3DZEA

Crystal structure of bovine coupling factor b bound with cadmium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
176
structure length
176
Chain Sequence
SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit s, mitochondrial
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
source organism Bos taurus
molecule tags Electron transport
total genus 65
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3dzeA00
2Z7XA 3GOZA 4AW4A 1SQ0B 1DS9A 1WWLA 2O6SA 4R58A 3REZA 3P72A 5GMGA 5D3IA 4LSXC 5GMFA 4C2AB 5B0NA 3RW6A 1D0BA 3OGLB 4LSCA 2Z63A 2UZYA 3W3NA 1IO0A 1K5GC 1M0ZA 2Q4GW 3E2JA 2XWTC 1XCDA 3W3LA 4ECNA 2OMZA 2Z81A 3KJ4A 3ULUA 3O53A 4UFRA 1H6UA 4KNGA 1K5DC 4LXRA 3ULVA 1G9UA 1OOKG 3OJAA 4QBZA 4R07A 1ZIWA 3CVRA 5IJCA 4CC4A 4ARRA 1OTMA 4GLPA 3SB4A 3E3ZA 4LI2A 4BV4R 2R9UA 4K17A 4BSUA 3RFSA 5CMNA 4LSXA 3E6JA 4LXSA 4IM6A 4PEQB 3W3KA 2OMYA 2BNHA 5AZ5A 3RGXA 4XSQA 5IYXC 2IFGA 1GWBA 4PKIG 1OTNA 1DFJI 4P8SA 4QXEA 4WYKA 3WPGA 2OMUA 2P1PB 2JE0A 2WQUA 4EZGA 4AY9X 4FD0A 3VQ2A 1LTXA 5IJDA 5IJBA 3ZYOA 1OTOA 2OMWA 1P9AG 4C2BB 4V2CA 3WPBA 2OMVA 3RGZA 2P1NB 3OGMB 5GMHA 4KT1A 1FT8A 2Z64A 3OJAB 3W3JA 5AWBA 5GQRK 4MN8B 2RR6A 3C6NB 5HZLB 2Z62A 1W8AA 1M9LA 4LSAA 3RJ0A 3BZ5A 2P1QB 2ASTB 4RCAB 4OQTA 1XKUA 1FS2A 1PGVA 4R5DA 2OMXA 2Z65A 4KXFB 3ULAA 4U08A 3WPDA 5AWAA 5FTTB 4R5CA 1QYYA 1A9NA 4I6JB 1O6TA 4P91A 4YEBB 5B4PA 4R6GA 3ZYJA 3VQ1A 4J0MA 4BSRA 2V9TB 4R6JA 2FT3A 3TSRE 4CILA 3M18A 2A0ZA 3RFJA 3UL8A 2OMTA 4Z64C 5B0TA 4Z94G 3WPCA 3DZEA 5AWCA 1O6VA 3CIYA 1M9SA 4Q62A 5A5CA 3RFEA 4L3FA 2ID5A 5HDHA 3UL7A 4R0AA 3WPFA 4L3AA 1XWDC 2Z7XB 3M19A 3WPIA 4U06A 2Y5QA 4J4LA 4U7LA 1U0ND 3WPHA 3E4GA 3OGKB 4RCWA 1FO1A 3C6OB 2CA6A 4M7EC 3G3BA 2WQXA 4ECOA 3O6NA 3UL9A 4R09A 4QC0A 2O6QA 4GT6A 4CNCA 1XECA 2V9SA 1P8TA 3A79B 2Z66A 4MQWX 4ARNA 3FXIA 2RA8A 4Z8GA 4NKHA 4R6FA 4G8AA 3W3GA 1OGQA 1FQVA 1Z7XW 4WP6A 5GS2B 2ASSB 2ELLA 5LFNA 4FDWA 