3E01A

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
556
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Gag-Pol polyprotein
total genus 153
structure length 552
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3e01A05
3TAPA 4CHNA 3GIJA 3NBPA 3KKSA 3KHGA 4DTUA 5KRSA 4DQQA 2WOMA 4PY5A 3M8QB 3NGZA 3OJSA 1QSYA 1CSJA 1Y97A 4IRDA 3LWMA 4PWDA 2OA8A 3P1GA 4TY8A 4B9NA 4FW2A 4R5PA 5KFZA 4DL6A 2PY5A 3AA2A 3L2QA 4O44A 4EZ6A 4K4XA 1L3VA 5KG1A 3A2FA 1T03A 4HUGA 3BQ0A 4FJNA 4Y2CA 3TAMB 3V4IB 1LWCB 1TAUA 4M3YA 3OYEA 4HUEA 4CK2A 3TAQA 1RT5A 3ZT1A 4M42A 3V9ZA 2HHUA 1RILA 1HMVA 3C94A 2VA3A 4Y3CA 1HNVA 5KGWA 4RU9A 3BSAA 1C6VA 3RB0A 3AVCA 1TVRB 1SKSA 3H4BA 1JXEA 3I0SA 3QEIA 3QGHA 5KFCA 4ZP9A 5KFOA 3D45A 2IS3A 2EC0A 2D0AA 3HKWA 4DTOA 3SUPA 4M3XA 3NMAA 3ZSVA 3L3VA 1BISA 4ECRA 4ZPAA 2ZE2B 5DLGA 1JLFA 1Z25A 3SUQA 4FJHA 3TAMA 2F8EX 3VN5A 4J9SA 4OGCA 5KT2A 3QINA 4XIUA 4IG0A 5KI6A 3CFRA 1C1CB 3VQ4A 3KLIB 1VSHA 1MMLA 1S97A 2Z1GA 3DLRA 1C0TB 4O3QA 4R5PB 3CVKA 4CEDA 3OS1A 4TY8B 2OPRA 4TXSA 1ZBUA 3OYAA 1HYSB 2D7SA 2VWKA 4DTPA 3RR7A 4IG0B 3V6HA 2HW3A 4PUOA 4IFYA 3MFIA 4M3WA 2P1JA 3C6UB 5I42A 3HVTB 3SPYA 5I3UA 2BANA 3PX4A 4X2BA 2IGIA 3CWJA 4NLTA 4B9UA 2R2UA 2HVHA 2ZE2A 1LW2B 1FKPB 1FKOB 2YHAA 3OYFA 4DU1A 3QEXA 4CF8A 1J5OA 3KMQA 4OJRA 1SL1A 3ASMA 4N76A 3TANA 4RW7A 3OSNA 1K6YA 2GIRA 4ELVA 1BQMB 1S49A 4LSLB 2DFEA 1TVRA 2C2RA 1A5XA 3PUFA 3UDLA 2XCAA 4RW8B 3BR9A 4M94A 3NF9A 4YR2A 4EYHB 1D9FA 1IKXB 1N5YB 3DYAB 3GV8B 3DRSB 2UVRA 2R8JA 2JEFA 5KFUA 1JLBB 2RF2A 2UUWA 3V4IA 2R8KA 1KVAA 5C5JA 5KFXA 3L2WA 4RW6B 4IKFA 2OPQB 5L9XA 5DQGA 4DSLA 4KI4A 4ZVHA 4ZP8A 3LAMA 1U48A 3UR0A 2IM1A 3Q8PB 1VRUA 3NH2A 3H40A 2Q3SA 3QGGA 1FK9A 3HVWA 2XRIA 4YMEA 2VG5A 4FK4A 2FLLA 2E9RX 3M8QA 3ALYA 3LAKA 3MXMA 3I5CA 2YV0X 4Z4HA 4HTUA 3SNNA 3D28A 2C2DA 3LANA 2FBTA 1IG9A 4FJ9A 1TKXB 3ITHB 1SH3A 3DOLA 5EDWA 1DTTB 1LAVA 4KTZA 4IFVA 4FK2A 5KFQA 1N48A 3DLGB 1S1XA 1BI4A 3AA5X 1LWFB 5J2MB 4U7CA 1EETB 1RAJA 3OS0A 1S6QB 4BDYA 4JS5A 2FVQA 2D41A 2WB4A 3QEWA 4CIFA 2XY8A 2HMIA 4F2SA 4QAGA 3ICLA 4WZQA 1SUQA 1WSJA 3G6VA 1LV5A 2GIQA 2B6AB 3SYZA 4B9SA 2XHBA 3PHEA 4JV1A 3QNNA 1KSPA 3AA4A 1LWEA 4MQ3A 4K8XA 1JL2A 1YVUA 4CESA 5JUMA 4NCGB 5KFLA 3AO3A 1GOBA 3H08A 5CYQB 4FZYA 2BANB 3IS9A 2IJNA 4OL8A 4W5QA 3BSOA 1SKWA 1U49A 1XR7A 4BWMA 3DI6B 5FRMA 1C0UA 2VG5B 3KKRA 3OYMA 2F8TA 3QNOA 3RMDA 2B43A 4NRTA 5DGBA 3V6DB 2B5JB 4NRUA 3M9OB 4QPXA 4CGFA 4NCAA 3GV5B 1U47A 3OYHA 2IM3A 2HB5A 1KFDA 2O5DA 3AO4A 1R0AB 3RAXA 1Z26A 4ZTJA 5F8JA 5HP1A 1UAXA 1WSHA 4KRFA 2OZSA 4DLGA 3OYDA 4QW9A 2ILYA 4FZXC 4DL7A 1TKDA 2G8VA 4FLTA 4RW4A 1VSDA 4TYAA 1HYVA 2JC1A 1RBVA 1QUVA 2DTUA 3LP0A 4WFZA 3PVXA 1RYRA 4EEYA 4DF4A 3HT3A 4ZVFA 1S48A 4F2RA 3IGVA 4OPKA 2OZMA 4JV0A 2YNIB 4E7JA 4CERA 3CO9A 5HBMA 4M41A 1GX6A 1BL3A 3VQBA 4DWIA 1HARA 4N56A 5CYQA 4CJUA 2OPSB 1RT7A 2IC3B 4CGJA 3KK3A 4CEZA 3QZ8A 4G3IA 4YR0A 1LAWA 4CGDA 4O0IA 2JEIA 1LWEB 3TAGA 1Q9YA 3H5XA 1RTDB 4E89A 3HP9A 3H4DA 3SV3A 4F3TA 4O0JA 4EO8A 3LP0B 3HYFA 4UQGA 2BQ3A 1UA0A 2AGPA 4EP4A 1KFSA 3D0PA 2DPJA 1HNIA 3OYLA 1S1UA 4FJIA 4CJ4A 3LDSA 4K4YA 4HUFA 3MR3A 5HP1B 4G1QB 1WSIA 4CJQA 1RTJA 2HNDB 4ZTFA 3HK2A 2YNFA 5JS1A 2OPPB 1BIUA 2FBVA 4M3TA 4ZVEA 3DOLB 2JGUA 4NCBA 3CJ0A 1BIZA 4FJGA 1TKXA 3ITHA 4MIBA 3PW4A 4AHUA 3ZT3A 2BQUA 5J2PB 2B5JA 2C28A 4DTRA 4F50A 3WNEA 3IRXB 4CF1A 4QWEA 3OJUA 3NF8A 4RUCA 1GOCA 4EBCA 5F8GA 2WONA 2X6NA 5KFJA 4QCLA 1S10A 4MKAA 1RTIA 1D8YA 1NKBA 5HRSA 3DM2B 4OKJA 3H98A 3IG1B 4ELUA 4CFAA 4E19A 4KKOB 2KQ2A 3U3YA 5C42B 2RDIA 1G15A 1KCFA 4O44B 3DYAA 2W9CB 4PA1A 4KE5A 4MH8A 4QWAA 5CY4A 3VQ7A 3NL0A 1RT2B 1LW0B 2HMIB 3OY9A 4CJRA 3IRXA 4DL4A 2RDJA 5KFMA 1T94A 4NLOA 3OSPA 3ZT4A 4DL5A 4CIEA 2XCPA 4KSEB 3BJYA 4O4GB 2NUBA 1KLNA 4YQWA 5T14A 5J1EA 3KHRA 3T1AA 1N6QB 3DRRA 4G1QA 2XI2A 3TWHA 1O1WA 1X9SA 5I3UB 3DRPB 4CECA 4CHYA 4FYDA 2QV6A 4CK3A 3V9XA 4HVJA 1ZYQA 1HNIB 5KT5A 4E7LA 3MEDA 3RRGA 1RT6B 3OYJA 4YFUA 3M8PB 3MECA 2AGQA 3OL6A 4CJ3A 3M9MB 1A5VA 3PV8A 2AWZA 3ISND 3AVJA 3KLIA 2XI3A 3IGNA 3M8SA 3JYTA 1EP4A 5DG9A 5E41A 5HLFA 3LPTA 1KRPA 4C8NA 4KTQA 4CF0A 3DLKA 4KB0A 4ID5A 2HWHA 4CFDA 2BDPA 4ID1A 4FS1A 1HJRA 1JLCB 3B6OA 4TSXA 4Q0BA 2V4RA 1TP7A 4DQPA 2KW4A 4F4KA 1ZTTA 5J1EB 4ECSA 2XY7A 4LH5A 4J2BA 2QE5A 1L3SA 4FVMA 4AHRA 3TAEA 4LSLA 3DOKA 5KG0A 1RDDA 4I9LA 1S1VB 3QERA 1U4BA 3MF5A 3NE6A 1F21A 5F8LA 1B9DA 5F8HA 4FK0A 1KVBA 3LP1A 1U04A 1T3NA 4F4YA 1L3TA 2HNZB 3THVA 2XY5A 1NJWA 4IFYB 1Z4UA 2D3ZA 2IAJA 2DY4A 4OGEA 3I0RB 2JEGA 4CJSA 4DF8A 3SQ0A 3V6KA 3H5SA 4LY7A 4DU4A 3PR5B 3L2UA 2IA6A 4HCCA 4KFBA 5KG2A 1TK0A 2IDOA 4NLDA 3NGYA 1RT3A 2BR0A 1TL1A 1W0HA 4J2EA 3ZSYA 4CEEA 3KHLA 2RKIB 3CDUA 4Q5VA 1D1UA 3NHGA 4E7IA 5KFFA 2W7OA 4DTSA 2YKMB 3WNFA 1K1QA 2AQ4A 3EZUA 4R8UB 4WE1B 4IG3A 1D9DA 3T3FA 4J9MA 4OKEA 3ZSOA 4DG1A 1X9WA 1JLBA 3LWLA 1YTAA 4FXDA 2UVWA 1BQNA 3I8DA 3RBDA 4I2QA 1WLJA 2W9AA 1Q8IA 3QLHB 4K4WA 5HRRA 3QZ7A 3ISNC 4ZPDA 3SJJA 3MEEB 1LW0A 1C0MA 3V81A 3NH1A 1ZBIA 1S1WA 1VRTA 4KO0B 5F9LA 1RT2A 3F73A 1S9GA 4K4ZA 4ZPCA 4IH6A 2KZMA 2HHXA 