3E01A

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
556
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Gag-Pol polyprotein
total genus 153
structure length 552
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3e01A05
1WSHA 4URGA 3FRZA 5FRNA 1JKHB 4IFYA 3KIOA 4R5PA 4DLEA 2PYLA 2XWYA 3MFHA 1TK5A 3UQSA 1S49A 3MXMA 5HROA 4YMEA 4FJIA 2V4QA 2BANB 4W5TA 3C6TA 3PO5A 3LALA 2D7SA 4DQPA 4C8KA 4CJEA 4PUOA 3H98A 1ITGA 3PX6A 3HVTB 5JXSA 3HVRA 3V9XA 4DU3A 1XI1A 3E51A 2IJNA 3V4IB 1D0EA 3CG7A 4DSIA 4K8ZA 3TAFA 5KG4A 4M3UA 2YKNB 1SKWA 1VK0A 5D3GB 1JXBA 3QEIA 4KTQA 2P51A 3QETA 4WZMA 1S9GB 4TLRA 3SUPA 4KPYA 2HNDB 3E01B 2GIQA 3EPGA 4CEZA 4EBDA 1FK9A 1TV6A 5HRNA 4KB1A 5DG9A 4DFMA 3SNNA 1TGOA 3RBEA 5DQGA 1I39A 1SL0A 3LWMA 4ECQA 4QWAA 4M42A 1C1BB 1LW2B 4RNOA 2ZQBA 4CEEA 4E89A 2D5RA 4WZQA 3OYGA 3IRXA 3RR7A 5EDWA 4M3RA 4DTUA 4F4KA 3DYAB 1S1TA 2E6LA 2Q3SA 1ASUA 3KLEB 3NH2A 1D1UA 3I5CA 4LD0A 3I8DA 4FK4A 2DY4A 2KFNA 1UA1A 5KG1A 2YKNA 2G8IA 5KFJA 4IH5A 2UUTA 4FS1A 3V9WA 4M3ZA 1K6YA 4MFBA 1TKTB 5HLFA 3K59A 4CJ3A 3C6UA 3D45A 1BI4A 1YVUA 4KFBB 2WTFA 2HW3A 1VSMA 2OPQB 1U47A 2IM2A 2W7OA 3JSMA 4CERA 3ULDA 2FJVA 2XC9A 2W42A 3VQEA 3LAKA 1MMLA 4CIGA 3M8SA 4MK7A 1TP7A 4R8UA 3AVNA 4DTOA 4IH6A 3PO4A 4WFZA 2OPPA 2QXFA 2I1RA 1S0OA 2BGGA 2F8TA 3N6LA 1FK9B 4Q44A 2O5DA 3HKWA 1A5WA 3RMDA 1T03B 3OJSA 1KTQA 4NCBA 2FVPA 4NLRA 5KT6A 1TL1B 4EO6A 1JLCA 4FBTA 5EWGA 1BQMA 4WYLA 4KB0A 4CJVA 4KSEB 4RNMA 3PW7A 2BQRA 4NLSA 4LY7A 1DTQB 4LSLB 1NKCA 3JSMB 3H08A 1QE1A 1XR6A 1WSGA 1IKVA 3HPGA 4MK8A 2X6SA 1NJWA 1HQEA 2FBVA 4KV8B 4CGHA 1HNVB 3ZSXA 4DTMA 4DF4A 5F8IA 1TAQA 2VG6B 4QWBA 1BIUA 5DLGA 2R7YA 1VSIA 4E7KA 2G8HA 3DI6B 3Q8PB 3NAEA 1SV5A 5KFMA 1J54A 2KW4A 1S1XB 3SUOA 4RW9B 1Y97A 2B6AB 5C24B 4K4VA 3SZ2A 4DTPA 3P1GA 2G8WA 2AJQA 4NCGB 4JV1A 3PHEA 3KLEA 1XR7A 5T14A 1U4BA 3KNAA 4J9PA 1B9DA 1KVBA 4CF0A 1JIHA 3P83D 2JEIA 1L3UA 3AVCA 3AVFA 3OL7A 3DRSA 4FLZA 2W7PA 4N41A 2IM1A 4KKOA 4FJNA 3DOKB 2FJWA 4CJUA 4YFUA 2VG7A 2B6AA 4AHUA 1N4LA 1KHVA 3TAMB 4EYIB 4I9QA 2B5JB 4M94A 3VQ9A 3OYJA 4DS5A 4NLQA 2UVVA 1CXUA 4WFXA 1JL2A 5KG0A 1KHWA 1BCMA 1GOBA 4C8LA 4ECSA 4FLYA 4DSLA 4ED0A 5FDLB 2GIRA 2RKIA 4YR0A 1BL3A 3KK1A 4E19A 4OL8A 4B8AB 1EETA 1T8EA 3L8BA 4LSNA 4HHTA 1RA7A 3BDPA 2FVSA 4Q0BB 3AVGA 4CGJA 5T7BA 3MAQA 4FJJA 4DQSA 2HAIA 5F9NA 4ED1A 3EPIA 4O4GA 3DMJB 4KHSA 3DRPA 3CDUA 4CF9A 1TKXB 5HROB 2D0AA 2HWIA 2P5GA 1R0AB 3CFPA 1S1XA 4DFKA 2UVUA 3OLAA 4CEDA 2HHTA 5SWMA 2KZZA 1QE1B 4IG3A 3V9SA 3KOAA 1REVB 1NJXA 3KK2B 4RW7B 4EBEA 3TR8A 3QINA 2A1RA 5K14A 4CE9A 2YNFA 3LWLA 4JRPA 3LP1A 1LW2A 4NRUA 3ITHB 3I0SB 1S1UB 2BANA 3MEGA 4ELTA 1ZETA 3TI0A 1QTMA 4DU4A 5KRTA 3HXMA 1RT7B 4M41A 2GUIA 2FVCA 2J6UA 3GYNA 4N5SA 4Q0BA 1LWEB 3IRXB 1BI4B 3HO1A 4ECWA 4DL3A 3RB6A 1N6QA 1RTIA 3KJVB 1D9DA 2V9WA 5HRPA 3RRGA 3KLHB 4Y1DA 2ASJA 4FYDA 2YKMB 1EETB 5F8JA 4C8OA 4Q45A 4OGEA 3KLGA 3QNNA 3VQ5A 5EWEA 4DL2A 5DG8A 4RW8A 3AO3A 4NLDA 5FRMA 2ASLA 3PR4A 4K4ZA 4CK1A 3CJ2A 2B43A 2IM0A 3H5YA 4Z4GA 4YR2A 3QO9B 3RR8A 5CYQA 4B08A 3OVNA 3QLHB 3S3MA 1RT1B 1UAXA 5KFBA 3I0SA 4EEYA 4FBUA 3CM6A 3OYIA 1TKXA 4UQGA 5F9LA 5CZ1A 3CIZA 4N47A 4ZTFA 2JC0A 1VRUB 3L3UA 1WSFA 4E7IA 2G8KA 3HHKA 5L1IA 4IFVA 1RT7A 4CHYA 5L1LA 5KT5A 4RUAA 2DPIA 2D41A 3N6MA 1RT1A 5F8MA 2W9BA 3AA5X 4RG8A 2HMIB 4CEQA 4DG1B 4KHWA 4RUCA 3NDKA 4B9MA 3CDEA 1ZBFA 4O3QA 1Q9XA 3G6XA 4B9UA 1FKPB 4RNHA 4NLYA 2HHUA 1RDDA 1U04A 1C0UA 2HHQA 2BE2A 1W0HA 3HT3A 3AO4A 3BSAA 3G10A 2DFEA 3SQ4A 2YHAA 1U09A 3LP1B 3CJ0A 1D9FA 4FM0A 3SV3A 1N48A 4EYHB 1X9WA 4TQSA 5L1JA 4J9KA 5JS2A 2R2UA 4AHRA 3G6VA 2GBZA 1VRTA 5KTQA 1BCOA 1IKYA 4CJQA 4GC6A 3OYLA 2A1SA 3CFOA 4O3RA 1KLNA 1W9HA 1T03A 4JV0A 2KZMA 4ZP8A 3IG1A 1LWCB 3AVIA 3BSCA 2YNHB 3ZSOA 3L2UA 3DM2B 4DG1A 1ZTTA 1SL2A 1VSFA 3OYFA 1ASWA 2W9BB 4RW6B 4IG0B 4CJPA 5KFHA 1VSLA 4FXDA 2BQUA 1FXXA 4ID1A 1RTHB 5FDLA 4KAZA 1HYSB 5I3UB 4CFAA 1C0UB 3T1AA 1DTTB 1IKVB 1S97A 5KFTA 3T5KA 4O44B 5EU7A 3RAXA 3NKYA 4RW4B 3EYZA 1BIZA 2R8GA 5KT3A 4FK2A 4CJFA 1C1CB 1RDBA 1C0TA 2G8UA 1HMVB 3MR2A 2FJXA 4CIFA 4J9RA 3I5AA 2JEFA 3MECB 1C0MA 5KG6A 2BR0A 3GILA 3ZSRA 3NH0A 1SUQA 3THVA 4B3OB 3ZT0A 3CYMA 4IKAA 5KG7A 1K1SA 4RW4A 2BRLA 3V9UA 2DPJA 4ZP9A 4M45A 3GQCA 2ASDA 3Q8QB 1WAFA 1SL1A 4ID5B 4CHNA 1XHXA 4Z0UA 1TKZA 1QSSA 5KFOA 5KG3A 4Q43A 1JLEB 1JX4A 3RRHA 3UR0A 4BDYA 3KK3B 1S9GA 3HSTB 4J2AA 1JLGB 3K57A 2R8HA 2OZSA 2IJFA 1JLAB 4ICLB 1S5JA 3OYMA 3CM5A 2IDOA 3WNFA 2YNHA 4ZTJA 1HNVA 1EXQA 4AHSA 3DLHA 3C94A 4CECA 3AVKA 1KFSA 5KG5A 5KFKA 4ECXA 3KLHA 2R8KA 1NKBA 2FLLA 1XC9A 1VSDA 5DMRA 3M8PB 3KLFA 5KFLA 1RTJB 2OPSB 5HP1B 5F8HA 1S6PA 5C42A 3VQBA 4B9LA 3K58A 1IKWA 3TARA 2KQ2A 4CESA 2G8FA 4ZPAA 4IRKA 3TVKA 1NHVA 2WRMA 3PJXA 1DTTA 3V1RA 4KFBA 2OA8A 4KO0B 5KFCA 3MFIA 2YHBA 1RILA 4GMJB 4QOZB 4Y34A 5HBMB 3CFRA 3O4QA 1KSPA 1S4FA 2WCXA 3BR9A 3DMJA 3PVXA 1LWFB 4DSKA 1HJRA 3PZPA 2WOMB 1KLMB 3OS0A 2JC1A 1L5UA 4CJTA 4ZPCA 4DSEA 1CZBA 4DWIA 1XWLA 3NH1A 1JXEA 1KFDA 3MXIA 1GOAA 2XHBA 2QKKA 4DTNA 2ETJA 2OZMA 1X1PA 3QIPA 5C42B 1U48A 1RBRA 2HNYB 4PQUA 