3C6PB 2P1OB 4M7EA 4Q3GA 1XEUA 4H09A 2UZXA 1OZNA 2JQDA 3ZYNA 4U09A 2WQVA 5CMPA 2XOTA 4PERA 4Y61B 3W3MA 1A4YA 4FCGA 4R6AA 4R08A 1KOOA 1M10B 3G3AA 4CNMA 1H6TA 2WQWA 3JB9j 4FS7A 4CP6A 1DCEA 2JE1A 4PSJA 4RWTC 2V70A 4V2DA 4Z61C 2BEXA 3RIZA 4XOSA 4NKGA 1O6SA 4TZHA 1JL5A 4Q3IA 3G04C 2Z82A 4B8CD 3G06A 2P1MB 5GS0A 4FMZA 4XGOA 3PMHG 3UN9A 3WN4A 4V2EA 4LI1A 1KOHA 5AWDA 1P8VA 2WFHA 4FHOA 3ZYIA 4PQ8A 3CIGA 3WPEA 4Z79A 3RW7A 2O6RA 1YRGA 3G39A 4HQ1A 4BSSA 4CC4C
chains in the Genus database with same CATH superfamily
2Z7XA 3GOZA 4AW4A 1SQ0B 1DS9A 1WWLA 2O6SA 4R58A 3REZA 3P72A 5GMGA 5D3IA 4LSXC 5GMFA 4C2AB 5B0NA 3RW6A 1D0BA 3OGLB 4LSCA 2Z63A 2UZYA 3W3NA 1IO0A 1K5GC 1M0ZA 2Q4GW 3E2JA 2XWTC 1XCDA 3W3LA 4ECNA 2OMZA 2Z81A 3KJ4A 3ULUA 3O53A 4UFRA 1H6UA 4KNGA 1K5DC 4LXRA 3ULVA 1G9UA 1OOKG 3OJAA 4QBZA 4R07A 1ZIWA 3CVRA 5IJCA 4CC4A 4ARRA 1OTMA 4GLPA 3SB4A 3E3ZA 4LI2A 4BV4R 2R9UA 4K17A 4BSUA 3RFSA 5CMNA 4LSXA 3E6JA 4LXSA 4IM6A 4PEQB 3W3KA 2OMYA 2BNHA 5AZ5A 3RGXA 4XSQA 5IYXC 2IFGA 1GWBA 4PKIG 1OTNA 1DFJI 4P8SA 4QXEA 4WYKA 3WPGA 2OMUA 2P1PB 2JE0A 2WQUA 4EZGA 4AY9X 4NZTM 4FD0A 3VQ2A 1LTXA 5IJDA 5IJBA 3ZYOA 1OTOA 2OMWA 1P9AG 4C2BB 4V2CA 3WPBA 2OMVA 3RGZA 2P1NB 3OGMB 5GMHA 4KT1A 1FT8A 2Z64A 3OJAB 3W3JA 5AWBA 5GQRK 4MN8B 2RR6A 3C6NB 5HZLB 2Z62A 1W8AA 1M9LA 4LSAA 3RJ0A 3BZ5A 2P1QB 2ASTB 4RCAB 4OQTA 1XKUA 1FS2A 1PGVA 4R5DA 2OMXA 2Z65A 4KXFB 3ULAA 4U08A 3WPDA 5AWAA 5FTTB 4R5CA 1QYYA 1A9NA 4I6JB 1O6TA 4P91A 4YEBB 5B4PA 4R6GA 3ZYJA 3VQ1A 4J0MA 4BSRA 2V9TB 4R6JA 2FT3A 3TSRE 4CILA 3M18A 2A0ZA 3RFJA 3UL8A 2OMTA 4Z64C 5B0TA 4Z94G 3WPCA 3DZEA 5AWCA 1O6VA 3CIYA 1M9SA 4Q62A 5A5CA 3RFEA 4L3FA 2ID5A 5HDHA 3UL7A 4R0AA 3WPFA 4L3AA 1XWDC 2Z7XB 3M19A 3WPIA 4U06A 2Y5QA 4J4LA 4U7LA 1U0ND 3WPHA 3E4GA 3OGKB 4RCWA 1FO1A 3C6OB 2CA6A 4M7EC 3G3BA 2WQXA 4ECOA 3O6NA 3UL9A 4R09A 4QC0A 2O6QA 4GT6A 4CNCA 1XECA 2V9SA 1P8TA 3A79B 2Z66A 4MQWX 4ARNA 3FXIA 2RA8A 4Z8GA 