2J6SA 3K2PA 4LH4A 1S6QA 3CJ4A 3TABA 4FS2A 3KNAA 4AH9A 4NLYA 1FKOA 4R8UA 3AVBA 3LP2B 2OPSA 4CGIA 4XO0A 4IDKB 3OLAA 2ALZA 2YNGB 3LPUA 4O3PA 4PWDB 4DFKA 2WRMA 1DLOB 4MFBA 3SCXA 2W9BB 3OS2A 4W5TA 1WNEA 1QSSA 4BACA 3E01A 2A1RA 1TK5A 4XPEA 3KOAA 4WFYA 1RCHA 4B8CA 2IAJB 1UWBB 3HL8A 4OKKA 1K1SA 4O4RA 4IBNA 4I7FA 3NF7A 3NDKA 4BDZA 3ZSXA 3HSTB 4I2PB 1HQUB 4O3OA 4GC7A 3OYKA 2HNYA 3V9SA 1S1UB 5J2NB 3NAHA 3RRHA 3FRZA 4YP3A 1VSKA 3V81B 3MEEA 4XPCA 4Z4CA 5KRTA 2R2RA 4IR9A 1KTQA 2J6UA 1RBSA 4KREA 2DPIA 3KJVA 2HHQA 3OLBA 3NCIA 5F8MA 3PJXA 2D5RA 3L8BA 1UOCA 2QKBA 1S1TB 3KK3B 3NGIA 4NLXA 1IH7A 4RNNA 1TL3A 2X74A 3VQ6A 3KK2A 3HVTA 3GV7B 3E51A 3PZPA 5HBMB 1JL1A 4PUOB 4J9QA 4KHSA 4DL2A 3KLEB 3MR6A 1DTQA 3VA0A 4NLVA 3KLVA 5KFVA 4M3ZA 1I3AA 1TV6A 3I5AA 3I0RA 1HPZA 1HRHA 1QE1A 2V4QA 2EX3A 4Z4IA 1SH2A 2G8IA 1X9MA 5L1KA 2UUTA 1ZETA 4I2PA 4ECTA 1LWFA 3U3GA 4ZVGA 4DL3A 2IOCA 4E1NA 4Z4EA 3CQ8A 4WXWA 1N4LA 5FDLB 3PY8A 3FQLA 3CJ5A 2OH2A 2FLPA 4YNQA 4J9PA 1VSLA 4WYWA 1U09A 3E01B 1XC9A 3CFPA 4QWDA 3PR4A 3QGIA 4JV2A 4KHNA 2FJVA 2F96A 3KD5E 3MR5A 4BE0A 2ZKUA 3I5BA 4OVLA 2E6LA 1VRUB 4ICLA 4CCHA 4NLGA 4AILC 4CJLA 1T7PA 3KD1E 1QS4A 4FBTA 4CIGA 1FXXA 3L2RA 4J9RA 3MXIA 3MEGB 1T03B 3CFOA 1RTHB 3RTVA 1NOZA 3PO5A 3AVNA 4NLWA 3VQCA 3F9KA 2YNHA 4H4OA 5KT6A 4NYFA 4NYZA 4J9LA 2YKNB 4ZP6A 3O3HA 3EYZA 4KO0A 4Y1CA 4DFMA 3VQSA 1RT6A 2CKWA 3AVAA 1S6PB 5J2NA 3AO1A 2XWYA 1BQMA 5DMRA 1D5AA 4C8KA 5KFRA 1NK5A 3CIZA 1N6QA 5CZ1A 4J2AA 4I7FB 1WSGA 3QETA 1JLEB 2YNFB 1VSMA 4NLRA 2VWJA 4CK1A 3S3NA 1IM4A 4CHZA 1IKYB 4F4XA 4KV8A 4KHMA 2RKIA 4Y34A 3NAIA 4CF9A 4AHCA 1JLGB 3V1RA 5C24A 1XHXA 1XI1A 1NJYA 1QE1B 4O3NA 1TV6B 1DLOA 4ZP7A 2G8FA 3JSMB 3DMJB 2W9CA 4MIAA 2BRKA 4RNFA 4CEQA 3LP2A 2AU0A 2OPQA 3K58A 4E1MA 3O4NA 3SQ2A 2O4IA 4DFJA 4Y2AA 4HKQA 4FM0A 4CJ5A 2ATQA 1TKTB 2RF2B 4W5OA 4ECWA 3QYYA 4E3SA 4KHRA 3DRSA 1IKXA 3CM5A 1D0EA 4RNHA 1S9EA 4JRQA 4B9TA 2YNIA 4WZMA 4MKBA 3M8RA 4EBEA 1S1VA 1JLQA 3DOKB 4FBUA 3KTQA 2G8UA 3OL7A 4I2QB 4FLVA 1OS5A 1RT4A 1W25A 3HPHA 2AGOA 1HMVB 1QQCA 1ZTWA 1WNSA 3HVRA 3B6PA 5C25A 4Q8FA 3VQAA 1CXUA 5L1JA 5T7BA 2W8LA 1YVFA 4GC6A 2OPPA 2P5GA 1FKPA 4M3UA 2RN2A 3QIOA 4K4VA 1NK8A 1WN7A 2GC8A 4RUAA 5DK5A 1RDRA 2CJQA 4DQIA 5D3GB 4EP5A 1RT3B 4HYKA 4IH5A 3BREA 2LSNA 5DQHA 2JEJA 1BHLA 1IO2A 3LP3A 4B9MA 5KFEA 1C0TA 4CEBA 1S5JA 1A5WA 2HHVA 4IR1A 2KTQA 5KGXA 4NZ0A 1TK8A 4ELTA 4RNMA 1S9FA 4CEAA 3NBPB 1T05A 4JLHA 2C22A 4NYNA 1JLFB 2O4GA 3NH0A 2VG6B 4DSJA 1QHTA 2ASDA 4N41A 5DQIA 1ASVA 2IM2A 3KK1A 4ECXA 5C25B 4IRCA 1GOAA 3L2VA 4MK9A 4QOZB 3UPFA 4KB1A 4NLQA 4CHOA 4E0DA 1C1AA 4ECQA 3G6YA 4RW9B 3FFIB 3BSCA 4URSA 4B8AB 1SUQB 1QAIA 4DQRA 1ASWA 1B9FA 3C95A 3KLHB 4FJJA 4JS4A 3DLEA 3C6TA 2XGQA 2YKNA 1GX5A 4K4SA 1IKVB 3K59A 1BQNB 2HHWA 3N6NA 4DS4A 3RBEA 2FVSA 3V1OA 1TKTA 1S1XB 3OHBA 2HAIA 1BI4B 2G8WA 3MFHA 2ZD1B 2GV9A 4IRKA 4CE9A 3MEGA 4TQSA 2PYLA 1NK6A 3SQ4A 4Y1DA 4FW1A 4DSEA 2Y1IA 1X1PA 4FLYA 1NK9A 3VQ5A 4BE1A 2G8HA 3NKYA 4O55A 4ED0A 2R8HA 4L8RB 4BWJA 2ETJA 4K4UA 4W5NA 1J54A 2W9BA 1NK4A 4ED7A 3UIQA 4NLSA 1JLGA 3SV4A 3BGRA 2WOMB 4KV8B 1IKYA 1XR5A 2F8SA 4IDKA 4B3OA 2D3UA 4H54A 3NGDA 3KLFA 1NKEA 2E9TA 2XGPA 3HXMA 4ZHRB 1ZBFA 4CHQA 1BGXT 1ASUA 2ZD1A 1S0MA 4J2DA 3PO4A 1HYZA 3CYMA 1MU2A 5KFPA 4FM2A 2PZSA 5EWFA 4I9QA 3OL9A 4FLZA 1S6PA 5JXSA 2B6AA 4DTNA 5SWMA 2GBZA 5KTQA 3AVKA 4RW8A 3FQKA 3AVIA 4IQXA 3FFIA 2C2EA 2KZZA 4CHPA 3M9NB 3OYBA 3AVLA 1JIHA 2ASLA 3EZ5A 1RTDA 5KG5A 2YNHB 5JS2A 1EETA 4TN2A 1MU2B 1CZBA 5KG3A 2BE2A 3RR8A 1JX4A 3T5HA 3CG7A 4KKOA 3GIIA 4NLPA 2YHBA 3K5LA 4WE1A 2G8KA 3V1QA 1ZBLA 1T8EA 1JLCA 4CJFA 3DLKB 3MTKA 3C6UA 4ICLB 5HLFB 1RTIB 4U6PA 4FZZA 3TAFA 4QWBA 1WSEA 4N47A 3ZT2A 5L1IA 3PW5A 1FK9B 3CDEA 4KTWA 1RBRA 4KHQA 1SV5B 4AHSA 4RZRA 3MECB 1UA1A 5J2QA 3TR8A 2P51A 4KI6A 3T5LA 1VK0A 3KLGB 1NNDA 4K4TA 4LSNB 3V6JA 2D0BA 4GW6A 4QW8A 1WSFA 4ECZA 3NAEA 4KPYA 4O5BA 3KMSA 2GUIA 3GYNA 3LP1B 4DS5A 3C6TB 3RB4A 3BQ1A 4DLEA 1BCMA 4O3RA 1EX4A 3CJ2A 4EYIB 5KFBA 1XWLA 4H8KA 4KHWA 4DTMA 1C0UB 3SI8A 3KIOA 3WNGA 3WNHA 1RYSA 3VQQA 3K57A 1RBUA 4TYBA 5FROA 3NFAA 5CZ2A 2EHGA 4KAIA 1NKCA 2AX1A 2V9WA 3HJFA 3Q8SB 5L1LA 3GILA 1JKHB 4ECUA 3CJ3A 4WXOA 1HYSA 5SZTA 4KHUA 4DSIA 1NHVA 3JSMA 2FBXA 3RMAA 4OPJA 4F3OA 1QTMA 2FVPA 4F8RA 5C24B 4FJ7A 4DSKA 1TGOA 5J2PA 2JLEA 4HHTA 4ECVA 4JUZA 1HQUA 3SQ1A 2XC9A 4FJ5A 5KG7A 1WAFA 4WYLA 4LSNA 1JLEA 3DLBA 5HROB 4IFVB 3EPIA 4IG3B 1SL0A 4ZHRA 4DMNA 5KT7A 3O3GA 2AJQA 1UWBA 3K5NA 3G86A 3OHAA 4CFCA 3MXJA 2R8IA 1SV5A 3I0SB 1JLQB 3RAQA 3V9UA 3ZSRA 2WTFA 4Q44A 1TL1B 2FJXA 2UVVA 3AVMA 1S9EB 3QESA 1NOYA 4CGHA 1HQEA 2I5JA 3TQ1A 4H4OB 3SZ2A 5KG4A 3S3OA 3AO5A 1KHWA 5C42A 4ED8A 2Z1HA 4KBIA 3H59A 3T5KA 1RT7B 2IC3A 3GIMA 3N6MA 4TQRA 2BE2B 4CFBA 3G6XA 2HNZA 4JRPA 2QKKA 2I5JB 3QEPA 1NK7A 3Q8QB 3O3FA 3ZSQA 3HO1A 5KFTA 2KFZA 1IKWB 5HRPA 2FVCA 3AVHA 3OYCA 4CGGA 4URQU 4J9OA 3VQEA 4ZPBA 3S9HA 4FJXA 3DLGA 2A1SA 4RW4B 3ULDA 5HROA 5KFSA 3V9WA 4E7KA 4TY9A 1REVA 1VSFA 1LW2A 3RB3A 2VG6A 4Q0BB 3OYIA 4F4WA 1C1BB 2IBKA 3LZIA 3TI0A 4K8ZA 5DLFA 4M95A 1T05B 4URGA 1CXQA 