3E01A

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
556
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 153
structure length 552
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3e01A05
1MU2A 4EBCA 3IGNA 2V4RA 3N6LA 2YNGA 3DOLB 4E7HA 4O4RA 3E51A 2AU0A 2VWJA 3DM2A 4KO0B 4F4XA 2HNZB 3CG7A 1NK5A 2G8WA 4JV1A 1DTQA 4TXSA 2KTQA 3K59A 3AVMA 1KHWA 1JLFB 4KPYA 1SV5B 3WNGA 4MFBB 2FVCA 3WNFA 4KV8A 1IH7A 3VQ5A 3MF5A 3VQAA 3S3MA 4HCCA 1ZBFA 4GW6A 4WZMA 4CJ4A 1C0UA 3AVCA 1Z25A 4J9OA 1MMLA 1JLBA 3SUNA 4IR9A 2I1RA 4Q43A 4Q0BB 2Y1IA 4ZVEA 1RDBA 2R2RA 1VSJA 1RT3A 5J2QB 4CJTA 3DRPB 4ED1A 4EO8A 3AVLA 2YNIB 4RZRA 4DMNA 3SI6A 4YP3A 3LP3A 4RNMA 2P5OA 4OPKA 1JX4A 3OL8A 1L3VA 4FYDA 2AGQA 5KGXA 4ED2A 2FC0A 3CM6A 3T3FA 2JC0A 5I3UA 2HNYA 3PW0A 4KHQA 4Z4HA 3I8DA 3HO1A 4IKAA 5CYQB 2O4IA 4W5NA 2WOMB 3S9HA 2YNFB 1S1VA 1TGOA 4TQSA 4O3PA 1J5OA 2AQ4A 2V4QA 3DMJA 2WONA 2R7YA 2HHVA 1S9EB 4KFBA 4Y34A 3CJ0A 2X6NA 3CM5A 2RF2B 1GOBA 2R8JA 4KKOB 1TQLA 2HAIA 2XO7A 3V9UA 4C8OA 1I3AA 4ECTA 1IKVB 5L9XA 5JS1A 1IKWB 3AA4A 4Z0UA 1LWEA 2XI2A 4OJRA 4AHVA 4M94A 1LW2B 2GC8A 4NCGA 3KHLA 4EYIB 3LP1A 4OL8A 4AHSA 1NKCA 1XHZA 3NGYA 3Q8PB 2D0AA 3TAEA 4LSLA 2DFHA 5J2PA 2AGPA 4YQWA 1YTAA 4GMJB 4URGA 1RT1B 2R8HA 4HVJA 1TAUA 4EBDA 2ATLA 1GOCA 3MEDB 1NHUA 3UPFA 3L2UA 1O1WA 2D0BA 1KLMA 3TAFA 1WNEA 3V6DB 3NKYA 5D3GB 3SCXA 3RB6A 3VQQA 4ECZA 3TANA 2OPQB 1L3SA 4NLWA 3NGIA 5F9NA 3DRRB 3I0RA 1S4FA 1SUQA 3GQCA 4E3SA 1NK7A 4H54A 4OKJA 4PY5A 2DY4A 4PQUB 4EBEA 1RT4A 3NGDA 3LP2A 2RPIA 3RRHA 3DYAA 3RB3A 3V9XA 3MECB 4FJKA 1LW0A 3Q8RB 1LWCB 3LP0B 3G6YA 4N5SA 4K4TA 2JEIA 4F50A 1S6QB 4ICLA 4C8KA 3H5UA 4AHCA 5HLFA 4Y1CA 1FKPA 3HVTA 3CQ8A 3KLGA 5KT3A 1EXQA 3K5NA 1WSIA 1VSDA 1KLNA 2YKNA 5KG7A 4BDZA 1QUVA 3M8RA 4GC6A 2YV0X 4CF0A 3PW5A 2Z1HA 5KFWA 2HVHA 4N47A 3NE6A 3ZSXA 4U6PA 4DQSA 3DI6A 4O55A 2ZE2B 4CIFA 4RW9A 1RILA 4NZ0A 3QGIA 4WYLA 2D3ZA 2FVSA 2B5JA 3KLFA 4E19A 4NLSA 1RA7A 5DLFA 4ECRA 1VRTA 4FJ7A 1TVRA 1ZYQA 3HVAA 3JSMB 5KFCA 4ECSA 1ASUA 4YNQA 4I2QA 4CJRA 3ULDA 3HJFA 1UAXA 2ETJA 3HXMA 1T94A 5K14B 4DU3A 3HSTB 1C1BA 4TY8A 4DTUA 1U47A 1S1UB 2X6SA 3WNHA 2QKBA 5C25A 4O3SA 4Y3CA 1XR5A 3LANA 4XPCA 4DL5A 2BQ3A 3BDPA 4DTNA 3V1RA 2IAJB 4O3RA 3KKRA 4FM2A 3DRSB 4OPJA 3QYYA 4Z4GA 1LAWA 3TI0A 4EEYA 4CGJA 4JUZA 2IS3A 2C22A 4ED7A 1MU2B 2RKIB 2VA3A 3CVKA 1N5YB 5C42A 1D1UA 3DLBA 4URQU 4NLRA 4NYNA 1NJYA 3RMAA 1D8YA 4WXWA 4RU9A 4DSIA 4W5TA 4FK4A 1RDRA 2GIQA 1DTQB 3QGGA 2NUBA 5EWGA 2B6AA 2P51A 3QO9A 1Q8IA 4KV8B 5DLGA 4Z4FA 4IFVA 1RAJA 1DLOA 3ALYA 1YVUA 2OPPB 1TV6B 1VSFA 2GV9A 3QZ7A 4NCAA 2BRLA 5FDLA 1U09A 1B9DA 3BR9A 1LV5A 4DG1A 1IM4A 4IH7A 4Q5VA 3PJWA 1C0UB 5JUMA 5HROA 3PY8A 3PUFA 1QS4A 1JLBB 3FQKA 4HCBA 3PZPA 1T7PA 1VSIA 4B9TA 3OSPA 4K8ZA 1TKXB 5KTQA 2OYQA 3L8BA 4FBTA 2ZKUA 5KGWA 4B3OA 4MK8A 5KFHA 1ASVA 4DL6A 3DLRA 3I5BA 1S0NA 4NRUA 1T05B 3GYNA 1S9GA 4OLAA 5I3UB 3SV3A 1CSJA 3RR8A 4J9KA 3GIMA 4DTSA 2EX3A 2HHXA 2OPSB 2FJVA 4CEOA 1RT7B 1VK0A 3GILA 1IKXA 5KFJA 4N76A 5EWFA 1Q9YA 2ASLA 1S1VB 3RBDA 4WFXA 3RAQA 4Q8EA 1J5OB 4KB1A 4PUOB 4KHNA 3DMJB 3D5MA 2WONB 4KE5A 5KFMA 3PW2A 1TK8A 4NLYA 3IAYA 4KFBB 3IG1A 2ILYA 4J9QA 4MKBA 1BQNA 1IG9A 4BDYA 1WN7A 1JLEA 2UVVA 4FLUA 2QE5A 1TP7A 2W9BA 4BE2A 1K1QA 4IKFA 4M3XA 2AX0A 3SJJA 3QIPA 1LWEB 4I2PB 4O44A 1ZETA 3H4DA 1TL3A 3DLGB 1N6QA 4FCYA 4FJNA 3KK2A 2VG5B 3PO5A 1KSPA 2R8GA 5DK5A 2RN2A 4CHQA 3NHGA 4IG0A 4CEEA 5EUHA 3NMAA 2IDOA 1RTJA 1BISA 2HNDB 4LSLB 4DTJA 4FVMA 2F8TA 1SL2A 1A5VA 5J2PB 1HPZA 4RNNA 3VQSA 3HP6A 1TKTB 2E9ZA 3L2VA 5JS2A 1S1XB 4IRDA 2E6MA 4HUEA 3LALA 1CXQA 3TQ1A 4F4YA 2BGGA 1I6JA 3KLVA 4CJVA 4CJUA 4RNFA 3K5OA 2RDIA 4CF1A 3NH2A 2AWZA 4B9LA 1L3UA 2BDPA 4ECWA 1IKYB 3OSNA 3MFHA 4O4GB 2R8KA 1YTUA 3QLHB 3GV5B 5EU7A 1RBRA 4WXOA 3I0RB 1SUQB 3LZIA 3ZT0A 4JLHA 3EY1A 4NYFA 2W9CA 2W8KA 2FBVA 3DYAB 4UQGA 4XIUA 1RDDA 2WCXA 5J2MB 1LW0B 3NF7A 5FRMA 3FRZA 3QINA 1RTIA 1JL2A 4WE1B 2W7PA 1XR6A 2IGIA 3SFUA 3IN5A 4CERA 4F2SA 3HVTB 4FM0A 1RTHA 4XPEA 3VQDA 2YKMA 4KSEB 2XY6A 2XY8A 2YKNB 3B6OA 4FM1A 1S97A 2V0NA 4IH5A 3PW4A 2HMIB 3TAQA 1KVAA 3LWLA 3ZSVA 4FK2A 2J6SA 2JEJA 2PZSA 1BQMA 2YNHB 3ZSYA 3V9ZA 2UVUA 3ASMA 3DI6B 4RW4A 4RW9B 3KJVA 4CEQA 1HNIA 3KMQA 4TQRA 1A5WA 1EP4B 2B5JB 3KLFB 4FLYA 4E7LA 1CZ9A 2EC0A 5CYMA 3MR5A 5J1EA 4ECYA 3ZSQA 3DLKA 1HYSA 3HM9A 1TVRB 1SH0A 1J53A 3KHRA 3QGHA 4ZPCA 3U3YA 4EP5A 4I2QB 5DGAA 1S1TA 2DPIA 3IGVA 3VA0A 3L2RA 4E7KA 4HHTA 5CZ2A 1T3NA 1KTQA 1KHVA 3D45A 4TY8B 1VSMA 4NLPA 1JLAA 3UIQA 4CGHA 4NLTA 2IC3B 3V6HA 3K2PA 5KFYA 5DQIA 4IR1A 2OPRA 2OZMA 2JEFA 4DLGA 3QNOA 3OS1A 4K4UA 1RT6A 3CJ5A 3SUOA 2O5DA 4TSXA 4KB7A 2KFZA 3SUQA 4CGIA 4O3QA 3K58A 4DLEA 4DFPA 4YR3A 4BWJA 3ZT2A 2JC1A 3BGRA 4QWBA 1BI4A 4LH4A 1TL1A 3OL6A 5C24A 3QEIA 4FW1A 5DQHA 1TKZB 4TY9A 3NAEA 4QPXA 4BDPA 1S5JA 3AA2A 4CJSA 4RNOA 5I42A 3GIKA 4NRTA 3V6KA 3QIDA 3OJUA 1RBSA 4ZP9A 3GV7B 4CJFA 4QOZB 4IFVB 4CJWA 1DLOB 4IG3A 4RUCA 4O3OA 3G6XA 1ITGA 4QW9A 1QE1A 3G86A 3PVXA 5KFKA 3VQ6A 3ZT1A 3DOKA 4DG1B 4K4YA 5HRNA 5HROB 2C28A 4RW6A 1LWFB 3AVBA 4F4ZA 3NFAA 5KFZA 