4NKHA 4R6FA 4G8AA 3W3GA 1OGQA 1FQVA 1Z7XW 4WP6A 5GS2B 2ASSB 2ELLA 5LFNA 4FDWA 3C6PB 2P1OB 4M7EA 4Q3GA 1XEUA 4H09A 2UZXA 1OZNA 2JQDA 3ZYNA 4U09A 2WQVA 5CMPA 2XOTA 4PERA 4Y61B 3W3MA 1A4YA 4FCGA 4R6AA 4R08A 1KOOA 1M10B 3G3AA 4CNMA 1H6TA 2WQWA 3JB9j 4FS7A 4CP6A 1DCEA 2JE1A 4PSJA 4RWTC 2V70A 4V2DA 4Z61C 2BEXA 3RIZA 4XOSA 4NKGA 1O6SA 4TZHA 1JL5A 4Q3IA 3G04C 2Z82A 4B8CD 3G06A 2P1MB 5GS0A 4FMZA 4XGOA 3PMHG 3UN9A 3WN4A 4NZRM 4V2EA 4LI1A 1KOHA 5AWDA 1P8VA 2WFHA 4FHOA 3ZYIA 4PQ8A 3CIGA 3WPEA 4Z79A 3RW7A 2O6RA 1YRGA 3G39A 4HQ1A 4BSSA 4CC4C
chains in the Genus database with same CATH topology
2Z7XA 3GOZA 4AW4A 1SQ0B 1DS9A 1WWLA 2O6SA 4R58A 3REZA 3P72A 5GMGA 5D3IA 4LSXC 5GMFA 4C2AB 5B0NA 3RW6A 1D0BA 3OGLB 4LSCA 2Z63A 2UZYA 3W3NA 1IO0A 1K5GC 1M0ZA 2Q4GW 3E2JA 2XWTC 1XCDA 3W3LA 4ECNA 2OMZA 2Z81A 3KJ4A 3ULUA 3O53A 4UFRA 1H6UA 4KNGA 1K5DC 4LXRA 3ULVA 1G9UA 1OOKG 3OJAA 4QBZA 4R07A 1ZIWA 3CVRA 5IJCA 4CC4A 4ARRA 1OTMA 4GLPA 3SB4A 3E3ZA 4LI2A 4BV4R 2R9UA 4K17A 4BSUA 3RFSA 5CMNA 4LSXA 3E6JA 4LXSA 4IM6A 4PEQB 3W3KA 2OMYA 2BNHA 5AZ5A 3RGXA 4XSQA 5IYXC 2IFGA 1GWBA 4PKIG 1OTNA 1DFJI 4P8SA 4QXEA 4WYKA 3WPGA 2OMUA 2P1PB 2JE0A 2WQUA 4EZGA 4AY9X 4FD0A 3VQ2A 1LTXA 5IJDA 5IJBA 3ZYOA 1OTOA 2OMWA 1P9AG 4C2BB 4V2CA 3WPBA 2OMVA 3RGZA 2P1NB 3OGMB 5GMHA 4KT1A 1FT8A 2Z64A 3OJAB 3W3JA 5AWBA 5GQRK 4MN8B 2RR6A 3C6NB 5HZLB 2Z62A 1W8AA 1M9LA 4LSAA 3RJ0A 3BZ5A 2P1QB 2ASTB 4RCAB 4OQTA 1XKUA 1FS2A 1PGVA 4R5DA 2OMXA 2Z65A 4KXFB 3ULAA 4U08A 3WPDA 5AWAA 5FTTB 4R5CA 1QYYA 1A9NA 4I6JB 1O6TA 4P91A 4YEBB 5B4PA 4R6GA 3ZYJA 3VQ1A 4J0MA 4BSRA 2V9TB 4R6JA 2FT3A 3TSRE 4CILA 3M18A 2A0ZA 3RFJA 3UL8A 2OMTA 4Z64C 5B0TA 4Z94G 3WPCA 3DZEA 5AWCA 1O6VA 3CIYA 1M9SA 4Q62A 5A5CA 3RFEA 4L3FA 2ID5A 5HDHA 3UL7A 4R0AA 3WPFA 4L3AA 1XWDC 2Z7XB 3M19A 3WPIA 4U06A 2Y5QA 4J4LA 4U7LA 1U0ND 3WPHA 3E4GA 3OGKB 4RCWA 1FO1A 3C6OB 2CA6A 4M7EC 3G3BA 2WQXA 4ECOA 3O6NA 3UL9A 4R09A 4QC0A 