5DG8A 2HWIA 1Q9XA 1S4FA 1R0AA 1VSJA 2X78A 2P5OA 2QXFA 3DLHA 4Q43A 3QIPB 4M45A 3AV9A 4Z0UA 2FBYA 2OPRB 4RG8A 4KFBB 4YR3A 4R0EA 3V6DA 4LQ9A 3ZCMA 4RNOA 2ATLA 4DU3A 2DFFA 3M8PA 3AO2A 1I39A 3K5MA 3MAQA 1C1CA 1TAQA 3U6FA 3MEDB 1J9AA 4C8OA 1RTHA 5D3GA 3HP6A 5KG6A 3IS9B 2IMWP 2Y1JA 3KK2B 4J9KA 2R2SA 1TL3B 3SFUA 4DFPA 1WAJA 4C8MA 1CLQA 1RDAA 3CM6A 3T19A 4CJVA 3VQDA 4HCBA 1RDCA 3DLEB 5K14A 4ED6A 1NK0A 4E7HA 4BE2A 4FLXA 2HHTA 3SUOA 1YTUA 1XR6A 4Q8EA 3PJWA 3L3UA 2BRLA 1HNVB 4LD0A 3S3MA 4EBDA 2ZQBA 5KT3A 3HPGA 4ED2A 3RB6A 4EZ9A 1TQLA 4FJ8A 4FCYA 4EO6A 3GQCA 3PX0A 2W42A 4F4ZA 1RNHA 3IG1A 2I1RA 2UVUA 4B9LA 2W8KA 4FJMA 4Z4FA 1U45A 5J2QB 2HHSA 3VA3A 4H4MB 4B3OB 4DTJA 3DMJA 1L5UA 5KFKA 4TLRA 3BGRB 5KFAA 2KFNA 3RMCA 4MFBB 4IH7A 5KFDA 3H2LA 1NJXA 2E6MA 1JLAA 2E9ZA 2WK4A 2HVIA 1J53A 4J9NA 3DRPA 3BDPA 3QIDA 1C1BA 4KAZA 4RW6A 4Z4GA 4OLBA 3Q8RB 3O4QA 4QWCA 3SPZA 1RTJB 2HNDA 2VA2A 4K50A 3SFGA 2ITGA 4CJPA 2DFHA 1RT4B 1RT1A 1N5YA 4AHTA 1C2PA 1TKZA 3HPOA 5F8IA 4LQ3A 4DEZA 3G0ZA 5KFHA 4RW9A 3UQSA 1RT5B 1RT1B 2D0CA 5J2MA 1EXQA 4CJEA 1KHVA 4MK7A 3TVKA 4CJTA 5FRNA 1RBTA 3BQ2A 3RMBA 3SI6A 2YKMA 1JXBA 5KT4A 3ZT0A 3KLFB 2Z1IA 3QO9A 1KLMA 2Z1JA 3AA3A 2IJFA 2FLNA 3QEVA 3TARA 1SKRA 3HVAA 1B92A 2WONB 2FJWA 4CJWA 2W7PA 4DQSA 2BGGA 3QO9B 1S0OA 3G10A 1W9HA 2FC0A 3LALA 2ILZA 4ZMMA 1L3UA 3VQ9A 4OLAA 1SL2A 4C8LA 4FLWA 3KLGA 4WFXA 1XHZA 1S9GB 5EWEA 1TKZB 5KFYA 1HPZB 5KFGA 2BQRA 2VG7B 1KVCA 3OYGA 3KHHA 1BCOA 4CEFA 1QAJA 3FDSA 2WCXA 4KB7A 4RW7B 5K14B 1VSEA 4O3SA 3GIKA 4GVMA 5DG7A 4DG1B 3KLEA 1J5OB 3DI6A 4GMJB 4AHVA 4N5SA 5CYMB 3SUNA 1JKHA 3KK1B 5EWGA 4M3RA 2E4LA 1JXLA 2OYQA 2J6TA 4IKAA 1RDBA 2AX0A 2R8GA 1S0NA 4ID5B 3OL8A 3OVNA 4NCGA 5I42B 1S1TA 2WHOA 1RA7A 5CYMA 1SH0A 3KJVB 1JLAB 4IOBA 1RA6A 2XY6A 4FM1A 3AVGA 4Q45A 4H4MA 2VG7A 3AVFA 1VSIA 2X6SA 1EKEA 5FDLA 3H5YA 4B08A 4PQUB 2JC0A 3VQ8A 2PYJA 2QK9A 1ZBHA 3IN5A 4CEOA 3H5UA 3EY1A 3T5JA 4FJKA 2RPIA 4PQUA 3VQPA 2ASJA 4O4GA 5EUHA 3P83D 3OYNA 1QSLA 4DSFA 3PW0A 3BSNA 3LZJA 3CDWA 5HRNA 1DTQB 1I6JA 2XO7A 4ECYA 5DGAA 1IKWA 4B9VA 3HHKA 5F9NA 3EPGA 4BDPA 4CJKA 2YNGA 1KLMB 3IAYA 4DTXA 1LWCA 4CF2A 3N6LA 1N56A 5F8NA 2R2TA 3PX6A 1EP4B 3ZSZA 4W5RA 3JYTB 1YT3A 4KHYA 2FVRA 3DDKA 3DM2A 3FSIA 3ZSWA 2IM0A 1HQEB 1IKVA 1CZ9A 3D5MA 4MK8A 5KFWA 1S1WB 1VRTB 3KLHA 3NF6A 5KFIA 5KFNA 5EU7A 3PW2A 2R7YA 3QIPA 3QLHA 4FJLA 3RWUA 2HNYB 4FLUA 3PW7A 4ED1A 3K5OA 3DRRB 1REVB 3MR2A 2V0NA 4ED3A 3HM9A 4NLUA 1DTTA 2B4JA 3P5JA 1NJZA 1NHUA 1ITGA
chains in the Genus database with same CATH superfamily
3TAPA 3R7NB 1XK8A 3TZWA 1V3RA 3HLUA 3KKSA 1NGFA 4YHHF 3OBYA 1WELA 4PY5A 2ABYA 3BY5A 2ACMA 1CSJA 3FUYA 1U1KA 4DX6A 2F1FA 4B9NA 1E6VA 1GLCG 2PY5A 3CEDA 2HFNA 3H42A 4F9OA 3A2FA 2YX4A 5AE2A 1T03A 4HUGA 3GIRA 3V4IB 2J7UA 3G82A 2HLUA 2DITA 4ZVPB 3G2XA 4M42A 5ADXH 1I94J 3A3PB 4FXWA 4CLKA 1D8ZA 4CRJA 4B3TJ 2OUGA 2HHUA 4MYUA 4X64J 4RU9A 3BSAA 1C6VA 3RB0A 1SKSA 3VZHA 1JXEA 3I0SA 1NGIA 5KFOA 2IS3A 4OPAA 5DZ6A 3J7Z5 4DR3J 4DV6J 2D0OA 5E26A 3UKRA 3L7PA 4ECRA 5DLGA 4HLBA 2CQ4A 1FNXH 3HHNB 3TAMA 2F8EX 4DB3A 3CFRA 2JOQA 4P10A 3KLIB 4WFBQ 3SQGA 2O8DA 1M0SA 1CVJA 5HOOA 2DNYA 3D2EB 4R5PB 5AR0A 1PBAA 4TXSA 1ZBUA 3OYAA 4ILGB 2D7SA 2NSBA 4DTPA 3RR7A 1YZ7A 2XS2A 4PUOA 3MFIA 4M3WA 3QRRA 3SPYA 2LXIA 4Y65A 1BUXA 4PXEA 2ZE2A 3DFEA 1N5SA 4DPUA 2DNRA 1FKOB 1NBEB 1QD1A 3PHTA 1W2BR 1SB6A 2AZ1A 3KMQA 1SL1A 4RW7A 2L08A 3P31A 1WBDA 3SJHA 4GKJF 2M8HA 4DV0J 1YRTA 3PUFA 2C1EB 1Z2LA 3BO2A 2XCAA 3GMGA 3BR9A 4M94A 5C2DA 2HBKA 4YR2A 2JNJA 1D9FA 5G4DA 3TZYA 2CPHA 2Q6CA 2Q1LA 4DUZJ 1IKXB 3DYAB 3AODA 2R8JA 5BJRA 3THPA 5KFUA 4KH6A 2R8KA 3HDSA 3CD6N 3JS6A 2LEPA 3LOUA 4IKFA 2PA3A 4ZVHA 3G4SN 4V1Ak 3PYGA 3LAMA 3I9V9 4CW7B 4B17A 1VRUA 3HFVA 3H40A 2M3DA 4PXCA 3ZETA 2X51A 2FLLA 4LFBF 2VFVA 3M8QA 2F3JA 3ENQA 9ATCB 3I5CA 3MXMA 4R25A 2YV0X 1KONA 1QHAA 2FBTA 1IG9A 1SH3A 1RAIB 4KTZA 3CCMN 1LAVA 1F1BB 2GHPA 2DNLA 4ISGA 1VS3A 3R6LB 1S1XA 3PRDA 3LDOA 4WK3A 3AA5X 2VQFK 2NXEA 1S6QB 4CVNE 2E44A 2D41A 1P8ZA 3QEWA 2RUGA 1Q86T 2HMIA 2HBYB 5GAHU 3OTEA 1H2VZ 1SUQA 3SDEB 2B6AB 3LGNA 1KSPA 3AA4A 1Q82O 1JL2A 3MPYA 3MEKA 2VODA 3QMQA 1VQ6N 2EFNA 5JUMA 1F2GA 3AO3A 2Z56B 3FEXB 1E6YA 1BWVA 3CJ9A 1V3SA 5CYQB 2BANB 3IS9A 4ZJQA 3PNIA 3T6JA 3DI6B 5FRMA 2VG5B 1N32J 3KKRA 5M1QA 2F8TA 3NCPA 1T44A 3QNOA 4F7VA 3PJ9A 2B4UA 2OKQA 2HBMA 1RAGB 2ZGZA 4FL9A 5JJBA 2AJ0A 5AQYA 1UW9A 4M5IA 2CVEA 4CNZA 4BRNA 2XLIA 1AYEA 2VD3A 3M2VB 1UAXA 1WOSA 3LGHA 4KRFA 4DLGA 2HSTA 4ANEA 1JJ4A 5M2RA 1VSDA 4C0BA 2AEFA 3IC1A 4PYAA 2JFKA 2O1PA 3C3LA 4IO8A 2DTUA 3LP0A 2CA9A 1YI2N 2YH0A 1S48A 4F2RA 4OPKA 1NUEA 3TJ9A 4CERA 1SIWB 3E2EA 1W7AA 5HBMA 3CC2N 1QVFM 1HW8A 5H1SV 4N56A 4JOUA 3MX5A 1Q86O 1RT7A 2ROPA 4J37A 4CGJA 3UDCA 4CGDA 4KJIA 3FZLA 1Q9YA 1BC6A 1BE4A 1U26A 4E89A 2V51B 2FUG9 3SV3A 2YWWA 4O0JA 1GMWD 3K7RA 1KR4A 3TEHB 5CHIA 1YIJN 5A2QU 3UN3A 4EP4A 5IQ6A 3D0PA 5CA5A 2DPJA 1HNIA 4HUFA 1NPPA 5A8WB 2W2QP 3MMBB 2HVDA 2DBBA 2PBDA 4N8OA 4ENOA 1RTJA 4CD1A 4IDHA 3U1MA 4AM7A 4NCBA 2DNQA 1TKXA 4U9RA 4AHUA 4WP9A 1HBMA 1N52B 4NZ7A 4WFNL 1QAYA 