3DZEA

Crystal structure of bovine coupling factor b bound with cadmium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
176
structure length
176
Chain Sequence
b'SFWEWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine mitochondrial factor B at 0.96-A resolution.
pubmed doi rcsb
molecule keywords ATP synthase subunit s, mitochondrial
source organism Bos taurus
molecule tags Electron transport
total genus 65
structure length 176
sequence length 176
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2008-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3dzeA00
4QC0A 2RR6A 4CNCA 4FMZA 4NKGA 2A0ZA 1FT8A 1OOKG 5AZ5A 4PEQB 2V70A 4U09A 2ID5A 2Z64A 3RFEA 4BV4R 4Q3GA 4M7EC 5AWCA 4BSUA 4LSXC 2R9UA 2P1QB 4LSCA 3CVRA 4WYKA 1P8VA 5A5CA 1Z7XW 1D0BA 4R5CA 3P72A 2JE0A 4YEBB 1XWDC 4LI2A 4V2EA 4R0AA 5AWAA 2P1PB 5GMGA 3M18A 1W8AA 3TSRE 4R08A 1P9AG 4U08A 4ARNA 4UFRA 4R6AA 1XCDA 3WPCA 3E3ZA 2WFHA 2O6QA 5IYXC 2V9SA 3RW7A 4RCWA 4BSRA 4R09A 1O6VA 2BNHA 3W3GA 3C6OB 3OGKB 5IJDA 4CILA 4B8CD 2P1MB 2OMXA 4CC4C 1XKUA 2O6SA 4ECOA 5LFNA 4FHOA 5D3IA 4AY9X 4RWTC 3O53A 2OMTA 4EZGA 2WQVA 2UZXA 3A79B 4XSQA 2OMZA 2RA8A 4K17A 3WPFA 3GOZA 3RGXA 4CNMA 4Z61C 4AW4A 2IFGA 3M19A 1SQ0B 4OQTA 4PQ8A 1KOHA 3FXIA 1PGVA 1A4YA 3WPIA 4MQWX 4FCGA 3DZEA 4GT6A 1O6TA 3WN4A 4ARRA 2OMUA 4QBZA 1OTMA 4M7EA 3WPEA 4LSXA 1K5DC 5HZLB 5IJBA 2ASTB 2WQUA 3OGLB 3RIZA 4P91A 1DCEA 5HDHA 4GLPA 1G9UA 2XOTA 4TZHA 2P1NB 5B0TA 1M10B 3C6NB 3O6NA 4CP6A 2CA6A 5GMHA 4NKHA 3ZYNA 1OZNA 4R6JA 4KT1A 5GS2B 3VQ1A 4KNGA 1O6SA 5GS0A 4G8AA 4Z79A 5CMNA 3G06A 3OJAB 2OMYA 3ZYOA 3E2JA 3ZYJA 1FO1A 3ULVA 3ZYIA 4U7LA 4Q3IA 1GWBA 3KJ4A 2OMWA 4P8SA 4CC4A 4LXRA 4XGOA 1OTOA 3SB4A 3G3AA 3G3BA 3W3MA 3W3LA 4KXFB 4BSSA 2P1OB 4XOSA 1YRGA 4R07A 1OGQA 5AWDA 1XECA 4FS7A 2FT3A 2UZYA 5FTTB 3REZA 1K5GC 3UN9A 4PERA 4LXSA 4J0MA 2ASSB 3WPDA 5B4PA 1XEUA 4R58A 2O6RA 4R6FA 4IM6A 5IJCA 2XWTC 2V9TB 4V2DA 2BEXA 2Z66A 