2O6QA 4GT6A 4CNCA 1XECA 2V9SA 1P8TA 3A79B 2Z66A 4MQWX 4ARNA 3FXIA 2RA8A 4Z8GA 4NKHA 4R6FA 4G8AA 3W3GA 1OGQA 1FQVA 1Z7XW 4WP6A 5GS2B 2ASSB 2ELLA 5LFNA 4FDWA 3C6PB 2P1OB 4M7EA 4Q3GA 1XEUA 4H09A 2UZXA 1OZNA 2JQDA 3ZYNA 4U09A 2WQVA 5CMPA 2XOTA 4PERA 4Y61B 3W3MA 1A4YA 4FCGA 4R6AA 4R08A 1KOOA 1M10B 3G3AA 4CNMA 1H6TA 2WQWA 3JB9j 4FS7A 4CP6A 1DCEA 2JE1A 4PSJA 4RWTC 2V70A 4V2DA 4Z61C 2BEXA 3RIZA 4XOSA 4NKGA 1O6SA 4TZHA 1JL5A 4Q3IA 3G04C 2Z82A 4B8CD 3G06A 2P1MB 5GS0A 4FMZA 4XGOA 3PMHG 3UN9A 3WN4A 4V2EA 4LI1A 1KOHA 5AWDA 1P8VA 2WFHA 4FHOA 3ZYIA 4PQ8A 3CIGA 3WPEA 4Z79A 3RW7A 2O6RA 1YRGA 3G39A 4HQ1A 4BSSA 4CC4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7X A;  3GOZ A;  4AW4 A;  1SQ0 B;  1DS9 A;  1WWL A;  2O6S A;  4R58 A;  3REZ A;  3P72 A;  5GMG A;  5D3I A;  4LSX C;  5GMF A;  4C2A B;  5B0N A;  3RW6 A;  1D0B A;  3OGL B;  4LSC A;  2Z63 A;  2UZY A;  3W3N A;  1IO0 A;  1K5G C;  1M0Z A;  2Q4G W;  3E2J A;  2XWT C;  1XCD A;  3W3L A;  4ECN A;  2OMZ A;  2Z81 A;  3KJ4 A;  3ULU A;  3O53 A;  4UFR A;  1H6U A;  4KNG A;  1K5D C;  4LXR A;  3ULV A;  1G9U A;  1OOK G;  3OJA A;  4QBZ A;  4R07 A;  1ZIW A;  3CVR A;  5IJC A;  4CC4 A;  4ARR A;  1OTM A;  4GLP A;  3SB4 A;  3E3Z A;  4LI2 A;  4BV4 R;  2R9U A;  4K17 A;  4BSU A;  3RFS A;  5CMN A;  4LSX A;  3E6J A;  4LXS A;  4IM6 A;  4PEQ B;  3W3K A;  2OMY A;  2BNH A;  5AZ5 A;  3RGX A;  4XSQ A;  5IYX C;  2IFG A;  1GWB A;  4PKI G;  1OTN A;  1DFJ I;  4P8S A;  4QXE A;  4WYK A;  3WPG A;  2OMU A;  2P1P B;  2JE0 A;  2WQU A;  4EZG A;  4AY9 X;  4FD0 A;  3VQ2 A;  1LTX A;  5IJD A;  5IJB A;  3ZYO A;  1OTO A;  2OMW A;  1P9A G;  4C2B B;  4V2C A;  3WPB A;  2OMV A;  3RGZ A;  2P1N B;  3OGM B;  5GMH A;  4KT1 A;  1FT8 A;  2Z64 A;  3OJA B;  3W3J A;  5AWB A;  5GQR K;  4MN8 B;  2RR6 A;  3C6N B;  5HZL B;  2Z62 A;  1W8A A;  1M9L A;  4LSA A;  3RJ0 A;  3BZ5 A;  2P1Q B;  2AST B;  4RCA B;  4OQT A;  1XKU A;  1FS2 