3PV8A 4HKQA 4BACA 4JS5A 2HVIA 1C1BA 2P1JA 4ED8A 3KK3A 3FFIA 4I2PB 1JLEA 5SZTA 4KAIA 4ECUA 4CEBA 4NLUA 4KHNA 3K5LA 3OYEA 3KHRA 5KI6A 1RT5A 2XCPA 4F3TA 3F73A 1IKXA 1S1VA 1WNSA 3AVAA 4IRCA 3O3FA 5L9XA 4K4YA 4QPXA 3QIOA 3NL0A 3ZSWA 4TXSA 3DRPB 1Z26A 1RTIB 3OLBA 4CEAA 4BDPA 2Z1IA 2JLEA 1RT2B 3JYTB 3EZUA 4BE1A 1VRUA 4CHQA 1HPZA 3L2WA 2JEGA 3UDLA 3GIIA 3PW2A 3RB0A 3H5XA 2HHXA 1Z25A 4AILC 1HQUA 1UWBB 3OSPA 1N5YA 3IS9A 4KI6A 3DLBA 1D8YA 4K4TA 1LAVA 4K4UA 3VQ4A 3QO9A 3QGGA 4WFYA 4R8UB 2HNYA 3QEPA 3IGVA 4J9OA 3NF7A 3QIPB 3OHBA 1S1UA 3M8RA 3ZCMA 4OKJA 4H4OA 5I3UA 3ITHA 3D5MA 2VG5B 4CF1A 3DLGB 2Y1JA 4KTWA 2D3ZA 3LP2A 1W25A 3ASMA 3AVHA 1C2PA 4K8XA 1HNIB 1JLFA 4FJ8A 4K4XA 3S9HA 3KHLA 1S1WA 4ELUA 2C22A 3V9ZA 2X78A 3DLEA 3KHHA 4G1QA 3HVTA 2CJQA 2B4JA 4OLBA 3BJYA 4KHYA 2ZD1A 1LW0A 4ZPDA 2C2RA 4DQIA 3FFIB 3ISND 2AX0A 3GV7B 4PA1A 4QCLA 5KFGA 5C24A 4ED2A 4J9MA 4XPCA 4ZHRB 4RW8B 4JUZA 2W9CA 3AV9A 3RWUA 4FLUA 1JLAA 4ICLA 5J2MB 4EZ6A 3V81B 2RF2A 3DM2A 4B9TA 4IR1A 4J9NA 3QESA 2FVQA 2XY8A 4IOBA 4C8NA 4PY5A 4KE5A 3U3YA 1RNHA 3DRRB 3OYBA 3SCXA 1HYSA 2RDJA 3DRSB 5C25B 1JLGA 1LWEA 4GW6A 4RZRA 1TK0A 2P5OA 5CZ2A 3M8PA 2EC0A 4MK9A 3QYYA 4YNQA 2C2EA 4DTJA 4Z4IA 2I5JA 2WONA 1UA0A 1IKXB 1S1VB 5J1EA 2W9AA 4CK2A 3PY8A 2BRKA 1ASVA 3VQQA 1NJYA 4CGIA 3SJJA 3H4DA 4NLOA 4ZP7A 1L3VA 3KD5E 1RDCA 5I42A 3DRRA 1ZBLA 4KHMA 2IC3A 3LP0B 3T5HA 2OPPB 3U3GA 3SYZA 4DTXA 1MU2B 1VSKA 3TAQA 5JS1A 1TL3A 3AA2A 3ALYA 4I7FA 5KFAA 5HRRA 4XO0A 3KD1E 2RDIA 3H4BA 4MKAA 3LP2B 2IAJB 4QW8A 1A5XA 5DQHA 3U6FA 2IBKA 5HRSA 3HP6A 3DLKB 4BE0A 2HHSA 4DU1A 1S9EA 1QHTA 4G1QB 1LWCA 4J2BA 4Z4CA 2O4GA 3QZ8A 3SFUA 3NHGA 5J1EB 5KFZA 1B92A 2ATQA 2DFHA 1J5OA 1BQMB 5I42B 1VSEA 3OYKA 3G0ZA 1NK0A 4NLGA 4NYZA 4QW9A 2W8KA 4OKEA 1Z4UA 4B9NA 1BHLA 1FKOA 2AWZA 2R2RA 2GC8A 4E7JA 3BQ2A 4MIBA 4ECYA 4R0EA 3ZSVA 3V6KA 2Z1HA 1TKDA 3LANA 5DK5A 5K14B 1HQEB 4IRDA 3BQ1A 4J2EA 3IGNA 4FJKA 4ECTA 4FZZA 4E3SA 1N6QB 2VG6A 2AX1A 2XO7A 4CJ4A 4F3OA 5C25A 3NCIA 1C1AA 1NK7A 3AVBA 3PW5A 3I0RA 4E1NA 4FJHA 3NBPB 1XHZA 2VA2A 1RYSA 3NGDA 3TANA 5E41A 3HK2A 2YNGB 4MH8A 1T05A 5KGWA 1RTJA 4WYWA 1NNDA 2FBXA 4HUEA 3V4IA 1S6PB 3NGIA 2QKBA 3SV4A 4KHRA 5DGAA 2Z1GA 1F21A 1HRHA 4NYNA 2IAJA 3OJUA 1RTDA 3NAHA 4DL6A 3ZSYA 3RTVA 3FQKA 4QWCA 2ZKUA 2Z1JA 4W5OA 1GX6A 4CJWA 4B9SA 4CGFA 3L3VA 3NE6A 4W5RA 4JLHA 3VA0A 3DDKA 2R8JA 1X9SA 4F4YA 3B6OA 1ZBIA 1RA6A 3OY9A 2ILYA 1JLBA 3GIJA 3ZT1A 3QIDA 4FLWA 3CQ8A 1HYVA 4NLPA 2HMIA 4URSA 2HHVA 3QEVA 4KI4A 4K50A 3AVLA 4CF2A 3SQ1A 2GV9A 4H4MA 3HL8A 4B9VA 4DEZA 4AHCA 4CCHA 3HP9A 4DL4A 5J2NB 2KTQA 3BSNA 4CJSA 1GX5A 4Z4FA 1S1TB 4ZMMA 3NGZA 1S48A 3QERA 3M9MB 3M9OB 4U6PA 1L3TA 1RT3A 4O4GB 4MQ3A 4DL5A 5HBMA 1RDRA 2W8LA 3EY1A 2XCAA 1HYZA 3QZ7A 4TYBA 2ILZA 1RTDB 5KFIA 4GC7A 3I0RB 1RBTA 1IKYB 4DSJA 1XR5A 2OPQA 3CJ3A 5J2MA 3AA3A 2EX3A 1QAIA 4ZVFA 3BGRB 3OL8A 3VQAA 4ELVA 2E9TA 4EP4A 1QUVA 2PY5A 3O4NA 4PWDA 1YT3A 4R5PB 5J2QA 4TQRA 2IOCA 1RT6B 1RYRA 4CFBA 4CJKA 4IR9A 3BQ0A 4BE2A 5KFRA 2VG5A 2IMWP 2E9RX 3H59A 3PUFA 4JS4A 4BDZA 1WAJA 3GIKA 1WN7A 5J2NA 1WLJA 4DTRA 4FCYA 1S0MA 3V81A 4FM1A 1NK4A 2HNZA 3TABA 1NHUA 4KTZA 1T05B 4ZPBA 1RDAA 5EUHA 1TQLA 3HYFA 1RT4B 4XPEA 3H2LA 4FJ9A 3G6YA 1JLCB 2AGPA 4HVJA 3MR5A 3IN5A 2XY7A 4DTSA 3OYCA 1WSJA 3S3OA 1DTQA 4U7CA 1C0TB 4CJLA 3T5JA 2YV0X 2XGPA 2WK4A 2WONB 4KRFA 5CYMB 5D3GA 4O3NA 2J6TA 1HNIA 1OS5A 2XI3A 5KFQA 3PW4A 3OYHA 3Q8RB 4NLWA 4JRQA 4PWDB 5KG2A 1VSHA 4IDKB 3V6DB 4AH9A 3L2QA 1D5AA 4I9LA 3QEXA 5KFUA 2QV6A 4FJGA 1X9MA 3VQ6A 4H54A 1KVAA 4HUFA 4DLGA 5KFDA 2VG7B 2C28A 4H4MB 3C95A 2HNZB 2HWHA 4Z4HA 4M3YA 2UVWA 3KKRA 4CK3A 4NCGA 3FSIA 4O0JA 3I5BA 1RCHA 1G15A 3LPTA 4CHOA 4Q5VA 3SPYA 2XY6A 3LZJA 2WB4A 2OPRA 3ISNC 4NZ0A 4O3OA 5J2PA 2ZD1B 4RNFA 5KFPA 3KLGB 4LQ3A 4RU9A 2YNIB 3KMSA 1RBUA 4WE1B 1S6QB 2KFZA 1TKZB 3C6UB 4OPKA 2E9ZA 4ZVEA 4OKKA 2LSNA 5CYMA 1RAJA 1DLOB 3LZIA 5DQIA 1JLQB 5KFFA 4MKBA 3AVJA 4E7HA 2IS3A 3LDSA 2RF2B 2O4IA 4CEOA 2BDPA 3DOLA 2VWJA 4H4OB 3CWJA 4Y3CA 1I6JA 4HCBA 1C6VA 2J6SA 4W5QA 3F9KA 3WNGA 4CJRA 3KMQA 4ZP6A 4KHUA 5KT4A 3MEDB 5HP1A 5C5JA 4CHZA 3M8QA 4CF8A 2PZSA 4O3SA 2HB5A 2F8EX 2JGUA 3OL6A 3DLGA 3NF9A 3NF6A 3SUQA 2XI2A 4L8RB 3D28A 3V6HA 4O55A 1K1QA 3L2RA 1LAWA 1RTHA 5DLFA 3MEGB 4FJMA 1FKOB 1JL1A 3A2FA 4H8KA 3DLEB 4FLTA 4IBNA 4OLAA 1NK8A 5JUMA 3TWHA 2G8VA 4E0DA 4URQU 1YTUA 2YNIA 4AHVA 4FJ7A 4LSLA 1IO2A 2IGIA 3VQDA 2HVHA 1J5OB 3PX0A 1HPZB 3C6TB 4E1MA 3V6JA 3VQPA 1SV5B 4DFPA 1EP4B 3M8QB 4K4SA 2YNGA 3OYDA 1RT5B 3KJVA 4B3OA 1KVCA 4QAGA 3TAEA 2EHGA 2UVRA 2PYJA 1TK8A 3OS2A 3OL9A 4Y1CA 3K5NA 4YR3A 3K5OA 1HMVA 3RB4A 4CIEA 1RT6A 3VA3A 4TN2A 1QSYA 3QGIA 1FKPA 4ECRA 3TAGA 3LP3A 4ED3A 1S9EB 3M9NB 4KBIA 4YP3A 5CYQB 1T3NA 1L3SA 1JLQA 3DLKA 4HCCA 5FROA 1SUQB 4XIUA 3RMBA 3OS1A 4KB7A 1JXLA 4CFDA 4J9LA 2ITGA 3O3GA 2XY5A 4FLXA 2AQ4A 4O3PA 3RMCA 5L1KA 4QWDA 3DOKA 4NLVA 3SQ2A 3K2PA 2X6NA 4B8CA 1CLQA 3MEDA 3WNHA 2WHOA 2JEJA 2R2SA 1IG9A 4WXWA 4Z4EA 4HYKA 1EP4A 3VQSA 4NRTA 4HTUA 3AA4A 2VA3A 1RT4A 4ZVHA 4EZ9A 3ZSZA 3PJWA 4DFJA 2OH2A 3OYAA 4N56A 4W5NA 1KCFA 1IH7A 