4QXEA 3OGMB 4HQ1A 1P8TA 1QYYA 2Z65A 2WQWA 1A9NA 1M9LA 4V2CA 4PKIG 2Z7XB 3WPHA 4LI1A 1DFJI 3CIGA 3ULAA 4H09A 4U06A 3W3NA 3W3KA 3E6JA 4Q62A 3UL9A 3RFSA 3C6PB 4C2AB 1FS2A 2Y5QA 4L3FA 5GQRK 4I6JB 3G39A 2Z82A 3RGZA 4Y61B 4FD0A 1H6TA 1KOOA 1OTNA 4R6GA 1JL5A 3E4GA 2OMVA 2ELLA 4R5DA 2WQXA 4L3AA 3UL7A 1M0ZA 3CIYA 3W3JA 1WWLA 1H6UA 3UL8A 2Z7XA 2Z62A 4WP6A 4Z8GA 1LTXA 1FQVA 2Z81A 3RJ0A 3BZ5A 4RCAB 5CMPA 4PSJA 5B0NA 4C2BB 4Z64C 1U0ND 4MN8B 2JQDA 3ULUA 2Q4GW 5GMFA 4LSAA 5AWBA 3PMHG 3OJAA 2JE1A 1IO0A 4FDWA 3RFJA 2Z63A 3VQ2A 4J4LA 3WPBA 4Z94G 1M9SA 4ECNA 1ZIWA 3WPGA 1DS9A 3G04C 3RW6A 3JB9j
chains in the Genus database with same CATH superfamily
4QC0A 2RR6A 4CNCA 4FMZA 4NKGA 2A0ZA 1FT8A 1OOKG 5AZ5A 4PEQB 2V70A 4U09A 2ID5A 2Z64A 3RFEA 4BV4R 4Q3GA 4M7EC 5AWCA 4BSUA 4LSXC 2R9UA 2P1QB 4LSCA 3CVRA 4WYKA 1P8VA 5A5CA 1Z7XW 1D0BA 4R5CA 3P72A 2JE0A 4YEBB 1XWDC 4LI2A 4V2EA 4R0AA 5AWAA 2P1PB 5GMGA 3M18A 1W8AA 3TSRE 4R08A 4NZRM 1P9AG 4U08A 4ARNA 4UFRA 4R6AA 1XCDA 3WPCA 3E3ZA 2WFHA 2O6QA 5IYXC 2V9SA 3RW7A 4RCWA 4BSRA 4R09A 1O6VA 2BNHA 3W3GA 3C6OB 3OGKB 5IJDA 4CILA 4B8CD 2P1MB 2OMXA 4CC4C 1XKUA 2O6SA 4ECOA 4NZTM 5LFNA 4FHOA 5D3IA 4AY9X 4RWTC 3O53A 2OMTA 4EZGA 2WQVA 2UZXA 3A79B 4XSQA 2OMZA 2RA8A 4K17A 3WPFA 3GOZA 3RGXA 4CNMA 4Z61C 4AW4A 2IFGA 3M19A 1SQ0B 4OQTA 4PQ8A 1KOHA 3FXIA 1PGVA 1A4YA 3WPIA 4MQWX 4FCGA 3DZEA 4GT6A 1O6TA 3WN4A 4ARRA 2OMUA 4QBZA 1OTMA 4M7EA 3WPEA 4LSXA 1K5DC 5HZLB 5IJBA 2ASTB 2WQUA 3OGLB 3RIZA 4P91A 1DCEA 5HDHA 4GLPA 1G9UA 2XOTA 4TZHA 2P1NB 5B0TA 1M10B 3C6NB 3O6NA 4CP6A 2CA6A 5GMHA 4NKHA 3ZYNA 1OZNA 4R6JA 4KT1A 5GS2B 3VQ1A 4KNGA 1O6SA 5GS0A 4G8AA 4Z79A 5CMNA 3G06A 3OJAB 2OMYA 3ZYOA 3E2JA 3ZYJA 1FO1A 3ULVA 3ZYIA 4U7LA 4Q3IA 1GWBA 3KJ4A 2OMWA 4P8SA 4CC4A 4LXRA 4XGOA 1OTOA 3SB4A 3G3AA 3G3BA 3W3MA 3W3LA 4KXFB 4BSSA 2P1OB 4XOSA 1YRGA 4R07A 1OGQA 5AWDA 1XECA 4FS7A 2FT3A 2UZYA 5FTTB 3REZA 1K5GC 3UN9A 4PERA 4LXSA 4J0MA 2ASSB 3WPDA 5B4PA 