A;  1PGV A;  4R5D A;  2OMX A;  2Z65 A;  4KXF B;  3ULA A;  4U08 A;  3WPD A;  5AWA A;  5FTT B;  4R5C A;  1QYY A;  1A9N A;  4I6J B;  1O6T A;  4P91 A;  4YEB B;  5B4P A;  4R6G A;  3ZYJ A;  3VQ1 A;  4J0M A;  4BSR A;  2V9T B;  4R6J A;  2FT3 A;  3TSR E;  4CIL A;  3M18 A;  2A0Z A;  3RFJ A;  3UL8 A;  2OMT A;  4Z64 C;  5B0T A;  4Z94 G;  3WPC A;  3DZE A;  5AWC A;  1O6V A;  3CIY A;  1M9S A;  4Q62 A;  5A5C A;  3RFE A;  4L3F A;  2ID5 A;  5HDH A;  3UL7 A;  4R0A A;  3WPF A;  4L3A A;  1XWD C;  2Z7X B;  3M19 A;  3WPI A;  4U06 A;  2Y5Q A;  4J4L A;  4U7L A;  1U0N D;  3WPH A;  3E4G A;  3OGK B;  4RCW A;  1FO1 A;  3C6O B;  2CA6 A;  4M7E C;  3G3B A;  2WQX A;  4ECO A;  3O6N A;  3UL9 A;  4R09 A;  4QC0 A;  2O6Q A;  4GT6 A;  4CNC A;  1XEC A;  2V9S A;  1P8T A;  3A79 B;  2Z66 A;  4MQW X;  4ARN A;  3FXI A;  2RA8 A;  4Z8G A;  4NKH A;  4R6F A;  4G8A A;  3W3G A;  1OGQ A;  1FQV A;  1Z7X W;  4WP6 A;  5GS2 B;  2ASS B;  2ELL A;  5LFN A;  4FDW A;  3C6P B;  2P1O B;  4M7E A;  4Q3G A;  1XEU A;  4H09 A;  2UZX A;  1OZN A;  2JQD A;  3ZYN A;  4U09 A;  2WQV A;  5CMP A;  2XOT A;  4PER A;  4Y61 B;  3W3M A;  1A4Y A;  4FCG A;  4R6A A;  4R08 A;  1KOO A;  1M10 B;  3G3A A;  4CNM A;  1H6T A;  2WQW A;  3JB9 j;  4FS7 A;  4CP6 A;  1DCE A;  2JE1 A;  4PSJ A;  4RWT C;  2V70 A;  4V2D A;  4Z61 C;  2BEX A;  3RIZ A;  4XOS A;  4NKG A;  1O6S A;  4TZH A;  1JL5 A;  4Q3I A;  3G04 C;  2Z82 A;  4B8C D;  3G06 A;  2P1M B;  5GS0 A;  4FMZ A;  4XGO A;  3PMH G;  3UN9 A;  3WN4 A;  4V2E A;  4LI1 A;  1KOH A;  5AWD A;  1P8V A;  2WFH A;  4FHO A;  3ZYI A;  4PQ8 A;  3CIG A;  3WPE A;  4Z79 A;  3RW7 A;  2O6R A;  1YRG A;  3G39 A;  4HQ1 A;  4BSS A;  4CC4 C; 
#chains in the Genus database with same CATH topology