4RW9A 5KFVA 4J9QA 2IM3A 1R0AA 1S1WB 5HLFB 1REVA 2ZE2B 1NJZA 3LAMA 2FBYA 2RPIA 4FZYA 1NKEA 3KHGA 3SFGA 5F8GA 4FW2A 4DMNA 4F4ZA 1SH0A 4EP5A 5KRSA 3VQ8A 3CJ5A 1NOZA 3T19A 4E7LA 4DQQA 1SH2A 4DF8A 2D3UA 1QAJA 4I2QB 3AO2A 4OVLA 3V1QA 3HJFA 3GV8B 1QS4A 2FLPA 4IQXA 1BQNA 3HVWA 4N76A 1QQCA 4CGDA 1VRTB 3BREA 4TYAA 1UOCA 1VSJA 3B6PA 1KLMA 4LSNB 4IG0A 3UPFA 3MR3A 4Q8FA 3MEEB 1ZBHA 3FDSA 3K5MA 4MIAA 2ALZA 1QSLA 1TVRA 1Q8IA 4C8MA 1IM4A 2I5JB 3IG1B 4CHPA 1O1WA 4BWJA 1ZTWA 4KO0A 1RBSA 2OYQA 4M95A 2YNFB 1JLBB 3KLIA 2WOMA 3CVKA 3MXJA 2F8SA 1S9FA 3FQLA 4LH5A 2E6MA 1LWFA 2FVRA 4ECVA 2NUBA 2V4RA 5KT7A 4IG3B 3S3NA 4K4WA 1JKHA 1LV5A 3SI6A 4BWMA 4F8RA 2AGQA 3EZ5A 3LP0A 2X74A 4KV8A 3RB3A 3OYNA 3AO5A 4FM2A 4FK0A 4TY8A 2FLNA 1N5YB 1BQNB 4Y2CA 2DFFA 3OSNA 2B5JA 4OPJA 1NOYA 3DOLB 4NLTA 4HUGA 5J2PB 3SPZA 3H40A 3PX4A 3ZSQA 1U49A 4RW6A 1N56A 3ICLA 3GIMA 1S0NA 2XGQA 2FC0A 1WNEA 1TKTA 5F8LA 4M3XA 4CEFA 4IFVB 1HARA 4I2PA 4O0IA 1UWBA 4TSXA 2QE5A 3N6NA 2OPSA 4ZVGA 3ZT2A 4PUOB 4DL7A 3H5SA 3E01A 2UUWA 1YVFA 1T7PA 2OPRB 4PQUB 2IA6A 3MF5A 4YQWA 3G86A 1NK9A 5EWFA 3NF8A 4J2DA 1T94A 3VN5A 4F4WA 4KKOB 3MEEA 1SKSA 3WNEA 3RBDA 3T5LA 1J9AA 4TY9A 4X2BA 3D0PA 1TV6B 1YTAA 4OJRA 3IS9B 1J53A 2XRIA 3IAYA 3HPOA 4FZXC 2RN2A 1HQUB 2VWKA 4AHTA 4I2QA 4DQRA 5KGXA 3BSOA 1U45A 3KLIB 4TY8B 1I3AA 1RBVA 1TL1A 3V1OA 4LQ9A 1CZ9A 3AO1A 4IDKA 3V6DA 1SH3A 2E4LA 2D0BA 2D0CA 5KT2A 4ED6A 4J9SA 3RMAA 1BGXT 3L2VA 2RKIB 2ATLA 3NBPA 3CO9A 1Q9YA 4WE1A 1WSIA 3KLFB 4Q8EA 1GOCA 2W9CB 3AVMA 1NK6A 3KK2A 3UIQA 4GVMA 4QWEA 3DYAA 3Q8SB 4IFYB 3OHAA 1IKWB 4IH7A 4NCAA 5KFWA 4CGGA 1LW0B 2AU0A 1NK5A 2BE2B 4MFBB 4F2SA 3DI6A 4CJ5A 1EX4A 3SI8A 3CJ4A 3NAIA 1WSEA 4KREA 3QEWA 5CY4A 3PW0A 3TAPA 2QK9A 1S10A 3BGRA 1CSJA 3QGHA 4NLXA 1ZYQA 4ZHRA 4G3IA 3HPHA 4RW7A 3H5UA 4M3WA 3P5JA 3HVAA 3KTQA 4FJXA 4RNNA 1MU2A 3MR6A 1BISA 1TL3B 2DTUA 4IKFA 5J2QB 5KFNA 1CXQA 2R8IA 4Y2AA 4KHQA 3VQ7A 3VQCA 4DSFA 2V0NA 2IC3B 4DS4A 4FLVA 4FW1A 4WXOA 4F4XA 3O3HA 1B9FA 2AGOA 3RAQA 4O44A 3MECA 2CKWA 1TAUA 2HHWA 3GV5B 4OGCA 2C2DA 4I7FB 3QLHA 2BQ3A 4ED7A 4LH4A 1C1CA 4FVMA 4CFCA 3KLVA 3ZT3A 3HM9A 3SUNA 1RT3B 3DLRA 3KKSA 4O5BA 3CDWA 3NMAA 1S6QA 1ZBUA 2YKMA 5DG7A 2ZE2A 1A5VA 2F96A 5KFEA 3ZT4A 1DLOA 2Y1IA 2FBTA 3MTKA 1JLFB 2HNDA 5F8NA 3PR5B 4FJLA 3TAMA 3NFAA 4F2RA 5KFXA 5DGBA 5KFYA 4ID5A 4M3TA 4FJ5A 3T3FA 1RT2A 3JYTA 1EKEA 1SKRA 4ECZA 3SQ0A 4F50A 1KRPA 5KFSA 4O4RA 4FS2A 3TQ1A 3NGYA 3KK1B 3QNOA 4JV2A 3LPUA 4NYFA 1TVRB 4EO8A 2R2TA 4EBCA
chains in the Genus database with same CATH superfamily
4ANEA 1Z1ZA 4URGA 5CD4A 3FRZA 3BO3A 1WSHA 2Q0UA 5FRNA 3MM6A 4YOEA 1U25A 3GTYX 2F4VK 2XWYA 4IUFA 2XTJP 3CCJN 3MFHA 1K8KA 1F3FA 3HHLA 3MXMA 5HROA 4FJIA 2V4QA 3BZQA 1VQPN 3WX8A 2D7SA 4OI6A 2OTJS 2EBGA 5D4PA 2GGPA 1FKAF 2Y8YA 3MEKA 4RCHA 2V5HG 2W6KA 5ETVA 3S41A 4LF8K 2GNKA 1V5IB 2QLFB 4U7BA 1CBKA 4JKCA 5AR0A 3VF2A 2IJNA 1BHNA 1D0EA 3H1VX 2GTDA 4BR0A 4DSIA 4K8ZA 4M3UA 1V3ZA 3TJ9A 4B1XB 3MMAA 3BUZB 3QEIA 1NU4A 4KTQA 2P51A 4ETXA 1PC4A 1FERA 3PSIA 2IY5B 4KPYA 3QWUA 3F9MA 4WCEL 2GIQA 3G9CA 4IOAQ 3MMBB 4OYXA 3TW0A 2OTLS 1ZOTA 2LQ8A 4DPXA 3RBEA 3DU6A 2G9OA 2B51A 3UE5A 3R3TA 4A4JA 4KYZA 4CWBA 4PXCA 2GJFA 1C1BB 3K8WA 2UXBF 4NLCA 4CEEA 2LA4A 4JI2K 3V2UC 2WZ1A 1CJVB 4B3TJ 4JI6J 4BC7A 3OYGA 3IRXA 3RR7A 2FJDB 1CJKA 5D15A 2J4RA 4LD0A 4EAHD 1PILA 1H2TZ 2KFNA 2VDHA 2DIVA 1UZHA 5KFJA 3PJ9A 2UUTA 2ZDOA 1TKTB 4CJ3A 3W5YA 2VOPA 5M1FA 4YY3F 4LF5K 1HNWF 2NR0A 3C7NB 2HW3A 1VSMA 2OPQB 4H03B 1U47A 2IM2A 4I0WA 1KP6A 3E8OA 2FJVA 2XC9A 3U9DA 4V1Ak 2FQQB 3DWLA 4L74A 3VQEA 3SCKE 3M8SA 2PAVA 2CUYA 4IH6A 2CJKA 3FCVA 3S1TA 2F8MA 3PO4A 2HFSA 2OPPA 2OHDA 3N4PA 1S0OA 2ZH7A 2F8TA 5G0RA 1H7WA 1OIAA 3N6LA 1RWWB 1FK9B 2O1PA 1I51B 2AA4A 3HKWA 1P90A 3M2RB 5GAHU 5KT6A 1VFJA 1TL1B 1YI2S 4K0KK 4EO6A 3BKTA 5EWGA 1BQMA 1FTRA 4WYLA 2DIUA 1T3VA 5BRDA 4RNMA 3TR5A 3U1NA 1VQ6N 4LY7A 4JI3J 3JXOA 1HBNB 3JSMB 3H08A 1QE1A 3ZLJA 1WORA 3GCXP 4LBPA 3N9UC 1FE4A 2DNLA 5F8IA 1VCTA 1TAQA 5U47A 3AOCA 5AQVA 1NPKA 1GXUA 4OZ1A 1X0PA 1FXLA 4EU0A 3VAHA 1SIZA 3C19A 4E7KA 2HG4A 3NAEA 5KFMA 4U9RA 4OYIA 3SUOA 3CJCA 1H2UX 5AQMA 5F0WA 2GWJA 4DTPA 3PIPQ 2R7WA 5E2QA 3KVGA 2G8WA 2AJQA 2ROEA 2X1GA 4NCGB 4FPRA 4I6AA 1GEHA 3KLEA 5T14A 3AD8C 5HMYA 4JI8F 3LPEA 4J9PA 2Q2RA 1KVBA 1JIHA 3M8YA 3P83D 2DHSA 3CJQA 2GVDA 4JP8A 3AVFA 2ZBQA 3OL7A 3C16A 2ZNYA 1N36F 3DRSA 4CJUA 1Q1KA 3VGUA 4YB7A 5BYSA 3VQ9A 3OYJA 4OMFG 2UVVA 3GFYA 4DBQA 1JL2A 1BCMA 1T95A 3J80O 4DSLA 3ZNJ1 2VBWA 2RKIA 1BL3A 3KK1A 3ZZPA 1Y3KA 4LSNA 1HNXJ 5T7BA 2NUUG 4FJJA 4CLWA 3KUHA 5GVQA 1F2HA 2G1HA 3EPIA 4EI2A 4KHSA 4CLZA 5A8RB 3VV2B 2HS0A 5HROB 3MX5A 2BOPA 1S1XA 2J0QD 4CNYA 2HHTA 3GG1A 1J5EK 2KYXA 3KOAA 4A8QA 1REVB 2Y0SD 4PWUA 2P9KB 3KK2B 1WC0A 2RUSA 4RW7B 4FPBA 4JKGA 2A10A 2YKPA 3LWLA 2HFOA 3LP1A 5FLXY 4NRUA 3ITHB 1S1UB 4QR1A 4OX6A 4CO5A 5EGYA 4V19J 3U1MA 1QVFM 4LRBA 3M05A 5BPNA 5KRTA 1RT7B 1B70B 2C3OA 1ZM3A 3C14A 3IRXB 3QNWB 2QM1A 3KJVB 1F60B 4F0MA 3KLHB 1J27A 2Q79A 1PJ6A 1N5SA 3C65A 2YKMB 5F8JA 4CD1A 1FESA 4OGEA 3AGRA 2DNZA 4L6V3 1KQKA 3QNNA 3VQ5A 