1XEUA 4R58A 2O6RA 4R6FA 4IM6A 5IJCA 2XWTC 2V9TB 4V2DA 2BEXA 2Z66A 4QXEA 3OGMB 4HQ1A 1P8TA 1QYYA 2Z65A 2WQWA 1A9NA 1M9LA 4V2CA 4PKIG 2Z7XB 3WPHA 4LI1A 1DFJI 3CIGA 3ULAA 4H09A 4U06A 3W3NA 3W3KA 3E6JA 4Q62A 3UL9A 3RFSA 3C6PB 4C2AB 1FS2A 2Y5QA 4L3FA 5GQRK 4I6JB 3G39A 2Z82A 3RGZA 4Y61B 4FD0A 1H6TA 1KOOA 1OTNA 4R6GA 1JL5A 3E4GA 2OMVA 2ELLA 4R5DA 2WQXA 4L3AA 3UL7A 1M0ZA 3CIYA 3W3JA 1WWLA 1H6UA 3UL8A 2Z7XA 2Z62A 4WP6A 4Z8GA 1LTXA 1FQVA 2Z81A 3RJ0A 3BZ5A 4RCAB 5CMPA 4PSJA 5B0NA 4C2BB 4Z64C 1U0ND 4MN8B 2JQDA 3ULUA 2Q4GW 5GMFA 4LSAA 5AWBA 3PMHG 3OJAA 2JE1A 1IO0A 4FDWA 3RFJA 2Z63A 3VQ2A 4J4LA 3WPBA 4Z94G 1M9SA 4ECNA 1ZIWA 3WPGA 1DS9A 3G04C 3RW6A 3JB9j
chains in the Genus database with same CATH topology
4QC0A 2RR6A 4CNCA 4FMZA 4NKGA 2A0ZA 1FT8A 1OOKG 5AZ5A 4PEQB 2V70A 4U09A 2ID5A 2Z64A 3RFEA 4BV4R 4Q3GA 4M7EC 5AWCA 4BSUA 4LSXC 2R9UA 2P1QB 4LSCA 3CVRA 4WYKA 1P8VA 5A5CA 1Z7XW 1D0BA 4R5CA 3P72A 2JE0A 4YEBB 1XWDC 4LI2A 4V2EA 4R0AA 5AWAA 2P1PB 5GMGA 3M18A 1W8AA 3TSRE 4R08A 1P9AG 4U08A 4ARNA 4UFRA 4R6AA 1XCDA 3WPCA 3E3ZA 2WFHA 2O6QA 5IYXC 2V9SA 3RW7A 4RCWA 4BSRA 4R09A 1O6VA 2BNHA 3W3GA 3C6OB 3OGKB 5IJDA 4CILA 4B8CD 2P1MB 2OMXA 4CC4C 1XKUA 2O6SA 4ECOA 5LFNA 4FHOA 5D3IA 4AY9X 4RWTC 3O53A 2OMTA 4EZGA 2WQVA 2UZXA 3A79B 4XSQA 2OMZA 2RA8A 4K17A 3WPFA 3GOZA 3RGXA 4CNMA 4Z61C 4AW4A 2IFGA 3M19A 1SQ0B 4OQTA 4PQ8A 1KOHA 3FXIA 1PGVA 1A4YA 3WPIA 4MQWX 4FCGA 3DZEA 4GT6A 1O6TA 3WN4A 4ARRA 2OMUA 4QBZA 1OTMA 4M7EA 3WPEA 4LSXA 1K5DC 5HZLB 5IJBA 2ASTB 2WQUA 3OGLB 3RIZA 4P91A 1DCEA 5HDHA 4GLPA 1G9UA 2XOTA 4TZHA 2P1NB 5B0TA 1M10B 3C6NB 3O6NA 4CP6A 2CA6A 5GMHA 4NKHA 3ZYNA 1OZNA 4R6JA 4KT1A 5GS2B 3VQ1A 4KNGA 1O6SA 5GS0A 4G8AA 4Z79A 5CMNA 3G06A 3OJAB 2OMYA 3ZYOA 3E2JA 3ZYJA 1FO1A 3ULVA 3ZYIA 4U7LA 4Q3IA 1GWBA 3KJ4A 2OMWA 4P8SA 4CC4A 4LXRA 4XGOA 1OTOA 3SB4A 3G3AA 3G3BA 3W3MA 3W3LA 4KXFB 4BSSA 2P1OB 4XOSA 1YRGA 4R07A 1OGQA 5AWDA 1XECA 4FS7A 2FT3A 2UZYA 5FTTB 