3DZTA

Aed7-leukotriene e4 complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
302
structure length
298
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
molecule keywords D7 protein
molecule tags Odorant-binding protein
source organism Aedes aegypti
total genus 114
structure length 298
sequence length 302
ec nomenclature
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dztA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dztA02
4OZDA 3DYEA 2JPOA 2QEOA 1TWOA 3S0AA 1DQEA 3OGNA 3RZSA 3BFHA 3DY9A 3DZTA 3D78A 2WCHA 3S0FA 2QEVA 1C3YA 1OOFA 2WCKA 3NHIA 2QDIA 3Q8IA 4INXA 1OOIX 4INWA 1OOGA 2WC6A 1ORGA 3BJHA 1OOHA 3L4AA 4F7FA 2L2CA 5EL2A 2H8VA 4JD9A 3D75A 3DXLA 4PT1A 3BFBA 3CZ2A 3CABA 3VB1A 3B88A 3FE9A 3D74A 3L47A 3CZ0A 3D76A 2GTEA 3L4LA 3NHTA 2WCJA 3R72A 1TUJA 3S0BA 1P28A 3D77A 1QWVA 1GM0A 3K1EA 2ERBA 1C3ZA 3R1OA 3B6XA 3BFAA 3R1PA 3CZ1A 3B7AA 1LS8A 2QEHA 3FE8A 3S0GA 3B87A 2WCLA 2QEBA 2P71A 3D73A 2WC5A 3NGVA 3B86A 2WCMA 2KPHA 5DICA 3FE6A 3N7HA 3S0DA 2P70A 2PQLA 3S0EA 3QMEA 2FJYA 3CDNA 3CYZA 1OW4A 3PJIA 1T14A 1XFRA 3V2LA 3R1VA 4FQTA
chains in the Genus database with same CATH superfamily
3AKAA 4OZDA 1NX2A 1WDCC 2AMIA 4M2PA 2JPOA 2H2KA 1CDNA 3VRQA 1IIOA 2SASA 3OGNA 1N65A 1FBVA 1B47A 3VRRA 3RZSA 5I2QA 3KF9A 4MZLA 1YUTA 1RTP1 3DY9A 1RFJA 1TTXA 2PASA 2FCDA 3BOWB 3O4XA 3S0FA 2HPSA 1C3YA 3GOFA 2KNEA 3I5IC 2KFHA 2WCKA 2CXJA 3NHIA 1NCZA 2CNPA 5KSZA 2BL0B 3CTNA 3OB1B 2OS8B 3I5HB 1ALVA 1LA3A 2Y4QA 1V1FA 5TNCA 5CSJA 1IQ3A 2LV7A 3SG5A 1OOGA 2PALA 5CSFA 4TNCA 3DF0A 1KFUS 3BJHA 1PK0D 1RROA 1OMVA 5HYDA 3O2PA 1OOHA 4F7FA 1F55A 2KFGA 2LMUA 1KFXS 2M97A 3EVVA 2F3YA 2M0RA 3LCPC 3JVTC 5EL2A 1L2OB 2L4IA 2JT0A 2MA2A 2IS9A 1WRZA 1F4QA 1A29A 1XVJA 2COLB 1FI6A 1B9AA 2KAXA 3DXLA 3SS5A 1TIZA 2BKHB 1F54A 1SYMA 3CABA 3LLEA 1TCFA 3VB1A 2MLFC 4I5JA 1PRWA 3TUYB 4I5LB 3BXKA 5HKYA 1KK7Z 2ZN8A 4MSPA 5FYXA 5KU1A 1WDCB 3L47A 3VROA 4OKHA 2LANA 3C1VA 1A2XA 3CZ0A 1OMRA 2BNXA 1DT7B 4P2YB 4F0ZB 3D76A 3LK0A 3L4LA 2F33A 4A4CA 5DKNA 3TDZA 2M49B 1IKUA 1IQ5A 1KCYA 1DEKA 5AEQA 3UNWA 1QX2A 1QV0A 1LINA 2TN4A 3D77A 3I5IB 1R2UA 1UHJA 1AVSA 1KK8C 4IL1A 2L5YA 3FS7A 3I5GC 2QPTA 1B4CA 1CDLA 4N1GA 1FW4A 1J1DA 2WCBA 4MBEA 1IH0A 1G4YR 2K7OA 1SL9A 4WQ3A 1XFYO 1OQPA 2KI6C 3WHUB 3B6XA 3R1PA 3SIAA 1YURA 1S6JA 2NXQA 2JXLA 1MXLC 2CBLA 3JVTB 2NLNA 3B7AA 4HSZA 4AQIA 3FE8A 1NYAA 2OTGC 2WCLA 1XK4C 1ZOTB 1SNLA 2E6WA 4OV2A 5AANA 1SY9A 2EC6C 2BBMA 