1B0TA 2ZBRA 4OZ5A 3PR4A 4K4ZA 3LDQA 2QYGA 3T1HK 4QR0A 1RCOB 2IM0A 2AYBA 1CQNA 4YR2A 2CQ2A 3QO9B 4B08A 2EK1A 3OVNA 5L38A 1RHRB 2Z8QA 1ATRA 3OFEA 4FBUA 4K5RA 3CCLS 2PMWA 3HI0A 5CA5A 3CIZA 3OQ2A 1OQ3A 3KJQB 1WSFA 4E7IA 3TO8A 3EE8A 2P9LB 4GMKA 4A2BA 1J6ZA 1A7GE 5F8MA 2W9BA 1N34F 4DG1B 3ZETB 4KHWA 1TFYA 5IQQA 4ZIVA 2IRYA 1Q9XA 3LGHA 3RBZA 4OYMA 1FKPB 3SJHA 4RNHA 3HOTA 1U04A 3FSYA 4MYTA 4Y2MA 3KXDA 2QA4G 1PYTA 2GO9A 3G10A 1NB2A 3MM7B 2DFEA 2MJNA 3GWCA 3WXLA 1VBZA 1RHMB 3BGUA 5L1JA 2R2UA 5ETTA 4AHRA 3G71N 1BCOA 1IKYA 4NE9C 2VFUA 2R7UA 3LDOA 1KWMA 2FZKB 4CZEA 3RJMB 3MDFA 3CFOA 4JV0A 3HULA 4FF3A 3ZXWA 1F9HA 3IG1A 3VEYA 2YNHB 2X3GA 1FX2A 3BYPA 4FYYB 3DGPB 1I94J 2NS1B 4ZA1A 1YJUA 3SLCA 3WIVA 4L3NA 4JI0J 4H5TA 4RUHA 4OLOA 3K7RA 4KH1B 3BF4A 3RAXA 3QBXA 5F3TA 5GAHP 4CLPA 2XULA 5KT3A 3D1HA 1VC6A 2LEPA 1C0TA 3EICA 2FJAB 4CIFA 4YDUA 2JEFA 4DV6F 5KG6A 2E1RA 1K73O 1D9AA 2BR0A 1TYQA 1P27B 1FEEA 1S6OA 5BPLA 1VQOS 5K20B 4BC4A 4JKEA 1FWKA 5AQGA 4RW4A 5BR9A 2P9EA 4AQYF 2V68A 1PGZA 2FHMA 5M1PA 4M45A 1SL1A 1WAFA 2CPDA 1PAEX 1Q7LB 1XMQJ 1RWPB 3KUGA 5KG3A 4Q43A 4A47A 1JLEB 3EXYA 2HVDA 3F44A 2NLWA 3KK3B 1S9GA 1HD1A 3CMES 2R8HA 2J0WA 3GG0A 4MKYA 1LXJA 4ZTJA 1C0GA 3RW6A 2MZJA 3C94A 2J5AA 3JB9k 3TU5A 4CECA 5KG5A 3KLHA 3OPKA 3DDNA 1U1LA 1VSDA 5K9FA 2P9KA 3M8PB 1WUUA 3KLFA 5KFLA 1RTJB 3D7SB 2OPSB 4OYZA 4USHA 1XBWA 2OCEA 4B9LA 1RJJA 2B9WA 3TWZA 2OEMA 1IKWA 1V5VA 2MTLA 3C15B 3TARA 1BD6A 5B0DA 5LL6Z 4GKJK 4CRJA 4F26A 2NQPA 1ILYA 1HBOB 3TVKA 1FA0A 2UXDF 4KFBA 4ZCMA 4CDIA 2GELA 4U67Q 1PSDA 2B4VA 3D2EA 1S4FA 3POTB 4X65F 2MXYA 3DMJA 1LWFB 3A8IA 3OS0A 1AUDA 4DSEA 4DWIA 2GFFA 1ZAVA 3MXIA 4PHTX 2XMUA 5AE3A 3THPA 3BBBA 3HKZD 2D3OR 2KM8C 3PV8A 4EMDA 4EUVA 1H38A 2KXFA 2P1JA 1SQEA 3NWGA 1MWYA 2FJEB 4I2PB 3CD5A 4KAIA 4ECUA 1NGEA 5BR8F 3GFZA 4PG6A 3K5LA 5KI6A 2XCPA 4F3TA 4HLBA 3BM7A 1KDNA 4GKKF 5L9XA 3Q22A 4QPXA 2XYHB 3ZSWA 3DRPB 1Z26A 1X4AA 4QR2A 4BS2A 3QFPA 2B9XA 1ITPA 2KXNB 3JYTB 1EB0A 4QIEA 2DNRA 3GIIA 3RB0A 1DJ0A 4KY3A 1BE4A 1X31C 3QRQA 1Y11A 1TUWA 3CF5L 9ATCB 1LAVA 4C97A 3QGPA 4K4UA 1F1BB 3QGGA 2EXUA 3CDBA 2HNYA 4BQLA 3IGVA 4X4UA 1NRKA 4KH0B 4OO1J 4F0KA 4X65K 3BV8A 3MMAB 1JLFA 3S9HA 5AE2A 2X78A 2ZZMA 3DLEA 2VL1A 4G1QA 3FBEA 3AJ1A 2B4JA 3VENA 3W9JA 4BRHA 2C2RA 2ZUGA 3BPDA 1K9MT 1LNQA 3R9PA 2G1DA 2XB2D 4ED2A 4ZHRB 3KJFB 4JUZA 3UCUP 1F5BA 3VALA 2VGNA 4X4RA 3RWUA 4FLUA 5J2MB 4DV1F 4PKIA 2RF2A 4B9TA 2VZ9A 4IR1A 2XMJA 3QT5A 2O3DA 2ITMA 2FVQA 5BYRA 4IOBA 2HWTA 3MDQA 3O8MA 2XBPA 2LXUA 4I4BA 3NP5A 1RNHA 5F1XA 4F0HA 3DXBA 1IV0A 5ADXA 4RZRA 3NCQA 3W61A 5CZ2A 3M8PA 3QYYA 3U1LA 3G25A 1X4HA 2PD1A 2MKCA 4CK2A 1CLFA 4LVOP 3VQQA 3KZBA 3MMCA 2ADBA 4CYUA 4X4PA 2MB0B 2QEXN 2YI1A 3EGNA 3HFKA 3UCZP 4X66K 5LXYA 4LUBA 1TUGB 1T9VA 2OPPB 1MU2B 3BDEA 3TAQA 3ILOA 1TL3A 2LEBA 1M5PC 4DV6K 2FXUA 3JTNA 2F4FA 2RDIA 2W41A 3KD1E 5ETQA 3RW7A 3HZ6A 3LP2B 2F9WA 1HBOA 4JI8K 4QW8A 2DNGA 1W26A 5DQHA 2O8FB 4FKXA 1Y5LB 1UVJA 2W24A 5HRSA 4DU1A 1IM6A 4USKA 3T1YK 1K73T 1UVLA 4NXNJ 2WTUA 2IMOA 5J1EB 1B92A 2XQCA 1R3NA 3UN2A 2DFHA 1N33K 1J5OA 1FE0A 3JAMU 4NYZA 4QZVB 3DXMB 3NXZA 1XJWB 3T9ZA 2R2RA 2GC8A 4ECYA 4R0EA 3V6KA 2Z1HA 2DR6A 5G0RB 1TKDA 1H74A 5AQQA 1N6QB 4RR5A 4ETZA 4A8OA 1SPBP 5C25A 5D8HB 4WK1A 1U02A 3H20A 4FDFA 1S22A 2LQBA 3N5BA 2W4PA 2ZH1A 1T05A 2VPXB 4IWVA 3V4IA 4LF4K 3SV4A 1GLJO 5DGAA 4NYNA 3M6WA 4IXCA 3NAHA 2YVSA 1XNQK 2O8BB 1MNEA 3UO0A 4JI2J 4KQZA 1IWGA 2ZOMA 4P2XA 3M30B 3L3VA 3NE6A 2FB0A 3DDKA 1X9SA 2D3O1 2NZ4A 2E5IA 3CJTA 2E44A 4O5FA 2CPJA 5GADU 3ENVA 1RE1B 3ZT1A 4CBUA 4FLWA 2LU1A 5LMUK 3QB0A 1MN9A 1NPRA 3O9RA 1Q0NA 3SQ1A 4DR4K 5FJ4A 2HZAA 3TA2A 4PPDA 5AQFA 4CCHA 4OHVA 3HP9A 3CCZA 3CD0A 2BW2A 3BSNA 4Z4FA 3FUYA 3T1HF 3QERA 3M9OB 4U6PA 1L3TA 1RT3A 2KB2A 4O4GB 1C4CA 2VQEK 2RB7A 4WK3A 3RBXA 1RDRA 2W8LA 2EFVA 4KGXB 3HSDA 1HYZA 1DAXA 3QZ7A 2HSEB 1RTDB 5KFIA 3I0RB 1RBTA 5KPRA 4C7QA 1Q7YO 3CJ3A 1WBDA 4M5DA 5FPEA 5J2MA 1QAIA 4ZVFA 3VQAA 1HUXA 4EP4A 1FJGJ 1S7IA 3O4NA 3MCAB 2V2KA 3ZEUA 1U2VB 4R5PB 3GYGA 2E7WA 3A0IX 4Z2XA 3JSBA 4TQRA 3J7YU 2IOCA 3FMWA 1RYRA 2ZH4A 4IR9A 1NM1A 2QL7B 4BE2A 3TZXA 3HDSA 4HHHA 2LEAA 2W2QP 4QS8A 3PUFA 4CT8A 1C4AA 1AT1B 4DCJB 4DL0C 2HYIB 1IXKA 5B0EA 1WAJA 3JQMA 4DTRA 4YB6A 1WLJA 3PXGa 4JK7A 2R7XA 3TABA 2NYHA 1TTHB 1RT4B 1B99A 4DOZA 2XY7A 4DTSA 3I9ZA 4K41A 3PRBA 1OPIA 1DTQA 4U7CA 4FP9A 1IJJA 2QWQA 5BR8K 5KFQA 1HBMB 3OYHA 3FK4A 1S99A 4JRQA 4F36A 3CC4N 1FRIA 4USVA 3UVJA 4IDKB 1VISA 2G2ZA 3S7RA 1BA1A 4K43A 2E2OA 1XQSC 2F9TA 2BJ3A 1R8CA 4FJGA 3OBIA 3VQ6A 4H54A 1KVAA 2DISA 4DLGA 4OV6A 2POKA 5BPMA 2BMBA 1IJFB 4JV5K 2DHXA 4M3YA 4CK3A 2QWMA 3ENBA 2O8EA 1RCHA 1YGYA 2MQQA 1UTAA 2D74B 4ERDA 1VYAA 2WB4A 4P52A 1IBLJ 3M1VA 4OZ0A 1OQ6A 1VQYA 4RNFA 3VEWA 4RU9A 2H51B 2YNIB 3KMSA 4DZ6A 4DCOB 2E9ZA 1VQNS 5H9FJ 3LZIA 2EKNA 4MKBA 1FJCA 1XMOK 2IS3A 4D3HA 2BDPA 2VWJA 3SEOA 4H4OB 1I94K 4HCBA 2ZOGA 4AF1A 3WNGA 2AF6A 4A5BA 2YJFA 3M6XA 1JNRB 1WC3A 2VBXA 4KHUA 5KT4A 4QIFA 1FVSA 2EWSA 2RILA 1RWUA 3M8QA 2KG1A 2CJ9A 3PCOB 3NEKA 4ILHA 2GX8A 1S79A 1MWQA 1EAYC 4Q2MA 2ZHAA 