3REZA 1K5GC 3UN9A 4PERA 4LXSA 4J0MA 2ASSB 3WPDA 5B4PA 1XEUA 4R58A 2O6RA 4R6FA 4IM6A 5IJCA 2XWTC 2V9TB 4V2DA 2BEXA 2Z66A 4QXEA 3OGMB 4HQ1A 1P8TA 1QYYA 2Z65A 2WQWA 1A9NA 1M9LA 4V2CA 4PKIG 2Z7XB 3WPHA 4LI1A 1DFJI 3CIGA 3ULAA 4H09A 4U06A 3W3NA 3W3KA 3E6JA 4Q62A 3UL9A 3RFSA 3C6PB 4C2AB 1FS2A 2Y5QA 4L3FA 5GQRK 4I6JB 3G39A 2Z82A 3RGZA 4Y61B 4FD0A 1H6TA 1KOOA 1OTNA 4R6GA 1JL5A 3E4GA 2OMVA 2ELLA 4R5DA 2WQXA 4L3AA 3UL7A 1M0ZA 3CIYA 3W3JA 1WWLA 1H6UA 3UL8A 2Z7XA 2Z62A 4WP6A 4Z8GA 1LTXA 1FQVA 2Z81A 3RJ0A 3BZ5A 4RCAB 5CMPA 4PSJA 5B0NA 4C2BB 4Z64C 1U0ND 4MN8B 2JQDA 3ULUA 2Q4GW 5GMFA 4LSAA 5AWBA 3PMHG 3OJAA 2JE1A 1IO0A 4FDWA 3RFJA 2Z63A 3VQ2A 4J4LA 3WPBA 4Z94G 1M9SA 4ECNA 1ZIWA 3WPGA 1DS9A 3G04C 3RW6A 3JB9j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC0 A;  2RR6 A;  4CNC A;  4FMZ A;  4NKG A;  2A0Z A;  1FT8 A;  1OOK G;  5AZ5 A;  4PEQ B;  2V70 A;  4U09 A;  2ID5 A;  2Z64 A;  3RFE A;  4BV4 R;  4Q3G A;  4M7E C;  5AWC A;  4BSU A;  4LSX C;  2R9U A;  2P1Q B;  4LSC A;  3CVR A;  4WYK A;  1P8V A;  5A5C A;  1Z7X W;  1D0B A;  4R5C A;  3P72 A;  2JE0 A;  4YEB B;  1XWD C;  4LI2 A;  4V2E A;  4R0A A;  5AWA A;  2P1P B;  5GMG A;  3M18 A;  1W8A A;  3TSR E;  4R08 A;  1P9A G;  4U08 A;  4ARN A;  4UFR A;  4R6A A;  1XCD A;  3WPC A;  3E3Z A;  2WFH A;  2O6Q A;  5IYX C;  2V9S A;  3RW7 A;  4RCW A;  4BSR A;  4R09 A;  1O6V A;  2BNH A;  3W3G A;  3C6O B;  3OGK B;  5IJD A;  4CIL A;  4B8C D;  2P1M B;  2OMX A;  4CC4 C;  1XKU A;  2O6S A;  4ECO A;  5LFN A;  4FHO A;  5D3I A;  4AY9 X;  4RWT C;  3O53 A;  2OMT A;  4EZG A;  2WQV A;  2UZX A;  3A79 B;  4XSQ A;  2OMZ A;  2RA8 A;  4K17 A;  3WPF A;  3GOZ A;  3RGX A;  4CNM A;  4Z61 C;  4AW4 A;  2IFG A;  3M19 A;  1SQ0 B;  4OQT A;  4PQ8 A;  1KOH A;  3FXI A;  1PGV A;  1A4Y A;  3WPI A;  4MQW X;  4FCG A;  3DZE A;  4GT6 A;  1O6T A;  3WN4 A;  4ARR A;  2OMU A;  4QBZ A;  1OTM A;  4M7E A;  3WPE A;  4LSX A;  1K5D C;  5HZL B;  5IJB A;  