 2Z7X A;  3GOZ A;  4AW4 A;  1SQ0 B;  1DS9 A;  1WWL A;  2O6S A;  4R58 A;  3REZ A;  3P72 A;  5GMG A;  5D3I A;  4LSX C;  5GMF A;  4C2A B;  5B0N A;  3RW6 A;  1D0B A;  3OGL B;  4LSC A;  2Z63 A;  2UZY A;  3W3N A;  1IO0 A;  1K5G C;  1M0Z A;  2Q4G W;  3E2J A;  2XWT C;  1XCD A;  3W3L A;  4ECN A;  2OMZ A;  2Z81 A;  3KJ4 A;  3ULU A;  3O53 A;  4UFR A;  1H6U A;  4KNG A;  1K5D C;  4LXR A;  3ULV A;  1G9U A;  1OOK G;  3OJA A;  4QBZ A;  4R07 A;  1ZIW A;  3CVR A;  5IJC A;  4CC4 A;  4ARR A;  1OTM A;  4GLP A;  3SB4 A;  3E3Z A;  4LI2 A;  4BV4 R;  2R9U A;  4K17 A;  4BSU A;  3RFS A;  5CMN A;  4LSX A;  3E6J A;  4LXS A;  4IM6 A;  4PEQ B;  3W3K A;  2OMY A;  2BNH A;  5AZ5 A;  3RGX A;  4XSQ A;  5IYX C;  2IFG A;  1GWB A;  4PKI G;  1OTN A;  1DFJ I;  4P8S A;  4QXE A;  4WYK A;  3WPG A;  2OMU A;  2P1P B;  2JE0 A;  2WQU A;  4EZG A;  4AY9 X;  4NZT M;  4FD0 A;  3VQ2 A;  1LTX A;  5IJD A;  5IJB A;  3ZYO A;  1OTO A;  2OMW A;  1P9A G;  4C2B B;  4V2C A;  3WPB A;  2OMV A;  3RGZ A;  2P1N B;  3OGM B;  5GMH A;  4KT1 A;  1FT8 A;  2Z64 A;  3OJA B;  3W3J A;  5AWB A;  5GQR K;  4MN8 B;  2RR6 A;  3C6N B;  5HZL B;  2Z62 A;  1W8A A;  1M9L A;  4LSA A;  3RJ0 A;  3BZ5 A;  2P1Q B;  2AST B;  4RCA B;  4OQT A;  1XKU A;  1FS2 A;  1PGV A;  4R5D A;  2OMX A;  2Z65 A;  4KXF B;  3ULA A;  4U08 A;  3WPD A;  5AWA A;  5FTT B;  4R5C A;  1QYY A;  1A9N A;  4I6J B;  1O6T A;  4P91 A;  4YEB B;  5B4P A;  4R6G A;  3ZYJ A;  3VQ1 A;  4J0M A;  4BSR A;  2V9T B;  4R6J A;  2FT3 A;  3TSR E;  4CIL A;  3M18 A;  2A0Z A;  3RFJ A;  3UL8 A;  2OMT A;  4Z64 C;  5B0T A;  4Z94 G;  3WPC A;  3DZE A;  5AWC A;  1O6V A;  3CIY A;  1M9S A;  4Q62 A;  5A5C A;  3RFE A;  4L3F A;  2ID5 A;  5HDH A;  3UL7 A;  4R0A A;  3WPF A;  4L3A A;  1XWD C;  2Z7X B;  3M19 A;  3WPI A;  4U06 A;  2Y5Q A;  4J4L A;  4U7L A;  1U0N D;  3WPH A;  3E4G A;  3OGK B;  4RCW A;  1FO1 A;  3C6O B;  2CA6 A;  4M7E C;  3G3B A;  2WQX A;  4ECO A;  3O6N A;  3UL9 A;  4R09 A;  4QC0 A;  2O6Q A;  4GT6 A;  4CNC A;  1XEC A;  2V9S A;  1P8T A;  3A79 B;  2Z66 A;  4MQW X;  4ARN A;  3FXI A;  2RA8 A;  4Z8G A;  4NKH A;  4R6F A;  