3Q8QB 4ECVA 2UVRA 2BE2A 5KI6A 1VSLA 1X9WA 4W5QA 2ALZA 4B3OB 3MXJA 1C1CA 3L2WA 4HYKA 3FSIA 3NBPA 1GX5A 3ISNC 5C5JA 2F8EX 3MEEA 4J2AA 3KOAA 4QWEA 3HYFA 4KAZA 3O4NA 3C94A 3P1GA 4C8MA 1TK5A 4KB0A 4H4MB 3V81A 2VG6A 3G6VA 1IKXB 4ED6A 3E01A 1WAJA 4MIBA 1VSHA 1A5XA 1HJRA 3BQ1A 3OLBA 1KFSA 4J9RA 2ASDA 3HVRA 3IG1B 2FVRA 3V4IB 4NYZA 4Y1DA 1IO2A 4MK9A 1JLEB 4MKAA 3SI8A 2WK4A 3FFIA 1WNSA 4FJXA 3AA3A 4CEAA 4IDKA 4B9VA 3OYLA 3CO9A 5KFOA 3SNNA 4FZZA 4LH5A 4G1QB 5KT4A 4KHSA 3QIPB 4J9NA 1WSHA 4ZVHA 5F8MA 1X9SA 2X78A 1TL3B 3BSCA 2J6UA 3KK2B 5KG4A 2XGPA 2VA2A 3KLIA 4OGEA 4Q8FA 3OYBA 4F4KA 2IM2A 4IBNA 4ZPDA 4PA1A 1EETA 4IG0B 4OKEA 4NLOA 3I5AA 4DSKA 2WB4A 2R8IA 1SH3A 4CFBA 3LWMA 4JS5A 3CDWA 2D7SA 4FZXC 4H4OA 1FK9A 4CJ5A 2CKWA 1HPZB 3PX4A 4CCHA 4CFDA 3M8QA 3KLEB 1T8EA 3HPGA 3V9SA 1JLQA 4DF4A 2DTUA 3CYMA 1KVCA 4CF2A 2UUWA 3H4BA 1DTTA 3QEPA 3TABA 4DFMA 2JGUA 2IJFA 3SPYA 3D0PA 2IOCA 3AA5X 3OYIA 4K4WA 4DL4A 3VQEA 3VQ4A 2G8UA 4M3TA 3NGZA 4LSNA 4ID1A 3ITHA 3FDSA 3KK1B 3RBEA 1EX4A 3AVIA 1ZBHA 2WHOA 3OS0A 2I5JA 4EYHB 2CJQA 3AO4A 2W9CB 1HMVA 4KO0A 3VQBA 1NKBA 3MEGA 1JLGA 1RCHA 1REVA 3RTVA 4ID5B 3ZCMA 1S6PB 5L1KA 1RTIB 3O3HA 5F9LA 2O4GA 4EZ6A 3L3VA 3AVFA 3V6JA 2JLEA 4CJQA 4BWMA 3H2LA 1S1WB 3QESA 3D28A 5HP1A 4ZTJA 2Y1JA 4KI6A 4R8UB 4NLQA 5L1IA 4FXDA 1U4BA 4E1MA 1HNVB 3BQ2A 4RW7B 4CJKA 2XI3A 3OYGA 1NK8A 4I7FA 3SQ1A 4Q0BA 2FLNA 5KFTA 3PJXA 2YNGB 4OLBA 3KJVB 4F4WA 1RBUA 2YNIA 4FJIA 5CZ1A 1QQCA 3DM2B 1Q9XA 1D9FA 5CYMB 4KHYA 3IRXA 4ZP7A 1CZBA 3PR5B 1RTDA 2QXFA 3DLKB 1HYSB 4J2BA 2FLPA 1U04A 1UA0A 4WZQA 4ZTFA 5CYQA 4EZ9A 4HTUA 3Q8SB 3TAGA 2YNFA 3EPIA 3QEWA 1NK9A 4ZP8A 2Z1IA 3NF8A 4CHPA 3NF6A 4CFAA 1JLAB 1WSEA 2BANA 1K6YA 4DQQA 3O3GA 3SZ2A 4DU4A 3AVKA 4R5PA 4M45A 1RNHA 4F8RA 2P1JA 2OPRB 1RBTA 4X2BA 5KT6A 4NLGA 3L3UA 3AO3A 3NAHA 4BE1A 5KFEA 1IKVA 2BQRA 1WSGA 4CGGA 1RT3B 3RMBA 3KIOA 4R0EA 3H5SA 4B8CA 2AGOA 2HHQA 3OYJA 4DQPA 1NJXA 4CHNA 2FLLA 4JRQA 1SKSA 4O5BA 5HRRA 3BGRB 5KFUA 4DS5A 4F3OA 1JXLA 1WLJA 1TL1B 1X9MA 4J9LA 4Z4IA 5E41A 1HQEA 4E89A 3PV8A 3BQ0A 2HNYB 4I9QA 5C24B 2ATQA 3MR2A 5KFVA 3QERA 2F96A 1I39A 3JYTA 4FJMA 1UOCA 5KFSA 3KKSA 1U48A 2HVIA 5HBMA 1RT1A 1KFDA 2OH2A 3CJ3A 4CHYA 4GC7A 4TN2A 4J2EA 5I42B 3KLHA 5KRTA 4GVMA 3P83D 2XC9A 3OHBA 3TVKA 3S3OA 4QCLA 4RW8A 1L5UA 5F8HA 3QIOA 2GIRA 1D0EA 4IG3B 3NCIA 5D3GA 3K57A 3HPOA 5CY4A 1NJZA 4AILC 1QAIA 4CGDA 1QE1B 3H40A 3DLEA 1S10A 4K50A 4TLRA 4KBIA 2OPQA 1JLCA 4IOBA 2QK9A 4FLZA 3DRRA 1NK4A 1HQUA 5KFAA 1UWBA 3OYMA 3VQPA 4NCGB 2IJNA 3LP1B 3AVAA 5DG9A 4DSEA 2HB5A 4CJPA 4C8NA 5J2NA 3C95A 3N6MA 1NHVA 2RDJA 1XR7A 1LWCA 3LP0A 2R2TA 3HP9A 1G15A 4ZPAA 1W0HA 1S6QA 2G8FA 1VSEA 4FJJA 1C1CB 3H59A 3KK3A 4CEBA 5KFQA 3OJSA 4DTXA 1KRPA 1S49A 1Y97A 2OZSA 4AHTA 2AJQA 1YVFA 4EP4A 2XCAA 1KLMB 4IRCA 3AO1A 3V1OA 2IA6A 2GBZA 1RBVA 2G8IA 2BRKA 3HPHA 4M3UA 1JXEA 3TARA 3GIJA 4W5OA 2FVQA 5DQGA 1N56A 4CJ3A 2Q3SA 4ZVFA 3NF9A 3HK2A 3SFGA 5KFXA 4DS4A 4MH8A 1RT4B 4IDKB 3LP2B 1GOAA 3EZ5A 3U6FA 2IM3A 5KG1A 5KG5A 4M3ZA 3IS9A 4C8LA 2V9WA 3KD5E 2IBKA 4WFYA 3JSMA 3KTQA 4ICLB 3BSAA 5HLFB 5KFNA 3KLIB 4CIEA 2C2EA 1FKPB 5F8NA 1EETB 3UR0A 3KLGB 5KG2A 5L1LA 3LZJA 4F2RA 1ZBUA 4ED0A 4O3NA 1L3TA 5K14A 2UVWA 2EHGA 1VSKA 1T03A 2G8HA 1FK9B 4M3YA 4ECQA 3G10A 4YFUA 4JS4A 2ZQBA 2C2RA 2E6LA 2WTFA 4KREA 3AVGA 1R0AA 2XY5A 2B43A 1DTTB 3TAMA 2IAJA 3N6NA 4CECA 3V1QA 3RR7A 4FLTA 1VRTB 4ZP6A 4WFZA 5KFLA 4KTWA 3M8PA 4LSNB 3ZSRA 3ITHB 3SUPA 2IMWP 2RKIA 4QW8A 1N5YA 3FQLA 2I5JB 1RT5A 4DF8A 1HMVB 2HWIA 4E7JA 4MK7A 2XCPA 1QSYA 5F8GA 4URSA 3T1AA 3MEGB 1JLGB 3NH1A 2HHUA 1REVB 2R2UA 3CWJA 1C1BB 2PY5A 2X74A 4HUFA 3CFOA 4DFKA 2BR0A 5SWMA 1RDCA 3F9KA 3HL8A 2IM1A 4J2DA 4XO0A 1VRUA 4IFYA 4FK0A 1B9FA 4CK2A 5C25B 4Q44A 4M3WA 3OL7A 4DSJA 4ELVA 2OPPA 1TV6A 4KHMA 4KAIA 1Z4UA 1NNDA 4LY7A 4DSFA 3OYKA 5SZTA 5HP1B 4I9LA 3MR6A 1C0TA 4CEDA 4TYAA 1BHLA 1NK0A 4FS1A 4O0JA 4CJLA 1BIZA 2D41A 5DG8A 4I7FB 4OVLA 1HYZA 3RAXA 1XI1A 3O4QA 3OVNA 4B8AB 5C42B 1TKXA 2HW3A 4EO6A 1FKOA 3BSNA 2XHBA 3QETA 4CESA 3L2QA 1U45A 3IRXB 1YT3A 1RT2A 1J54A 1RTDB 2OA8A 3TR8A 4AHUA 1T05A 2B6AB 1RDAA 3QO9B 3AVJA 3HT3A 3M9MB 2OPSA 1RT7A 3RB4A 4PUOA 2HWHA 5KG6A 3AO2A 5FDLB 3EZUA 2BANB 1NKEA 4KI4A 4R5PB 2FBYA 1JIHA 5F8LA 2JEGA 4ZHRA 1WSJA 3NAIA 4I2PA 3AO5A 4G3IA 3ZSOA 3DLGA 4KHWA 2VG5A 4Z4CA 3SV4A 5KRSA 2VG7A 3OLAA 4HKQA 2PYLA 4CEFA 1C1AA 1ZTTA 1HQEB 1S9GB 3LAKA 2E4LA 2A1RA 1SL1A 3LPTA 2F8SA 2HNDA 2Z1JA 4QWCA 3ZSWA 3JYTB 3BREA 3BSOA 4FJGA 3KHHA 3WNEA 3OYFA 4TYBA 4QWAA 3I0SA 4LQ9A 1TKTA 2KFNA 3PX6A 4CE9A 5HBMB 3RMDA 1S48A 4LQ3A 5KG3A 1XHXA 4QWDA 2G8KA 3CDUA 1S1XA 3KLHB 4ZPBA 3MTKA 1BQNB 4RW8B 1RA6A 2KZMA 1U49A 1SH2A 3C6TA 3BJYA 2W9BB 1IKYA 3DLEB 4O4GA 4N41A 3QLHA 4O44B 1JLCB 2R2SA 2XY7A 3O3FA 1N6QB 4FLWA 1HQUB 4DU1A 4BE0A 2ZD1A 4FLXA 1OS5A 1UWBB 2VWKA 3G0ZA 1W25A 4PWDA 1K1SA 1FXXA 4J9SA 4B9MA 4E7IA 4JV2A 1HRHA 2FVPA 4KHRA 3F73A 5J2NB 1NOZA 1RTJB 5J2MA 2IM0A 4LD0A 2XGQA 1SKRA 3K5MA 1JL1A 1JKHA 4WE1A 3VQ8A 4M42A 1JXBA 3GIIA 3SPZA 3KK3B 2FBXA 3M8SA 5T14A 1TAQA 5KG0A 5DGBA 2ILZA 1QTMA 2DFEA 