3SUQA 4ISGA 3D28A 1SJFA 4O55A 3L2RA 4DX5A 2QJ3A 3CCRN 2MSSA 4H8KA 2DNHA 1LEOA 3DGVA 5LMNJ 5A8WB 2AIRB 4OX9K 4OLAA 1G6BA 1NK8A 4B3RJ 4E2FB 1Z6RA 1AB8A 1K0TA 2N4CA 5HK4A 2XWXA 4RPFA 4AL7A 1YTUA 3MCNA 4AHVA 1S4EA 3FZHA 1U1OA 1NMDA 2HVHA 4DR5J 1HPZB 4ED4A 2CG4A 3VQPA 2KO1A 3SIPB 4DUZF 3LDLA 4K4SA 3OYDA 3OUYA 1LOTB 1DFDA 3GJTB 2MKYA 3QFUA 1IBLK 4PAAA 2DGTA 4FOEA 4Y1CA 3UI3A 2DNQA 1WHXA 3CD7A 2H5IB 4AL6A 4XEIA 3Q24A 1QSYA 2AJ4A 3EJMA 4BCAA 2BJ7A 3R6MA 3PG9A 1S9EB 3FRYA 5CYQB 2J8AA 3VAKA 3O9SA 3DLKA 2OJ3A 5D77A 2N3LA 2HHHK 2KG0A 4CBWA 2DNYA 3ZFVA 5F0UA 4J9LA 1EWQA 3DOMA 5HQLA 3VWSA 1W2BM 4YOVA 3BYRA 2YJEA 2JEJA 2CDQA 2KLAA 4Z4EA 2RMLA 1EP4A 3KG0A 1EO1A 4DV7J 1HIYA 5GADP 2VA3A 4DR4F 1RT4A 4EZ9A 1HKAA 4O23A 4GO7X 3ZSZA 3L6QA 3PJWA 1R7IA 4DFJA 4E1JA 1WOOA 2DY1A 4W5NA 4V19X 5IM0A 1IH7A 3RU0A 2MLZA 1R0AA 1S1WB 4ZPWR 2KYZA 3IAS9 2GV1A 4KHPF 4DR3K 2WVBA 1FDAA 3KHGA 5BR8J 4FW2A 4PKHA 1VK3A 2P9PA 3CJ5A 5AQHA 3MM5A 4DF8A 5CHCB 4OVLA 2C3MA 3CJSA 1QS4A 1H73A 2B3TB 1QQCA 1WBBA 1UOCA 1VSJA 4P9SA 1UP1A 2W7AA 2PO4A 5AZJA 3X3UA 4LRCA 1A0OB 2ALZA 1QSLA 2B7BB 3FCWA 1FNMA 3OVAA 3E2EA 4O8UA 1EQMA 1CJKB 4M1KA 1RBSA 1H2VZ 2YNFB 4ILRA 2LQ5A 1JLBB 1YBTA 2EPIA 2OMOA 1S72S 1HX1A 3EZWA 4LH5A 1LWFA 2NUBA 4EWTA 3S3NA 2KXHA 1VQ8N 1S76D 3NNAA 3SI6A 4DI6A 2J9DA 2R42A 3C3LA 4K0KF 2HK2A 2X74A 3NVKA 2BACA 3IM9A 1VQNN 3OYNA 2KRBA 1VS3A 1TUVA 4FM2A 4FK0A 1KKHA 4Y2CA 2Z2YB 1Z05A 2WBMA 4PQAA 4GKJF 4BY9C 1N56A 4P2MA 3B8AX 2XGQA 2FC0A 3C2PA 1UL3A 4JI0K 3GL1A 4BRLA 1HARA 4I2PA 1IN0A 2F1FA 2QE5A 1GH8A 4ZVGA 3HSZA 4WP9A 2CNLB 2P2CB 3E01A 2DEJA 1YVFA 4GNIA 3CCEN 2NSCA 3U9ZA 5GINA 5GAEP 3VEZA 3VN5A 1Q82O 4NXMJ 3L9ZA 4GVLA 3QT6A 3MEEA 3CHWA 3ZX2A 3C16B 1SKSA 2MZTA 3RBDA 3T5LA 1J9AA 2C3UA 4OJRA 4BR2A 1VQ9N 5HN0A 4FZXC 2VWKA 4AHTA 3ZTPA 5FPMA 2HFVA 3LPYA 3O6QA 5KGXA 8RUCA 5L9NA 3KLIB 4TY8B 1ZZNA 4BHQA 1RBVA 2JFKA 3V6DA 3MPDA 2E4LA 3KHYA 5KT2A 2KDOA 1VJWA 1UVMA 4ED6A 1BXNA 4J9SA 4AQYJ 1BGXT 2P9UB 2RKIB 2FHJD 2ATLA 3NBPA 2I38A 3CO9A 1UVIA 5BN8A 2CQPA 1URRA 1WSIA 5BN9A 3UD3P 4GVMA 5C7PA 3VVTA 2Y1LB 4IFYB 3Q8SB 1YVNA 2HGLA 4ZLNA 2WBNA 1PG5B 2EC2A 1N32J 3MCSA 5DM7L 4CGGA 2AU0A 2XEXA 2BE2B 1FFSB 3DI6A 4KH6A 3NAIA 4KREA 1MA9B 2QGFB 4FWMA 1CSJA 4ZHRA 2B9EA 3ZZOA 3UB5A 4RW7A 4M3WA 1MU2A 2GO8A 5GAGP 4H0VB 1TL3B 1I94F 4IKFA 2BJDA 4ZVUB 1YJWN 4Y2AA 1WKLA 3FBBA 3VQCA 1UW4A 1WEYA 2GZOA 1GLCG 3RSEA 2AGOA 3QT8A 2CKWA 1HI1A 2HHWA 4OQJA 5DDRC 2C2DA 3QLHA 2ZBCA 2BQ3A 3HHLC 2P9PB 4BRNA 2E1PA 3KLVA 2ZJPL 4LR8A 3HM9A 3DLRA 4O5BA 1NDKA 3NMAA 2UUAJ 2M7SA 2YKMA 4H0YB 2IVYA 2F96A 5KFEA 3A5NC 1RI7A 3D1OA 3ZT4A 1DLOA 4JK9A 2RHSB 1X7VA 4CQ1A 3SQGB 4YUDA 2OFHX 2VBYA 2RSQA 4FJ5A 1EKEA 3QPIA 2YWKA 3O80A 4O4RA 4FS2A 1QQOA 2QLWA 1WEZA 3QNOA 1AXQA 3WZ0A 4NYFA 2CPHA 2PFDA 2VG7A 3IDHA 2RDDA 3KIOA 2HQIA 1Q95G 4M63C 4IJAA 1GT8A 1TK5A 5LSLA 2E7XA 1YWXA 4I64A 3C6TA 1J2VA 2BJ9A 3LALA 2MHNA 3MPYA 4DQPA 3H6EA 4NI2A 3FZLA 2YX7A 1X0FA 2PI5A 1HW8A 4LFBF 3H98A 3TNVA 4JI5J 4ZLJA 3PX6A 1ITGA 2B8QA 2ROPA 4UZCA 3NOGA 2KJWA 4IO8A 3V9XA 3NOCA 4ZVPB 3EGZA 3W3DA 4KJIA 3P4UB 4YORA 4B1UB 1SKWA 4LF7K 1GFWB 3QETA 4TLRA 3SUPA 1YTYA 2JWKA 2H65B 2HNDB 3E01B 2I7NA 2HHPA 4IQMA 3AODA 2KHOA 1NGCA 5HRNA 5T7LA 4CO2A 4KB1A 5DG9A 2HLUA 3SNNA 1X3MA 3TP2A 1T9UA 1YUWA 1WJ9A 4M42A 3OTOF 4E89A 3PDNA 5D78A 2D5RA 3IFRA 4IO9Q 2LXFA 4F4KA 1VQ8S 4JI5F 4DV1K 2Q3SA 2WUSA 3AA9A 3H42A 4OHXA 2IVOA 3NH2A 1D1UA 3TYTA 5IT0A 4CO0A 2K2PA 3ENHA 3CCTA 1AFIA 2MY8A 5A2QY 4IH5A 4FS1A 4DDFA 1NMNA 4BVPA 3K59A 3ONQA 1S0VA 1E6VB 5AQXA 1BI4A 1DURA 4NB4A 3B6BA 4ISEA 1NSPA 5DJBA 1R0BG 2W7OA 4OI0A 1EKRA 3B82A 3FMBA 5AQJA 2W42A 4X4OA 3MN6A 2AJ2A 2Y9HA 3VZIA 3RG6A 1CJTB 1MMLA 2O8CA 3AVNA 1N33J 4R8UA 3HHLB 3PNIA 2ZWOA 3D54A 2CQ3A 2MPUA 2QXFA 2VODA 3IM8A 3R97A 5JLHA 3OFFA 2Z30B 3UKUB 2FTRA 2O5DA 5B0FA 3OJSA 1KTQA 1U6BA 3TZWA 7AT1B 1G3OA 1HQ2A 5HOOA 4JI8J 3OV7A 3PW7A 2W2NP 2HBJA 1RHKB 3S01A 1PIEA 2MEWA 3FE1A 1NKCA 4AD6A 4D3GA 3E9OA 1SXLA 1XR6A 1WG5A 1NJWA 4TLQA 3R1LA 2P9GA 2FBVA 4KV8B 4CGHA 2DT9A 4DF4A 4DTMA 1RU2A 2DR9A 1ULRA 2PFUA 2R7YA 2UXBJ 3K9KA 2MZ1A 3AAQA 3DI6B 2RVJA 2UU9K 3TA0A 3CD6N 4HH0A 3CGIA 1ZBTA 1GLLO 1WC5A 2B6AB 5C24B 3EDQB 2QN6B 3OFHA 3SZ2A 1IBKF 1QZ6A 2JVRA 2NXNA 4LFBJ 4MLHA 1AFJA 1GMVA 3TEHB 5D0EA 3O5TB 4H0PA 1XR7A 3P6YC 2XNQA 2QL5B 1B9DA 3GONA 2JEIA 1L3UA 5KPTA 2ZGZA 2DHGA 3BN4A 2IM1A 4KKOA 3DOKB 3HZGA 4YFUA 2MMYA 3CCQS 3J7AP 3PFEA 1T44A 4DS5A 4AUKA 3AJDA 1GMUA 5SUHA 5KG0A 5AZIB 4I1TA 2C2MB 3CIPA 4ED0A 5FDLB 4M5IA 4YR0A 3O9TA 3D0IE 4W92B 2CQBA 4DPUA 3HM8A 2R7RA 3K9JA 4IO9L 3AVGA 2E2PA 3MAQA 4CLKA 2HAIA 5F9NA 2IA0A 4ED1A 4WIQA 3DMJB 2V8PA 5IT4A 2XLJA 3DRPA 3D3BJ 4CF9A 1YAGA 3D3CJ 1UMJA 1NJIT 2UUAF 2D0AA 2VKRA 4NXMF 1MWKA 2UVUA 3CXCR 5SWMA 1QE1B 4IG3A 1FI4A 1NJXA 2J9CA 4Q7AA 1U1MA 1IBMJ 4I6YA 2XLIA 3TR8A 2VQFF 2A1RA 5LJVA 5K14A 2GHPA 1RAGB 2V63A 2H3GX 1JMTA 4JRPA 2N7YA 2BUNA 2XZTB 3TZYA 4UF4A 2HGNA 3OTBA 1ZETA 1QTMA 2D0OA 3HXMA 2VQFJ 2QFJA 3CPWR 2J6UA 4LF9F 3GYNA 4UOGA 4N5SA 1FFGB 3MCOA 1IBMF 3WUHA 4CZIA 3HO1A 1BI4B 