2KG1A 3WNEA 3IRXB 5F0XA 5LMNK 2APOA 3NF8A 4EAHD 4FKYA 1NM1A 2X6NA 1S10A 2DH7A 4MKAA 1D8YA 1EJ7L 3W9IA 2N7CA 1E4GT 3VHQA 4E19A 3A0IX 2MQMA 4JI6F 5C42B 2MEWA 3W7BA 1W7WA 1KCFA 1RE1B 4DN0A 2BUNA 4MH8A 5CY4A 5FPDA 2LU2A 2PC6A 3NOGA 3OY9A 3O08A 4H0OA 1R8BA 4JI4K 3ZT4A 3K8WA 2E5GA 4JKGB 4OZ1A 1OMSA 3I9ZA 3J80U 2QFJA 2QYGA 3IM8A 3D2WA 4ISEA 3T1AA 2ZH9A 4G1QA 3TWHA 1GT8A 3J7YU 2EK1A 4WWSA 4FYDA 3V9XA 1ZYQA 4HVJA 4LRCA 3RRGA 4PZVA 3S7RA 2JDJA 3O44A 3OYJA 3EXYA 4L6V3 1MW7A 2IVYA 2LQJA 3CD0A 2CZ4A 2XI3A 3M8SA 3QQCD 3N01A 3SMZA 2DD8S 2DGSA 1KRPA 3LPTA 4KTQA 4CF0A 4DUYK 3VAMA 1JLCB 1DEJA 3ELHA 1IN0A 4DQPA 4ECSA 2XY7A 2FPHX 1WG1A 1NGDA 2CIMA 4J2BA 1L3SA 1A7GE 3UE5A 2DNHA 2VHGA 1NJIO 3OFFA 3QERA 4LF4F 4FF4A 3U9DA 2HQCA 3OR1B 3R1HA 1QQNA 1F21A 4FYYB 5HANA 5BYRA 3ZC4A 1KVBA 1U04A 2FB0A 4MKYA 2DGXA 2IRUA 2XY5A 4IFYB 1LWXA 2FHOB 1KC8O 2MZTA 2CNOB 2QGFB 5KG2A 1QUPA 3TNVA 1TK0A 4NLDA 2ZWPA 1TL1A 4PHTX 5ETTA 2FGCA 3ZSYA 4CEEA 2B8QA 3KHLA 3C6HA 1Y64A 4Q5VA 3VF0B 5ETRA 2ZH6A 3NHGA 5AFUH 4U7BA 2W24A 3A1YG 3WNFA 3EZUA 1RUSA 5C10A 4IG3A 2XMJA 5CCMA 4M5HA 3ZTQA 2KL8A 2VBZA 2FXUA 1JLBA 3LWLA 4FXDA 1FWLA 3AOAA 2AJFE 4JHDB 1V5IB 3CCUN 1BQNA 4DZDA 4FXVA 1WLJA 3LA0A 2W9AA 2ASMA 4GKJK 5T7LA 3SJJA 1ZBIA 3V81A 2DT9A 2A10A 4K4ZA 1RWOB 2J6SA 1WBBA 4P7VA 3L09A 3DLLQ 3PRBA 2IRXA 3TABA 3EZOA 3IP0A 1H3DA 1OSCA 5IS2A 4H5WA 1WWHA 4FVCA 2NRWA 3FC9A 2CWXA 4CGIA 1FRHA 4IDKB 4DV4K 5IV4A 4Z7YA 2R7XA 4BY9C 3DLLL 4OO1J 3OS2A 3FGVA 4W5TA 4NYOA 1QSSA 3IR5B 4QQBA 4BCAA 4RTFD 1Q18A 1TK5A 4K7QA 3MCSA 1IBLK 4IEIA 5H9EJ 1RCHA 3U8XA 2IAJB 4NMXA 3N4QA 2BH1A 2CH6A 4I7FA 1ZM9A 3NF7A 3NDKA 4BDZA 4BLGA 5M1FA 2Q0RA 1T9XA 3C46A 2QWRA 2WVBA 1NZAA 4GC7A 1HNWF 3J80Y 2PI5A 3RRHA 5IT9Y 2CQHA 2HAFA 3SSQA 1FJ7A 4NXNF 2VJVA 1YHQN 1ESVA 1FJEB 3DDIA 2P6SA 2R2RA 3HD1A 1VQMN 5K8PA 4IR9A 1UJ5A 1O5JA 4X4RA 2V67A 2LFVA 3WEEB 3B82A 2CADA 1VQ5N 2VOPA 4KGZB 3RVCA 5F8MA 2DY9A 2KRRA 2GAHC 3KK3B 4NLXA 2GUPA 4JI1F 2NXUA 1TL3A 4CBXA 5FPEA 4FN5A 3KK2A 2ZHBA 3GV7B 5E3PA 3PZPA 4C0OC 5IQQA 4KHSA 1I1GA 4K5RA 3R3TA 3KLEB 1QZ6A 2E8AA 1WI8A 4J9UE 3QAEA 2N4CA 2Q1NA 4KIAA 3SDEA 4M3ZA 4JI0K 3I5AA 3I0RA 3NS5A 1U1PA 1WHXA 1QE1A 3AQPA 3B4MA 2CNKB 3OPKA 3CMEN 4CYUA 1SH2A 2E7WA 1VOMA 3RSEB 3S41A 5DM6Q 2UUTA 5SUHA 3HULA 1FX4A 1Q82T 1P27B 4JKHA 3CQ8A 2E1CA 4HT5A 1H2UX 2UXCJ 1WF0A 3HD2A 2DGVA 5FDLB 2CFXA 2H3GX 2OH2A 2KJWA 4YNQA 2F9TA 4BRKA 1NGJA 2VYPA 3T1YF 2F7VA 3CJQA 4DV7K 5CH7B 3QGIA 4JV2A 4KHNA 2F96A 3KD5E 2ZKUA 3I5BA 4EUVA 1RCXB 2MQNA 2E6LA 2VQEF 1VRUB 2V68A 5BR9A 1RQ0A 3KD1E 3HFKA 3VETA 4JD2A 4CIGA 1S6UA 2EFPA 3M8YA 1RTHB 3O1LA 3ZFVA 1NOZA 3VQTA 3BPSP 3WEEA 2YNHA 4H4OA 2R7TA 3CD5A 4NYFA 4JI5F 4NYZA 3C2PA 3ID6A 1ILYA 2FZCB 1KQSR 1GTEA 2IIRA 4DOZA 3AO1A 5DMRA 4ZCLA 1KOOA 3G9CA 4C8KA 3HX9A 4BHQA 4I7FB 3QETA 2YNFB 3DGPA 1UWAA 4K5SA 1U0HB 3GBTA 4NLRA 4CHZA 4F4XA 2HHPA 3V1RA 3TTDA 4XH4A 1QE1B 4CT9A 1NHKL 2FSJA 1XBWA 3FZHA 3SK3A 2CXEA 4QS8A 2ZVSA 4UQTA 2HFVA 3GG0A 4RNFA 2OFHX 3DXMB 4CEQA 1Y00A 5CXTA 3OXGA 2OPQA 3K58A 2BEFA 2BJ1A 4KYZA 3CCWA 4M5NA 2ATQA 3UNGC 3CC4N 4E3SA 3DRSA 3CMAS 2RVJA 4IOXA 1HWIA 2YNIA 2XMMA 3M8RA 3OR1A 4IEEA 4OHWA 1GTHA 2W2OP 1QQCA 1Q79A 4JI3J 1VQ6S 3BZQA 3U9ZA 5C25A 3ZTOA 1YVFA 4GC6A 1W97L 2RN2A 1NB2A 3QIOA 2NRVA 1NGCA 1NK8A 2GC8A 4YB7A 4CTAB 4NA3A 4Y28C 4D3HA 3CCJN 1CG2A 4MDBA 1XNQF 4XDDA 4NO7A 4FP9A 1YUWA 2GV1A 2XNQA 3U7JA 3M05A 1VFJA 5DQHA 4B9MA 1BHLA 3LP3A 2F4FA 1EO1A 3VGKA 1CJUA 3ENVA 3FMWA 2UUBF 1A5WA 1I3OB 4DV2F 4OYPA 2HYIB 4DV5F 1KVIA 1OVYA 4MO4A 4CZGA 1S9FA 5LMNJ 4JLHA 1JLFB 5ETSA 1ZPWX 5HO4A 1VQSA 2GHVC 4ECXA 2EPIA 3L2VA 4MK9A 1C1AA 2Z58B 3CCQN 4ECQA 5HVHA 4U67Q 1EWRA 3G87A 3H8YA 2X1AA 4FJJA 3DLEA 2XGQA 1Q95G 4DPOA 3K59A 1BQNB 3FK4A 2RB7A 4IUFA 2G8WA 4B3MF 2ZH3A 2BW7A 2J9EA 3WQPA 2B56A 4CH1A 2MKCA 2Q79A 1RDWX 3CCEN 1X1PA 3OHRA 3W63A 3O6QA 1XNRJ 1X4FA 2R8HA 3PYEA 4BWJA 5GAEP 1U2VA 4ED7A 4LF7K 4H54A 2IVNA 3KLFA 4ZN1A 5CYJA 1NKEA 3CCLN 5BR8J 1B0TA 3PSFA 3A8JA 4CHQA 1HNWJ 1ASUA 1M90T 3PO4A 2IHR1 1HYZA 2X1BA 2B4VA 2W40A 1NDCA 5KFPA 4USMA 3J81j 4B3SF 2UUCF 3X1LB 2FZGB 1S6PA 4DTNA 3CXCM 4WF9Q 5KTQA 4RW8A 1V5VA 3LPEA 4M63A 1VGYA 2ZM6K 1YLXA 3QAUA 1EHWA 3CJCA 1HWKA 2BE2A 2C2NA 1YSJA 2C3PA 2G2OA 4Y2MA 2DISA 2VFSA 4NLPA 2YHBA 2L9NA 1T8EA 1JLCA 3TUZC 1PYSB 4C4WA 1MG7A 4U6PA 4FNIA 3TAFA 4A5AA 4WCEL 1T3VA 3ZT2A 4DV4F 2COLA 3O8WA 3CDEA 3UN5A 4QYZK 4OIXA 1RBRA 4KHQA 2RU9A 3B54A 2MYFA 3H90A 1UA1A 5BREA 5J2QA 3TR8A 2P51A 2VOOA 3N4PA 2PA8D 3O80A 1U1MA 3GB0A 2ZH8A 3KLGB 4OHYA 3T9NA 2D0BA 3G6ES 3HF5A 1ZAVA 1VQPS 4X62F 3K0SA 1S22A 3KMSA 3GYNA 3KWIA 2U2FA 3E9LA 2FSKA 1MROA 4LUBA 1BCMA 1H7WA 5GIPA 3P5BP 4IZ9A 3T69A 3TA2A 4EYIB 3BBCA 5KFBA 3SI8A 4LJMA 1KQKA 2MQQA 2ZEJA 4OI4A 5HL7Q 3G8TA 4UTGA 2DHSA 1RBUA 1VAZA 4FZVA 4LFBK 4TYBA 1B7YB 2A5XA 2AX1A 3J7YP 3Q8SB 2RS8A 5F41A 3TTCA 4HDHA 3CJ3A 3BO3A 5ETOA 4QIFA 3M6GA 4WXOA 5HSPA 1HYSA 4GRSA 3QATA 2OMLA 4A61A 1AZSA 2UUAF 4DSIA 1NHVA 4TVAB 4BGBA 4F3OA 1QTMA 2FVPA 5MLCQ 4FJ7A 4OZNA 4YOYA 4ECVA 4LF5K 7AT1B 3OXLA 2XC9A 3RW6A 5KG7A 2KYZA 