2YHBA 1NJWA 2XRIA 4QAGA 4NCBA 2HMIA 2HHSA 3LAMA 4FJLA 1C2PA 1BCOA 3C6UA 5HRPA 2YNHA 3ZSZA 1C6VA 3UDLA 3CJ4A 2G8VA 4CHZA 4DQRA 3OY9A 4M95A 1LAVA 4ZVGA 3DOLA 3CJ2A 1F21A 3MFIA 4MQ3A 4FJ9A 4W5RA 2HNZA 1EP4A 4K8XA 4Y2AA 4L8RB 4NLUA 1SL0A 3OYCA 3IS9B 2A1SA 1S0MA 2XWYA 4DL2A 1JLFA 1S0OA 1SV5A 1N48A 4MFBA 4CIGA 4KRFA 1TK0A 5KT5A 2HHWA 4IQXA 5HRSA 3ZT3A 3OYHA 1RTHB 2KZZA 2YKMB 5KFBA 4M41A 2D3UA 4B08A 4K4SA 3EPGA 4B9SA 1B92A 1T03B 1CLQA 2ASJA 2IC3A 3SQ4A 1BQMB 3PR4A 4CFCA 3I5CA 1XC9A 4ELTA 2Z1GA 1R0AB 4RW4B 5J2QA 3TAMB 3DRPA 5L1JA 2WRMA 3RRGA 4NLXA 1HNIB 2D5RA 1WSFA 4RG8A 3PO4A 1GX6A 3DDKA 4FW2A 3OYDA 2W8LA 4FJ5A 4FJHA 1TKDA 2C2DA 1KCFA 3LPUA 5J1EB 1NK6A 2D0CA 4B9UA 3M8PB 5T7BA 3TWHA 2DPJA 4ED8A 3MXIA 4RUAA 4HUGA 1RT5B 1S1TB 3T5KA 4J9MA 3NH0A 2WOMA 4FZYA 1TKZA 1Z26A 4FBUA 1W9HA 1RYSA 5EDWA 4CF8A 4DFJA 1S9EA 1C0MA 4E0DA 3VA3A 2FJWA 3OL9A 1VRUB 4IFYB 2RF2A 1HARA 4OGCA 4KKOA 3H5YA 3HHKA 1RT6B 4DL3A 1CXUA 4Z4EA 1IKWA 4K4XA 4KTQA 4NLVA 1WAFA 4CGFA 1C0TB 4OKKA 3HVWA 3T5HA 2E9RX 1LW2A 1LWFA 3H98A 2BQUA 4WYWA 4NLDA 5KFGA 1BI4B 1J9AA 3VQ9A 3PHEA 2FJXA 2KW4A 4DSLA 3P5JA 1FKOB 3THVA 4RNHA 2ITGA 2W9AA 4YR2A 4DTOA 3KNAA 2DFFA 3VQCA 3VN5A 3H08A 1RT2B 3M9OB 1QHTA 3MEDA 4J9PA 2GUIA 3OYEA 3GV8B 4ZMMA 5F8JA 5EWEA 4CF9A 1UA1A 3V6DA 3HKWA 4ECXA 3SQ2A 4H4MA 4DTRA 3PX0A 4K4ZA 1QAJA 4H8KA 2QV6A 4Y2CA 4O0IA 4U7CA 4F3TA 2KQ2A 1ZTWA 2HHTA 3DOKB 3AVHA 5FROA 3QZ8A 3ISND 3V4IA 3V9WA 5KFPA 4RW6B 4K4VA 3T19A 3NL0A 4YR0A 3KMSA 1QSSA 2FBTA 4PQUA 2E9TA 4ZHRB 3CIZA 3QEXA 2BE2B 3MECA 4E1NA 4DL7A 4G1QA 4Q45A 5DMRA 4DQIA 5KT2A 4JRPA 1S9FA 4KHUA 3RMCA 3T5JA 3EYZA 5DG7A 3QNNA 3CDEA 2VG7B 5FRNA 3KHGA 4JV0A 3OYAA 3NBPB 2J6TA 3RWUA 3MXMA 3CFPA 3TAPA 3MEEB 2YHAA 1SKWA 3ZT4A 2W7OA 3LDSA 3CFRA 4YMEA 2W42A 3V81B 5KFRA 2VG6B 3KD1E 4M3RA 1BCMA 3E01B 1ZBIA 3I0SB 4IRKA 3KLEA 3OS2A 1RYRA 4KTZA 3RB0A 4CEZA 4DWIA 3DLHA 2ZE2A 1N4LA 3S3NA 3SYZA 3FFIB 3UQSA 3OHAA 1XWLA 3C6TB 3PW7A 1BIUA 2QKKA 1D9DA 5F8IA 4FS2A 3U3GA 1ZBLA 4CJEA 4ED3A 3A2FA 3KK1A 3AV9A 4DEZA 3T5LA 1ASWA 4FLVA 2ZD1B 4DTMA 1BL3A 4BACA 4IH6A 4PWDB 4CK3A 4N56A 4MIAA 3OYNA 4CK1A 5KFFA 4ECUA 4ID5A 5KFIA 1HYVA 3H5XA 2LSNA 1S6PA 4AH9A 1JKHB 1S1UA 5KT7A 4H4OB 3ICLA 4FJ8A 2UUTA 1D5AA 3M8QB 2AX1A 1KVBA 1NOYA 3VQ7A 3MAQA 1JLQB 4CHOA 2PYJA 5JXSA 3AVNA 3SQ0A 3QEVA 1S1WA 2B4JA 4ELUA 2P5GA 3B6PA 1BGXT 1X1PA 3MR3A 4DTPA 3DRSA 4R8UA 5KFDA 1EKEA 4B9NA 1HNVA 4RW7A 1QSLA 3C6UB 3NDKA 4AHRA 3K5LA 3M9NB
chains in the Genus database with same CATH superfamily
2YHYA 2O66A 3IGNA 3N6LA 2NPIA 5E3AA 4H0OA 4ILHA 4O4RA 5H9EJ 4ISFA 4OMFG 1X3MA 1LNQA 4YOEA 3VAJA 4DL0C 4ISGA 1NK5A 4Y6IA 1X4CA 3K59A 5BYRA 5AZIB 1KHWA 1SIZA 1SV5B 3MM6B 3HF5A 4LFCJ 4OZ2A 2AEJA 4FN5A 3QJJA 3VQAA 3W60A 1UAWA 3EXYA 3ZETA 2Z2YB 2M5YA 2AKWB 3MAHA 3WC0A 4ZIWA 1WHWA 5CQGA 1N34K 3PIOL 2DGSA 1SXLA 3GPAA 1WC1A 1C0UA 2W2MP 3DU5A 4IR9A 2I1RA 3OVAA 2B4PA 4DV6J 2HVEA 2DR6A 2R2RA 4CJTA 1NAQA 2OANA 4QS8A 4FYWB 1ULRA 3THTA 3M3ZA 4RZRA 4ZPVR 3TSUA 1RWVB 1Z2LA 4RNMA 4OPKA 4CLFA 2CVIA 2CNKB 4YDUC 3GSIA 4BC9A 2JC0A 1Y11A 4X65F 3PW0A 2Q0UA 3I8DA 4IKAA 4GV9A 2NXEA 2O4IA 2WOMB 3WX4A 4TQSA 4O3PA 1R8PA 3O6QA 3MHYA 1FNOA 4AF1A 4LF9J 4CNZA 4KFBA 2DNYA 2CQ3A 4Y34A 1PBAA 2DGVA 2RF2B 1RAFB 5HJYA 2R8JA 2LMIA 2HAIA 1NPKA 2GQ2A 3V9UA 3JAMU 4ECTA 4C6AA 2HOEA 3P49B 1QDUB 3CJBA 5D0HA 4EK2A 4ZIVA 3HSDA 3TX0A 4AHVA 4M94A 1QAXA 4NOHA 2DITA 4OL8A 2DNLA 4AHSA 5CA5A 1XHZA 5CCLA 1ATNA 4AFFA 2D0AA 4LSLA 3IKMA 3U4LA 2DFHA 2AGPA 3UCGA 2VV5A 4DR4J 1Q8KA 5AJ3K 4JI1J 3TTDA 5BPLA 5B0EA 4ZJLA 2MQQA 4HVJA 2HQGA 1VQKS 3MEDB 4W4MA 4K2JA 2Z30B 3MMJA 1YLXA 3Q0AA 3NKYA 4JI5F 2IYIA 3SCXA 4KH0B 2IPOB 4C98A 4EGLA 3DXKB 3NGIA 5F9NA 1S4FA 1RWUA 3GQCA 1NK7A 2MQPA 5D0GA 1OWXA 2DYAA 3NGDA 3LP2A 3P38A 1LW0A 3Q8RB 3OBYA 1VQ4N 4K4TA 3CJAA 3KZBA 4Y1CA 3PXGa 1NGHA 2ZH7A 4JI6F 2JFDA 1VISA 1WSIA 4DPYA 2B4UA 1QUVA 2NUHA 1NH7A 1FRXA 3SK3A 3W3SA 5AQYA 5H1SQ 3W0LA 2FTRA 3KFWX 4U6PA 4DQSA 2J0QD 4W98A 1W26A 3CCUS 1V3RA 3NMUA 3KUEA 3ZZRA 1OQ6A 4NLSA 2E1PA 4M8LA 5DLFA 1N88A 4ECRA 2E5JA 1VRTA 1WI6A 2VU5A 3I9V9 5KFCA 3HFVA 1HBOB 4L6V3 4X66F 3ULDA 3PDNA 2ASYA 3AFGA 4DU3A 3HSTB 1C1BA 4KGZB 1U47A 1EQ0A 2X6SA 3WNHA 1YHQS 1VQPN 2C3PA 3L9ZA 4CZCA 5C25A 2QKBA 3LANA 1SQGA 1FFWB 4DL5A 1URRA 1VFJA 2DCLA 5K8OA 1EQYA 3TYTA 3CMES 2HRTA 5G4DA 3V1RA 4A47A 3DRSB 2DEJA 3EE3A 1GMWA 1AW0A 4EEYA 4JUZA 2D3O1 2A5XA 1QTNB 1YXQA 1NB7A 3NVKA 2VA3A 4CI6A 1FJGK 4YY3K 4A2BA 4X4VA 1D1UA 3D2EB 1NJYA 4WPAA 4W5TA 1NDKA 4X4NA 4FK4A 2FC9A 3MX2A 1DTQB 2QFJA 2LXIA 3CCTA 3M6UA 3HM8A 3NOCA 4OHVA 3L09A 4Y2MA 4IFVA 1NPPA 2KDOA 3ALYA 3CE8A 2GV9A 1RGVA 4WTYA 2QM1A 5IFMA 4NCAA 4LFBK 2BRLA 3QICA 1VQ6N 5FDLA 3BR9A 4LRBA 1LV5A 3CIMA 3PJWA 5HROA 3PUFA 3NGKA 1DHMA 5B08A 1WKJA 3W9IA 5MLCQ 2G1DA 1AZSB 3CJCA 1P6TA 1Z1ZA 4C1NI 1TKXB 4M5JA 1WJ9A 3TP2A 2R7VA 4JNEA 1LFPA 4CZFA 2E7XA 2D4WA 3VGMA 3TO8A 3R3TA 3T1HJ 4FP9A 4PKIA 1DFDA 3DLRA 3J81Y 2L3MA 1T05B 2MZSA 1DAXA 4OLAA 1CSJA 4OI2A 3RR8A 4DR3F 1DJ0A 4DTSA 2OMOA 2DXDA 5D6GA 2R9LA 1VK0A 3PACA 3EZOA 3G9CA 3RBDA 