3NGVA 1W9ZA 1SSEB 1S26D 3D0YA 5CPVA 2WCEA 3KPXA 4CIDA 5PALA 2K7CA 5DKQA 2JPTA 3DVMA 2NCOA 2R2IA 3BUXB 2LVKA 4NDDA 2ZNEA 1NX1A 2LVVA 1EG4A 3CYZA 4MZJA 1OW4A 3SG2A 1UURA 1CM1A 3SG7A 3SS4A 1S1EA 3K21A 3V2LA 1UHHA 1JFJA 2WOSA 4MN0A 1NIWA 1RK9A 1GQMA 1AUIB 4FQTA 4YGCB 5I8NA 1KK8B 1QLKA 3LL8B 1KQVA 3I5GB 2OS8C 3I5HC 1TWOA 1NWDA 1S6CA 2I2RE 4YI9A 1GGWA 1Z2CB 1AJ4A 1QATA 2G2BA 1PSRA 1YUUA 1SW8A 1EL4A 1MHOA 2KYCA 2WNDA 3BFHA 4GUKA 4D1EA 1EG3A 2QEVA 2LUCA 2PMYA 1S5GZ 2O5GA 5D3OA 2I7AA 2QDIA 4YBHB 2K60A 2LP2A 1G33A 2OTGB 3I5FC 4WQ2A 1OOIX 1CFCA 2EC6B 1AHRA 3KEVA 5AXIA 2BAPA 1LXFC 1RWYA 3MSEB 1M31A 2FCEA 5BPJA 3L4AA 1YX7A 4PALA 2KQ6A 1F4OA 3GK2A 3TDUA 1JBAA 2L2CA 1TN4A 1QJTA 1EXRA 4YI8A 1MF8B 1WRLA 2LMTA 4NDCA 1KSMA 3AAKA 1WLMA 3CR5X 3CZ2A 3FWCA 3NSOA 5ER4X 1SMGA 2JQ6A 2MHHA 4MEWA 2SCPA 1UHIA 3EVUA 4GGNA 4I5NB 1KQMC 3SS3A 2FOTA 2I94A 1JF0A 3NSIA 3HCMA 1SCMC 2MAZA 1H8BA 2AUCA 3QRXA 4QJ5B 3PN7C 2L5XB 4ORAB 2GTEA 1CMFA 2HQ8A 2BE4A 2O60A 1A75B 1EH2A 1DJYA 1ODBA 1DGVA 1B8LA 3S0BA 1K9UA 1L7ZA 2L4HA 2JT3A 1MWNA 3EVRA 1DJGA 2LLUA 2LHIA 2LLSA 2KAVA 1K93D 1KK7Y 2LLTA 2LP3A 2CCMA 3I5FB 3GK1A 4DIRA 4ORCB 1CLBA 2NZ0A 5AFPA 2ERBA 1C3ZA 4CFQA 3O78A 1CLLA 4HREE 2B1UA 1K90D 4GAOA 3PALA 1QS7A 1CMGA 1SK6D 3R1OA 1C7VA 3BFAA 1CFPA 3KO0A 4C0KA 2Y1MA 3E3RA 4PE1A 3VGOA 4R1EA 1AJ5A 1QTXA 3GK4X 5HKZA 1CM4A 3H4SE 1B8RA 1XFZO 3PLFB 1LS8A 2QEHA 4NDBA 1RJVA 1BU3A 1SL8A 3IQOA 5J3XA 5ER5A 1DTLA 1PALA 4YGEB 2F2PA 2CTNA 1AK8A 3FWBA 3EG5B 4PE4A 1DMOA 3WXAA 1ZACA 1J7RA 3AAJA 3DF0B 3OX6A 4GGFA 3M0WA 1K96A 3A4UB 2KBMA 1KQMB 4YGBB 3JTDC 2KPHA 1BLQA 4CLNA 1K8UA 5DICA 4UPGA 2LM5A 3N7HA 5CSIA 1CB1A 1QLSA 1SCMB 1BMOA 4HRHA 2MLEC 3PN7B 3NXAA 1TRFA 5D7FA 1B8CA 3CDNA 3EKHA 3PM2A 1NCYA 1T14A 1XFRA 2JZIA 4JPZB 4PCWA 1TNXA 1A03A 1SCVA 3RM1A 3D10A 1HT9A 1M39A 3DYEA 2MBXA 1KSOA 1YR5A 2EGDA 2PYQA 4GNKB 2M1KB 3DVEA 3VRPA 1QASA 1S6IA 3AKBA 5F6TA 2M3WA 4MRXA 3IVTA 4P5OE 1ZUZA 4PE7A 3EKJA 2HQWA 4AOMA 1K9KA 1ALWA 3DD4A 1CDMA 1DJXA 2BKIB 4OVNF 3DZTA 3D78A 2LHLA 1BR4B 1Y6WA 4JQ0D 4DRWA 4FQOA 2KFFA 3BUMB 4JKTA 1M63B 1OOFA 1YRUB 1QIWA 2CT9A 3Q8IA 4XJKB 1CTRA 4MLWA 2ZRTA 3KHEA 1A4PA 2JU0A 1IRJA 1DF0B 1UUSA 2GV5A 2MJWB 3NSKA 3ZWHA 4N5XA 1G8IA 1GGZA 1OE9B 1IJ5A 1IWQA 2JULA 1ORGA 1LKJA 2M9GA 4M2OA 5G08A 3TDIA 3JTDB 1QV1A 3OBVA 1U5IB 2LAPA 4AQJA 1KWOC 2LE9B 2M7NA 5HLVA 3SIBA 3UO9A 1BODA 1F8HA 2QACA 1F71A 2M29A 1H4BA 3VRNA 2PRUA 3BYAA 2GGZA 1S5GY 1SPYA 4JD9A 