3BF1A 3FVYA 2P9IB 3O3GA 2YWHA 2AJQA 1XJWB 1Q53A 3VWSA 3I55N 2R8IA 4B1ZA 1UZHA 3GLJA 2WTFA 2UVVA 1X8DA 1OY8A 3RZAA 4ETXA 2GVZB 3ZETB 1ACMB 3NY0A 2LLZA 1F9EB 4CGHA 3J7YI 2I5JA 4H4OB 1AFIA 3S3OA 3AO5A 1KHWA 2XZDB 3L4QA 4WFNQ 2Z1HA 4YOWA 1B7FA 4FPIA 1RT7B 3GIMA 1UKUA 2AJ4A 3G6XA 3TW0A 4YB1P 1OH7A 3HJVA 4JRPA 2GTDA 2B9XA 1NK7A 4AL6A 3HO1A 3MDQA 4JI7J 2HKEA 2W2NP 1LKZA 2Z2ZA 1IBLJ 3PSIA 5BR8K 4LRBA 4OI6A 5IT9O 2EFGA 4CGGA 4URQU 4WIQA 4CLSA 4J9OA 3VQEA 4ZPBA 4K41A 1CBKA 2DCUB 2IDEA 1C0GA 2J9DA 1V3ZA 2C3YA 1LXJA 2HMPA 2CQ2A 1X7VA 3SAGA 1C1BB 3LZIA 1RAAB 4UT4A 4M95A 2L9DA 5DG8A 4CLYA 3CJBA 3TTFA 4PABA 1YKWA 1AFJA 3O8MA 4WK1A 3K9KA 4CO4A 4KFBB 5L9NA 4R0EA 1H72C 4CO2A 5AQIA 4RNOA 3KHYA 4DU3A 3I4PA 2DFFA 3D6FB 2A3ZA 4OYBA 3K5MA 1BO5O 2OSQA 4RBVA 1J5EJ 2DEJA 3HHLA 1TAQA 1RTHA 5D3GA 4FWKA 3HP6A 4FWQA 5KG6A 4HTJA 3IS9B 4X4UA 3KK2B 4J9KA 4JI2J 3FZ2A 1TL3B 1RWNB 2IMOA 1PC5A 3UKRB 1RDAA 2RT3A 2P9NB 3CM6A 2WSCC 4YDXA 7FDRA 3UE2A 4YUDA 1K44A 3M30A 4ED6A 1NK0A 1KD1O 3BYRA 4Y2KA 4F02A 1SQEA 1PJ6A 5GMEA 2G1HA 1XR6A 5ETKA 4Q8EA 2BRLA 3GJTB 1VQ9N 2FDNA 3CCRN 4EBDA 5KT3A 4RWXA 3RB6A 1REGX 1WUUA 4YDUC 4EZ9A 3M6UA 2QM1A 4KH0B 2HSEB 5A0YA 1RCOB 1SC6A 2CQ1A 4P9SA 1XMQK 2CNLB 1MN9A 5EX0A 3SCKE 3VGTA 3CPEA 5K8OA 4CLLA 3QJJA 5EN1A 2I1RA 3HHLC 2VBXA 4Z2XA 1HNZJ 3THXB 3DC2A 3CD7A 1GMWA 5CE3A 4DTJA 2P9UA 5HMXA 2CDRB 1BHNA 3GE1A 3SIPB 4TLRA 5KFKA 1ZM4A 4DR3K 2Y3YA 5KFDA 3W9JA 2E6MA 1JLAA 1RLCL 2E9ZA 3QFWA 1UZDA 3BYPA 1J53A 3DRPA 3FR0A 4OZ5A 3QIDA 2GO8A 3KYLA 3O4QA 1RZMA 4QWCA 2HNDA 1IR1A 1WB9A 3ULEB 2X1GA 4DPTA 2O8EA 4DV7F 3T9ZA 3D0IE 2HF3A 1C2PA 2L9WA 2V8GA 3MM9A 5KFHA 4RW9A 2WVDA 4JHDA 5J2MA 1SQFA 3D0HE 1EXQA 3GZ7A 3UB5A 1YF5L 3EXCX 3JB9k 1FE4A 4M5DA 4LFAK 4WTYA 3BQ2A 3RMBA 3MM5A 5GAGI 2AZ3A 1N0UA 1UAWA 3AH6A 4J90A 2PAVA 3AA3A 3TARA 1LOTB 1B92A 1IR2A 2QO3A 1UVMA 5KQDA 3W2VA 3P45B 4HL9A 1Q7LB 3D2EA 1S0OA 3CUNA 3FBCA 2HFSA 3KUHA 4ZCKA 1IBMJ 2CQ3A 1X4HA 1SPBP 1TUUA 3DU5A 3FMBA 1YK9A 4OLAA 5IC6B 1SL2A 1URNA 1UVLA 3CERA 4P2MA 2OEJA 3D9BA 4MKVA 3QBWA 1ULRA 5EWEA 1TKZB 1HUXA 1GQEA 2NREA 4FF1A 2PSZA 1WSVA 2VG7B 1EQMA 3M2RA 1WI6A 1KVCA 4CEFA 3VAGA 2E5LK 4ES2A 4O3SA 4GVMA 4B1YB 4AHVA 2RD5C 1YWXA 1JKHA 3KK1B 4CZIA 1S0VA 3J80O 4DV7J 1WTBA 4M3RA 4CZHA 2E4LA 3VEYA 1JXLA 2DGTA 2J6TA 3MMCA 4ILJA 2IIHA 2AX0A 5AXNA 2R8GA 1JJ2R 3OL8A 3OVNA 2QZ8A 2M9KA 1YJNN 1BU6O 1FXDA 2FTRA 2LQ5A 3CNQP 1WKLA 4QPTA 1RA6A 3AVGA 4C11A 3RJMB 4JI7K 1R27B 4USIA 2LEAA 3AVFA 1EZZB 1HKAA 3ILLA 2PDAA 2A2CA 3SLCA 2C42A 1WEXA 4JI0J 4RWWA 4NEYA 4BC5A 3QJPA 5AQPA 4FYXB 1VR6A 3HKZD 1RI7A 3M32B 2UXDF 2HHHK 2FIUA 2RPIA 2ASJA 3BP8A 3VZIA 2HQDA 1T11A 4JKGA 3P83D 1NMEB 4EU0A 2XHWA 1K73O 2VPYB 2RQCA 2MZQA 2E7VA 3CDWA 5GINA 1I6JA 1CULB 2ZBQA 4LF9F 1K47A 3QT7A 3JAMU 5DGAA 3HI0A 4CJKA 1KLMB 3ZTRA 3FFKB 3CC7N 2J8AA 4PRFA 4E8UA 4CF2A 3N6LA 5F8NA 2MY7A 3ZSZA 3Q2TC 1YT3A 4KHYA 3ZSWA 2VQFF 1GLEG 1VRTB 5KFNA 3PW2A 4TLQA 4KBOA 1ZBTA 2ZNZA 4ED4A 3WXKA 2Q66A 4FJLA 2IYGA 4UZCA 3GG4A 4FWMA 5L38A 4ED1A 1HHQA 3EGWB 3KUEA 1VQKS 3MR2A 4OMFG 3GTYX 2ZBIA 3HM9A 2QWQA 1CC7A 1DTTA 2YQ1A 3CO0P 1RB0A 5E3CA 5B0BA 1WHWA 1RU2A 5KRSA 3TVYA 1FFSB 4HT7A 1Y97A 2P6TA 4TY8A 5BN8A 5KFZA 2HZVA 3C66A 3BN4A 2DB1A 2MXYA 1DFDA 1H6KX 4FJNA 3IAS9 2WZ1A 2J7KA 1LWCB 1TAUA 4M3YA 3OYEA 4HUEA 1F2HA 4XTTA 3TAQA 3UVJB 1RT5A 4GVLA 3DCAA 2OO4A 3W0LA 3THWB 1M1HA 3C94A 4R0JA 2FHJD 2V2ZA 4Y3CA 4MO5A 1NCLA 1VQOS 2ZWHA 1HWUA 2MJNA 3K0JA 5KFCA 4ZP9A 3LW5C 1T3OA 2D0AA 3HKWA 4DTOA 3TYTA 4M3XA 4AD6A 2CPEA 3L3VA 4BG9A 1E3MA 1R43A 2F63A 3TR5A 3ILIA 5AJ3K 3WC2A 3MMVA 2DCLA 4IG0A 3VQ4A 1VSHA 1S97A 4A5BA 1C0TB 4O3QA 2MKKA 3CVKA 4TY8B 4CP5A 4QZVB 4USVA 2VWKA 5F3ZA 5GADP 4DV0K 4IG0B 3C6UB 5I42A 1HBUB 5I3UA 2BANA 1IJEB 2FF3B 4X2BA 3LDPA 3CWJA 2HVHA 3BO4A 4NXMF 2AD9A 3P4IA 2O3DA 4CQ1A 4CWBA 3WDOA 2LQ8A 4HH0A 1BXNA 4ILLA 3ASMA 4X64K 4PR6A 1K6YA 1NDKA 1KQFB 3NGKA 4P6QA 1XNRK 4J7CA 3NF9A 3P39A 3R6GB 4QJVA 3GV8B 1KBRA 1OPZA 4UW2A 3WX8A 3VAHA 3H7HB 4G9ZA 1UEKA 3MOZA 4RW6B 3JQMA 3JSYA 2I2YA 1C4CA 2NRZA 4CO0A 2HZAA 3US5A 2JFDA 2IM1A 1RHQB 3NH2A 3QGGA 5DDQC 1QZ5A 2VG5A 2D3OR 2DRDA 4C2MA 1ZAWA 2LU1A 4JKFA 2C2DA 4DX5A 5AQNA 3DOLA 2QA2A 1DTTB 1KTVA 5EDWA 5LL6Z 4AQYK 4FK2A 3M8ZA 1ATRA 5GMDA 2EW9A 3PIPL 1BI4A 2GJFA 1EETB 4YOEA 1VQ7S 1KNZA 4CIFA 2QMXA 2F9JA 4QS7A 5A6WA 4WZQA 1TUYA 1WORA 3G6VA 3GPAA 3MN5A 2GIQA 3SYZA 2M88A 4B9SA 4K0KJ 1NNEA 3O3LA 3QNNA 1VK8A 4X65J 1LWEA 4ZA1A 4ZJLA 4JKEA 4K8XA 1U25A 1LQ9A 3H3OB 3BGLA 2LKZA 4CESA 2I7PA 4MIWA 2J0XA 1BA0A 3O9RA 1VQ4N 5A8RA 1F5CA 5HMYA 2VGNA 3KG0A 3WXMB 3ENBA 4FZYA 4IO9Q 3OR2B 1UVNA 4CLPA 1FEEA 2KM8C 3F41A 4WP8A 1PAUB 4W5QA 1SKWA 1C0UA 1SC4B 1HBOB 1CLFA 4LF9J 2GJIA 2FZKB 5DGBA 3QSIA 3SBMA 2NQPA 2OEKA 4QPXA 4CGFA 3I32A 2I9SA 3GV5B 2YPZA 5RUBA 4OX8A 3Q8VA 1HLUA 2O5DA 1HD1A 4ZLLA 4YOVA 5F8JA 1VK3A 1Q81T 3S8SA 3GG1A 4QU6A 2VBYA 1NH8A 4PG4A 4QW9A 2ILYA 4FZXC 4BQLA 2G8VA 1PJ7A 4FLTA 5AJ3J 2LECA 3R97A 3H2VE 1RBVA 4DF4A 4WFZA 3PVXA 1RYRA 4EEYA 2Z30B 3IGVA 2OZMA 4JV0A 4M5KA 4C23A 5AFUA 2AYBA 2EC2A 5D8HB 