3E01B

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Gag-Pol polyprotein
total genus 108
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B04
1S1TA 2OPPA 1WNEA 3H98A 4J9QA 2W9CA 4DG1A 1RTHB 1SUQB 4R5PB 1C1CB 4JV1A 4ZPBA 3H40A 4ZP6A 1RTJA 4J9KA 3MR3A 3I5CA 5KFPA 3IG1A 2E9TA 1RT1A 1MU2A 2ZD1A 4WXOA 4IG0B 4MFBB 3MFIA 4H4OB 4I7FB 4TXSA 3CWJA 4NCGB 4PWDA 4QWCA 5HBMA 4EEYA 4EBCA 4K4SA 5KFTA 2J6UA 5D3GB 3TQ1A 1TKXB 2O5DA 3PW7A 3ISNC 5FDLA 2IJNA 2WB4A 3DYAA 4I2PB 2W8LA 4ECZA 2AGOA 3FSIA 5KG4A 1KLMB 2JC0A 4ED0A 4MKBA 2YNIB 1S9FA 3DLGA 4KAIA 5KFIA 3MEGA 4O3QA 4RW6B 5F9NA 4F4YA 1JLGB 3OL9A 4LSNB 3CDEA 3TVKA 2R8GA 2ASJA 5KFAA 4KE5A 1D0EA 3GQCA 2JEGA 5HP1A 5DLGA 5KFHA 2UUWA 2BE2B 1RT7A 2WONB 4NLPA 4KV8B 1UWBA 2C2DA 2W7OA 4ECXA 2ILYA 4K4TA 2W7PA 3D28A 3G6VA 4IH7A 4MK8A 4RNOA 3M8QB 4DL3A 3ISND 3LAMA 3NBPA 2QV6A 5KFQA 5KFEA 5DGBA 2ALZA 4Q8FA 5HP1B 4MK7A 2I1RA 2C2EA 1N6QA 4NRUA 2F8EX 1JLGA 4F4XA 3MEGB 4EO6A 4ECVA 3BQ0A 3QGGA 3H4BA 1S1XA 5KT3A 1JKHA 3T1AA 2D41A 5EUHA 3C6TA 5KG2A 4X2BA 3KK1B 1KHVA 3PJWA 4RW9B 5J2QA 3QLHA 4RNNA 3LP0B 1ZTTA 2DPJA 3MF5A 4RW4A 3ITHB 1JLQA 3KHRA 2IJFA 1TV6B 5KG0A 4KHMA 4URSA 3M8QA 2R2RA 2VA3A 1RT1B 5DGAA 4NLVA 1TL1B 5KG5A 3PVXA 4NCGA 2YNFA 4J9LA 2WOMA 2BANA 3KLFB 4U6PA 2HMIB 3KK3B 4IG0A 1EETA 4K4UA 5EDWA 2RKIA 2AX0A 1IKXA 1K1QA 1S4FA 3Q8PB 4IDKB 2VG7A 4PUOA 5CYMB 4LSNA 3V4IA 4WFXA 3KHLA 4K4YA 4Y2CA 3MFHA 3GIKA 4RW7B 5EWEA 4K50A 1VRTA 3DLKA 4I2QB 1HQUB 1QE1A 4IFYB 5L1JA 3T5LA 4DL2A 1DLOA 1LW2B 4J9OA 5I42B 1RT3A 1TKZB 2IA6A 5F8GA 2UUTA 2XWYA 1IKXB 2B6AB 4R8UB 3GILA 1FKPA 3ICLA 4LQ9A 4ZPDA 1RTJB 3DDKA 1REVB 1BQMB 4ED8A 3M9OB 3KNAA 4U7CA 1TVRB 1SV5A 3E01A 1RT5B 5J1EB 2CKWA 1S0OA 1T03A 4FBTA 3H5XA 3DLKB 5KT6A 5KG7A 3UQSA 3GV7B 4Q8EA 4EBDA 4H54A 3SFUA 3FFIB 4NLXA 1S9GA 3G6YA 3QLHB 2WK4A 3N6MA 4RW8A 3CO9A 1J5OA 4TY8A 2V4RA 2VG6A 2FVSA 2FVCA 3TAMA 4B3OA 4IH6A 4RNHA 2BQ3A 2UVVA 