3SG3A 3D75A 1D1OA 1XK4A 3IQQA 2BBNA 4PT1A 4XYNA 3BFBA 1NP8A 3WHTB 1UWOA 2WORA 2H61C 3D0YB 4CFRA 2Y1NA 1LA0A 1QXPA 1XFVO 2JNXA 3B88A 1JFKA 2L2EA 5I2OA 3D74A 1WLZA 3EK7A 4FTGA 1MXEA 1CNPA 5D69A 2WCJA 3EK8A 1C7WA 1K9PA 2KQYA 1B1GA 1WY9A 2Q4UA 3BOWA 1P28A 4QJ3B 1Q80A 1YX8A 1IG5A 2K2AA 1XA5A 4PDZA 4BY5A 4WRIA 3F45A 4PHJA 1MUXA 1YVLA 1SKTA 2P6BB 2LVJA 2E30A 1GM0A 3K1EA 2JTTA 1XFWO 3DVKA 1TNQA 1RECA 4U8DA 3BUWB 1W7JB 2BCBA 2F8PA 1QX7A 1ZMZA 3LK1A 4BY4A 4ZCUA 1Y1AA 1A75A 1NUBA 2KI4C 2K7BA 1BT6A 1J7PA 1KWOB 1QX5B 4USLA 2JC2A 1IGVA 5HKWA 2YGUA 1OZSA 3CZ1A 3S0GA 1F70A 1IJ6A 2LC5A 2ZNDA 3CGAA 1JC2A 2QEBA 2P71A 3O6BA 1SR6C 2WC5A 2LNKA 2V53A 3BUNB 2LUXA 1M45A 2KAYA 1NPQA 4PHMA 4ETOA 4ORBB 2WCMA 1XYDA 2Q91A 5I2LA 3PATA 3FE6A 3S0DA 2M7LA 1B7TY 1AP4A 1FI5A 2P70A 4YGAA 2PQLA 1PVAA 1QIVA 1PVBA 2KGBC 3EK4A 1FPWA 1UP5A 2KHNA 1UHNA 1QVIY 1DVIA 2RGIA 1B7TZ 1J7QA 3SG4A 2L51A 2JXCA 4GGFC 3R1VA 4MZKA 1BR1B 1MR8A 3SJSA 3NSLA 3FIAA 4IJ7A 2L50A 1QVIZ 2QEOA 3BUOB 3S0AA 2MRDA 1FF1A 1DQEA 1YVHA 3SG6A 2JRFA 4QJ4B 2A4JA 3WNXB 2KI4B 1K95A 2NCPA 2PVBA 4DCKA 3PFVA 4KYNA 1NX0A 1S36A 1Y0VH 2WCHA 1KFUL 2LCPA 2F2OA 2BCXA 5IBWA 1KFXL 1C07A 4INXA 1BJFA 2L98A 4JWQA 2BE6A 3A8RA 1SR6B 4INWA 1HQVA 5K89A 1PSBA 4GBAA 2K7DA 2WC6A 1J55A 2G9BA 2ZKMX 4OCIA 1PULA 1V1GA 2JNFA 2KOTA 4GPLB 2KDHA 3TS5C 1N2DA 3IF7A 1NCXA 3OP0A 4MRYA 2HF5A 1CFDA 4L9MA 2L0PA 1K94A 1SBJA 2H8VA 1BF5A 1BG1A 4XJKA 4CPVA 4M2QA 3OB2B 1OZOA 1YUSA 2LMVA 1DF0A 3RLZA 1OSAA 3HX4A 4E68A 1JSAA 1WRKA 2D8NA 5GQQC 2GGMA 3FE9A 1JF2A 1DELA 1S3PA 1Z4HA 1U5IA 2JT8A 1EJ3A 2Y5IA 5AERA 3PM8A 2KGRA 3CS1A 2EHBA 1TNPA 1Y1XA 3O4YA 3ZNIA 1MQ1A 4NQGA 3NHTA 3CWGA 1YTZC 1OMDA 1CDPA 2KI6D 2OPOA 1GJYA 2JOJA 1R6PA 3R72A 1TUJA 1OOJA 2I18A 2K2FA 1XFXO 2KLEA 1TNWA 3DVJA 1DJZA 4C0LA 5I94A 1SL7A 2K0JA 2VRGA 1JUOA 3ICBA 2ZN9A 1K2HA 4PHNA 1Y1UA 2ZRSA 2JWWA 3OX5A 2F3ZA 2HETA 1QWVA 3OHMB 1E8AA 1M46A 2ISDA 1UHKA 2DOQA 2AAOA 1CFFA 1DC1A 5HL1A 2M1UA 1DGUA 3PSRA 1TOPA 2KYFA 4PE0A 2KSPA 3TS5B 1CKKA 1BOCA 3CR2A 2ZFDA 4I5KA 3CR4X 2M8UA 3TZ1A 5FI2A 1X02A 1YRTB 4GFTA 4HRGA 5JJGA 5FI7A 4ZCVA 1TUZA 1JWDA 2JTZA 2BL0C 3B87A 5DKRA 1SRAA 2BCAA 3D73A 3BQ3A 1N0YA 3B86A 4PHKA 5CSNA 2LVIA 1NSHA 4MVFA 4YGDB 1VRKA 2KBIA 1NX3A 2PSRA 3CZTX 2BECA 4C0JA 1DJWA 4DUQA 5FI6A 4OR9B 4A4BA 1XO5A 1J7OA 1DJIA 2WC8A 1J1EA 2K8MB 3CLNA 4YRUA 2K61A 1L2OC 4Q04A 3S0EA 3QMEA 2FJYA 1DJHA 5B8IB 2KLDA 4N1FA 5JOLA 1CLMA 4DS7A 3PJIA 2FJUB 1TCOB 5KTYA 2H61A 5HLOA 4ICBA 2WCFA 1ZFSA 1W7IB 1XFUO 3TUYC 1LVCD