4G8A A;  3W3G A;  1OGQ A;  1FQV A;  1Z7X W;  4WP6 A;  5GS2 B;  2ASS B;  2ELL A;  5LFN A;  4FDW A;  3C6P B;  2P1O B;  4M7E A;  4Q3G A;  1XEU A;  4H09 A;  2UZX A;  1OZN A;  2JQD A;  3ZYN A;  4U09 A;  2WQV A;  5CMP A;  2XOT A;  4PER A;  4Y61 B;  3W3M A;  1A4Y A;  4FCG A;  4R6A A;  4R08 A;  1KOO A;  1M10 B;  3G3A A;  4CNM A;  1H6T A;  2WQW A;  3JB9 j;  4FS7 A;  4CP6 A;  1DCE A;  2JE1 A;  4PSJ A;  4RWT C;  2V70 A;  4V2D A;  4Z61 C;  2BEX A;  3RIZ A;  4XOS A;  4NKG A;  1O6S A;  4TZH A;  1JL5 A;  4Q3I A;  3G04 C;  2Z82 A;  4B8C D;  3G06 A;  2P1M B;  5GS0 A;  4FMZ A;  4XGO A;  3PMH G;  3UN9 A;  3WN4 A;  4NZR M;  4V2E A;  4LI1 A;  1KOH A;  5AWD A;  1P8V A;  2WFH A;  4FHO A;  3ZYI A;  4PQ8 A;  3CIG A;  3WPE A;  4Z79 A;  3RW7 A;  2O6R A;  1YRG A;  3G39 A;  4HQ1 A;  4BSS A;  4CC4 C; 
#chains in the Genus database with same CATH homology
 2Z7X A;  3GOZ A;  4AW4 A;  1SQ0 B;  1DS9 A;  1WWL A;  2O6S A;  4R58 A;  3REZ A;  3P72 A;  5GMG A;  5D3I A;  4LSX C;  5GMF A;  4C2A B;  5B0N A;  3RW6 A;  1D0B A;  3OGL B;  4LSC A;  2Z63 A;  2UZY A;  3W3N A;  1IO0 A;  1K5G C;  1M0Z A;  2Q4G W;  3E2J A;  2XWT C;  1XCD A;  3W3L A;  4ECN A;  2OMZ A;  2Z81 A;  3KJ4 A;  3ULU A;  3O53 A;  4UFR A;  1H6U A;  4KNG A;  1K5D C;  4LXR A;  3ULV A;  1G9U A;  1OOK G;  3OJA A;  4QBZ A;  4R07 A;  1ZIW A;  3CVR A;  5IJC A;  4CC4 A;  4ARR A;  1OTM A;  4GLP A;  3SB4 A;  3E3Z A;  4LI2 A;  4BV4 R;  2R9U A;  4K17 A;  4BSU A;  3RFS A;  5CMN A;  4LSX A;  3E6J A;  4LXS A;  4IM6 A;  4PEQ B;  3W3K A;  2OMY A;  2BNH A;  5AZ5 A;  3RGX A;  4XSQ A;  5IYX C;  2IFG A;  1GWB A;  4PKI G;  1OTN A;  1DFJ I;  4P8S A;  4QXE A;  4WYK A;  3WPG A;  2OMU A;  2P1P B;  2JE0 A;  2WQU A;  4EZG A;  4AY9 X;  4FD0 A;  3VQ2 A;  1LTX A;  5IJD A;  5IJB A;  3ZYO A;  1OTO A;  2OMW A;  1P9A G;  4C2B B;  4V2C A;  3WPB A;  2OMV A;  3RGZ A;  2P1N B;  3OGM B;  5GMH A;  4KT1 A;  1FT8 A;  2Z64 