2XQCA 3FBEA 4A46A 5K8NA 3W1YC 2IC3B 3QZ8A 2E5LJ 1WC5A 1RBLA 1UJ6A 4O0IA 1PSDA 3AB4B 1UFKA 3H5XA 3HMJG 4HR2A 1RTDB 4PEOA 1YG0A 1JNZB 2RRBA 1X4AA 4UQGA 1GLAG 4FPAA 2AGPA 4W4MA 1XMQF 2NRXA 3MGJA 1IBKJ 1S1UA 4FJIA 4CJ4A 3SQOP 1QVGM 5C15A 1WSIA 2HNDB 4ZTFA 5JS1A 4X4TA 1BIUA 4ZIVA 3CJKA 1B0VA 3ITHA 2W4DA 5D4NA 3ZT3A 2MQLA 1B99A 3HRGA 1JJHA 5CZXA 3FCHA 2GWKA 3C16B 3TUIC 4PL8A 2W6KA 5LSRA 5KFJA 4Y0FA 4QCLA 1RTIA 5KAKA 1XMBA 3P49B 1ZC6A 1VJWA 4OKJA 2H65B 4IJAA 2CQ0A 3A5MC 2MMYA 4DX8H 4DBQA 2OCEA 8AT1B 1G15A 3M6VA 4RJVA 3GR0A 1E6VB 4ATNA 4NOHA 2H9ZA 2W25A 5HN0A 3MPWA 1YJ9S 2CJBA 1OJ4A 4NXNK 2RDJA 3D3BJ 5KFMA 3ZEUB 3KKFA 4NLOA 3QWUA 4N8NA 4OV6A 5IZHA 2LA6A 2F40A 5HMZA 4KSEB 3BJYA 4O4GB 3ONQA 2NUBA 5T14A 1KXPA 4LF6K 2XI2A 1YXQA 2DTJA 3DRPB 4C3KA 3FJ2A 4CK3A 3D1QA 4E7LA 2F4VJ 3D1HA 2HIYA 5AXMA 4CZFA 1OVQA 5GAHP 1HWLA 2AGQA 4C9DA 4QU7A 1R8CA 3M9MB 3PV8A 3ISND 3AVJA 1GLLO 2PI4A 3GJSB 4YDDB 4FPRA 4RWTA 2HWHA 5B0DA 3OR2A 4FS1A 2Q97A 2NYHA 2GQCA 1HJRA 3B6OA 2MGZB 5J1EB 1RP5A 1HI0P 2BX6A 3CCLS 1KS2A 1R59O 3ETMA 3OFEA 2E1YA 2RHQB 5LSOA 4AHRA 4K59A 2L48A 3C7NB 4ANDA 1RDDA 2OGUA 3MF5A 5JLHA 2NYIA 4LF2A 1N8RO 3QRQA 4BR4A 1B9DA 4DKWA 1RADB 3LP1A 1RU1A 3MM6A 5CD4A 1DKGD 1T3NA 1L3TA 1TL5A 3D6MB 1OQ6A 1N5QA 2YQ3A 1VHFA 2D3ZA 4ZJOA 1RISA 2B7BB 1CC8A 4ZLPA 3V6KA 4LY7A 3PR5B 4OX9K 1CQMA 4KFBA 4F3MA 3CSKA 2BR0A 2V8VA 2QLFB 1W0HA 2DY1A 5LJWA 4C97A 3RU0A 3R1LA 1XEZA 1D1UA 5KQ8A 4E7IA 5A8RB 2KXNB 1ROFA 4HI1A 3UNYA 2H4WB 2QXLA 3ZSOA 1NZ8A 3I87A 1YITN 3MUMP 1YTAA 1XTZA 5L46A 9RUBA 3TZZA 4Y0WA 3TPQA 2K3IA 4I2QA 5D15A 4BRDA 1Q8IA 3QLHB 3AAQA 2V63A 3QZ7A 1X5OA 4ZPDA 3WQUA 1LW0A 4OQJA 3EVOA 1CZAN 4KO0B 1RT2A 4ZPCA 4CLTA 2KZMA 2ZJPL 1CJKA 4I69A 2CQGA 2G0JA 2N82B 4LH4A 5B0FA 4X4SA 3QJLA 4FS2A 3KNAA 4AXJA 3E8OA 4ANCA 4R8UA 4CM2A 3O9TA 2BV3A 4DV1K 4ILHA 2P9PA 3K17A 4XO0A 3OLAA 2ALZA 2YNGB 2DHGA 1DLOB 4JKBA 4MFBA 4JK7A 3A8KA 5GAEI 5HQMA 4NPOA 2ADCA 2O8CB 3KUGA 4NB4A 2EFOA 3E01A 2ZH4A 2VC1A 1VQKN 1VDHA 4WFYA 4JK8A 4B8CA 4YEAA 2GQQA 4GY2B 4OKKA 1K1SA 4DR1K 1WUAA 4JI2K 2XSJB 5AE3A 2H54B 2PN6A 2FJBB 4AQYF 2UU9J 3VF4A 3ZSXA 2YCHA 3HSTB 2DXFA 4O3OA 3CW2C 3OT9A 2UUBK 1AT1B 1LFPA 3FRZA 4TU8A 4YP3A 2NRRA 1RBOB 4A8WA 3RW7A 1KC8T 1VBXA 5C12A 2D74B 4MMOA 3MTJA 2BXJA 2VPXB 2B4PA 2D5RA 3L8BA 3A12A 3GSDA 1S1TB 4BR2A 3DOMA 3NGIA 1IH7A 4RNNA 4YHHK 3PRVA 4X84A 4NI2B 2GZOA 3E51A 2DR5A 4LF8F 4CH7A 3M1FA 3IFEA 2BKOA 2XMKA 5F0UA 5KFVA 1Q78A 1TFYA 4UY8T 1I3AA 2KKHA 1FRXA 1MROB 4Z4IA 4DUYF 2RH3A 1GMVA 1X9MA 1ZETA 2FHMA 2KO1A 4I2PA 1LWFA 2WB1D 4Z4EA 4U8VA 3A4TA 1N4LA 2GJ2A 4NXMJ 3CJ5A 2F65A 1QVGR 1VSLA 1U09A 1XC9A 3CFPA 4QWDA 2HS4A 5MLCV 2CVIA 2YWFA 1FFGB 5ETLA 3L7UA 5AZJB 4OVLA 2W41A 4BRIA 3TU5A 1HW9A 2HOEA 4HTLA 4CJLA 5BYQA 3WIUA 2YX6A 4OZJA 3NP5A 4JI6J 4B3RJ 2RIJA 4JNEA 4DUZF 1K73T 1BY9A 3VQCA 4J91A 1VMBA 4M8LA 3IMXA 5KT6A 4J9LA 4JV5K 4XEIA 4AT1B 3O3HA 1UEVA 3EYZA 4Z7CA 4DUTA 5ADZA 1MLAA 4DFMA 3W60A 3TUJC 4LBHA 1S6PB 2XWYA 2A40A 2K7KA 2WVFA 3I4HX 2PT0A 4PXBA 2DKOB 4WPAA 1NK5A 4H4KA 2DYAA 2NRHA 1WSGA 2HQ3A 1U6FA 1WOPA 3CCRS 5CABA 1RAOA 1KDNA 3W2WA 2BUPA 4Y34A 4CF9A 3NAIA 2MHNA 1HKCA 1DRZA 1DGKN 2EFVA 1M5PC 3DMJB 3JAMO 3CJTA 2BRKA 2EI5A 3LP2A 2AU0A 3NEKA 4E1MA 4KRWA 3AJDA 3W66A 4DU7A 2JLFA 2JLGA 3WIVA 1FRKA 4DV6F 4HKQA 4FM0A 4DX7A 5DM6L 5B7WA 4WF9L 2P9CA 2G13A 2ZOFA 1PGZA 2RF2B 2M2BA 3QYYA 3POTA 4KHRA 3CI5A 1KQSM 2Y9HA 2MLXA 1D0EA 4AF1A 2DO0A 4DR5K 2DXDA 5E3QA 4EBEA 3DOKB 4FBUA 3S6EA 2RAQA 1FRLA 3M5RA 3H6EA 3DGVA 4FLVA 1AUDA 2VV5A 4JI4J 3Q22A 1W25A 1FJGK 3HPHA 3DXSX 3CJKB 2KRBA 2UXBK 4BQZA 2MPUA 1CXUA 2W8LA 3W3DA 1FKPA 1V4TA 2ZUGA 3NWRA 2CJQA 4DQIA 3NXZA 3EDRB 2Q6BA 5LMUF 2QA4G 2HF4A 1RT3B 4EP5A 2KVQE 4CZEA 3BREA 2LSNA 4C11B 4WFAQ 2Q0UA 2RILA 5KFEA 3BF4A 2YWKA 4ELTA 5JVGQ 4CEAA 1T05A 2NXJA 4NYNA 3DGPB 4FWOA 3BKTA 5LOQA 4JI3K 3MM5B 5LT5A 3SAFA 1ASVA 1V4SA 3T41A 1SVDA 3KK1A 2IM2A 5C25B 1GOAA 4AYBD 4J8FA 3UPFA 2RMLA 3UD5A 4NLQA 4RW9B 2PD1A 3TUPA 3SBGA 3BSCA 1TELA 1QAIA 3MM9B 4M7XA 1B9FA 1EKRA 3AA8A 4CI0B 2PEBA 2BM0A 4JS4A 3RGIA 4LR7A 4QBUA 1VC0A 1GX5A 3ZZUA 2K1RA 2IVPA 2HHWA 3N6NA 1PYTA 4DS4A 3RBEA 3LDQA 2NNWA 2HAIA 2GV9A 4HHJA 4TQSA 1FI4A 2EBGA 1NK6A 3SQ4A 4GVBA 1FW6A 3GJRB 4DSEA 4FLYA 3VGSA 3TSQA 3K5PA 3VQ5A 1X5TA 3NKYA 4O55A 1HI8A 3VGLA 4PG7A 5MAOA 1J54A 1I51B 2W9BA 3MD1A 3EM1A 1T9WA 1RKJA 3BDEA 2M70A 2WOMB 4B9QA 5AQXA 2I38A 1RGVA 4YHHJ 3A5NC 3HXMA 3J7ZT 1ZBFA 2QL5B 3SBTA 1S0MA 1FE0A 4HDGA 3MM7A 3CYMA 1MU2A 2ASPA 3KG4A 2PZSA 4I9QA 2E5JA 3GFZA 3BBBA 4FLZA 3OVAA 3C14B 4I6AA 4WBFA 5IT9U 3NGRA 2IYIA 1HNZK 3Q8YA 3EO3A 1WD6A 2YHYA 2QTDA 4A8SA 2N4DA 2CJAA 3ZNUA 1HKGA 2KZZA 3AOBA 2QL7B 3M9NB 3OYBA 2O8EB 2YNHB 5JS2A 1EETA 2KHOA 2GGPA 1U7LA 4TN2A 5KG3A 4OFZA 3RR8A 4JKCA 1JK9B 4JI8K 4KPCA 3IR7B 3K5LA 2RHSB 4WE1A 3TO8A 4OZ0A 1RAEB 4A57A 3O2IA 1ZBLA 2F9DA 2DIUA 5A2QO 1K8AO 4CJFA 1HHSA 3MTKA 4DMZA 2RQKA 5HLFB 2AYEA 4QWBA 4LF4J 1WSEA 1S12A 2DH9A 2DNOA 4OLPA 4DR4J 3FCWA 1N36F 4RZRA 3MECB 1U1RA 5LM7E 3THXA 2BYCA 2MKYA 1I5OB 1HKBA 3L6QA 1VK0A 3MAHA 1RLDA 3B4DA 