chains in the Genus database with same CATH topology
4OZDA 3DYEA 2JPOA 2QEOA 1TWOA 3S0AA 1DQEA 3OGNA 3RZSA 3BFHA 3DY9A 3DZTA 3D78A 2WCHA 3S0FA 2QEVA 1C3YA 1OOFA 2WCKA 3NHIA 2QDIA 3Q8IA 4INXA 1OOIX 4INWA 1OOGA 2WC6A 1ORGA 3BJHA 1OOHA 3L4AA 4F7FA 2L2CA 5EL2A 2H8VA 4JD9A 3D75A 3DXLA 4PT1A 3BFBA 3CZ2A 3CABA 3VB1A 3B88A 3FE9A 3D74A 3L47A 3CZ0A 3D76A 2GTEA 3L4LA 3NHTA 2WCJA 3R72A 1TUJA 3S0BA 1P28A 3D77A 1QWVA 1GM0A 3K1EA 2ERBA 1C3ZA 3R1OA 3B6XA 3BFAA 3R1PA 3CZ1A 3B7AA 1LS8A 2QEHA 3FE8A 3S0GA 3B87A 2WCLA 2QEBA 2P71A 3D73A 2WC5A 3NGVA 3B86A 2WCMA 2KPHA 5DICA 3FE6A 3N7HA 3S0DA 2P70A 2PQLA 3S0EA 3QMEA 2FJYA 3CDNA 3CYZA 1OW4A 3PJIA 1T14A 1XFRA 3V2LA 3R1VA 4FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZD A;  3DYE A;  2JPO A;  2QEO A;  1TWO A;  3S0A A;  1DQE A;  3OGN A;  3RZS A;  3BFH A;  3DY9 A;  3DZT A;  3D78 A;  2WCH A;  3S0F A;  2QEV A;  1C3Y A;  1OOF A;  2WCK A;  3NHI A;  2QDI A;  3Q8I A;  4INX A;  1OOI X;  4INW A;  1OOG A;  2WC6 A;  1ORG A;  3BJH A;  1OOH A;  3L4A A;  4F7F A;  2L2C A;  5EL2 A;  2H8V A;  4JD9 A;  3D75 A;  3DXL A;  4PT1 A;  3BFB A;  3CZ2 A;  3CAB A;  3VB1 A;  3B88 A;  3FE9 A;  3D74 A;  3L47 A;  3CZ0 A;  3D76 A;  2GTE A;  3L4L A;  3NHT A;  2WCJ A;  3R72 A;  1TUJ A;  3S0B A;  1P28 A;  3D77 A;  1QWV A;  1GM0 A;  3K1E A;  2ERB A;  1C3Z A;  3R1O A;  3B6X A;  3BFA A;  3R1P A;  3CZ1 A;  3B7A A;  1LS8 A;  2QEH A;  3FE8 A;  3S0G A;  3B87 A;  2WCL A;  2QEB A;  2P71 A;  3D73 A;  2WC5 A;  3NGV A;  3B86 A;  2WCM A;  2KPH A;  5DIC A;  3FE6 A;  3N7H A;  3S0D A;  2P70 A;  2PQL A;  3S0E A;  3QME A;  2FJY A;  3CDN A;  3CYZ A;  1OW4 A;  3PJI A;  1T14 A;  1XFR A;  3V2L A;  3R1V A;  4FQT A; 
#chains in the Genus database with same CATH topology
 3AKA A;  4OZD A;  1NX2 A;  1WDC C;  2AMI A;  4M2P A;  2JPO A;  2H2K A;  1CDN A;  3VRQ A;  1IIO A;  2SAS A;  3OGN A;  1N65 A;  1FBV A;  1B47 A;  3VRR A;  3RZS A;  5I2Q A;  3KF9 A;  4MZL A;  1YUT A;  1RTP 1;  3DY9 A;  1RFJ A;  1TTX A;  2PAS A;  2FCD A;  3BOW B;  3O4X A;  3S0F A;  2HPS A;  1C3Y A;  3GOF A;  2KNE A;  3I5I C;  2KFH A;  2WCK A;  2CXJ A;  3NHI A;  1NCZ A;  2CNP A;  5KSZ A;  2BL0 B;  3CTN A;  3OB1 B;  2OS8 B;  3I5H B;  1ALV A;  1LA3 A;  2Y4Q A;  1V1F A;  5TNC A;  5CSJ A;  1IQ3 A;  2LV7 A;  3SG5 A;  1OOG A;  2PAL A;  5CSF A;  4TNC A;  3DF0 A;  1KFU S;  3BJH A;  1PK0 D;  1RRO A;  