A;  3OJA B;  3W3J A;  5AWB A;  5GQR K;  4MN8 B;  2RR6 A;  3C6N B;  5HZL B;  2Z62 A;  1W8A A;  1M9L A;  4LSA A;  3RJ0 A;  3BZ5 A;  2P1Q B;  2AST B;  4RCA B;  4OQT A;  1XKU A;  1FS2 A;  1PGV A;  4R5D A;  2OMX A;  2Z65 A;  4KXF B;  3ULA A;  4U08 A;  3WPD A;  5AWA A;  5FTT B;  4R5C A;  1QYY A;  1A9N A;  4I6J B;  1O6T A;  4P91 A;  4YEB B;  5B4P A;  4R6G A;  3ZYJ A;  3VQ1 A;  4J0M A;  4BSR A;  2V9T B;  4R6J A;  2FT3 A;  3TSR E;  4CIL A;  3M18 A;  2A0Z A;  3RFJ A;  3UL8 A;  2OMT A;  4Z64 C;  5B0T A;  4Z94 G;  3WPC A;  3DZE A;  5AWC A;  1O6V A;  3CIY A;  1M9S A;  4Q62 A;  5A5C A;  3RFE A;  4L3F A;  2ID5 A;  5HDH A;  3UL7 A;  4R0A A;  3WPF A;  4L3A A;  1XWD C;  2Z7X B;  3M19 A;  3WPI A;  4U06 A;  2Y5Q A;  4J4L A;  4U7L A;  1U0N D;  3WPH A;  3E4G A;  3OGK B;  4RCW A;  1FO1 A;  3C6O B;  2CA6 A;  4M7E C;  3G3B A;  2WQX A;  4ECO A;  3O6N A;  3UL9 A;  4R09 A;  4QC0 A;  2O6Q A;  4GT6 A;  4CNC A;  1XEC A;  2V9S A;  1P8T A;  3A79 B;  2Z66 A;  4MQW X;  4ARN A;  3FXI A;  2RA8 A;  4Z8G A;  4NKH A;  4R6F A;  4G8A A;  3W3G A;  1OGQ A;  1FQV A;  1Z7X W;  4WP6 A;  5GS2 B;  2ASS B;  2ELL A;  5LFN A;  4FDW A;  3C6P B;  2P1O B;  4M7E A;  4Q3G A;  1XEU A;  4H09 A;  2UZX A;  1OZN A;  2JQD A;  3ZYN A;  4U09 A;  2WQV A;  5CMP A;  2XOT A;  4PER A;  4Y61 B;  3W3M A;  1A4Y A;  4FCG A;  4R6A A;  4R08 A;  1KOO A;  1M10 B;  3G3A A;  4CNM A;  1H6T A;  2WQW A;  3JB9 j;  4FS7 A;  4CP6 A;  1DCE A;  2JE1 A;  4PSJ A;  4RWT C;  2V70 A;  4V2D A;  4Z61 C;  2BEX A;  3RIZ A;  4XOS A;  4NKG A;  1O6S A;  4TZH A;  1JL5 A;  4Q3I A;  3G04 C;  2Z82 A;  4B8C D;  3G06 A;  2P1M B;  5GS0 A;  4FMZ A;  4XGO A;  3PMH G;  3UN9 A;  3WN4 A;  4V2E A;  4LI1 A;  1KOH A;  5AWD A;  1P8V A;  2WFH A;  4FHO A;  3ZYI A;  4PQ8 A;  3CIG A;  3WPE A;  4Z79 A;  3RW7 A;  2O6R A;  1YRG A;  3G39 A;  4HQ1 A;  4BSS A;  4CC4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...