2J7WA 4Q8EA 1Q82T 1LWXA 3DXBA 1WTFA 2YHWA 2PMZD 1NMNA 4EU0A 2GUPA 3D0IE 2W6LA 2PT0A 5BR9A 3QFUA 3H90A 2UVVA 2IY5B 2GJ2A 2QE5A 3DWLA 4L72B 1TP7A 3FCHA 1WF1A 5ETKA 3KKFA 1P8GA 4B3RF 4OX6A 3SJJA 1UEUA 1KDNA 1LWEB 3H4DA 2HVDA 3FFKB 1TL3A 2V52B 4FCYA 4IJNA 5JICA 1K8KA 2R8GA 1HHSA 3MM7A 4DV7F 4X4SA 2F4VK 4PL8A 4CEEA 1WEZA 2XBPA 1U7LA 2HNDB 3EX7B 2MKYA 2DR7A 2NR0A 1DY3A 5J2PB 1GMWD 2W4CA 1G6BA 3CQXA 2RIJA 3GBTA 4DR2J 2H4YB 1VR6A 1KD1T 3MCMA 1JJHA 1FNXH 4EHTA 4B1YB 2MQ8A 4K7QA 1ZAWA 2QJ3A 1I6JA 1NG9A 2V5HG 3MAAB 4MAKA 2MZ1A 1L3UA 4OYAA 3D68A 1BD6A 1X4EA 1YTUA 1RBRA 3KNGA 4H5TA 3PYEA 3U27A 1HNXF 3CC4S 4JD2B 2HK2A 4UQGA 1TYQB 3WUHA 2D9OA 1NU0A 3ENQA 4ZVPB 1N34J 1AB8A 4IXCA 3QINA 1JL2A 2V4JB 3AXKA 2IGIA 3VEYA 3EGWB 3J7Z5 4F0HA 1EWQA 2RAQA 3KJQB 3THYA 2QLBB 2XY8A 2YKNB 2WSEC 4IH5A 3TUJC 3PW4A 3S01A 2JWLA 1EKRA 3L7PA 3LWLA 2JEJA 3ZSYA 1VIOA 4ZCLA 4XH5A 1Y9OA 2EG1A 5E3PA 3TJ9A 4J5OA 4RW4A 3N4QA 1W7WA 4YOTA 1YI2N 4LF4J 2CQHA 4BQLA 4BRDA 4TQRA 2F7VA 1A5WA 2KRRA 1EP4B 2B5JB 4DR5K 4FLYA 4F67A 1FTCA 4N8OA 3ZSQA 5A8WA 3DLKA 3OFGA 3QGHA 1XQSC 4JI2K 3SSSA 5LJVA 4CD1A 4EP5A 4I2QB 1XMOF 9ATCB 1I5OB 2QN6B 1S1TA 3UD3P 2P9LA 4JI0F 1RAOA 5CZ2A 1T3NA 3D2FA 1FXDA 1KTQA 5DETA 4CNYA 4GKKK 1CG2A 4CLPA 4NLPA 2IDLA 3V6HA 2YX4A 3K2PA 5KFYA 4YOUA 3PEHA 3FK4A 3QNOA 1MN9A 3HD1A 4I6AA 3TVZA 5HMWA 3GZ7A 1QM9A 3NXZA 4DLEA 4DFPA 5AJ3J 2PC6A 4PR6A 2JC1A 3DXMB 4QWBA 3B54A 1BI4A 4DOZA 4ES2A 1WC0A 4FVCA 3A5MC 1WOQA 3PKYA 3H1VX 2KVQE 3NS7B 2JJ4D 2K1RA 1I94F 2HFUA 1GFWB 1VHIA 4K59A 2QRRA 4OO1J 1U0HB 1YGYA 4USTA 1VJWA 4X64K 4CVNE 6FDRA 3O1LA 4NRTA 3OJUA 3CCVN 4ZP9A 2FDNA 3LDNA 3AODA 4CJWA 1DLOB 5JMNA 3EO3A 2H5JB 1U1QA 3VETA 1V4TA 1OMSA 3U9DA 2Y0SD 3G86A 1BLUA 1MMNA 1I51B 2V8GA 1F2GA 3VQ6A 5AE2A 4FWLA 3VF0B 2VQEF 3MN5A 1RGIA 3C46A 4PWUA 1VC6A 4RW6A 5F3ZA 3R9LA 3Q8QB 4ECVA 3D7SB 3FZBA 2X3DA 1VSLA 1Y3KA 2CQIA 4DX6A 2ALZA 2QMXA 2Q3PA 2ZM6K 4B3OB 2YX1A 3M1VB 5C5JA 3J81U 4J2AA 4WFAQ 2F8HA 3C94A 2P9SB 4H4MB 2J8SA 3V81A 5B09A 2GELA 4MIBA 1VSHA 1TL7A 2CPYA 2GW8A 3FNNA 3MPDA 2A2CA 2O01C 3OLBA 3TUIC 3D1HA 2ASDA 3IMQJ 1X0PA 2A2DA 2EKYA 4X4QA 3RJMB 4LBHA 4NYZA 4MK9A 1JLEB 2G0CA 4I6MB 1FEHA 2CJAA 1LKZA 2XNQA 3SNNA 1WHXA 4KHSA 2RUSA 1JCEA 2HURA 4DV4F 1XNQF 2XGPA 4ZPDA 4IG0B 2NPFA 1KQGB 3O08A 4NLOA 3UE2A 1P90A 4WQ4C 3MCOA 2P2CB 1HBUB 2KM8C 2W2OP 3O9UA 4CFBA 3CDWA 1YUWA 1FXLA 4F25A 5AQFA 4CFDA 2CAJA 3M8QA 1QY7A 3HT0A 1C0GA 3KLEB 3CYMA 1Y5IB 2QMWA 2H1YA 2ROGA 1FJGJ 2J9DA 3QEPA 3TABA 2VF3A 2UUBK 3D0PA 3AA5X 4K4WA 3UVJB 4DL4A 3MMBB 4YDDB 4GO5X 2DGTA 2ATCB 1H0HB 4M3TA 4LF8F 2FZKB 4AL5A 2CZ4A 1VC5A 1NM2A 2RQ4A 4MJKA 4NL5A 3AO4A 1HMVA 2CJ9A 4KO0A 1YAGA 3ZFVA 2HQ3A 1JLGA 1YVNA 1REVA 3ZTQA 3OQ2A 4ID5B 2ZJQQ 1S6PB 2L9NA 3C15B 3EVWA 3O3HA 5F9LA 3GJSB 2FB0A 2OLWA 3AVFA 3V6JA 2HS0A 2F4FA 1NO8A 1NU4A 1VQON 2I2YA 2IYGA 4MKYA 3D28A 5HP1A 4B3SF 4ZTJA 4KI6A 1Q7YO 1U4BA 4E1MA 2EW9A 2C3OA 3I31A 4I7FA 3O3LA 5A2QO 3SQ1A 2P9KB 2ZF5O 3KUGA 3NWGA 2EBEA 2FLNA 2FYXA 2YNGB 1X31C 1ESVA 2P5VA 2YNIA 1RBUA 3DM2B 1SIWB 4OI4A 4ZP7A 4JKBA 2E5GA 2QXFA 3C14B 2FLPA 3W9JA 1VQYA 1UA0A 4ZTFA 3K5PA 4FPIA 3Q8SB 3NS6A 2JHEA 2YNFA 3HHEA 4KGXB 1NK9A 3QEWA 4ZP8A 5DRKA 2HPUA 2WBMA 1IQZA 3NF8A 2V2KA 4A8SA 4DN0A 1KAXA 4ETXA 4DR6J 3RU0A 1WC4A 4CQ1A 3PSIA 4BG9A 4F8RA 1FKAF 2OPRB 1CPZA 2CH6A 3MXHP 1BWVA 2E7VA 3LW5C 2F4VJ 2JOQA 3AO3A 4BE1A 5HK4A 4CGGA 2UUCF 3ZZYA 2HF3A 3KIOA 1R7IA 4UF4A 2AGOA 2IVPA 4DB3A 4MKVA 1RXOB 3CPWM 3A1YG 3BBBA 4OQJA 1UEKA 4JRQA 1BE4A 4O5BA 3BGRB 1X4DA 3JSRA 2DNZA 4CLTA 4E89A 2EK6A 4I9QA 5C24B 1X4BA 2MKIA 1WTBA 5LXRA 2F96A 2FZGB 4LBIA 4KPCA 2E29A 1F9EB 3MUVP 3AGRA 3VF6A 1RT1A 4G65A 5HVHA 3D6FB 2LEAA 2OH2A 5KPTA 3CJ3A 4DV2J 5IS2A 4J2EA 5KRTA 4GVMA 3S3OA 1IG8A 4CO1A 3QIOA 1D0EA 3NCIA 5D3GA 2K3KA 2QWMA 5CY4A 2ZDOA 4AILC 3QT7A 3H40A 3SJHA 2B9EA 4KBIA 1KAZA 2YPZA 4JP8A 2KL8A 2BH1A 4J90A 2GQCA 1HR0K 3ZZ0A 1OH6A 4A59A 4NCGB 1CJUB 2DGQA 5DG9A 4DSEA 2FF3B 2HB5A 3N6MA 1NHVA 5D4LA 1JJ2M 1LWCA 3LP0A 3HP9A 3VAIA 1S6QA 3TW0A 4Y0FA 3RSEB 1VSEA 3KK3A 4Z7YA 5SUHA 1S49A 1Y97A 1U02A 2OZSA 3CULA 5HAOA 2RB7A 1N36K 2XCAA 1KLMB 3H0PA 3AQPA 5FLXY 4MO5A 2BRKA 3VF2A 2B3TB 4CZEA 4DR5J 4M3UA 2O3DA 1KAYA 5AXLA 8ATCB 1J27A 3PFOA 2HQIA 1N56A 1IWGA 1VBZA 4CJ3A 4ZVFA 3HK2A 4LF5K 1F0XA 3TUZC 1OQ3A 1QVFM 5KFXA 4DS4A 2F5GA 4USHA 1GOAA 2IM3A 4GKKJ 3DLLL 4WFYA 1S59A 1VQ5S 2CJKA 3TOQA 3HZ6A 2CPDA 2VC0A 4ICLB 2CIMA 5HLFB 3KLIB 2C2EA 4M5DA 2EC2A 5F8NA 1EETB 3UN2A 4LR8A 2PDAA 3LZJA 3G82B 2MZRA 2E5LJ 2YWHA 3GFYA 3R6MA 4O3NA 4JI4K 2YWFA 3FEXB 1TUYA 1FESA 1HKBA 2LQ8A 2EHGA 1B0TA 1WELA 2CQ1A 3JXUA 2DNQA 2KXFA 4ECQA 4XDCA 2Q1NA 2C2RA 1U2RA 5BJRA 3TAMA 4YHHK 1FRLA 3MM8B 3RR7A 4FLTA 1KVIA 3U02A 4KTWA 3CIPA 2DIVA 3Q22A 4LSNB 1KS2A 2M7SA 4QW8A 3C16A 5BPMA 3J8AA 1RT5A 5IOLA 2WC9A 3VGLA 4E7JA 3R5DA 3IBCB 3L6QA 5A0YA 3MEGB 2HHUA 3NCRA 3CD6N 1YZ7A 1LOTB 2BR0A 1RDCA 3F9KA 1VRUA 1WG5A 2M2BA 4YB7A 4CK2A 2LYVA 2CQPA 3OL7A 3OTEA 2JFKA 2GVZA 2YBVA 4DSFA 3FR0A 4ZDNA 4CYUB 3VEXA 1WWHA 4I9LA 4GRSA 1C0TA 4OZ0A 2ZM6J 2NXCA 1VLOA 