1OMV A;  5HYD A;  3O2P A;  1OOH A;  4F7F A;  1F55 A;  2KFG A;  2LMU A;  1KFX S;  2M97 A;  3EVV A;  2F3Y A;  2M0R A;  3LCP C;  3JVT C;  5EL2 A;  1L2O B;  2L4I A;  2JT0 A;  2MA2 A;  2IS9 A;  1WRZ A;  1F4Q A;  1A29 A;  1XVJ A;  2COL B;  1FI6 A;  1B9A A;  2KAX A;  3DXL A;  3SS5 A;  1TIZ A;  2BKH B;  1F54 A;  1SYM A;  3CAB A;  3LLE A;  1TCF A;  3VB1 A;  2MLF C;  4I5J A;  1PRW A;  3TUY B;  4I5L B;  3BXK A;  5HKY A;  1KK7 Z;  2ZN8 A;  4MSP A;  5FYX A;  5KU1 A;  1WDC B;  3L47 A;  3VRO A;  4OKH A;  2LAN A;  3C1V A;  1A2X A;  3CZ0 A;  1OMR A;  2BNX A;  1DT7 B;  4P2Y B;  4F0Z B;  3D76 A;  3LK0 A;  3L4L A;  2F33 A;  4A4C A;  5DKN A;  3TDZ A;  2M49 B;  1IKU A;  1IQ5 A;  1KCY A;  1DEK A;  5AEQ A;  3UNW A;  1QX2 A;  1QV0 A;  1LIN A;  2TN4 A;  3D77 A;  3I5I B;  1R2U A;  1UHJ A;  1AVS A;  1KK8 C;  4IL1 A;  2L5Y A;  3FS7 A;  3I5G C;  2QPT A;  1B4C A;  1CDL A;  4N1G A;  1FW4 A;  1J1D A;  2WCB A;  4MBE A;  1IH0 A;  1G4Y R;  2K7O A;  1SL9 A;  4WQ3 A;  1XFY O;  1OQP A;  2KI6 C;  3WHU B;  3B6X A;  3R1P A;  3SIA A;  1YUR A;  1S6J A;  2NXQ A;  2JXL A;  1MXL C;  2CBL A;  3JVT B;  2NLN A;  3B7A A;  4HSZ A;  4AQI A;  3FE8 A;  1NYA A;  2OTG C;  2WCL A;  1XK4 C;  1ZOT B;  1SNL A;  2E6W A;  4OV2 A;  5AAN A;  1SY9 A;  2EC6 C;  2BBM A;  3NGV A;  1W9Z A;  1SSE B;  1S26 D;  3D0Y A;  5CPV A;  2WCE A;  3KPX A;  4CID A;  5PAL A;  2K7C A;  5DKQ A;  2JPT A;  3DVM A;  2NCO A;  2R2I A;  3BUX B;  2LVK A;  4NDD A;  2ZNE A;  1NX1 A;  2LVV A;  1EG4 A;  3CYZ A;  4MZJ A;  1OW4 A;  3SG2 A;  1UUR A;  1CM1 A;  3SG7 A;  3SS4 A;  1S1E A;  3K21 A;  3V2L A;  1UHH A;  1JFJ A;  2WOS A;  4MN0 A;  1NIW A;  1RK9 A;  1GQM A;  1AUI B;  4FQT A;  4YGC B;  5I8N A;  1KK8 B;  1QLK A;  3LL8 B;  1KQV A;  3I5G B;  2OS8 C;  3I5H C;  1TWO A;  1NWD A;  1S6C A;  2I2R E;  4YI9 A;  1GGW A;  1Z2C B;  1AJ4 A;  1QAT A;  2G2B A;  1PSR A;  1YUU A;  1SW8 A;  1EL4 A;  1MHO A;  2KYC A;  2WND A;  3BFH A;  4GUK A;  4D1E A;  1EG3 A;  2QEV A;  2LUC A;  2PMY A;  1S5G Z;  2O5G A;  5D3O A;  2I7A A;  2QDI A;  4YBH B;  2K60 A;  2LP2 A;  1G33 A;  2OTG B;  3I5F C;  4WQ2 A;  1OOI X;  1CFC A;  2EC6 B;  1AHR A;  3KEV A;  5AXI A;  2BAP A;  1LXF C;  1RWY A;  3MSE B;  1M31 A;  2FCE A;  5BPJ A;  3L4A A;  1YX7 A;  4PAL A;  2KQ6 A;  1F4O A;  3GK2 A;  3TDU A;  1JBA A;  2L2C A;  1TN4 A;  1QJT A;  1EXR A;  4YI8 A;  1MF8 B;  1WRL A;  2LMT A;  4NDC A;  1KSM A;  3AAK A;  1WLM A;  3CR5 X;  