5D C;  3W3K A;  3RFJ A;  4WP6 A;  3OGM B;  2JE0 A;  2JE1 A;  1FT8 A;  2Z7X B;  1PGV A;  3WPB A;  3E4G A;  1D0B A;  4QC0 A;  3ZYN A;  3WPI A;  5A5C A;  3JB9 j;  4FMZ A;  4XSQ A;  1H6U A;  5GMF A;  3GOZ A;  4J0M A;  1P8V A;  1OZN A;  4R6F A;  1JL5 A;  5IJC A;  5IYX C;  2RR6 A;  1W8A A;  4BSU A;  5AWA A;  4QXE A;  3WPD A;  3W3N A;  2P1N B;  3E3Z A;  4R07 A;  4EZG A;  3UL8 A;  3BZ5 A;  3G3B A;  1XWD C;  4HQ1 A;  1XEU A;  1OTM A;  4LSC A;  5LFN A;  3SB4 A;  4U06 A;  4Z8G A;  1H6T A;  4PQ8 A;  4BV4 R;  3RFS A;  3TSR E;  4PER A;  3FXI A;  3VQ2 A;  4Z61 C;  4YEB B;  3WPH A;  3ZYJ A;  2BNH A;  5GS0 A;  3OGL B;  4LSX A;  4L3A A;  3ULA A;  2UZX A;  4M7E A;  2R9U A;  4CNM A;  4XGO A;  2OMX A;  3KJ4 A;  4XOS A;  2Z81 A;  5B0N A;  1KOO A;  4R5C A;  3UL7 A;  2WQV A;  4R6A A;  1XKU A;  1OTO A;  2BEX A;  4LSA A;  3A79 B;  1U0N D;  2A0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...