1R0CB 1U0SA 4J9VA 3V6JA 4F25A 1WSFA 2KB2A 5BYSA 1Y11A 2HQIA 5CHCB 4O5BA 2DNMA 5A0YB 4DS5A 2RDDA 1KAZA 2CPYA 3R2DJ 2MSSA 1Y5IB 2AYGA 4P72A 2UUCJ 4DTMA 3KIOA 3UDEA 3WNHA 4JKDA 4K43A 3MD3A 2P9NA 3VQQA 2NUUG 1SJ3P 3K57A 2EBEA 3AT1B 1T0TV 4KAIA 2R7SA 2M4MA 2Z2MA 3VVUA 3GILA 5EXWA 3HHLB 5G0RB 5KOXA 2R7UA 3F5TA 2LXFA 3I6PA 1PAEX 4AM6A 3T1HJ 4LF8K 4KHUA 2D9PA 2MZJA 3JSMA 2GVZA 3RMAA 2PFUA 5HJYA 1XNQK 5C24B 4FWNA 4DSKA 3R8YA 2JLEA 1X0FA 4MDAA 3SQ1A 2OIHA 1R6VA 4DR1J 2AMCB 1JLEA 2VZ9A 1WKKA 4IFVB 4IG3B 1SL0A 2BM1A 4N7TA 1P8GA 4C3LA 5AQMA 2E66A 3MXJA 3VF2A 8ATCB 2V2VA 4M5JA 1KKHA 3A8YA 4PQAA 4Q44A 3PIOL 1TL1B 2FJXA 5D4LA 1FO1A 1U2RA 5BRDA 4FOEA 1S9EB 4DR7J 2B3TB 1NOYA 3Q7BA 4NXMK 3CULA 4HACA 4WQ4C 2ZH5A 3TQ1A 3DRYA 2HHHJ 1T9TA 2DXEA 4A8KA 1A0OB 5C2GA 5F2RA 4QIEA 4WQ5A 1SBRA 4LFCK 1QTNB 3QMLA 2ZC4A 3T5KA 2V4JB 2P2CB 5TKWA 1OKJA 2BE2B 4CFBA 4KY3A 2BA9A 2OTJS 2I5JB 3Q8QB 3O3FA 1G1XA 4PWWA 3CTRA 2KFZA 3LL3A 4HVZA 1TL7A 4B3MK 4EFAC 1HNXF 1Q16B 2MKSA 3R3LA 4ZN3A 1SI9A 3DLGA 5L39A 2A1SA 1TL4A 5JVGL 4E7KA 2WC9A 3PCOB 3OYIA 2KT3A 2IBKA 2VPZB 1T05B 1CXQA 2HWIA 3JSBA 2JH3A 1GXUA 1VSJA 2P5OA 3DLHA 2WFBA 4BG8A 1WKJA 2OI2A 3ZZYA 4Z0UA 3ET6A 2FBYA 3CF5L 4RG8A 3OTOK 3J81U 3V6DA 3ZCMA 3EKSA 3CQXA 2ATLA 2ZJQQ 3TJAA 1YJNS 1MWQA 1C1CA 4OLOA 2FY8A 3TRGA 3U6FA 2A3JA 2DNGA 2Y1JA 2R2SA 3MAAA 4TU9A 3ZO7A 4DFPA 4C8MA 4CJVA 2VFTA 4HCBA 3DLEB 4RPFA 3QT8A 2AKWB 4BE2A 4PKHA 1G6BA 3ZNJ1 2HHTA 1B4SA 4DR4F 3L3UA 5FLXO 4YOTA 1HNVB 3S3MA 4V19S 2YQ0A 3HPGA 4IOCQ 2R7WA 4IXCA 3P5TL 3P3DA 2EVZA 1GLFO 2WBMA 4LFAJ 2M0GB 5H9FK 3EGNA 3HSDA 3MAAB 5B8HA 1WEYA 3CCTA 3PEHA 3GQCA 2AJ2A 3PX0A 4NMLA 1X3MA 1RNHA 2W8KA 5J2QB 1N88A 3JXUA 1KP6A 3B8AX 3DMJA 1TUGB 4ID8A 3IBWA 1Z6RA 4IYQA 4J9NA 4LF6J 3HTVA 5ETPA 4F3QA 1R0BG 2QSFA 4KAZA 2HBQB 2OTLN 3KJFB 1NGEA 2BE9B 3J7ZO 5D77A 4TU7A 1MNEA 1IM6A 1RTJB 4K50A 2QWOA 4AL5A 3ZTSA 3U02A 3VESA 2WSFC 1MWKA 1RT1A 3E1YA 4AHTA 2CJ9A 4M5LA 2RQ4A 4FYVB 2DH8A 2CGJA 1KVKA 1TKZA 4LQ3A 1GK8A 2JSXA 3R9LA 4DEZA 3G0ZA 3MPVA 1RT1B 1A6LA 2GNKA 4BBYA 1M5VC 3DHWC 1KHVA 4MK7A 3TVKA 4CZMA 5FRNA 1RBTA 4OYZA 4IOAQ 3Q8UA 3EDQB 4O23A 5KT4A 4USJC 1FRJA 1HPMA 3KLFB 2R7QA 2FLNA 1EQYA 3TSPA 1H38A 3N4WA 2FJWA 3IUCA 4CJWA 4FNHA 5AJ3F 4JYAF 1HBMB 4DR6K 4BRGA 2FC0A 3LALA 2UV8G 2NZ4A 2E5HA 1YITS 4WQ5C 1GH8A 1X3NA 1WC0A 3AAPA 1L3UA 2A1BA 8RUCA 3GWCA 3MMBA 3CB4A 2G2ZA 2C2OB 3VPZA 3CJ8A 2AT1B 3CETA 3D68A 2BQRA 3HFZB 2QL9B 2CWKA 1NWKA 3KHHA 1BCOA 3PFEA 1IWAA 2WCXA 4HEA9 5I4MA 4YY3K 1J5OB 3DI6A 1SJRA 5CAAA 5CYMB 5FPNA 3SUNA 1YJWS 3C8YA 4CI6A 4L73A 4JD2B 3CXCR 3WUHA 2GCFA 4X65F 3D4JA 4ID5B 1RHJB 2QJ3A 4JYAJ 1S1TA 3QT5A 1RA7A 1SH0A 1JLAB 2E5IA 1CJUB 5THWA 3PM9A 4H5RA 4FM1A 3IA0A 2O66A 4DDFA 4UY85 3UKUA 2J76E 1P90A 4CIOA 1UETA 5AQJA 3DKDA 4QS9A 3NCRA 5FDLA 4OX7A 5A76A 4B08A 4PQUB 3I31A 1Y0HA 1S3XA 2QK9A 3E9OA 3M2VA 2C3MA 3H5UA 3EY1A 1FDAA 4CZCA 1NDLA 1FJCA 1Q7YT 4I6MA 1XMOK 3BEXA 3BGFA 3JS9A 3W5XA 2VB6A 3QB0A 4X66F 2XO7A 2UUCK 2FLOA 1TL7B 2HFUA 4B9VA 3HHKA 1GLDG 2W6LA 2YNGA 5DRKA 2FHJA 3IAYA 4JKAA 2JL9A 4DTXA 4GMKA 3QGPA 1EP4B 1WF2A 2OFGX 4W5RA 2DNKA 2GGPB 2FVRA 3DM2A 1JQGA 3R5AA 2GIFA 1IKVA 1CZ9A 2P9SB 4LBIA 4MK8A 3DU6A 3RG6A 3KLHA 3JTOA 5KFIA 5EU7A 3D6TB 1U1NA 5AQVA 3QLHA 3C14A 1R8PA 3TEGA 2BKPA 1RGIA 1HFEL 5KPZA 3DRRB 4PG5A 2RRAA 2RJZA 5K8MA 4NLUA 1S79A 3H0PA 3P5JA 4O8UA 1NHUA 1XQSC 2DO4A 3GIJA 3PDNA 2QMUB 3CMQA 3NBPA 4M1KA 3KHGA 4ALZA 4DTUA 2WOMA 2NLWA 3M8QB 1QSYA 3CD6S 3NGZA 1H98A 3LWMA 3EKUA 3P1GA 5LJ3Y 4L74A 4FW2A 4R5PA 3L2QA 4EZ6A 5U47A 3ZX2A 4RO0A 4K4XA 1L3VA 2H1YA 5KG1A 2G0CA 1SIZA 1T9YA 3ILOA 1MMNA 2G1DA 4ZVRB 3TAMB 1DBDA 1GLJO 2E2QA 4Y6IA 3HZ6A 1YHQS 3V9ZA 2Z8QA 1FX2A 3R2CJ 1RILA 1HMVA 2Y8WA 5DDRC 5KGWA 4OHXA 3AVCA 1WC6A 3H4BA 3HCXA 2CPIA 3QEIA 3QGHA 3D45A 1W26A 3A5LC 2EC0A 2B9EA 1D4XA 1U02A 1S59A 3DDNA 3WQTA 3BS9A 1BISA 3ZLJA 4YY3J 2ZE2B 4P75A 2I7NA 1DQAA 4FJHA 3VN5A 2DPNA 4J9SA 4OGCA 3OBIA 5KT2A 3QINA 4XIUA 5KI6A 4OYAA 2LA4A 3DNCA 1BOTO 4DV3K 4FPBA 4CEDA 2LYVA 3OS1A 1IWGA 2P5VA 3HOTA 2OPRA 4JK9A 4LF1A 1HYSB 2LCWA 3D66A 4P2XA 4JBCA 3BH7B 4RBTA 4JV5F 3V6HA 4IFYA 4B3RK 1B0PA 3VENA 3PX4A 4AQYJ 1J27A 3R5DA 4NLTA 4B9UA 2R2UA 1LW2B 1TUWA 1FKPB 4ZDNA 3OYFA 4DU1A 4CF8A 1Q4RA 1J5OA 2BVZA 3ZYYX 4N76A 1K0VA 4LT6A 1BQMB 3CJSA 2DFEA 4JI5K 3VERA 3UDLA 4QIVA 3LM2A 2KN4A 1NDPA 2DR9A 3IBFB 5HI7A 2Q2RA 1N5YB 5DETA 3U4LA 2UVRA 2R7OA 2JEFA 1JLBB 2RF2A 2VDHA 2UUWA 3V4IA 4JAXA 3PACA 5KFXA 2KDOA 2JVRA 2XNRA 3KVGA 4X62J 5L9XA 4KI4A 2XBPA 3JQKA 1R89A 1U6BA 1OIAA 3LTOA 4DV6K 3RBZA 3Q8PB 1CEZA 4DHYA 2A42A 2Q3SA 1YJUA 3HVWA 3QNWB 3NGTA 3TSUA 2VBWA 2ACYA 2E9RX 4UOCA 4GV3A 1XNRF 1LXNA 3WHIA 4Z4HA 3D28A 4KH5A 4LC9B 3LANA 4NXNJ 3ITHB 2P9GA 3AJ2A 2K7JA 2ATCB 3MN7A 4ZK7M 5KFQA 4X4OA 1MDUB 1N48A 5AQTA 2F9WA 3NS6A 3K2YA 3WC0A 4RUHA 3BH6B 1U1QA 2YWEA 1M5SA 2PE8A 3OS0A 3MURP 4USKA 4JS5A 3H46O 3AGRA 2XY8A 2D4WA 3WXLA 1VQ8N 3DJCA 1KAXA 3ICLA 5IWAF 2ZVIA 1WSJA 2YJFA 2E1ZA 3VEZA 2XHBA 1PYOB 3PHEA 4JV1A 5IWAJ 2HFZA 1YVUA 3HSGA 3NCQA 1GOBA 3H08A 4A4JA 2UXBJ 1YVNA 3OVSA 