4ZVHA 3FQLA 3KK2B 5C25A 2GC8A 4ZMMA 3MR6A 1EETB 2ZKUA 1RT6B 3CJ3A 5DQHA 4MIBA 5L1IA 3RB6A 2YNFB 4G3IA 3JYTA 3I0SA 4QWEA 5L1KA 2IAJA 1XR5A 5K14A 1HMVA 1S1VB 4H4MB 2ILZA 2BANB 3KLFA 1S0MA 5F8MA 2JEFA 4IFVB 3HVWA 2YKMA 3BJYA 1QAIA 2QE5A 5KFLA 5T14A 2YKNB 5I3UA 2HWHA 4NLQA 2B5JB 3M8PA 3OL7A 4F4ZA 1S1UA 2R8IA 2R2UA 3H59A 4ZVEA 1JKHB 4RNMA 4IG3B 3CJ0A 3SFGA 1RYSA 1T94A 1C0UB 4KBIA 4ECSA 4ZPCA 4WE1B 4TQRA 1KLMA 1JLFA 3H5SA 3QZ7A 3GIJA 1VRUA 1TKXA 1RT2A 1RA7A 3QGHA 2WOMB 3BSNA 4G1QA 5DQIA 4IFVA 2HNYB 4IR9A 1UWBB 3EZUA 2YNGB 2V0NA 4MH8A 4O4RA 2C2RA 5KT7A 1S10A 1LWCB 2W9BA 4ZPAA 2FJXA 4O3SA 4MK9A 4G1QB 2YNHB 5KFJA 2BE2A 3IGVA 4IOBA 2FLNA 2W9CB 4IR1A 1ZETA 4NZ0A 4ED2A 3NMAA 4EYHB 2E9ZA 4J9NA 4ICLB 4TY9A 3DRPB 2AGPA 1RTDB 3Q8QB 3DI6B 5KFBA 3T19A 1JX4A 4EYIB 3DLEA 3QIPB 4ED1A 1LWCA 4Y34A 3BQ2A 2IM1A 4J9SA 2BQRA 3LP1B 5HROA 5FDLB 1HMVB 1S1VA 2HNZA 4H4MA 4MFBA 5D3GA 3FRZA 4F50A 2YKMB 3KLIB 4KO0B 4IRCA 2RDJA 3JYTB 3EPIA 3MECB 5KFCA 4Q44A 2ZE2B 5C24B 1BQMA 1ZTWA 4M95A 2IAJB 4ZP8A 3KLGB 3PHEA 3RB4A 4O3PA 3BREA 4Q0BA 4R0EA 4M94A 3LAKA 4IKAA 1S97A 1RTHA 3MTKA 1HPZA 4FS2A 5KG1A 5L9XA 2FJVA 1HYSB 3G86A 2OPPB 1S9GB 3HVAA 3RAQA 1S6PB 3IRXB 4WFYA 1S48A 4RW8B 4O3OA 5KFKA 4QW9A 1JXLA 2R2TA 3UDLA 4DEZA 2W8KA 5EWFA 3LP2A 2C22A 5DLFA 1HPZB 2DPIA 1DTQA 3V4IB 4DL4A 2ATLA 3DMJA 5F8IA 3I0SB 3JSMA 4NLRA 1IKWB 3RB3A 1C0TA 1RTIB 4ECUA 5KG3A 4ED7A 1IKYB 2FLLA 2B6AA 3V81B 3QO9A 3G6XA 5F8HA 1RAJA 4YR0A 1FKOA 4RW4B 1EP4B 2I5JB 3LP2B 2AWZA 4MKAA 4NLUA 3MEEB 2HNDA 1N56A 4XPCA 4KFBA 3OLBA 3DRPA 1T03B 4Y2AA 3BGRA 2R8HA 2RF2B 4O3NA 4K4ZA 4IDKA 3KLHA 3DOLB 5KFMA 2V9WA 5C24A 3LALA 1N6QB 4Q0BB 2BRKA 3N6NA 3M9MB 2E9RX 1JLBA 1U09A 3KK1A 4WXWA 2OPQB 3EPGA 3MR5A 1C1BB 1TL3A 1LW2A 3MECA 2V4QA 3CJ4A 4GC7A 4NLSA 2WTFA 3LP0A 1QE1B 1GX5A 4I2QA 1DTTA 4RW9A 3N6LA 1S6PA 4PQUB 2FLPA 3ITHA 3H2LA 4Q43A 1JLAA 4LSLB 4YP3A 3IN5A 2XI3A 3PW0A 4QWDA 1IKVA 1S6QA 