2AST B;  2WQU A;  3OGL B;  3RIZ A;  4P91 A;  1DCE A;  5HDH A;  4GLP A;  1G9U A;  2XOT A;  4TZH A;  2P1N B;  5B0T A;  1M10 B;  3C6N B;  3O6N A;  4CP6 A;  2CA6 A;  5GMH A;  4NKH A;  3ZYN A;  1OZN A;  4R6J A;  4KT1 A;  5GS2 B;  3VQ1 A;  4KNG A;  1O6S A;  5GS0 A;  4G8A A;  4Z79 A;  5CMN A;  3G06 A;  3OJA B;  2OMY A;  3ZYO A;  3E2J A;  3ZYJ A;  1FO1 A;  3ULV A;  3ZYI A;  4U7L A;  4Q3I A;  1GWB A;  3KJ4 A;  2OMW A;  4P8S A;  4CC4 A;  4LXR A;  4XGO A;  1OTO A;  3SB4 A;  3G3A A;  3G3B A;  3W3M A;  3W3L A;  4KXF B;  4BSS A;  2P1O B;  4XOS A;  1YRG A;  4R07 A;  1OGQ A;  5AWD A;  1XEC A;  4FS7 A;  2FT3 A;  2UZY A;  5FTT B;  3REZ A;  1K5G C;  3UN9 A;  4PER A;  4LXS A;  4J0M A;  2ASS B;  3WPD A;  5B4P A;  1XEU A;  4R58 A;  2O6R A;  4R6F A;  4IM6 A;  5IJC A;  2XWT C;  2V9T B;  4V2D A;  2BEX A;  2Z66 A;  4QXE A;  3OGM B;  4HQ1 A;  1P8T A;  1QYY A;  2Z65 A;  2WQW A;  1A9N A;  1M9L A;  4V2C A;  4PKI G;  2Z7X B;  3WPH A;  4LI1 A;  1DFJ I;  3CIG A;  3ULA A;  4H09 A;  4U06 A;  3W3N A;  3W3K A;  3E6J A;  4Q62 A;  3UL9 A;  3RFS A;  3C6P B;  4C2A B;  1FS2 A;  2Y5Q A;  4L3F A;  5GQR K;  4I6J B;  3G39 A;  2Z82 A;  3RGZ A;  4Y61 B;  4FD0 A;  1H6T A;  1KOO A;  1OTN A;  4R6G A;  1JL5 A;  3E4G A;  2OMV A;  2ELL A;  4R5D A;  2WQX A;  4L3A A;  3UL7 A;  1M0Z A;  3CIY A;  3W3J A;  1WWL A;  1H6U A;  3UL8 A;  2Z7X A;  2Z62 A;  4WP6 A;  4Z8G A;  1LTX A;  1FQV A;  2Z81 A;  3RJ0 A;  3BZ5 A;  4RCA B;  5CMP A;  4PSJ A;  5B0N A;  4C2B B;  4Z64 C;  1U0N D;  4MN8 B;  2JQD A;  3ULU A;  2Q4G W;  5GMF A;  4LSA A;  5AWB A;  3PMH G;  3OJA A;  2JE1 A;  1IO0 A;  4FDW A;  3RFJ A;  2Z63 A;  3VQ2 A;  4J4L A;  3WPB A;  4Z94 G;  1M9S A;  4ECN A;  1ZIW A;  3WPG A;  1DS9 A;  3G04 C;  3RW6 A;  3JB9 j; 
#chains in the Genus database with same CATH topology