4FNIA 3MX2A 3RB6A 3A5MC 1D9DA 1V3RA 4K0KJ 2O8DA 4FN5A 3MN7A 2A6AA 1JXVA 4FXVA 4USJC 4Y1DA 1H7XA 5BXIA 2ASJA 3O1WA 2HPUA 4FYDA 3DOMB 1RGVA 4C8OA 2BKOA 1RAEB 4Q45A 4UY8T 5LOQA 3KLGA 3ZTOA 5EWEA 3AO3A 5EVZA 4NLDA 5FRMA 2ASLA 3CPWM 4ZN1A 1SJ4P 1OVYA 3UR3C 4CK1A 2B43A 3H5YA 4Z4GA 3SK3A 4J9VA 1YRXA 2A40A 3S3MA 1HFEL 1RT1B 4OI1A 1UAXA 3I55N 1AUSL 4EEYA 1FHTA 2IDEA 2O8CB 1TKXA 3CJKA 3ET6B 4UQGA 5F9LA 4N47A 4QPTA 3TJ8A 2GEMA 3L3UA 2P6SA 3HSGA 2GS8A 3G4SN 1NB7A 3LGNA 4IFVA 1RT7A 5L1LA 2OANA 1M5VC 4RUAA 2DPIA 2D41A 3MI7X 1RAIB 5A76A 2ABYA 2HMIB 1FD8A 4YY3K 4E8UA 4HHUA 4B02A 4O3QA 4B9UA 3EL2A 5JLFA 2HHUA 4NLYA 3OXFA 1RDDA 3H2VE 2Q3PA 4X64F 3IAM9 2V8HA 2YQ0A 3K8VA 4DV0F 1IBKJ 4C2MA 1T9WA 1U09A 3LP1B 1MMNA 2N7CA 4FM0A 1FRMA 2M3DA 2QC3A 3SV3A 2IIRA 1N48A 4EYHB 5JS2A 2CADA 3G6VA 3SMSA 3WC0A 4A8SA 1RACB 4GC6A 3W2VB 2YH1A 2HFUA 3OYLA 3LF0A 1VQLS 1Y7PA 2W2OP 3M32B 1S59A 4O3RA 2HQ3A 3CDAA 2KZMA 1T9YA 3SAGA 4DR7J 1VOMA 3BSCA 5F41A 4DG1A 1ZTTA 1SL2A 1VSFA 3ZETA 1RUSA 1JCFA 2XMTA 2JLFA 1QLNA 2W9BB 1H98A 1REGX 4FOIA 4CW7B 5B0CA 5D4LA 3NNHA 1RTHB 5FDLA 4AFFA 4CFAA 3WX4A 1DTTB 5KFTA 5EU7A 5EY4A 1S72N 3MM5B 1QAYA 1FDDA 1U0SA 1R0CB 2HS4A 2AZ1A 4FK2A 2OO4A 3HRGA 1UFLA 4WP8A 1C1CB 3IUCA 5AJ3F 5F2RA 5JVHQ 1CS4B 1HMVB 2A6OA 1KS2A 3MR2A 3HSJA 2DO4A 1HI0P 2L08A 2VYPA 3ZSRA 3NH0A 1SUQA 4B3OB 3CYMA 1TU0B 4OYPA 4ALZA 2MZSA 4ZP9A 2L9NA 2PDAA 3PIOQ 5M1NA 2C2ZB 1XHXA 4Z0UA 1TKZA 3I33A 3H2UB 3QICA 5BYQA 2VKZG 3UR0A 3CT9A 3IBCB 1PO6A 3F41A 1DEJA 2OZSA 2CPXA 3O5BA 2IJFA 1S5JA 4JV5J 3WNFA 3H46O 5JMVA 4U95A 3T6BA 3DGPA 2H5JB 3AVKA 4ZS6A 2UU9F 1GTHA 2VC1A 1XC9A 5DMRA 4DR7K 3WIUA 3K2YA 3CCJS 5E3RA 2CQCA 4NLBA 5C42A 3K58A 4BC9A 3AA8A 2RD5C 4YOUA 5M1OA 2VCPA 3DJCA 3B8HA 3UNYA 2KQ2A 4LMZA 3PKYA 3G8QA 1Y64A 1NHVA 2P6TA 2WRMA 2AEJA 3PJXA 3V1RA 4X4QA 3N5FA 4FKYA 5KFCA 3MFIA 4KH4A 2MQLA 1F0XA 3H8YA 3J81U 4Y34A 2EFQA 1KSPA 1U2VA 4DR5F 2OUGA 5RUBA 3PZPA 2WOMB 1KLMB 3BO4A 1TYQB 2APOA 1F5CA 2YWGA 2FC8A 5LMNF 1WELA 1VC5A 2XHBA 1M5KC 2QKKA 4J91A 4U67L 1N5QA 4DTNA 5JVGQ 1PC5A 2OZMA 1G1XA 3QIPA 1U48A 1XC3A 1B64A 1RBRA 4OX9J 2J0XA 4NZ6A 2L41A 3TX0A 3QSYB 2Q97A 2WFBA 4HI2A 2ROGA 1C1BA 1KC8T 4ED8A 3KK3A 4HDGA 1E6YB 3G8SA 4H4KA 1JLEA 3M32A 4C98A 1RT5A 2FY1A 4KHPK 3H1QA 3F73A 1IKXA 3AVAA 4IRCA 3RGIA 1X4CA 1N5VA 4TXSA 1RTIB 1QDUB 2HBLA 4BDPA 2Z1IA 5DDQC 4ZDNA 1CC8A 2JLEA 1RT2B 5E33A 1DT9A 4CHQA 2HHXA 1Z25A 2XLKA 3MXHP 5GAGI 4AILC 1YRTA 1VQKN 1HBNA 1HQUA 1OY9A 5ETRA 3OSPA 2EKYA 1YZ7A 5DO2A 3Q23A 2E5GA 2B8PA 1SC3B 1X4BA 5AFUH 5A8KB 2AEMA 3QJLA 2HQCA 1NSAA 4OKJA 2SXLA 1U2FA 3AB2B 3L4IA 2K7JA 5D0RA 3AVHA 2M52A 2VFRA 2ASMA 1BDGA 3AAWB 1R89A 4WFNQ 2IVFB 3U4LA 3T1HJ 1Q8LA 1NSKL 3SMZA 2OIHA 3JS9A 1YLXA 1JB0C 2CJQA 4OYAA 3POTA 3BJYA 2M5YA 4KHYA 3BGFA 3NCRA 1LW0A 5FPNA 2N4DA 5E84A 3DC2A 2GHVC 4Q2LA 2XS7A 3NWRA 4L75A 3FFIB 3ISND 4QCLA 4PL7A 4XPCA 2W9CA 1O5JA 4EZ6A 1T9TA 2G0JA 2D9OA 2LXIA 3A12A 4FWRA 4J9NA 3L95X 3D2FB 1Q78A 4X66F 2XY8A 2J7KA 2I7PA 2Q66A 2FF6A 3U3YA 1KAYA 3DRRB 3BEGB 3DXSX 3CI5A 3MM8B 2QA4N 4ZLLA 1LWEA 1TK0A 2P5OA 4G9ZA 2OGUA 2EC0A 3FZMA 4YNQA 1S77D 2I5JA 4AE5A 3KYLA 4QS7A 5HATA 1U26A 3ENAA 3J80Y 2BRKA 1CJTA 1ASVA 4CGIA 2WBRA 3L0QA 3SJJA 4NLOA 2CZVC 2Y0BB 4ZVRB 3Q0AA 1RDCA 5I42A 1YJTA 4XAKA 1X5OA 3LP0B 4L3QA 3PRVA 4DTXA 4JYAJ 1S5ZA 1UEUA 4DV3K 4Y6IA 4F67A 5JS1A 4FWOA 4JD2B 4AXJA 5T41A 1OVQA 4Y65A 5EX5A 4MKAA 2ZH8A 4GKJJ 5IT9O 3QSIA 1A5XA 2VQEF 3KWMA 1DZ5A 3DLKB 4BE0A 2HHSA 2FHJA 4XDCA 1S9EA 2HZVA 3EM1A 4G1QB 1LWCA 4Z4CA 3NHGA 5IFMA 1M90T 2ATQA 2E29A 5AQYA 1BQMB 2AP6A 1VSEA 4RBUA 2YWEA 4LR7A 5AQIA 1BLUA 1VQ6S 3G0ZA 3ZNUA 4QW9A 2W8KA 1Z4UA 1R8HA 1FKOA 3VR1A 1WEXA 1G4CA 3JSRA 4JNEA 3G96A 4DCPB 2NRTA 2CZ9A 2OI2A 1JCEA 1NDLA 2MKIA 4FJKA 2IRXA 3N28A 1ZM9A 2HBQB 4OHZA 2V8VA 3J8AA 2PI4A 2GIFA 4YOXA 4F3OA 2XNRA 1CJUB 3A3NB 2DR5A 1EKSA 3ZZUA 4Y00A 4ER8A 4OIXA 2R7OA 2HLTA 1UVNA 3J7YI 5I9EB 4DR2F 3HK2A 4KHPJ 4WYWA 2F63A 4OX7A 2RJZA 2FBXA 2DRAA 1S6PB 2J9DE 2QKBA 2DR8A 4KGMA 1HRHA 2H9ZA 2IAJA 3OJUA 4LRAA 3US5A 2BM1A 3MN5A 2H48B 5C12A 4CZKA 5D6GA 3ELHA 3RTVA 2MGZB 3FQKA 4DR6J 1RSCA 3A3PB 2HOEA 1GX6A 3TOQA 1P8GA 4C8YA 4CGFA 3L4BC 3HD2A 3VA0A 4JLHA 4DV1J 4XH4A 1EQ0A 2A2CA 3I31A 2NRWA 1EZZB 5A6WA 1ZBIA 2NNWA 1JLBA 2F9DA 3GIJA 3GFXA 1ZS6A 3SBTA 4WFAQ 3CQYA 1HYVA 2K06A 1WF2A 4KI4A 4B9VA 3CCRS 5AQOA 3T1YF 2P9LA 4DL4A 2B7CB 2KTQA 3MWPA 4ZMMA 4R79A 3NGZA 3T69A 3VGLA 6FD1A 1G7CB 2ALYB 5K5MA 3CJ7A 1E4GT 5HBMA 2ZZNA 4LFAK 5AZJB 1Q5VA 2XCAA 1XK8A 1SIWB 2EFPA 4TYBA 4GC7A 2VQFK 2D1KA 2I0XA 2AHOB 3OL8A 3BGRB 1QUVA 4HT5A 2PY5A 3VAIA 2A3ZA 4LF8F 4PWDA 1YIJS 2A18A 2HQGA 2KJVA 3E3XA 1DQ8A 4PXDA 3GMGA 4CJKA 3BQ0A 4RBVA 5KFRA 1F9EB 1HNZK 2IMWP 2VU5A 2RE2A 4JS4A 3OT9A 5M1KA 2FSKA 2QG9B 2AYGA 4HH1A 1S0MA 4OJ1A 4CZLA 1NK4A 4FYXB 1SJRA 1NHUA 1T05B 4ZPBA 5EUHA 1NDCA 1TQLA 4LF7F 1FEHA 3N4QA 2WW4A 2V7ZA 2ZVSA 4OPHA 4WQ5A 4DR6K 4CVNE 2VD3A 2F4VF 3S3OA 4GRSA 2IRUA 2YV0X 2FLOA 3WXKA 4KRFA 1ZA2B 5D3GA 2IDLA 4LF8J 4O3NA 2J6TA 1HNIA 1OS5A 2NRVA 2BJEA 3HHEA 4KPCA 5AQSA 2O8DB 2MKJA 4WQ5C 