3C19A 2D41A 1UW4A 2HRUA 2MTLA 4P9SA 4BRGA 3MGJA 1HUXA 4U95A 4EO6A 2BACA 4CESA 4DPTA 3GYXB 2DNOA 1VRQC 3HHLB 3QMQA 3UNGC 3VEWA 1CJKB 2VASA 1UVMA 4GKJF 1RTDB 4KGKA 3HOSA 3TR8A 8AT1B 5K8PA 3CETA 3AVJA 4HL9A 4NXMF 1VQ7N 4HEA9 3M9MB 2JLFA 2VIHA 2QLJB 1XMBA 3BYPA 1HA1A 1HL6A 1X5OA 2HWHA 3EZUA 5DZ6A 1ZM9A 3UB5A 3V2UC 2FBYA 3G8TA 4RL1A 4BRKA 2LXUA 2R7WA 4PG8A 2V51B 2JEGA 1E6VA 3HMJG 4OHZA 1WSJA 2E88A 2NNWA 3AO5A 3SV4A 5KRSA 2YTCA 3ZZOA 1OSDA 1WD6A 4CEFA 4UOGA 4JI5K 1HQEB 5ETVA 2Z1JA 4LSZB 3JYTB 3KXDA 1TKTA 2KFNA 1WDDA 3RMDA 1KOHA 2ZC3A 3IXQA 4LQ3A 3CDUA 1S1XA 1BY9A 2B9WA 2MB0B 1AXQA 4ZPBA 1BQNB 3VESA 1IJFB 2GIFA 2KZMA 3CDBA 2ZH3A 3BJYA 3OXGA 3BEXA 3SCLE 1EO1A 3TEGA 3H25A 4O4GA 2YQ0A 3B4DA 4N41A 1JLCB 2R2SA 1N6QB 4OYWA 2AP1A 1HQUB 3OR2B 3OTOF 4PG6A 3THPA 3GTYX 2VBXA 1OYDA 1YITN 4B9MA 1T9TA 5J2NB 1NOZA 1RTJB 6AT1B 4CM0A 4DHYA 2GMJA 2UXDF 2XGQA 2O8CB 4WE1A 1JXBA 5E26A 4H0PA 2V2VA 4DPWA 2HIYA 2P9UB 3O9RA 3TPQA 3RRKA 1QTMA 1R6VA 3Q7CA 4C2MA 5FLXU 2HMIA 1K73O 4BBYA 4XH1A 1FD2A 4CO5A 2H4WB 3RBZA 1BMQB 4OX9F 5C2GA 4X66K 4DQRA 2D9PA 3CF5L 2GA7A 3J81j 4FJ9A 1DQ8A 2K7JA 4BGAA 3CI5A 4UTGA 1RAHB 3OYCA 3LTOA 2C3YA 3WXJA 2VZ9A 5AZIA 5T7LB 1JJ4A 1SV5A 3CCWA 1XIQA 3FBFA 3MM6A 3THWA 5KT5A 4RPFA 2JVOA 4FPAA 2QZ8A 1RTHB 2YKMB 5F1XA 2D3UA 4DV0F 2F65A 1VQNS 4B9SA 2OHDA 2AA4A 2MQLA 1T03B 4IO1A 4WFAL 5BN9A 2ASJA 4LC9B 3AAQA 2V94A 3PR4A 3I5CA 1XC9A 2CPJA 1VQ9N 4ELTA 2DNGA 2DISA 3PNIA 2Z1GA 1G4CA 2RQKA 3G71S 3BV8A 3NCQA 4RG8A 3QSIA 3OYDA 2W8LA 3EZWA 1TKDA 1NK6A 1VAZA 3M6GA 4B9UA 3M8PB 2UU9J 5T7BA 2DPJA 1RCXB 1N54B 4RUAA 4HUGA 1U6ZA 2IVMA 5HMYA 3VAFA 3GR1A 2VYPA 2WOMA 1TKZA 2Q43A 4C4WA 5L46A 3GLJA 3K8WA 1RWOB 4F0KA 2MJUA 4C3MA 1C0MA 2YX7A 3BGLA 3VALA 3MK6A 3ZEUA 4ETZA 2D3OR 2RF2A 3TSQA 1O0PA 3HHKA 4A2AA 4WK3A 2LKZA 1RT6B 4DL3A 1EQMA 4KTQA 3SEOA 3RGIA 2MYFA 4CGFA 4DV3F 3SMPA 3R1XA 3QNWB 4DR3K 2WSCC 3H98A 3PCOB 4DR1F 4FWKA 3DOMA 4C3LA 3M30B 2W1BA 3FC9A 1CULB 2W9AA 4YR2A 4OJHA 3MEDA 3K17A 4J9PA 2GUIA 5F8JA 2FGOA 4CF9A 2ZJQL 4ZVUB 3HKWA 5CD4H 4B3RK 3HCXA 4K4ZA 1HLUA 5BRHA 1FDDA 3ZX3A 1Y00A 3EMTA 4O0IA 3HFZB 2WW8A 5GAHP 5CZVA 2LECA 4DV7K 3RAMA 5IWAF 1S0VA 3NL0A 4YR0A 2LVWA 3VCDA 2M88A 2ZH9A 1BWEA 3I56S 4JKHA 7FDRA 4JKCA 1VBXA 1UWAA 3BF1A 2LLZA 1F3FA 5DMRA 5KT2A 3M2UB 5EGYA 1TL4A 5DG7A 2VFTA 3QNNA 5D0RA 1RU2A 3VZIA 2UZAA 4OLOA 3NBPB 2HK3A 2J6TA 1S12A 3G6ES 3M7VA 1Q7YT 2RH3A 4YHHJ 4YMEA 5KFRA 4MO4A 5MLCV 4WJBA 1BCMA 3E01B 2F9JA 4WU2A 1RFQA 3I9ZA 3OS2A 5AQLA 1FVQA 3RB0A 3DLHA 2BVZA 3CTRA 2KI2A 2WTUA 3BF4A 4Z7CA 1NM1A 4N77A 3LGHA 2OCEA 2V69A 5LMUF 1XWLA 3FBEA 3C6TB 5B0AA 3PW7A 3QBXA 5HQ8A 1HNWF 1JNZB 3BYRA 2XMJA 3B78A 2YQ3A 1G3OA 4WWSA 2OTJS 4YB6A 3TX8A 2CH5A 4MIWA 1ASWA 1QQOA 4XDDA 1HBOA 4RBVA 3Q8UA 2Z4PA 4CK3A 4QR1A 2VODA 4PAAA 4CK1A 3SXLA 3W2VA 1M0SA 3AD9C 5KFIA 5GAEU 2GHVC 1BUPA 3R1HA 4AH9A 1JKHB 5CHIA 3SCIE 4H0XB 4X62K 2UUTA 2KN4A 1D5AA 4LT6A 3ULEB 2ZOFA 3MAQA 1JLQB 5B8HA 5JXSA 3G8SA 4BY9C 3SQ0A 2B8PA 1S1WA 1IN0A 2P5GA 1TU0B 4X84A 3CXCR 4JI7F 3DRSA 4R8UA 5KFDA 1HNVA 2FC8A 2LCWA 1XMOK 1HLWA 3K5LA 2QFIA 3D0HE 1FO1A 4IUFA 4EBCA 1OH7A 4LRAA 4JI0K 2FHMA 3DOLB 4LRFA 1KTVA 3D2EA 3BUZB 3E51A 1VIXA 4YEAA 1R8BA 3N79A 1WEXA 2ROPA 4WIIA 2G8WA 4U8VA 1DTQA 4TXSA 1HPMA 3B8HA 3AVMA 1H74A 4U8YA 2FVCA 3WNFA 5LXYA 3CCRS 3M32B 5BRFA 4J9UE 1N52B 4LIWA 4JI8F 1T9WA 3FZMA 1NZAA 4YORA 2ZBPA 2ZH4A 3M5RA 2PA8D 4J9OA 1MMLA 2GNKA 3F9MA 2ZBQA 3MURP 4Q0BB 4JI5J 1I94K 5J2QB 3DRPB 1VLYA 4EO8A 3MWPA 4E1JA 4YP3A 3LP3A 2P5OA 1X60A 5AQNA 4FWPA 4A62A 1U1MA 2RE1A 5D4OA 2GO8A 1FJ7A 1RWWB 3T3FA 4CH1A 2HNYA 3QRQA 4DV5F 4NXNF 3HO1A 5CR4A 3VZHA 3UKUB 5AXMA 1CJVA 2J0SD 4WP9A 1RKJA 3S9HA 4ANEA 2VQEK 2BW7A 2AQ4A 1ZBSA 4O0NA 1VBKA 4UY85 2OO4A 1V4SA 4USMA 3D6MB 2X6NA 5JVHQ 5GIOA 5AFUH 3VVUA 2XO7A 4C8OA 2YWKA 1I3OB 4UOFA 4BREA 4Z0UA 1LWEA 2HS4A 1N33F 3J80O 1Z05A 2KT5A 2BUNA 1FW6A 3F2KA 1NKCA 3NGYA 3CCQS 3NY0A 4K5RA 3TAEA 5LMNF 4ZCKA 2VPYB 5J2PA 3OVBA 1YTAA 4GMJB 3CC2N 2R3VA 4EBDA 3O8WA 3LA0A 3OR1B 3MD1A 4C9DA 3M2VB 3L2UA 2BJ1A 1O1WA 2DGWA 2IVNA 4DU8A 2L08A 3NGSA 2OD6A 5JMVA 4DV4K 2NRTA 1WG4A 1XNQK 4ECZA 4WF9Q 3U1MA 2CVEA 1L3SA 2RE2A 5D0EA 4H54A 1N8RO 2DY4A 4JD2A 2F9WA 4EBEA 1RT4A 3UCUP 1TYQA 3RB3A 3V9XA 4CLSA 2JL9A 1H73A 2OIHA 4C8KA 5C7PA 1YZ6A 1KP6A 2M9KA 3MM9B 3MUTP 2HFZA 2EBGA 2WBRA 4FZVA 2ZVIA 1EXQA 3R5JB 1KLNA 2YXLA 2YKNA 3D6HB 3K8VA 3FZKA 4LF8K 3M8RA 4GC6A 2FUG9 3IR5B 2PIIA 1UETA 3JS6A 2HVHA 5KFWA 4CDIA 2UXCF 5F0UA 3ZTOA 2M8DB 4DV1F 4KHPF 4BRCA 4O55A 2ZE2B 1RILA 2R7XA 4NZ0A 4WYLA 2FVSA 2B5JA 4E19A 2DVIA 2ZKTA 1VQNN 1RADB 4FJ7A 1SCJB 1T11A 1ASUA 4YNQA 4I2QA 2ZBIA 2NS1B 3J7YP 1S6OA 3ADAC 4B3SK 3WBZA 2GWJA 3D2WA 2ETJA 2CQ0A 1WORA 5K14B 3QBWA 2GMHA 2LQJA 4DX8H 2DB1A 5CABA 4O3SA 4Y3CA 1YJNS 5ETTA 2GVDB 2ACMA 2RVJA 3WXIA 3QYYA 4GO7X 2G2OA 3RYLA 3TI0A 3DXMA 2PFDA 4CT9A 3M2RB 2A42A 3VHQA 2AT1B 3KG0A 1T9XA 2RKIB 4OYMA 3BP8A 1N5YB 1WUAA 5C42A 5GAGI 3D6TB 1D8YA 2H5EA 5LL6d 4RU9A 2ZGZA 2IBOA 2W2PP 3UO0A 4DMZA 1RDRA 1U0HA 3QGGA 2HVZA 3QO9A 2AIRB 1Q8IA 3TEHB 4MDBA 