 4QC0 A;  2RR6 A;  4CNC A;  4FMZ A;  4NKG A;  2A0Z A;  1FT8 A;  1OOK G;  5AZ5 A;  4PEQ B;  2V70 A;  4U09 A;  2ID5 A;  2Z64 A;  3RFE A;  4BV4 R;  4Q3G A;  4M7E C;  5AWC A;  4BSU A;  4LSX C;  2R9U A;  2P1Q B;  4LSC A;  3CVR A;  4WYK A;  1P8V A;  5A5C A;  1Z7X W;  1D0B A;  4R5C A;  3P72 A;  2JE0 A;  4YEB B;  1XWD C;  4LI2 A;  4V2E A;  4R0A A;  5AWA A;  2P1P B;  5GMG A;  3M18 A;  1W8A A;  3TSR E;  4R08 A;  4NZR M;  1P9A G;  4U08 A;  4ARN A;  4UFR A;  4R6A A;  1XCD A;  3WPC A;  3E3Z A;  2WFH A;  2O6Q A;  5IYX C;  2V9S A;  3RW7 A;  4RCW A;  4BSR A;  4R09 A;  1O6V A;  2BNH A;  3W3G A;  3C6O B;  3OGK B;  5IJD A;  4CIL A;  4B8C D;  2P1M B;  2OMX A;  4CC4 C;  1XKU A;  2O6S A;  4ECO A;  4NZT M;  5LFN A;  4FHO A;  5D3I A;  4AY9 X;  4RWT C;  3O53 A;  2OMT A;  4EZG A;  2WQV A;  2UZX A;  3A79 B;  4XSQ A;  2OMZ A;  2RA8 A;  4K17 A;  3WPF A;  3GOZ A;  3RGX A;  4CNM A;  4Z61 C;  4AW4 A;  2IFG A;  3M19 A;  1SQ0 B;  4OQT A;  4PQ8 A;  1KOH A;  3FXI A;  1PGV A;  1A4Y A;  3WPI A;  4MQW X;  4FCG A;  3DZE A;  4GT6 A;  1O6T A;  3WN4 A;  4ARR A;  2OMU A;  4QBZ A;  1OTM A;  4M7E A;  3WPE A;  4LSX A;  1K5D C;  5HZL B;  5IJB A;  2AST B;  2WQU A;  3OGL B;  3RIZ A;  4P91 A;  1DCE A;  5HDH A;  4GLP A;  1G9U A;  2XOT A;  4TZH A;  2P1N B;  5B0T A;  1M10 B;  3C6N B;  3O6N A;  4CP6 A;  2CA6 A;  5GMH A;  4NKH A;  3ZYN A;  1OZN A;  4R6J A;  4KT1 A;  5GS2 B;  3VQ1 A;  4KNG A;  1O6S A;  5GS0 A;  4G8A A;  4Z79 A;  5CMN A;  3G06 A;  3OJA B;  2OMY A;  3ZYO A;  3E2J A;  3ZYJ A;  1FO1 A;  3ULV A;  3ZYI A;  4U7L A;  4Q3I A;  1GWB A;  3KJ4 A;  2OMW A;  4P8S A;  4CC4 A;  4LXR A;  4XGO A;  1OTO A;  3SB4 A;  3G3A A;  3G3B A;  3W3M A;  3W3L A;  4KXF B;  4BSS A;  2P1O B;  4XOS A;  1YRG A;  4R07 A;  1OGQ A;  5AWD A;  1XEC A;  4FS7 A;  2FT3 A;  2UZY A;  5FTT B;  3REZ A;  1K5G C;  3UN9 A;  4PER A;  4LXS A;  4J0M A;  2ASS B;  3WPD A;  5B4P A;  1XEU A;  4R58 A;  2O6R A;  4R6F A;  4IM6 A;  5IJC A;  2XWT C;  2V9T B;  4V2D A;  2BEX A;  2Z66 A;  4QXE A;  3OGM B;  4HQ1 A;  1P8T A;  1QYY A;  2Z65 A;  