1NGHA 1VSHA 1ELOA 3V6DB 2QWPA 1D5AA 2G2OA 4I9LA 4OFZA 2CPYA 3QEXA 4B3MK 4CM2A 2QV6A 1X9MA 4RU2A 2KVIA 4M5DB 1NZ8A 2DNMA 3C95A 2XG8A 4X65J 4H0OA 2UVWA 3KKRA 4BGBA 3T1YJ 3FSIA 4WJBA 3UKRA 3LPTA 4CHOA 1FNOA 3SPYA 3LZJA 1K8KB 1HJOA 2ZH5A 1WOQA 5J2PA 2DH9A 1FXDA 3KLGB 5IXUA 4LQ3A 4B3MF 3C6UB 1LQ9A 2YKAA 2LSNA 3ZTRA 5DQIA 1JLQB 4WYBA 5ELZA 4ZCIA 3D6MB 5IS2A 1MN7A 3ID8A 1RBLA 2ZDPA 2MLYA 4UOHA 1X5PA 3LDSA 4ATNA 1XNRK 3DOLA 2PA8D 3CWJA 5JVHL 3BR8A 4Y3CA 1EARA 4TU8A 2GMJA 4DUYK 1Q86O 1T11A 4CJRA 3QFHA 3KMQA 3AD7C 3W8PA 3A1YG 3ZC4A 2E5HA 3MEDB 5C5JA 2NUHA 2ASPA 5BRFA 2KN4A 5EN1A 4Y0FA 2JGUA 3AJ2A 2MYFA 2DGVA 2P9NB 3DLGA 3NF9A 4LFAF 1QVGM 2BOAA 4X4VA 3NF6A 4L8RB 2LDYA 1ROFA 3M8ZA 1K1QA 2X1BA 1LAWA 1RTHA 3U7JA 3MEGB 4CI0B 1U24A 1FKOB 4EK2A 1DHMA 5LXRA 1JL1A 1GLEG 2KT2A 4FLTA 4OJGA 3O9QA 4MAKA 1X3NA 3ZZYA 4LF2A 1HKBA 1U0HA 4DV4F 2EFOA 1NUEA 4URQU 5AQKA 4DV6J 4MDAA 2XHWA 1N36K 4CIOA 2P9IB 1KOOA 1TL4A 1IO2A 3WEEB 3VQDA 5IV3A 2X3DA 3C6TB 3GR0A 3V6JA 1SV5B 2W2PP 3MUVP 5ETPA 3M8QB 3O8WA 4DPYA 2RE1A 3ZX3A 3VVUA 2UXDJ 3NS5A 3TAEA 4DHYA 2Q1NA 2VQEJ 3LDPA 3K5NA 1HMVA 2IVMA 1YQHA 1VQ7S 3F5TA 4V19S 1RISA 3G4SS 3FLCO 4TN2A 3LTOA 1QD1A 1DQ9A 4ECRA 3EE3A 2ZBPA 3LP3A 4ED3A 3M9NB 1T3NA 2RNEA 3LH2S 2KL8A 3I56S 5FROA 1SUQB 3VETA 3G6ES 3A5LC 1FX4A 4JKHA 3RMBA 4OLPA 1JXLA 2Q36A 2ITGA 1JJCB 1CS4A 3P45B 3RMCA 4FYVB 4CH7A 4YB1P 2GVDB 3AXKA 5E3AA 3LO3A 3MPVA 1CLQA 3WNHA 3WC2A 2R2SA 1IG9A 3OUYB 3GIRA 1VQ4N 2W4DA 3NS7B 4ES1A 3VQSA 2X1FA 3TSPA 2BBEA 5CCLA 2DRDA 2GJIA 1NWKA 5IV4A 3M2UB 1VJQA 4XK8C 1HWJA 1RZMA 4MMOA 1EX8A 2DR7A 2OH2A 2KRRA 1KCFA 4DX8H 1NHKL 4GKKK 4KGVB 4NWBA 1NJZA 3LAMA 2FBYA 1N34J 4FZYA 1NKEA 1YDLA 4W4MA 1Z2ZA 2LQJA 3ILIA 5F8GA 5KRSA 3J7AN 4E7LA 5AE1A 3GJSB 3HJFA 3AO2A 4IQXA 4PXBA 1BQNA 4CLFA 4N76A 1H72C 4CGDA 1VRTB 3Q86A 4P71A 4X62K 2ZBIA 5AJ3K 1KLMA 5ETSA 3ZTQA 2WC9A 4IG0A 3UPFA 3MR3A 4DHVA 2B56A 4Q8FA 3K5MA 4YDDB 1OH8A 1RLCL 1IM4A 3MK6A 3VEVA 3M2VA 4BWJA 1ZTWA 1X5TA 4UTGA 2OYQA 4M95A 1Q79A 3HHNB 1E3MA 2U1AA 4KR0B 2WOMA 2F8SA 3VHQA 2XMVA 2E6MA 3ENOA 4UT4A 3VQTA 4WKRA 3G87A 4K4WA 1M1HA 3IWXA 4ZITA 3HMJG 4PZVA 4NXNF 4F04B 4DXLA 1JKHA 4BWMA 4F8RA 2AMCB 2AGQA 4KV8A 3PYDA 5LMNK 1Q4RA 2XMMA 2DY9A 4UZBA 2KKHA 1KQSM 1NOYA 3DOLB 1R6VA 5J2PB 2CQDA 1YBAA 4RW6A 4O8KA 3GBTA 4LR9A 3ICLA 4OHYA 1S0NA 4Y2KA 3VERA 1UW9A 4M3XA 2V4JB 4C48A 4CEFA 1JK9B 4TSXA 3N6NA 3NVMA 1S12A 4ANDA 5GMDA 4PUOB 4WFNL 3DRXA 1EWRA 2QL9B 2UUWA 5AXNA 2IA6A 5K8NA 4BR9A 3MF5A 5EWFA 3IBFB 1U1RA 2NLXA 3W5XA 4F4WA 4KKOB 3MOZA 2DGOA 3GG4A 3G2XA 2IYGA 2BJ1A 3CIMA 3D0PA 4K25A 1ATSA 1J53A 3HPOA 2RN2A 1HQUB 3CCWA 1UAWA 1BWEA 3BSOA 4DPWA 1VGYA 2Q0RA 3S6EA 4FL9A 2QO3A 5A2QU 2D0CA 3R6GB 3WBZA 3NGKA 1JJHA 2HRYA 3L2VA 1FVQA 4WBFA 4JI7F 1Q9YA 3MZIA 4WE1A 3W2WA 5DM6L 2EFGA 1GOCA 2W9CB 3ATUA 3R7NB 3KK2A 2Z58B 3DYAA 5THWA 1ZH5A 4NASA 3CC2S 1RCXB 2MHEA 4J9UE 4PL8A 3TPQA 2ZOFA 3W8GA 1LW0B 4KH5A 1CULB 3CB4A 1P1LA 1WSEA 3DLJA 3PW0A 1S10A 1ZYQA 3P49B 3FEXB 5I3QA 1RHQB 2DYAA 2HBZB 3BGLA 3MR6A 4FXWA 4DR1F 3N79A 1FWLA 2EG1A 3D6FB 5JICA 2DTUA 4FWLA 5J2QB 3TVYA 4NPOA 1J5EJ 3HOSA 1NLKL 3FEZA 3M6UA 3H0PA 1LCUA 4FW1A 4WXOA 1ZPWX 3MECA 2ZM6K 2VFTA 2KT3A 1R27B 4QYZK 1M5HA 4OGCA 4LVNP 3TUIC 4JD2A 3NS6A 4FSVA 3I56N 2YQ3A 3MURP 3BZCA 4CFCA 4CZJA 3SUNA 3CDWA 1S6QA 1YI2N 1G2EA 1A5VA 4GKKJ 3AAPA 2FBTA 5HQ8A 1XMOF 3MTKA 3AGKA 3JTPA 4BRFA 3M2VB 3AH6A 2E8AA 3M2UA 4F2RA 4CD3A 3QFWA 1MWMA 3O08A 1OO0B 3DLLL 4LFCK 4DKWA 1SKRA 4F50A 2QZ8A 2OAUA 5AJ3J 3W9IA 3P5BP 2VWBA 2XMKA 3LPUA 2YHYA 4EO8A 1JJ4A 2OLWA 2V69A 4A57A 1JKHB 4BRMA 4IFYA 3X1LB 5HMXA 1N32K 3VMFB 1V9OA 4R5PA 3J7YP 4DLEA 1K44A 3EGWB 4DMZA 1HNWJ 3AQPA 2LLZA 1VBXA 1S49A 2Z2MA 2DNPA 3R9LA 4X4SA 2Q1LA 4W5TA 4I6WA 3PO5A 1Y5NB 4WIIA 2QMWA 2YX6A 1VMBA 4IOAL 1KVIA 4NMXA 1APSA 3LA0A 3ILJA 4FPIA 3SSSA 1TMMA 4CJEA 4PUOA 3HVTB 1TR0A 4DU3A 4JI6F 1WOSA 3V4IB 3CG7A 2AZ3A 3TAFA 5KG4A 2NYIA 2YKNB 4GV9A 2VHGA 2VDIA 3P96A 1T3OA 1S9GB 4AL5A 3ZZRA 1AW0A 3PSFA 3KDOA 4CEZA 4EBDA 4X64J 4JI1K 1VLYA 4DFMA 3Q89A 1TGOA 1VDHA 1I39A 3LWMA 2LKZA 5I3PA 2BZ2A 4ECQA 1X4EA 4RNOA 2KI2A 2ZQBA 2MGZA 1B0VA 4MKVA 4WZQA 1ZBSA 2ZJRL 3DXKB 4DTUA 4M3RA 3ULEB 3DYAB 1JJ2M 1ASUA 2DNOA 2JX2A 4IDHA 1HKCA 3UD4P 3VESA 5KOXA 3V9WA 3GPAA 1K9MO 3THYA 1K6YA 1NLVA 5HLFA 4PPZA 2BW7A 1YVUA 4KFBB 1UZDA 2AP1A 1M5OC 3NNCA 2QIFA 3PACA 3MWBA 3OVSA 3ADAC 1Q81T 5DZ6A 3ULDA 4RJVA 1YK9A 4AXIA 4TU7A 5CXTA 2LQ9A 4KGZB 3CMQA 1HWIA 4PG5A 2BUPA 1NAQA 4WFZA 2COLA 2I1RA 5AQWA 1DARA 5H1SV 1VQMS 4RO0A 4Q44A 3FGUA 1T03B 4LF9J 2R9LA 1F3VA 1WI8A 4GV6A 3DKDA 3BBCA 5C15A 4KB0A 2FJBB 2DH7A 2BQRA 5C2GA 2MLXA 1DTQB 3BKUA 4LSLB 3WXMB 3VGKA 4GVBA 3Q2SC 1IKVA 3HPGA 1HQEA 4WFBL 2VG6B 3VGTA 1BIUA 4LF4J 2CNOB 5DLGA 1U1QA 4WP3A 1OSCA 1VSIA 3GZ7A 1CULA 3Q8PB 1J54A 1E6VA 4RW9B 2VPZB 3SXLA 1WTBA 2XSFA 2MY7A 1KOHA 3P1GA 4RWTA 4USMA 1K8AO 3P38A 3T9NA 3UKRB 3I55S 4JV1A 2EG2A 3VAJA 5C2FA 1U4BA 2RQMA 3OR1A 3LDNA 2V2ZA 3CEDA 4L76A 5LMUJ 2W7PA 1URNA 4FJNA 2FJWA 2OD6A 3PTWA 1N4LA 2JFDA 3E1YA 4M94A 2FSJA 4C23A 4HTLA 1CXUA 1H3DA 