3CZ2 A;  3FWC A;  3NSO A;  5ER4 X;  1SMG A;  2JQ6 A;  2MHH A;  4MEW A;  2SCP A;  1UHI A;  3EVU A;  4GGN A;  4I5N B;  1KQM C;  3SS3 A;  2FOT A;  2I94 A;  1JF0 A;  3NSI A;  3HCM A;  1SCM C;  2MAZ A;  1H8B A;  2AUC A;  3QRX A;  4QJ5 B;  3PN7 C;  2L5X B;  4ORA B;  2GTE A;  1CMF A;  2HQ8 A;  2BE4 A;  2O60 A;  1A75 B;  1EH2 A;  1DJY A;  1ODB A;  1DGV A;  1B8L A;  3S0B A;  1K9U A;  1L7Z A;  2L4H A;  2JT3 A;  1MWN A;  3EVR A;  1DJG A;  2LLU A;  2LHI A;  2LLS A;  2KAV A;  1K93 D;  1KK7 Y;  2LLT A;  2LP3 A;  2CCM A;  3I5F B;  3GK1 A;  4DIR A;  4ORC B;  1CLB A;  2NZ0 A;  5AFP A;  2ERB A;  1C3Z A;  4CFQ A;  3O78 A;  1CLL A;  4HRE E;  2B1U A;  1K90 D;  4GAO A;  3PAL A;  1QS7 A;  1CMG A;  1SK6 D;  3R1O A;  1C7V A;  3BFA A;  1CFP A;  3KO0 A;  4C0K A;  2Y1M A;  3E3R A;  4PE1 A;  3VGO A;  4R1E A;  1AJ5 A;  1QTX A;  3GK4 X;  5HKZ A;  1CM4 A;  3H4S E;  1B8R A;  1XFZ O;  3PLF B;  1LS8 A;  2QEH A;  4NDB A;  1RJV A;  1BU3 A;  1SL8 A;  3IQO A;  5J3X A;  5ER5 A;  1DTL A;  1PAL A;  4YGE B;  2F2P A;  2CTN A;  1AK8 A;  3FWB A;  3EG5 B;  4PE4 A;  1DMO A;  3WXA A;  1ZAC A;  1J7R A;  3AAJ A;  3DF0 B;  3OX6 A;  4GGF A;  3M0W A;  1K96 A;  3A4U B;  2KBM A;  1KQM B;  4YGB B;  3JTD C;  2KPH A;  1BLQ A;  4CLN A;  1K8U A;  5DIC A;  4UPG A;  2LM5 A;  3N7H A;  5CSI A;  1CB1 A;  1QLS A;  1SCM B;  1BMO A;  4HRH A;  2MLE C;  3PN7 B;  3NXA A;  1TRF A;  5D7F A;  1B8C A;  3CDN A;  3EKH A;  3PM2 A;  1NCY A;  1T14 A;  1XFR A;  2JZI A;  4JPZ B;  4PCW A;  1TNX A;  1A03 A;  1SCV A;  3RM1 A;  3D10 A;  1HT9 A;  1M39 A;  3DYE A;  2MBX A;  1KSO A;  1YR5 A;  2EGD A;  2PYQ A;  4GNK B;  2M1K B;  3DVE A;  3VRP A;  1QAS A;  1S6I A;  3AKB A;  5F6T A;  2M3W A;  4MRX A;  3IVT A;  4P5O E;  1ZUZ A;  4PE7 A;  3EKJ A;  2HQW A;  4AOM A;  1K9K A;  1ALW A;  3DD4 A;  1CDM A;  1DJX A;  2BKI B;  4OVN F;  3DZT A;  3D78 A;  2LHL A;  1BR4 B;  1Y6W A;  4JQ0 D;  4DRW A;  4FQO A;  2KFF A;  3BUM B;  4JKT A;  1M63 B;  1OOF A;  1YRU B;  1QIW A;  2CT9 A;  3Q8I A;  4XJK B;  1CTR A;  4MLW A;  2ZRT A;  3KHE A;  1A4P A;  2JU0 A;  1IRJ A;  1DF0 B;  1UUS A;  2GV5 A;  2MJW B;  3NSK A;  3ZWH A;  4N5X A;  1G8I A;  1GGZ A;  1OE9 B;  1IJ5 A;  1IWQ A;  2JUL A;  1ORG A;  1LKJ A;  2M9G A;  4M2O A;  5G08 A;  3TDI A;  3JTD B;  1QV1 A;  3OBV A;  1U5I B;  2LAP A;  4AQJ A;  1KWO C;  2LE9 B;  2M7N A;  5HLV A;  3SIB A;  3UO9 A;  1BOD A;  1F8H A;  2QAC A;  1F71 A;  2M29 A;  1H4B A;  