2WQW A;  1A9N A;  1M9L A;  4V2C A;  4PKI G;  2Z7X B;  3WPH A;  4LI1 A;  1DFJ I;  3CIG A;  3ULA A;  4H09 A;  4U06 A;  3W3N A;  3W3K A;  3E6J A;  4Q62 A;  3UL9 A;  3RFS A;  3C6P B;  4C2A B;  1FS2 A;  2Y5Q A;  4L3F A;  5GQR K;  4I6J B;  3G39 A;  2Z82 A;  3RGZ A;  4Y61 B;  4FD0 A;  1H6T A;  1KOO A;  1OTN A;  4R6G A;  1JL5 A;  3E4G A;  2OMV A;  2ELL A;  4R5D A;  2WQX A;  4L3A A;  3UL7 A;  1M0Z A;  3CIY A;  3W3J A;  1WWL A;  1H6U A;  3UL8 A;  2Z7X A;  2Z62 A;  4WP6 A;  4Z8G A;  1LTX A;  1FQV A;  2Z81 A;  3RJ0 A;  3BZ5 A;  4RCA B;  5CMP A;  4PSJ A;  5B0N A;  4C2B B;  4Z64 C;  1U0N D;  4MN8 B;  2JQD A;  3ULU A;  2Q4G W;  5GMF A;  4LSA A;  5AWB A;  3PMH G;  3OJA A;  2JE1 A;  1IO0 A;  4FDW A;  3RFJ A;  2Z63 A;  3VQ2 A;  4J4L A;  3WPB A;  4Z94 G;  1M9S A;  4ECN A;  1ZIW A;  3WPG A;  1DS9 A;  3G04 C;  3RW6 A;  3JB9 j; 
#chains in the Genus database with same CATH homology
 4QC0 A;  2RR6 A;  4CNC A;  4FMZ A;  4NKG A;  2A0Z A;  1FT8 A;  1OOK G;  5AZ5 A;  4PEQ B;  2V70 A;  4U09 A;  2ID5 A;  2Z64 A;  3RFE A;  4BV4 R;  4Q3G A;  4M7E C;  5AWC A;  4BSU A;  4LSX C;  2R9U A;  2P1Q B;  4LSC A;  3CVR A;  4WYK A;  1P8V A;  5A5C A;  1Z7X W;  1D0B A;  4R5C A;  3P72 A;  2JE0 A;  4YEB B;  1XWD C;  4LI2 A;  4V2E A;  4R0A A;  5AWA A;  2P1P B;  5GMG A;  3M18 A;  1W8A A;  3TSR E;  4R08 A;  1P9A G;  4U08 A;  4ARN A;  4UFR A;  4R6A A;  1XCD A;  3WPC A;  3E3Z A;  2WFH A;  2O6Q A;  5IYX C;  2V9S A;  3RW7 A;  4RCW A;  4BSR A;  4R09 A;  1O6V A;  2BNH A;  3W3G A;  3C6O B;  3OGK B;  5IJD A;  4CIL A;  4B8C D;  2P1M B;  2OMX A;  4CC4 C;  1XKU A;  2O6S A;  4ECO A;  5LFN A;  4FHO A;  5D3I A;  4AY9 X;  4RWT C;  3O53 A;  2OMT A;  4EZG A;  2WQV A;  2UZX A;  3A79 B;  4XSQ A;  2OMZ A;  2RA8 A;  4K17 A;  3WPF A;  3GOZ A;  3RGX A;  4CNM A;  4Z61 C;  4AW4 A;  2IFG A;  3M19 A;  1SQ0 B;  4OQT A;  4PQ8 A;  1KOH A;  3FXI A;  1PGV A;  1A4Y A;  3WPI A;  4MQW X;  4FCG A;  3DZE