1KHWA 2BKPA 4RLEA 1GOBA 1ATNA 4ECSA 4FLYA 2GAGC 1SZ2A 2VB6A 4B8AB 1EETA 1T8EA 4ZK7M 4DU7A 3L8BA 4HHTA 1RA7A 3UDVA 1F5AA 2FGOA 4JBCA 4Q0BB 4TKTA 4DQSA 3THXB 5HVGA 2UUCJ 3T41A 2I2YA 1GLAG 3FZ2A 2K1RB 2F7TA 2CVEA 3HFZB 2HWIA 4MT1A 1R0AB 2CJXB 4DFKA 3K17A 4CEDA 5IM0B 3OTOK 1SI9A 3V9SA 4QIGA 2ZEJA 3ZX0A 5E0OA 1Y10A 1P6TA 2KM8B 4CLUA 5HANA 2ZJRQ 4EBEA 4WF9Q 3QINA 2MDAA 4IOXA 3UD5A 3OR2B 1TFWA 3I0SB 5JJBA 3QAEA 1RWMB 5C2DA 3MEGA 3TI0A 2C3YA 3R7BB 1B4SA 4NX9A 4DU4A 5ADZA 1OPZA 2HKEA 5A0YB 1LWEB 3UN3A 3HBTA 4JKBA 4PKDB 1N6QA 1RTIA 2HBRB 3ZZ0A 2CA9A 2CYYA 3RRGA 2CH6A 3DNCA 4P2SA 4F02A 1YITN 3WEEA 3QT7A 3BB5A 4FPAA 4DL2A 5DG8A 2XMWA 2V9KA 1VQLN 3R5DA 1MW7A 5CYQA 5IWAJ 1HLWA 4USIA 5F3ZA 4JKAA 1KNZA 3CCVS 3CM6A 2MJUA 3IP0A 3OYIA 2O8BA 3U27A 2XSJB 1N88A 2JC0A 2R7VA 5GIOA 2G8KA 4LSZB 5L1IA 5L39A 1NCLA 3GJQB 1XNQJ 4CHYA 1D3WA 4ZCKA 2MKKA 5KT5A 2OEJA 3A8EA 4C11A 3N6MA 3W66A 4FWQA 2KT5A 4RG8A 3CETA 3OTOJ 3LL3A 1RDUA 4B9MA 3Q7CA 1ZBFA 3G6XA 1HHTP 2L9WA 1C0UA 2HHQA 2BE2A 1W0HA 3HT3A 2YXLA 3AO4A 3BSAA 3SQ4A 1WI6A 1GXTA 3LM9A 2YHAA 4CM0A 4M5NA 4FO0A 2GW8A 3OTCA 1X9WA 2F9JA 2H4YB 3S8SA 4J9KA 2E5LK 4B17A 1VRTA 5KTQA 4OI3A 4BRGA 2UXBK 8ATCB 5IT9U 4A46A 1UVKA 3GOIA 1HWUA 1T0TV 2A1SA 3B4MA 5FIIA 1Y00A 1RWNB 3T6JA 1T03A 3Q8VA 4ZP8A 3MN9A 4A8MP 2PEHA 4EGLA 1LWCB 3AVIA 2AD9A 3DM2B 5CQGA 1HW9A 3EGVA 3OYFA 2LP4A 4RW6B 2YQ1A 3DAWA 4K2XA 4IG0B 2F3JA 1VSLA 1SAZA 3BGOP 1RK8A 2HBKA 3H7HB 4ID1A 3CCQN 1IQTA 3CCSS 1HYSB 1QZ5A 1IJEB 3T1AA 1IKVB 1S97A 4ZN3A 3T5KA 4O44B 4LF5J 2BV3A 3W64A 3NKYA 4RW4B 1VR6A 3EYZA 2BA9A 3ET6A 4RL1A 2VJVA 3OR1B 3C15A 4CJFA 1RDBA 1WHWA 2G8UA 1WG4A 2HZCA 4J9RA 3I5AA 3I82A 1C0MA 5B08A 2ZVIA 4USWA 3GILA 4LBIA 4Y0WA 3THVA 3ZT0A 2UUBK 4MJKA 2BEFA 4OZNA 4YY3J 3CCUN 3TTDA 5IOLA 1K1SA 3I4HX 3EUNA 3VZHA 5CCMA 1ZZFA 2HGMA 2ZGYA 4N8NA 2ASDA 4C0OC 4FVCA 2Z57B 4ID5B 1TL5A 3W63A 5TKWA 4Y28C 1IBCB 5KFOA 1D8ZA 1QVFR 4C3MA 3RRHA 3IBWA 4BDYA 3K57A 3IWNC 1BG3A 3MCPA 3GCWP 4OJHA 3W2WB 5G4DA 3OYMA 3CM5A 2IDOA 2YNHA 3UFCX 1HNVA 1EXQA 4AHSA 3DLHA 2F7VA 4DPTA 2WSEC 1C0FA 1CEZA 1M1KO 2IJRA 4ES3A 2R8KA 2XO6A 3CCMS 1NKBA 2FLLA 1IUJA 2XS5A 3E9PA 5A0YA 5HP1B 5F8HA 5H9FK 1S6PA 1VIXA 1KAZA 1NO8A 2CH5A 2DRBA 2CQ4A 1SQFA 1CPZA 2HF3A 2QXLA 2ZJQL 2YTCA 4IRKA 3CJAA 2W1BA 1DTTA 2BKNA 2OA8A 2E1ZA 4DQ8A 2E1YA 5CH7B 2HK3A 2YHBA 5L46A 1RILA 3ILLA 5HBMB 3CFRA 4RKUC 1N5TA 5M2UA 3MPUB 3PVXA 3MMJA 4DSKA 3UWTA 2JC1A 2N3OA 4PABA 3NMRA 4ZPCA 4CJTA 1CZBA 1WWHA 1XWLA 3NH1A 1VQ9S 4I56A 1OYDA 5CABA 1CJVA 1JXEA 3R5AA 1KFDA 1OH6A 2ACMA 4ITSA 6FDRA 1Y9OA 1N52B 4YHHJ 2GQCA 5A8WA 3HJVA 1HBMA 1X1PA 2J76E 5C42B 1N54B 5AQUA 3PFOA 2X51A 4PQUA 1VHIA 2EWHA 4DR3F 5D4OA 3HHLD 4BACA 3CPEA 2L3MA 2HVIA 2A42A 1Q86T 2DCLA 2A2DA 4CLYA 3SCIE 2K8GA 2ZUAA 3OYEA 1S1VA 2HBYB 2VOOA 2UUBF 3W3SA 4K4YA 4QU7A 3FFKB 1WACA 1SQKA 4DR6F 3OLBA 4WFAL 3IA0A 2V7YA 1PYOB 4BE1A 2JEGA 2W01A 4DU8A 5EX0A 4USTA 1UWBB 5DDPC 4EHTA 4O0NA 3DLBA 4DR2J 2G2YA 1D8YA 4GVEA 2Q6CA 1UJ5A 4R8UB 2Y1RI 3QEPA 5AXMA 2RQCA 3NF7A 2AW0A 3QIPB 2OMLA 1UWAA 4H4OA 3D5MA 2VG5B 3AFGA 2KU7A 3DLGB 5KQ8A 2Y1JA 1NZAA 2IYIA 4K8XA 3UKUA 1QUPA 1HNIB 4K4XA 3M1FA 4DV7K 1H0HB 2C22A 3V9ZA 1OMSA 2NPFA 1QQMA 3IRWP 1RFQA 3GR1A 1IVZA 1RWOB 4ZPDA 1BWFO 4FNHA 1ZM4A 4UUXA 3EVWA 1RU1A 2B4PA 4QIVA 2M9KA 3GV7B 4PA1A 4FWPA 4RW8B 1HL6A 2YH0A 3AV9A 3H90A 1Q81O 3V81B 8AT1B 1U1NA 4M7YA 3DM2A 2DEIA 3QESA 2QA1A 5HL7L 2FC9A 2IBOA 3FNNA 3MGJA 3NGTA 1E6YA 1NJIO 3SCXA 3OYBA 1HYSA 1Q82T 2Y3YA 3DRSB 4GW6A 1WDDA 3N0VA 4DR4J 4ILJA 1HPMA 2JL9A 4DTJA 4Z4IA 2VJUA 2WONA 4ZVSB 4YOTA 2C2NA 1UA0A 1YHQN 1IKXB 1EIYB 2CWXA 3BO2A 2M2BA 2W9AA 1NJYA 3J7Z5 1L3VA 2IC3A 4BRKA 5CD4H 3CJ1A 4C0HA 3OW2R 4JI6K 3WQPA 3T5HA 3KWGA 3SYZA 5KAKA 3TUPA 2G0CA 2ASOA 1PAUB 4I7FA 5KFAA 2HVEA 2MQNA 3SCJE 2CXEA 3H4BA 4YEAA 1RKIA 2P5VA 9RUBA 1YRUA 5GAHI 3CO0P 1RBOB 3U6FA 3DXKA 2IBKA 3GP9A 2CZ4A 4GVBB 1K8AT 4J2BA 3PRDA 1VRQC 5D0GA 3QZ8A 3SFUA 5KFZA 1X9JA 2NXJA 4ANCA 1IG8A 5I42B 4I67A 1NGDA 1R8PA 1DBDA 4DZDA 3GE1A 4NLGA 4OKEA 1NGIA 4B3RF 4WQ4A 4B9NA 3SSRA 3BQ2A 1HHQA 4MIBA 3L09A 3D2FA 3LANA 5DK5A 5K14B 3C6HA 1SJQA 4ECTA 4FZZA 4E3SA 4C3KA 1FRXA 4CLSA 5AQPA 1NNEA 1B7YB 1RB0A 4AM6A 1XN9A 4DR1K 2JWLA 3PW5A 3I0RA 1M1KT 3NBPB 1XHZA 3R2CJ 2VV5A 1PJ5A 4GO5X 3O3LA 5DETA 2VA2A 3NGDA 4ZVTB 1HR0F 3HT0A 3L7OA 5E41A 2UXCF 2CQGA 2QFIA 2YNGB 4MH8A 5KGWA 5AXLA 3EMTA 3TSQA 4OPAA 4OZLA 2JHEA 1BQXA 2NZCA 2GHWA 2HQFA 1SCJB 3LUYA 1VQON 2ZKUA 4C3LA 2VONA 2Z1JA 4W5OA 3BY5A 2AJFE 4B9SA 1ZM2A 4W5RA 4FF2A 2G0IA 2R8JA 3D9BA 5FD1A 4YDUC 4PG4A 3CJKB 1OH5A 1HKGA 1P1TA 1RA6A 3OY9A 3A3OB 3BH7B 3JAMO 2KKZA 3CJ9A 5BRHA 1R8AA 3CMEN 3AVLA 4CF2A 4LFCF 3FBCA 4H4MA 3R1XA 4P73A 5J2NB 1RWXB 4CJSA 1GX5A 3VTIA 1S1TB 5AFUA 1S48A 3M30A 3M9MB 3M3ZA 1FJ7A 4LF5F 2L48A 4ZIWA 4CLTA 2PN6A 3SDEA 3EY1A 5B0GA 3CCUS 3QJPA 1IKYB 1XR5A 2KFYA 2OPQA 2GMHA 2EX3A 4ELVA 5EHHA 3VGVA 2XMAA 2PBDA 4LFCJ 5FLXU 1S7HA 2YHWA 3FZFA 3KG1A 1Q16B 1RLDA 1RT6B 3CW2C 2V51B 2VGMA 1XERA 2X1AA 4ED5A 2VG5A 4CO3A 4CH1A 4CLLA 2CDRB 5BJRA 2O66A 1NM2A 2AYMA 4F3QA