2BW2A 4KIAA 4P2SA 2GX9A 2BE7D 3IWXA 1DLOA 5BRDA 1TV6B 2MPUA 3QZ7A 4CTAB 4B3TF 1HJOA 5ADXH 5D78A 3BH6B 4IH7A 3OTDA 4Q5VA 5K20B 3PY8A 2QEXN 1QS4A 1JLBB 4DCOB 1Y5NB 3NCPA 2MXYA 2MGZB 1ZM2A 1GQEA 2HHHF 2VFRA 3W61A 4LF6F 4EFAC 4B3OA 1KQSM 2Z2MA 3JAMO 4Z94A 3QRRA 3M1VA 3GYNA 2DXEA 5I3UB 3SV3A 1WDTA 3GIMA 2P9SA 1K73T 2HHXA 4CEOA 1RT7B 3DGPB 3GILA 4N76A 1GK8A 1Q9YA 5ELZA 1S72S 1S1VB 4WFXA 1J5OB 4JAXA 4KB1A 4PUOB 4KE5A 2VD3A 5KFMA 1IBLF 1TK8A 2BKOA 4NLYA 2HWTA 5HSPA 1WF0A 4OYIA 1IG9A 1WN7A 1JLEA 1RE1B 3VTHA 4BE2A 4GV3A 4O44A 1ZETA 4RUBA 4AT1B 1VYAA 3DLGB 3GCXP 3FBBA 2CDQA 1KSPA 4I4BA 2ZH1A 4X62J 2GEMA 2ZNZA 4IG0A 3MDFA 4M5IA 4DTJA 2AW0A 3TR5A 2FD2A 3C6AA 1NXIA 1UPPA 4RNNA 1O13A 2FSKA 5FIIA 3R5CA 1OSCA 3PIOQ 5JS2A 4OYOA 2E6MA 4OZJA 3TQ1A 3UW1A 3ILIA 5CHCB 1S6UA 4F4YA 2ZUGA 4NWBA 4RNFA 1KVJA 3NVMA 2RDIA 4CF1A 4B9LA 3UVJA 4ECWA 3MMBA 3P4UB 1U1LA 3QLHB 2Q1LA 1VDHA 1URNA 1M90O 3HZGA 1NWKA 4Y00A 4NYFA 1X4HA 2W8KA 1U1NA 3IUCA 2EWSA 3DYAB 2ZNYA 2UV8G 5K5MA 4XIUA 3DJCA 3H6EA 5J2MB 5HJXA 4BRIA 3G25A 3MPUB 1YX2A 4OYPA 3SDEB 4JV5F 2NLXA 3PM9A 2KKZA 5LOQA 2XSJA 3IMXA 1B4SA 3O5TB 2N7CA 3SFUA 3HVTB 2CPEA 3VQDA 4IFEA 4KSEB 1CS4A 1I94J 3R5GA 2XY6A 5ETRA 2H3GX 4FM1A 3QMLA 2V8PA 2DGOA 2B7BB 1KVAA 2J6SA 1P9YA 3VAMA 3V9ZA 2AHOB 2P9KA 2UVUA 5F0WA 4CEQA 3QAEA 1HNIA 5HL7Q 1J2VA 5E3CA 1UKUA 1YJWS 1U24A 3D1OA 2VQEJ 2Z58B 3MR5A 2WZ1A 5J1EA 4ECYA 3P31A 1P9QC 4A48A 3HM9A 2B56A 1PAEX 1TVRB 5BREA 4J9VA 3N4PA 4K42A 2VGNA 4R0JA 3VERA 4U9RA 3IGVA 3VA0A 4LF2A 1IUJA 1WHYA 3S8SA 3ZO7A 1KHVA 3H3OB 1Q1KA 3D45A 4TY8B 4CGHA 1U6FA 2RS2A 3R5BA 1NJIO 3HHDA 2CXEA 2OPRA 2AZ1A 3UFCX 2OZMA 2JEFA 4DLGA 3GG0A 2DBBA 3CJ5A 3QQCD 3BO4A 4PKHA 3GOIA 4TSXA 2Y8WA 5E2QA 4FYVB 2NRWA 3BGOP 4DJBA 4QQBA 3K58A 1P8ZA 1I1GA 1RAIB 4NXMK 2VICA 3BGRA 3OVSA 5F2RA 3JQKA 1MSWD 3BBFA 4LREA 3KDNA 3POTA 5C24A 2M8HA 3E2EA 2XMAA 2DR9A 2XHCA 2BJ7A 4QIGA 3BO2A 5DQHA 3IWNC 4I69A 1FJEB 2DY9A 2VKRA 4QPXA 2IVYA 3NAEA 4IDHA 4NE9C 1Q4RA 1OO0B 5HO4A 3V6KA 3QIDA 1RBSA 3EGNA 3G6XA 3PG9A 1OIAA 1ITGA 1GLJO 3HSGA 2A3JA 3FUYA 4ZVOB 1ZZFA 2B51A 1NZ8A 1LWFB 3WZ0A 1CJUA 2K8GA 5KFZA 4NO7A 5KI6A 1ZA1B 4LFCF 5GADI 4CZLA 3D3BJ 4LF8J 4K8RA 4PXEA 3P3DA 3U9ZA 3MXJA 3L2WA 2HFNA 3LOUA 3M8WA 2VL1A 4JKDA 3MEEA 1LOUA 3HYFA 3O4NA 1TK5A 4KB0A 4DV6F 3WEEB 3G6VA 4ED6A 4CH7A 3GE1A 1CZAN 3OTOK 1HJRA 3BQ1A 2YKQA 1KFSA 2OJ3A 4ER8A 1ZAVA 5AXNA 3HVRA 3IG1B 4Y1DA 1IO2A 3IAS9 2MY8A 4MKAA 2WK4A 3FFIA 4B3SJ 1WNSA 4FYXB 2V8HA 2UXDK 3THXB 3CO9A 5KFOA 1R89A 4G1QB 5KT4A 3DDIA 4J9NA 1WSHA 5F8MA 3NGTA 1NHKL 5T41A 2X78A 3BSCA 2J6UA 2RSQA 3KK2B 5KG4A 4CWBA 1YK9A 3KLIA 2QWNA 4WCEL 1VQMN 2IM2A 3LPEA 1R0CB 1EETA 2DNKA 2H48B 4PA1A 4K0KF 4XAKA 1MLAA 1BG3A 3G82A 2V8VA 4LJMA 4M1KA 2R8IA 2O8BB 3J7A1 1FF2A 1SH3A 3CCSN 2PGCA 1EX8A 4OX9K 1T9UA 1HPZB 3CJTA 3PX4A 5B0CA 1BOTO 4DPOA 3HPGA 4DF4A 2DTUA 1UFWA 1KVCA 3P4IA 2I0XA 3R2DJ 3MM8A 3O9QA 1VQ4S 3OYIA 4DUZJ 3TA2A 3VQEA 5JVHL 3VQ4A 2G8UA 4BRLA 2XYHB 3GG1A 2A6OA 4LSNA 4DR4F 4JI1F 3J7AN 2EI5A 3RBEA 3AVIA 2WHOA 3OS0A 4QIWD 1RQ0A 2PMHA 4EYHB 3K9JA 4DV0K 2CJYB 2ZOMA 3VAHA 4JKGB 2EFNA 3VQBA 4NMXA 3MEGA 4OV1A 3GYGA 2NSBA 4I56A 4BCAA 3QATA 3A5LC 1RTIB 4RO0A 3W63A 2JSXA 1FFSB 1UJ4A 2R7SA 3MMCB 5HVGA 3AOAA 4DX5A 4BC2A 4C8ZA 4BWMA 2ZEJA 3N5BA 1FE4A 4RJVA 5HN0A 3LM9A 4CYUA 4FXDA 2XMUA 4TU8A 1SJ4P 3GIRA 3OYGA 1FVSA 3ZX0A 4GVBB 2J76E 1YJ9N 1GNKA 1J5EK 4OLBA 4TLQA 3KJVB 3GSDA 4WF9L 3FRYA 5CZ1A 1QQCA 3CJRA 1Q9XA 2KVIA 1D9FA 1BHNA 3HHLA 1CJKA 3KUHA 4CD3A 4J7CA 2OI2A 3BN7A 1RTDA 1VQPS 3AY0A 4J2BA 4WZQA 3AT1B 5CYQA 2BMBA 3R2CJ 1WI8A 4EZ9A 4HTUA 3BO3A 4BROA 4ED4A 5CCMA 5AE3A 4DV3K 3EPIA 2APOA 1HWIA 2NYIA 2I9SA 4TNOA 2KJWA 4DR1K 1JLAB 3NLCA 1OY6A 1N8RT 3FGVA 1T9VA 3AVKA 4A5AA 2QA1A 4M45A 4FKXA 3UWTA 4LR7A 1R3NA 2ZHAA 1SS6A 5GINA 1IKVA 4M5NA 2BV3A 2QT7A 2E7WA 4R0EA 1CJTB 4DQPA 4V1Ak 4CHNA 2FLLA 1Q0NA 2PFUA 5KFUA 3UKRB 4DS5A 4F3OA 3VGKA 1JXLA 3OUYA 1TL1B 1U8SA 4J9LA 4Z4IA 1HQEA 2LQ5A 3GMGA 4WKRA 2NXUA 3BQ0A 3MN6A 1ZC6A 3MR2A 2XZDB 4OZ3A 3JYTA 2CJBA 4FJMA 1VQ6S 5KFSA 5D4PA 5IWAK 1KFDA 3ETMA 5A6PA 3DRXA 4TN2A 4GC7A 4OZ5A 5BYQA 3BEGB 4BR2A 3SSRA 2XC9A 5FPDA 2Q6BA 5F8HA 2GIRA 4L3QA 2A40A 1QE1B 3J81O 2OPQA 3JXOA 3QWUA 1JLCA 3E1YA 1Y4ZB 2CZVC 3DRRA 1NK4A 1HQUA 3OYMA 3VQPA 4OX7A 4DN9A 2QIFA 4DR7F 4HTLA 2EFGA 5J2NA 1NCLA 5IT0A 2W24A 2R2TA 3C7NB 2HBKA 2B7CB 2O8CA 1V9OA 2D1KA 5LSRA 1C1CB 4G9ZA 4RWTA 3OD2A 3OJSA 1XUPO 5GMEA 1KRPA 1YVFA 2DNRA 2P9UA 4IRCA 2DCUB 3V1OA 1HNWK 3HI9A 4ZLPA 3FKBA 3M6WA 3ZNUA 2KG0A 2HRYA 4JYAJ 1RBVA 2QW9A 3CMQA 1MN7A 3HHLD 4OYXA 1JXEA 4Y2IA 2DO0A 1X4FA 2FVQA 2P8IA 4A8YA 3LL3A 5HOOA 5AZJB 1CVJA 2DGUA 2N82B 3NF9A 3SFGA 2AV5A 4MH8A 2CNOB 5L39A 2R7QA 4IDKB 3LP2B 1IR0A 4IOCQ 4BS2A 4C8LA 2V9WA 3KD5E 4UW2A 5T7LA 3JSMA 2Q97A 1N5SA 3A5OC 3TJ8A 1WKLA 5KFNA 5E3QA 4C0HA 1LXNA 5JLHA 3UR0A 3BM7A 5JVGL 4JI7K 2MLXA 4F2RA 3DHXA 2RT3A 1L3TA 5C15A 5AXKA 2UVWA 4XH4A 4BG8A 1VSKA 1T03A 5KPRA 1FK9B 5MAOA 5IT9O 5GMDA 4M3YA 4NXMJ 1Q5VA 3G10A 2ZQBA 1HI1A 3CJKA 4PQAA 2WTFA 2IAJA 1XJWB 3N6NA 5I3QA 1NSQA 