3VRN A;  2PRU A;  3BYA A;  2GGZ A;  1S5G Y;  1SPY A;  4JD9 A;  3SG3 A;  3D75 A;  1D1O A;  1XK4 A;  3IQQ A;  2BBN A;  4PT1 A;  4XYN A;  3BFB A;  1NP8 A;  3WHT B;  1UWO A;  2WOR A;  2H61 C;  3D0Y B;  4CFR A;  2Y1N A;  1LA0 A;  1QXP A;  1XFV O;  2JNX A;  3B88 A;  1JFK A;  2L2E A;  5I2O A;  3D74 A;  1WLZ A;  3EK7 A;  4FTG A;  1MXE A;  1CNP A;  5D69 A;  2WCJ A;  3EK8 A;  1C7W A;  1K9P A;  2KQY A;  1B1G A;  1WY9 A;  2Q4U A;  3BOW A;  1P28 A;  4QJ3 B;  1Q80 A;  1YX8 A;  1IG5 A;  2K2A A;  1XA5 A;  4PDZ A;  4BY5 A;  4WRI A;  3F45 A;  4PHJ A;  1MUX A;  1YVL A;  1SKT A;  2P6B B;  2LVJ A;  2E30 A;  1GM0 A;  3K1E A;  2JTT A;  1XFW O;  3DVK A;  1TNQ A;  1REC A;  4U8D A;  3BUW B;  1W7J B;  2BCB A;  2F8P A;  1QX7 A;  1ZMZ A;  3LK1 A;  4BY4 A;  4ZCU A;  1Y1A A;  1A75 A;  1NUB A;  2KI4 C;  2K7B A;  1BT6 A;  1J7P A;  1KWO B;  1QX5 B;  4USL A;  2JC2 A;  1IGV A;  5HKW A;  2YGU A;  1OZS A;  3CZ1 A;  3S0G A;  1F70 A;  1IJ6 A;  2LC5 A;  2ZND A;  3CGA A;  1JC2 A;  2QEB A;  2P71 A;  3O6B A;  1SR6 C;  2WC5 A;  2LNK A;  2V53 A;  3BUN B;  2LUX A;  1M45 A;  2KAY A;  1NPQ A;  4PHM A;  4ETO A;  4ORB B;  2WCM A;  1XYD A;  2Q91 A;  5I2L A;  3PAT A;  3FE6 A;  3S0D A;  2M7L A;  1B7T Y;  1AP4 A;  1FI5 A;  2P70 A;  4YGA A;  2PQL A;  1PVA A;  1QIV A;  1PVB A;  2KGB C;  3EK4 A;  1FPW A;  1UP5 A;  2KHN A;  1UHN A;  1QVI Y;  1DVI A;  2RGI A;  1B7T Z;  1J7Q A;  3SG4 A;  2L51 A;  2JXC A;  4GGF C;  3R1V A;  4MZK A;  1BR1 B;  1MR8 A;  3SJS A;  3NSL A;  3FIA A;  4IJ7 A;  2L50 A;  1QVI Z;  2QEO A;  3BUO B;  3S0A A;  2MRD A;  1FF1 A;  1DQE A;  1YVH A;  3SG6 A;  2JRF A;  4QJ4 B;  2A4J A;  3WNX B;  2KI4 B;  1K95 A;  2NCP A;  2PVB A;  4DCK A;  3PFV A;  4KYN A;  1NX0 A;  1S36 A;  1Y0V H;  2WCH A;  1KFU L;  2LCP A;  2F2O A;  2BCX A;  5IBW A;  1KFX L;  1C07 A;  4INX A;  1BJF A;  2L98 A;  4JWQ A;  2BE6 A;  3A8R A;  1SR6 B;  4INW A;  1HQV A;  5K89 A;  1PSB A;  4GBA A;  2K7D A;  2WC6 A;  1J55 A;  2G9B A;  2ZKM X;  4OCI A;  1PUL A;  1V1G A;  2JNF A;  2KOT A;  4GPL B;  2KDH A;  3TS5 C;  1N2D A;  3IF7 A;  1NCX A;  3OP0 A;  4MRY A;  2HF5 A;  1CFD A;  4L9M A;  2L0P A;  1K94 A;  1SBJ A;  2H8V A;  1BF5 A;  1BG1 A;  4XJK A;  4CPV A;  4M2Q A;  3OB2 B;  1OZO A;  1YUS A;  2LMV A;  1DF0 A;  3RLZ A;  1OSA A;  3HX4 A;  4E68 A;  1JSA A;  1WRK A;  2D8N A;  5GQQ C;  2GGM A;  3FE9 A;  1JF2 A;  1DEL A;  1S3P A;  1Z4H A;  1U5I A;  2JT8 A;  1EJ3 A;  2Y5I A;  5AER