A;  4GT6 A;  1O6T A;  3WN4 A;  4ARR A;  2OMU A;  4QBZ A;  1OTM A;  4M7E A;  3WPE A;  4LSX A;  1K5D C;  5HZL B;  5IJB A;  2AST B;  2WQU A;  3OGL B;  3RIZ A;  4P91 A;  1DCE A;  5HDH A;  4GLP A;  1G9U A;  2XOT A;  4TZH A;  2P1N B;  5B0T A;  1M10 B;  3C6N B;  3O6N A;  4CP6 A;  2CA6 A;  5GMH A;  4NKH A;  3ZYN A;  1OZN A;  4R6J A;  4KT1 A;  5GS2 B;  3VQ1 A;  4KNG A;  1O6S A;  5GS0 A;  4G8A A;  4Z79 A;  5CMN A;  3G06 A;  3OJA B;  2OMY A;  3ZYO A;  3E2J A;  3ZYJ A;  1FO1 A;  3ULV A;  3ZYI A;  4U7L A;  4Q3I A;  1GWB A;  3KJ4 A;  2OMW A;  4P8S A;  4CC4 A;  4LXR A;  4XGO A;  1OTO A;  3SB4 A;  3G3A A;  3G3B A;  3W3M A;  3W3L A;  4KXF B;  4BSS A;  2P1O B;  4XOS A;  1YRG A;  4R07 A;  1OGQ A;  5AWD A;  1XEC A;  4FS7 A;  2FT3 A;  2UZY A;  5FTT B;  3REZ A;  1K5G C;  3UN9 A;  4PER A;  4LXS A;  4J0M A;  2ASS B;  3WPD A;  5B4P A;  1XEU A;  4R58 A;  2O6R A;  4R6F A;  4IM6 A;  5IJC A;  2XWT C;  2V9T B;  4V2D A;  2BEX A;  2Z66 A;  4QXE A;  3OGM B;  4HQ1 A;  1P8T A;  1QYY A;  2Z65 A;  2WQW A;  1A9N A;  1M9L A;  4V2C A;  4PKI G;  2Z7X B;  3WPH A;  4LI1 A;  1DFJ I;  3CIG A;  3ULA A;  4H09 A;  4U06 A;  3W3N A;  3W3K A;  3E6J A;  4Q62 A;  3UL9 A;  3RFS A;  3C6P B;  4C2A B;  1FS2 A;  2Y5Q A;  4L3F A;  5GQR K;  4I6J B;  3G39 A;  2Z82 A;  3RGZ A;  4Y61 B;  4FD0 A;  1H6T A;  1KOO A;  1OTN A;  4R6G A;  1JL5 A;  3E4G A;  2OMV A;  2ELL A;  4R5D A;  2WQX A;  4L3A A;  3UL7 A;  1M0Z A;  3CIY A;  3W3J A;  1WWL A;  1H6U A;  3UL8 A;  2Z7X A;  2Z62 A;  4WP6 A;  4Z8G A;  1LTX A;  1FQV A;  2Z81 A;  3RJ0 A;  3BZ5 A;  4RCA B;  5CMP A;  4PSJ A;  5B0N A;  4C2B B;  4Z64 C;  1U0N D;  4MN8 B;  2JQD A;  3ULU A;  2Q4G W;  5GMF A;  4LSA A;  5AWB A;  3PMH G;  3OJA A;  2JE1 A;  1IO0 A;  4FDW A;  3RFJ A;  2Z63 A;  3VQ2 A;  4J4L A;  3WPB A;  4Z94 G;  1M9S A;  4ECN A;  1ZIW A;  3WPG A;  1DS9 A;  3G04 C;  3RW6 A;  3JB9 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...