3B4MA 1WF2A 1NMEB 5E7OB 4HHHA 2U1AA 4AYBD 3IFRA 1VRTB 3PRDA 4WFZA 5KFLA 2F3JA 2P9NA 3M8PA 2QA4N 2W4PA 3ITHB 2IMWP 1JCGA 2I5JB 4JI8K 4DF8A 1Y5LB 3QRPA 4ZVSB 2HWIA 1EKSA 4MK7A 3MTJA 4URSA 3T1AA 4BRAA 4HWIA 3QBCA 3UR3C 3CWJA 1C1BB 2PY5A 2X74A 4HUFA 4DFKA 2IM1A 1PC4A 1QQNA 2VC1A 4XO0A 5GMKa 4FK0A 4F36A 5C25B 4F9OA 4M3WA 4WQ5A 1YI2S 1H2VZ 2OPPA 4KHMA 2BJ8A 3GB0A 1Z4UA 1CC7A 1Q95G 2NZ4A 3CJ8A 3OYKA 4I1TA 5F0XA 5ETQA 3MR6A 3Q8YA 1KXPA 4H03B 4TYAA 4FS1A 4O0JA 4DV5K 4NXNK 4OVLA 2FHOB 2C2KB 1VQLN 4U96A 1HYZA 3RAXA 5CE3A 3F5TA 1VK8A 3A8EA 3SAFA 1XI1A 5B0GA 3OVNA 3ZC4A 4HH0A 4RR5A 3QETA 1CULA 4C1NK 4P75A 4J8FA 3IRXB 1J54A 3OTOJ 1WG1A 4AHUA 3E8OA 2OPSA 1YJVA 2CQBA 1RP5A 3IM9A 4GVEA 4LF4F 1N33K 5KG6A 5FDLB 2AJ4A 3IFEA 1M90T 2BANB 1TFWA 3PKMA 4R5PB 2QLFB 3QFPA 5A8KA 1WBDA 1JIHA 5LMNK 3WHIA 2XNRA 4YB5A 3A3NB 2QLWA 3R5AA 4IQMA 3M2UA 4I2PA 3ZSOA 3A12A 1NDPA 2P9IB 1GH8A 2VG5A 4Z4CA 3MMAB 4F3QA 3SBGA 5HL7L 2HQCA 4HKQA 3CCVS 2PYLA 2HBQB 1ZTTA 1F2HA 3LAKA 3QB0A 3VMFB 2A1RA 3DGVA 2F8SA 2GAGC 3CD0A 4P74A 3BREA 4FJGA 3KHHA 4TYBA 3W7BA 4LQ9A 3PX6A 3HJVA 4OYBA 4Q2MA 5KG3A 3PIPQ 3K9KA 2E2QA 4OLPA 3MCAB 4H4KC 3C6TA 2E1AA 2OSQA 3QWPA 1IKYA 4P2XA 4EHUA 4X4RA 4ZA1A 3DLEB 2VHGA 5AQJA 1UTAA 1GLFO 4FLWA 4XTTA 4DU1A 4BE0A 2VWKA 3G0ZA 3W66A 3C2PA 1FA0A 3RUBL 1W7AA 4E7IA 4JV2A 2UV8A 2IJRA 1HRHA 2H5IB 4KHRA 1NLKL 3IWLA 4MLEA 2IM0A 3EN9A 2UXCK 4LD0A 2VBWA 2YWEA 3K5MA 1JKHA 1NJIT 5E3RA 4DV1K 4KHPK 3G87A 2P9GA 4S0MA 3ULEA 2R7UA 2E8AA 2Q6CA 4OIXA 1TAQA 2J0XA 1J5EJ 2DFEA 3MCPA 1NJWA 3UNYA 1X8DA 3DHWC 2FHJA 3CEDA 4IO9Q 2HHSA 2W25A 3RVCA 1Y64A 2YNHA 3NMRA 3ZSZA 3EE8A 4WYBA 4KR0B 4M95A 1LAVA 2DJWA 3DOLA 2XYPB 3MFIA 2ASPA 4MQ3A 3OTBA 2CPIA 4K8XA 3ZYYX 3W5ZA 2KJVA 4QIEA 4BRHA 4NLUA 1SL0A 3IS9B 2A1SA 1IJEB 5BYSA 4DR1J 5M1OA 3KG1A 2OAUA 4CIGA 4KRFA 1HNZJ 4V19S 3OXFA 2HHWA 5AQQA 4IQXA 5HRSA 3OYHA 3HDSA 1FWPA 1NUEA 3THYB 2VFSA 4B08A 2KT3A 3O5BA 5FPNA 4MT1A 3RBXA 1CLQA 3ENAA 3W2WB 3S41A 2IC3A 4NPOA 2ZH8A 2DK2A 4CFCA 2IRYA 4QIFA 4ED5A 1R0AB 4RW4B 4H4KA 5J2QA 1VQ8N 2AYGA 3DRPA 5L1JA 1WSFA 3PO4A 1JWWA 3DDKA 4FJ5A 5EX0A 2C2DA 3LPUA 2EFQA 5IWAJ 2D74B 3MXIA 4Z37A 4B3TK 3UKUA 1S1TB 1VQOS 2V7ZA 2NRHA 4RCHA 1Z26A 4FBUA 1RYSA 3QJPA 1UVJA 1RI7A 1N0VC 5IT4A 1NSAA 2OUGA 3GDQA 2CADA 2FLOA 1S7IA 1HARA 4OGCA 1MMDA 5LM7E 2ZJRQ 2KYZA 4O8KA 4LF6K 2YVSA 4D3GA 2W41A 4NA1A 2QGFB 2AJFE 5LSLA 3WT0A 4NLVA 1PGZA 4OKKA 1Q79A 3HVWA 3T5HA 2EFPA 4RKUC 3DLLQ 1BI4B 2FJXA 3K89A 1Q8LA 2FHJD 1EAYC 4RBTA 3THVA 2EPIA 1IBLK 1XK8A 2ITGA 3SIPB 5EY4A 5HMXA 2VWBA 2VONA 3VQCA 4FNHA 1RT2B 5I3PA 4JK9A 3VGUA 4C7QA 4C11A 2LQ9A 3M2VA 3L4IA 1KQFB 2CG4A 4I68A 1UA1A 3I82A 3B8AX 3SQ2A 4DTRA 2P6TA 1QAJA 2DHSA 2QV6A 4KQZA 5HQMA 4U7CA 3ZNJ1 4LRDA 2KQ2A 2HHTA 1RHMB 5ADZA 3DCAA 5FROA 1FDNA 3ISND 3V4IA 4RW6B 3T19A 4QS7A 2A3ZA 3DKDA 3KMSA 1QSSA 4DCHA 4BRQA 2VQFK 4JI7J 3TQEA 4F26A 3FE1A 3CIZA 2LEBA 3QEXA 2O1PA 1UVNA 1OH5A 4E1NA 4DL7A 2WVBA 2KHOA 2ADCA 4AXIA 3T5JA 3EYZA 3UDEA 3C65A 2GGPB 3T7ZA 4B1WB 1XEZA 5L38A 1Z6RA 5FRNA 3OYAA 5RUBA 3RWUA 5AQZA 3MXMA 1ILYA 3P96A 3CFPA 4DR6F 1CLFA 2P9PA 1E3MA 3D67A 2YHAA 3ZT4A 5JLFA 1REGX 2F4VF 3BR8A 3V81B 4EIAA 4M3RA 2RHSB 2H65B 1ZBIA 3I0SB 2VH7A 1WC6A 3ONQA 2G2YA 1D3WA 3SQGA 4DWIA 4CEZA 2ZE2A 2VDHA 1VK3A 4A57A 4JI8J 4JKFA 1SC1B 3MCNA 4BVOA 3UQSA 1SJ1A 2C1EB 4BVPA 3CCJN 4NMLA 3Q7BA 4I67A 4FS2A 4HT7A 4EI2A 3MX5A 2JDJA 3KK1A 1FX4A 3T5LA 4FLVA 3SCKE 5FLXO 4BACA 1B3TA 4DV2F 4MIAA 2GV1A 4ECUA 1K0VA 1QVGM 2GFFA 1R27B 2A10A 3H5XA 3UCZP 2E1RA 4N8NA 5KT7A 3ICLA 3QT8A 1VMBA 3M8QB 4DV5J 4NXNJ 1KVBA 4YOWA 1NOYA 1ZH5A 3UDCA 2PYJA 3AVNA 2GVDA 1BGXT 3E3XA 5GAGP 4DTPA 1EKEA 3JQJA 3AAPA 4RW7A 3C6UB 1KKHA 1ZOTA 2Y1RI 3RW6A 4KBOA 4LBPA 4ZCMA 3FMBA 1BDGA 2M4MA 1CEZA 2CNLB 1BUXA 2NZTA 1H7XA 4F4XA 4KO0B 2HNZB 1HHTP 3L3CA 1N33J 4JV1A 2KTQA 3CMAN 1JLFB 4KPYA 3WNGA 4MFBB 1TL5A 2D0OA 4AL6A 3EDRB 2DHXA 2XLKA 1PAUB 3VQ5A 2ZZTA 3MF5A 4ID8A 5C2FA 1X5SA 4CTAA 3VENA 3H20A 4HCCA 1OKJA 1ZBFA 4WZMA 3US5A 2ZDPA 4HLBA 4GKKF 1Z25A 3AVCA 1JLBA 4L76A 3FLCO 1OPZA 2DNPA 4Q43A 2Y1IA 4ZVEA 1RDBA 3IR7B 1F1BB 1RT3A 1T9YA 4ED1A 3TNVA 2C3MA 2N4DA 3AVLA 5TKWA 2YNIB 4DMNA 2E5LF 2YJFA 3CD6S 2X1GA 4J91A 2ZC4A 1JX4A 2VGMA 2CWKA 2YH1A 2DTJA 1L3VA 4FYDA 5KGXA 4KH1B 1OVYA 2FC0A 5I3UA 4IOCL 4KHQA 4Z4HA 4DCPB 2BM0A 1U1KA 3DN9A 1WB9A 5H9EK 3HSJA 2YNFB 2KM8B 2JWKA 5U47A 1S1VA 2X3GA 1J5OA 2V4QA 1PILA 2BTFA 1O6XA 1NDCA 2HBYB 3CM5A 5A6WA 3MN7A 4LFCK 1LXJA 1WOPA 4KKOB 1XNRF 1TQLA 5M2RA 1I3AA 4HVZA 3L4BC 5L9XA 3CF5Q 5JS1A 1IKWB 4JI3K 3AA4A 2AYEA 2UXCJ 4UZBA 4B1XB 3IO1A 1QZ6A 4KHPJ 1LW2B 2NSCA 2GC8A 2J0WA 4NLCA 4UUXA 1VQ7S 5AQXA 3LP1A 2LU2A 3ENOA 4QOTA 5F3TA 3C66A 2FGCA 4BRPA 1Q86O 3BKTA 3DNCA 3M8ZA 4YQWA 1ZM3A 2M0GB 3I32A 4URGA 1RT1B 2L48A 1NHUA 3TAFA 1WNEA 2DH8A 3A3OB 5D3GB 1ZA2B 2KO1A 1H7WA 1EARA 3ZXWA 4NLWA 4K0KK 2VOPA 4E3SA 3G4SN 4OKJA 2HBLA 4PY5A 4FOIA 4A8MP 1ATSA 2ZUAA 1LCUA 4B3MK 2CQGA 2V67A 3RRHA 3DYAA 2YKOA 3GFHA 4FJKA 1S5ZA 2R7TA 4CZIA 1LWCB 3LP0B 3R27A 3G6YA 3SDEA 2JEIA 2R4FA 1S6QB 4BHQA 3H5UA 2C2ZB 5C2DA 