A;  3PM8 A;  2KGR A;  3CS1 A;  2EHB A;  1TNP A;  1Y1X A;  3O4Y A;  3ZNI A;  1MQ1 A;  4NQG A;  3NHT A;  3CWG A;  1YTZ C;  1OMD A;  1CDP A;  2KI6 D;  2OPO A;  1GJY A;  2JOJ A;  1R6P A;  3R72 A;  1TUJ A;  1OOJ A;  2I18 A;  2K2F A;  1XFX O;  2KLE A;  1TNW A;  3DVJ A;  1DJZ A;  4C0L A;  5I94 A;  1SL7 A;  2K0J A;  2VRG A;  1JUO A;  3ICB A;  2ZN9 A;  1K2H A;  4PHN A;  1Y1U A;  2ZRS A;  2JWW A;  3OX5 A;  2F3Z A;  2HET A;  1QWV A;  3OHM B;  1E8A A;  1M46 A;  2ISD A;  1UHK A;  2DOQ A;  2AAO A;  1CFF A;  1DC1 A;  5HL1 A;  2M1U A;  1DGU A;  3PSR A;  1TOP A;  2KYF A;  4PE0 A;  2KSP A;  3TS5 B;  1CKK A;  1BOC A;  3CR2 A;  2ZFD A;  4I5K A;  3CR4 X;  2M8U A;  3TZ1 A;  5FI2 A;  1X02 A;  1YRT B;  4GFT A;  4HRG A;  5JJG A;  5FI7 A;  4ZCV A;  1TUZ A;  1JWD A;  2JTZ A;  2BL0 C;  3B87 A;  5DKR A;  1SRA A;  2BCA A;  3D73 A;  3BQ3 A;  1N0Y A;  3B86 A;  4PHK A;  5CSN A;  2LVI A;  1NSH A;  4MVF A;  4YGD B;  1VRK A;  2KBI A;  1NX3 A;  2PSR A;  3CZT X;  2BEC A;  4C0J A;  1DJW A;  4DUQ A;  5FI6 A;  4OR9 B;  4A4B A;  1XO5 A;  1J7O A;  1DJI A;  2WC8 A;  1J1E A;  2K8M B;  3CLN A;  4YRU A;  2K61 A;  1L2O C;  4Q04 A;  3S0E A;  3QME A;  2FJY A;  1DJH A;  5B8I B;  2KLD A;  4N1F A;  5JOL A;  1CLM A;  4DS7 A;  3PJI A;  2FJU B;  1TCO B;  5KTY A;  2H61 A;  5HLO A;  4ICB A;  2WCF A;  1ZFS A;  1W7I B;  1XFU O;  3TUY C;  1LVC D; 
#chains in the Genus database with same CATH homology
 4OZD A;  3DYE A;  2JPO A;  2QEO A;  1TWO A;  3S0A A;  1DQE A;  3OGN A;  3RZS A;  3BFH A;  3DY9 A;  3DZT A;  3D78 A;  2WCH A;  3S0F A;  2QEV A;  1C3Y A;  1OOF A;  2WCK A;  3NHI A;  2QDI A;  3Q8I A;  4INX A;  1OOI X;  4INW A;  1OOG A;  2WC6 A;  1ORG A;  3BJH A;  1OOH A;  3L4A A;  4F7F A;  2L2C A;  5EL2 A;  2H8V A;  4JD9 A;  3D75 A;  3DXL A;  4PT1 A;  3BFB A;  3CZ2 A;  3CAB A;  3VB1 A;  3B88 A;  3FE9 A;  3D74 A;  3L47 A;  3CZ0 A;  3D76 A;  2GTE A;  3L4L A;  3NHT A;  2WCJ A;  3R72 A;  1TUJ A;  3S0B A;  1P28 A;  3D77 A;  1QWV A;  1GM0 A;  3K1E A;  2ERB A;  1C3Z A;  3R1O A;  3B6X A;  3BFA A;  3R1P A;  3CZ1 A;  3B7A A;  1LS8 A;  2QEH A;  3FE8 A;  3S0G A;  3B87 A;  2WCL A;  2QEB A;  2P71 A;  3D73 A;  2WC5 A;  3NGV A;  3B86 A;  2WCM A;  2KPH A;  5DIC A;  3FE6 A;  3N7H A;  3S0D A;  2P70 A;  2PQL A;  3S0E A;  3QME A;  2FJY A;  3CDN A;  3CYZ A;  1OW4 A;  3PJI A;  1T14 A;  1XFR A;  3V2L A;  3R1V A;  4FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...