3EGVA 1NSQA 3FBBA 2IJNA 4BRQA 2DHXA 4OL8A 4CDIA 1HIYA 3BSOA 1U49A 1XR7A 2GVDB 1ELOA 1T02A 4C8ZA 1A9NB 2V7YA 4BWMA 5AXKA 4ZCMA 1QAXA 3RMDA 5EX3A 2B43A 5JICA 4NRTA 4NRUA 3M9OB 4W90B 2ZZNA 4H0TB 4NCAA 3OYHA 2IM3A 5HJXA 1KFDA 1NSKL 2EFQA 1R0AB 3RAXA 5BPMA 2IA0A 4ZTJA 2MDAA 2IVFB 2CRLA 4HTIA 2OZSA 4EWTA 3BKUA 1TKDA 4RW4A 4KGMA 3LDLA 1OH6A 1HYVA 1NO8A 2JC1A 3V4MA 1K8KA 3PEJA 1QUVA 1R6YA 1T9UA 3IXQA 1XQIA 1SCJB 1UL3A 4K8RA 4ZVFA 1VBZA 1J6ZA 4KQZA 1HBOA 2VQEK 5IFMA 3CO9A 3G4SS 4M41A 4DWIA 1HARA 1YAGA 5FPMA 2OPSB 5A8KB 3MM8B 1R7IA 2HS3A 5CD4H 2IVMA 3ADAC 4UOFA 3DN9A 4G3IA 4YR0A 1LAWA 4IWVA 3OVBA 3MK6A 2JEIA 1N33K 1IXKA 2D69A 4YDUA 1LWEB 3W5ZA 3TAGA 3B6BA 3HP9A 4F3TA 1RAHB 5AZIB 3LP0B 3F0NA 1N36J 3HM8A 2UUBJ 4ETZA 1UA0A 2Y0BB 4C1NK 2NS1B 3N9UC 1FF2A 5EGYA 3LDSA 4K4YA 1BWFO 2HBZB 4G1QB 3FGUA 4LF4K 7FD1A 1RKIA 1Y4ZB 4ER8A 5D4OA 2FBVA 4M3TA 5H9EK 3CCES 1X9JA 4ZVEA 3DOLB 3AD9C 3BPDA 1U6ZA 2K3KA 5JVHL 1BIZA 3OD2A 4MIBA 4O8KA 3IWNC 2BQUA 5J2PB 1VRQC 1FRMA 4BR7A 1XMOF 4DTRA 1P1LA 3O9QA 3OW2M 4F26A 4RUCA 4EBCA 5F8GA 1XMOJ 1AA1B 1VQYA 1H73A 2N3LA 1NKBA 1F60B 4M7YA 1JWWA 1VQNN 3R7SB 4B3SJ 4CFAA 3MCOA 4KKOB 4NZ6A 3OBWA 5E2QA 3U3YA 2RDIA 2W7AA 4O44B 2YTCA 3MCMA 2Y0SD 4HACB 2BZ2A 4PA1A 4KE5A 4QWAA 2D9OA 1ATNA 3P96A 1RT2B 3WBZA 1LW0B 2HMIB 4L3KA 4CJRA 1HHTP 3IRXA 2KH9A 1FTCA 1T94A 3HZGA 4LF7J 1PBUA 4CIEA 2XYHB 2XCPA 4BRLA 2OP5A 4YQWA 3W8PA 2MZSA 3KHRA 3KWGA 1AXQA 4USWA 1J5EF 1ZS6A 1O1WA 4JB8B 1X9SA 5I3UB 4CECA 1HNIB 2HRTA 3MEDA 3MHYA 3MCAB 4OYOA 4ZVOB 2V2QA 4YFUA 3M8PB 2XMVA 2XMTA 3OL6A 4CJ3A 1SQGA 3FZBA 4BC9A 3JYTA 2GELA 1ZA2B 5DG9A 2UU9K 1ZBSA 1ATSA 4Y00A 1VQPN 3DLKA 2WW8A 4KB0A 4ID1A 3J7AN 2EKNA 1T95A 4Q0BA 2V4RA 4DXLA 5ETQA 2KW4A 3DOMB 1IJJA 2GHWA 4X4VA 1UMJA 4LH5A 2CPZA 3VAFA 4FVMA 2RUSA 5KG0A 4M63C 1S1VB 2A0FB 3D2FB 1N34K 1YJWN 4BC4A 1M5OC 4FF2A 5LMUJ 3RRKA 4ILRA 4F4YA 1JMTA 2HNZB 2GAGC 1VHIA 5B0AA 1YDLA 2QG9B 3RSEA 3VEOA 2NR0A 4IQMA 4OX6A 1Z4UA 4WJBA 1KAYA 5EVZA 2DY4A 3I0RB 3VCDA 4CJSA 4DF8A 3SQ0A 3H5SA 2IA6A 4OI1A 5EX5A 3O1BA 2VQFJ 2IDOA 3BZKA 4DV3F 1IUJA 4KR0B 1NSAA 3MMJA 3NGYA 2BMBA 2PMHA 4J2EA 2YKPA 1ZZNA 2RKIB 2R7VA 3H20A 1S4EA 2PMWA 2CJXB 2W7OA 4B3RF 3VOVA 2MKHA 2ZFHA 2YKMB 4R8UB 1G4CA 4WE1B 3TA1A 1D9DA 4OKEA 1FA0A 2RQMA 5C7PA 2UP1A 4DG1A 2RHKA 3CMES 1X9WA 4GO5X 1CJKB 2UUAJ 1CQNA 4K4WA 5HRRA 4FF3A 1VRTA 3IMQJ 2DHAA 1KEKA 1S9GA 4LVOP 4FWLA 2KU7A 2HHXA 1HD0A 3K2PA 1AB8A 1DHMA 3D6HB 1S6QA 5D4PA 2LEBA 4DI6A 3O9SA 3HHEA 4AH9A 5AQGA 4NLYA 1FKOA 3AVBA 2OPSA 5A8KA 4F67A 4WU3A 3VEXA 2VWBA 3CCZA 3LPUA 3UD3P 1K9MO 3FZMA 2WRMA 3V2UC 3SCXA 2W9BB 1X4CA 4DR5F 1RDUA 2Z0GA 2OTLS 2ZF5O 2BJ7A 2A1RA 3CGIA 3SQGB 2O8DB 5I3PA 1UWBB 3HL8A 3KJQB 4GVBB 2PFDA 4AE5A 4AFFA 4O4RA 4IBNA 2WBRA 3AOCA 3BUZB 3M32A 3OUYA 1IBKK 2K8GA 4X4PA 3AA9A 3OYKA 3V9SA 4LFCJ 1S1UB 5J2NB 4DV1F 1Q1KA 3NAHA 2GFFA 3CPWM 3W8GA 1VSKA 3V81B 2EEYA 3F9MA 2KI2A 5T7LB 3D3CJ 4XPCA 3QWPA 3ATVA 4Z4CA 1T6DA 2ZJRQ 5KRTA 3IWLA 1N34J 4LFCF 1KTQA 4GKKF 2J6UA 1NG9A 1RBSA 4GO7X 3ZZTA 4KREA 1RWKB 2D3O1 4P52A 2HHQA 2E1RA 3NCIA 3PJXA 3Q86A 3GYXB 4QR2A 3WXJA 4BR9A 3HT0A 3IBCB 4BREA 1JL1A 4PUOB 5M1PA 2ASYA 4DL2A 3IR6B 2MLYA 4DR5J 4PWUA 3MR6A 1DTQA 1OH5A 2XS5A 2YKAA 2KXFA 2ZH1A 2VJUA 2QI2A 1TV6A 3PIOQ 1HRHA 3OXFA 3SEOA 4NA1A 2Z4PA 2EX3A 1U2CA 1TUVA 2B8PA 1ZZFA 4GKJJ 2BW2A 2D0PA 5L1KA 1XUPO 1HL6A 4ECTA 2GWJA 4DUZK 2IOCA 2U1AA 4IJNA 2MJUA 4E1NA 4WXWA 2F8MA 3PY8A 3NWGA 1X31C 2AP6A 4QYZJ 4DJBA 4WYWA 4A2AA 2KG0A 1V9OA 2VPWB 4CLZA 1HBNA 5CR4A 2FJVA 2UZAA 3MR5A 4BE0A 3CCJS 4EGLA 1LFWA 4A8XA 1HLWA 1UFWA 4CCHA 4AILC 1T7PA 2AYMA 1NGGA 4B3MJ 1OH8A 1ICEB 1H2TZ 1QS4A 4FBTA 2WW4A 3W5YA 1FXXA 3MXIA 4GV6A 2XMAA 3MEGB 1T03B 3PO5A 3AVNA 1PC4A 4NLWA 2QWMA 3F9KA 5B0CA 1QVFR 2V52B 3CQYA 1BA1A 4OYWA 3EGZA 1OSDA 2YH1A 2ADBA 1LCUA 5IC4B 3NLCA 1FWKA 2QN6B 3CF5Q 2OD6A 5J2NA 2MSTA 1BQMA 5EHHA 3MWBA 3LGMA 1D5AA 1KWMA 3ULEA 2ZJQL 4B3TF 5KFRA 1BMQB 1DY3A 3CIZA 3NMRA 2VASA 3KFWX 3EE9A 3MZIA 2YKQA 3CCMS 5DS7A 3GONA 2VWJA 3S3NA 2DRAA 3L9ZA 1IKYB 3PG9A 4KV8A 2P8IA 2RKIA 4AHCA 4X66J 1JLGB 1NJYA 4X65K 3CDAA 5K5MA 1TV6B 2G8FA 4JI1K 2D1CA 1XNQJ 5E3RA 1CJVB 2QA4S 3BEGB 1RWWB 2JVOA 5DDPC 1EAYC 4Y2AA 1M1KT 1TKTB 1D09B 4W5OA 5D78A 2KHCA 4ECWA 4CZLA 1OWXA 4RNHA 1WHVA 4WU2A 2BJ9A 3PFOA 4WZMA 4MKBA 4F0KA 3JTNA 2A18A 3R5GA 1T6CA 1S1VA 1JLQA 2G8UA 3OL7A 3CJ7A 1OS5A 1HMVB 5ELZA 1ZTWA 1WNSA 3HVRA 2QYCA 3B6PA 4DQ8A 4M3UA 3PIPQ 1K0TA 2OMOA 3OTCA 2ZM6F 1WN7A 4RUAA 5DK5A 1Q7YO 1XIQA 3GE9A 1M5HA 5D3GB 2MLZA 2F7TA 3AAWB 4JV5J 4ISFA 4HYKA 3O5TB 3DXKA 1NXIA 3G71N 2VDIA 2JEJA 2E1MC 3ENAA 2G2YA 4EI2A 1C0TA 1S5JA 2FGOA 5AQKA 4LF9K 2KTQA 2EXUA 5KGXA 2FC8A 1TK8A 5C2FA 3NBPB 4NI2A 3SSSA 2XZTB 4NE9C 2C22A 1WG5A 1OY9A 2BJ3A 3GCWP 1IV0A 3NH0A 2ASDA 3BV8A 4DPXA 1QDUB 1T9VA 4IRCA 3NG8A 4RR5A 4QOZB 4OHZA 4E0DA 2HG4A 4PKIA 1F5BA 1SC3B 4JI8J 3G6YA 3FFIB 4B8AB 3AY0A 4DQRA 3THYB 1ASWA 1PCAA 4K0KK 3JQJA 3FEZA 3KLHB 3EUNA 2G9OA 3C6TA 3L95X 2YKNA 4K4SA 1IKVB 4XK8C 5JMVA 2DGQA 1WSRA 3TZXA 2FVSA 2QMWA 4DZ6A 3OHBA 1BI4B 4BRFA 4LF8J 3MFHA