1FKPA 3HVTA 4LF7F 3KLGA 4BR7A 2G0IA 3K5NA 1JB0C 3WC2A 2B9YA 1RAGB 3CO0P 1UPMB 4CP5A 5D77A 1XTZA 1HWUA 4C0OC 2YV0X 1XC3A 4DR4K 4RWWA 4CF0A 3NE6A 4JB8B 2HSEB 4PCQA 2ABYA 2PO4A 3JSBA 3T1YK 1ICEB 2J7UA 1KONA 1LFWA 2DIUA 4YY3J 1FRKA 1YITS 4B3TJ 2VPXB 4RLEA 2POKA 5DM6L 4IZ9A 2WBNA 2O8DA 1KBRA 1TVRA 2AZ3A 3SQOP 4ZOSA 4F4AA 1SBRA 4E98A 1R0BG 4M5DB 3HJFA 2GTDA 3D9BA 4DUYF 1T94A 2HZVA 4LFBJ 3L0QA 2HSTA 1SC3B 4TY8A 4CI0B 2XYGB 4A4JA 4DTUA 3P45B 5GAEP 1R6YA 1FJCA 3MM5B 2RMLA 2X1AA 4FSVA 4IOAQ 3W9HA 4ALZA 4CLZA 4XPCA 3OXLA 3HSCA 3FCVA 3UDVA 3GJTB 3PIPL 4R25A 2DNMA 4Z4GA 3GJQB 2JZ5A 4QU7A 1VJQA 1NSPA 1T0TV 4CGJA 3AAWB 2C22A 3FZHA 4ED7A 4M5KA 1MU2B 4WK1A 4ZS6A 1WOSA 3CVKA 2FSNA 1NGEA 2BUPA 3CPWR 5FPEA 4MDAA 4NYNA 3RMAA 2MMYA 4WXWA 4X4UA 2G0JA 2Z0GA 4PPZA 4DSIA 2HFOA 2ZBRA 3CC7N 1FEEA 3BPDA 4LIRA 2NUBA 4ES1A 3CJ1A 2Z57B 2B6AA 1RWMB 3KJNB 1VQ9S 3MOJB 1B0VA 4KV8B 1RAJA 2VQFJ 1YVUA 4USUA 1VSFA 3KDOA 5GIPA 2B9XA 4USIA 1SQFA 1U09A 1XERA 3CJQA 1Q16B 5JUMA 4TVAB 1UJ5A 1RISA 3K2YA 4IO9L 3FZLA 5ETSA 3FQKA 4HR2A 1T7PA 1TZ0A 3WIVA 4MTPA 1RBLA 3OSPA 3CT9A 3OW2M 4K8ZA 5KTQA 2BEFA 1RWXB 1RABB 4FBTA 5KGWA 3VQTA 2MKJA 3OV7A 2LQBA 4MK8A 5KFHA 2MKCA 1S0NA 1S9GA 1WC5A 1JJ2R 3KG4A 4J9KA 3BPSP 5IC4B 3ZTRA 3BDEA 3WEEA 5KFJA 4NYPA 5LJ3Y 2ASLA 2Q79A 3CPEA 3RAQA 4KHNA 3DMJB 5BXIA 2WONB 2O8EB 3LO3A 3PW2A 4DR7K 3KWGA 2HBRB 3IG1A 4FWOA 4XK8C 4BDYA 1DT9A 3WQUA 3I55N 2UU9F 1GLLO 4FLUA 1E6VB 2W9BA 4FL9A 5EHHA 2VBYA 1K1QA 4IKFA 1MROB 4PRFA 4OZ1A 3W1YC 5K8NA 3IBFB 3BKFA 2BJEA 1RJJA 3T9ZA 3KK2A 3PO5A 1N32F 2QI2A 2OGUA 1QVFR 2RN2A 3IBWA 3CUNA 4A8OA 3VGVA 5EUHA 2QWRA 2O8BA 3NMAA 3Q24A 2IDOA 2ZBCA 1F5BA 4FVMA 4YOXA 2F8TA 5H9FK 1SL2A 1IR2A 1HPZA 2VFUA 4DKWA 1TKTB 2XMMA 1N5QA 4K25A 1S1XB 4IRDA 4HUEA 2ZWHA 3PLAA 1CXQA 3LDPA 3NWRA 2B4VA 1MWYA 3KLVA 1UVKA 3K5OA 3SMZA 3NH2A 5B0FA 2OFHX 2BDPA 3LUYA 3MFHA 4O4GB 2R8KA 1RCOB 1GTHA 2QLXA 2ZJRL 2RQCA 2D0PA 5EU7A 4JI2J 2A41A 4WXOA 3I0RB 1SUQB 2ZWPA 3ZT0A 4BC4A 1IJJA 3O2IA 4HT5A 2WAQD 4JKGA 1RAAB 3VEOA 1OY8A 1RDDA 4P10A 3AD8C 4U67Q 3NF7A 5FRMA 3FRZA 4RWXA 1RTIA 5EN1A 2DO4A 4WE1B 2W7PA 3IN5A 4F2SA 4CERA 1GEHA 4QJVA 3MMCA 5AE1A 2CG8A 4XPEA 4HACB 3JTPA 3B6OA 2G2ZA 2V0NA 2HLTA 1YWXA 2QWPA 3SAHA 2HMIB 1ZXOA 2PFFB 3QT5A 4H5WA 2PZSA 1BQMA 2CPFA 4GVBA 1U2CA 3EXCX 3ASMA 3DI6B 2YHXA 4RW9B 3KJVA 2FY1A 1UL3A 3KMQA 4P2MA 1NSKL 3CCMN 4DPXA 3KLFB 4E7LA 4ILJA 4DZ6A 2EC0A 4EMDA 2MLYA 4PXBA 2IRXA 4YHHF 2J9DE 2Q2RA 1PYSB 2GAHC 2EFVA 2N3LA 4I0WA 1SH0A 4QR2A 4X64J 5IXUA 4ZPCA 2A6MA 5ETOA 5DDOC 4JK8A 4PYAA 3THWB 4GMKA 2DPIA 4L73A 4M5LA 4G6VB 4PXDA 1RB0A 1TUUA 4JI3J 1KC8O 2AD9A 4K43A 1JLAA 3UIQA 1P1LA 3NOGA 1O5JA 1MNEA 1X0FA 1W97L 2A6AA 4NLTA 3LPYA 4IR1A 4IYQA 5EX3A 2CRLA 2PE8A 4HDGA 3SUOA 2O5DA 4LRCA 3MWBA 4CW7B 3G96A 4CLWA 2KFZA 3FGUA 3SUQA 4CGIA 4O3QA 1CJTA 4GY2B 2DEIA 4X65K 3ZT2A 2W7AA 3UKRA 4LH4A 1TL1A 3A5NC 3OL6A 1YIJN 1C4CA 5CAAA 4LF4K 3HZEA 3M8YA 3QEIA 3O4WA 1TKZB 1MW7A 2G13A 4BDPA 2Z2LA 2OSRA 1U6BA 2E2PA 4RNOA 3CCZA 4K0KJ 3GIKA 3ZEUB 5M1PA 2QC3A 4QOZB 4X4OA 5C0YA 3D54A 3LM2A 3QGPA 3VGSA 4B3MJ 3VEZA 3BB5A 1RACB 4QW9A 1QE1A 3FSXA 5A8RB 2QMUB 3I96A 1RK8A 3PVXA 4WFNQ 3KK7A 3DOKA 5EVZA 4DG1B 3LDOA 1R31A 4K4YA 2GS8A 4IJAA 2RQMA 2C28A 3AVBA 2YWWA 3NFAA 4H0TB 1BO5O 3DOMB 1AT1B 2BE2A 2QTWA 3PRBA 4Z2XA 2V63A 1RDWX 1X9WA 3C7NA 4W5QA 5K9FA 1C1CA 4HYKA 3FSIA 3VOVA 2GQQA 3TJAA 1RTZA 4WU3A 1GX5A 5L8RC 1MWZA 3TWZA 3T1YJ 4QWEA 2I7NA 1U2VB 4C8MA 5KQ8A 3WDOA 3DAWA 5AQPA 2BX6A 2VG6A 4CRJA 2UUBJ 1UJ6A 1IKXB 2X7IA 2WVCA 4ZKAA 1WAJA 3ZX2A 1A5XA 2ZHBA 1S4EA 1HKCA 4J9RA 2MHNA 1M5VC 3FZ2A 5AZJA 5IM0B 2FVRA 1JNRB 3NEKA 4OJ1A 5K8MA 4FJXA 2MQNA 3AA3A 4CEAA 4IDKA 4B9VA 5GAHI 5LY3A 4FZZA 3QIPB 3ET6B 3CC2S 5M2PA 4ZVHA 2KB2A 3ZZTA 1HBMB 4PKDB 4YDUA 4JI6K 1HHQA 1YJ7A 4CZGA 4OGEA 4Q8FA 1A7GE 3AB4B 2GJIA 1YRUA 3MPVA 2ITMA 4OKEA 3I5AA 7FD1A 4DSKA 4LF1A 2YQ1A 2XS7A 3LWMA 4JS5A 3ENHA 2D7SA 4FZXC 4H4OA 1FK9A 4A8QA 4CJ5A 2CKWA 2QA2A 2A18A 3W5YA 1T8EA 3BZKA 4M5HA 3TZZA 5GAGU 4E2FB 4DFMA 2C2NA 2ZHOA 2IJFA 3FBCA 2IOCA 1IXKA 1HW8A 4U7UK 3ILJA 3ITHA 3FDSA 4FXWA 1ZBHA 2I5JA 5AQWA 2K06A 4BR9A 2CJQA 2IRUA 2W9CB 1F5AA 3W2VB 1RCHA 4P7VA 3UE5A 1YQHA 3ZCMA 2HFVA 4AXJA 1R59O 1Y7PA 2VJVA 4YOYA 3H42A 2O4GA 3A8JA 3L3VA 1XMQF 2JLEA 1S1WB 2VJUA 3QESA 1KNZA 1B70B 4ZCIA 1V3SA 1C0FA 1Q81O 4R8UB 4NLQA 5L1IA 2RJZA 1HNVB 3BQ2A 2VPWB 2XI3A 3AH6A 4UQTA 1LEOA 3ZZZA 5KFTA 1Q86T 3JS9A 2XQCA 4KGVB 2ZFHA 1AFJA 1FRHA 5CYMB 1IQTA 3IRXA 3CQYA 1HYSB 4DR7J 2XLJA 1RBAA 3TAGA 2Z1IA 1TTHB 1GLAG 4CHPA 1W2BR 3WQPA 2ALYB 2BANA 1K6YA 2BE9B 3SZ2A 1XN9A 4P6QA 1HR0J 4R5PA 2P1JA 1E6YB 4X2BA 5KT6A 4NLGA 3NAHA 4MYTA 5KFEA 1WSGA 2HZCA 4USVA 3H5SA 2PEBA 5H9FJ 3VV2B 1X4GA 1BQXA 2BOPA 3LDQA 2P9IA 1IBMF 4JKEA 3MMAA 3ETOA 3F0NA 1AROP 4C23A 1GLEG 2E1ZA 3MMVA 1X9MA 1K0TA 1N36J 3SCJE 2HNYB 3FEYB 2ATQA 2DNHA 1CJVB 1NGBA 1H2UX 1I39A 3SMSA 1D09B 1UOCA 4Q7AA 2ZH5A 5DDPC 3IA0A 2QEXS 2OTLN 2KFYA 2H9ZA 3CCLN 2JH3A 1W2BM 5I42B 3P83D 4C8YA 4LF5J 4QCLA 1L5UA 4BQZA 4JHDB 4IG3B 4OI0A 3BZCA 2LEPA 3K57A 3TZXA