4K4VA 1FK9A 1RTDA 1T05B 4WYWA 4F4WA 4EBEA 2YNHA 1S9EB 2BR0A 4ICLA 4IG3A 1OS5A 1HNIA 5KFGA 3Q8SB 3PR4A 1S0NA 4PQUA 1S49A 3Q8RB 1R0AB 3I0RB 3KOAA 2B43A 4K4XA 2C28A 3GIIA 5F8NA 5C42B 4J9PA 4ID5A 1IM4A 2HNZB 1RT7B 4H4OA 5KFDA 3V6JA 2HNYA 2OPRB 1K1SA 3RBDA 2IC3A 4FBUA 1T05A 2GIQA 5J2QB 3DRSB 3SI8A 1R0AA 1LWFA 1TKTB 1RDRA 3CJ2A 3C6TB 3FQKA 1S1XB 1SH3A 2RF2A 3BGRB 2HNDB 3QYYA 3OSPA 4IRKA 3RBEA 2W9BB 4XO0A 3NAHA 4ID5B 2OPQA 2YKNA 5I3UB 1RT5A 4TYBA 4QWAA 1QAJA 3LANA 2FVQA 4KV8A 3CIZA 2WONA 4ZP9A 1C0TB 1I6JA 4JV0A 4IQXA 4ZHRB 2JEIA 2OPSB 3IG1B 3PJXA 1RA6A 5KT5A 1S1TB 3DMJB 4WE1A 2XI2A 3TAMB 4B3OB 3GIMA 1FK9B 4TY8B 4JUZA 5L1LA 1IKVB 4WFZA 5C25B 3QZ8A 4O4GB 2JEJA 3IGNA 4IFYA 2XGQA 4URQU 3I5AA 3CDUA 4Y3CA 5KG6A 4DL5A 4Q45A 5F9LA 1EP4A 2I5JA 4JV2A 1FKOB 3NAIA 3DRRA 1HQEA 3GYNA 1LW0A 3PR5B 3MR2A 1BQNA 4NLOA 1XR7A 4R8UA 3H5YA 4QPXA 5KFUA 4ED6A 4WZMA 2OH2A 4RU9A 5I42A 2HMIA 1DTQB 3OSNA 3KHGA 1FKPB 1HNVA 3JSMB 2XGPA 2BQUA 2WRMA 4QW8A 4J9RA 5KFVA 1W25A 3IS9B 3HVTA 5KFSA 1MMLA 1J5OB 2AGQA 2EC0A 3DRRB 4ED3A 5KT2A 2UVWA 3PW2A 3DM2B 3E51A 1GX6A 2UVUA 5EWGA 4NRTA 5F8JA 3UR0A 2J6TA 5KT4A 4TQSA 2FVRA 2AQ4A 2UVRA 5CYMA 5KFWA 3PZPA 2ASDA 3V81A 2J6SA 1HNVB 4ZHRA 3RAXA 1N5YB 3CJ5A 3C6UA 5J2NB 1S1WA 4KSEB 2FVPA 4RNFA 3KLGA 2OPSA 5J2PB 4NLWA 2HWIA 4J9MA 1RT3B 1TKZA 1TQLA 5KFOA 1TV6A 3UPFA 5C5JA 3BQ1A 4FS1A 1JLQB 2IBKA 3FDSA 1TL1A 5HLFA 3HKWA 1T3NA 4MIAA 3DOKA 4ECQA 4XPEA 3LP1A 5HROB 2R2SA 3T5HA 3DLEB 3QIPA 3GV5B 4ECWA 2JC1A 3PW4A 5CYQA 1LWFB 1NNDA 1TKTA 2VG5B 4EO8A 3DRSA 4KKOB 3PW5A 1LWEB 3RB0A 1C0UA 2ASLA 2IC3B 4LQ3A 2VG7B 4PUOB 4ZP7A 1JLEA 1RT4B 3MEDA 5KFFA 2D3ZA 1JLAB 4LSLA 5KFZA 3T5JA 3KK3A 5KFXA 2ZE2A 1SH0A 3DOKB 3HHKA 4KO0A 5HBMB 4NLGA 5HLFB 1C2PA 4PWDB 4RUAA 2YNGA 1RYRA 4I7FA 2AX1A 5K14B 3I0RA 5C42A 3V6KA 2XCAA 1JLCA 1D1UA 4HKQA 4RUCA 4ZVGA 1HNIB 1JLEB 1RT4A 3MEDB 3BSCA 4ZVFA 4NLTA 1LWEA 3DI6A 4RW6A 5JUMA 2VG5A 2FJWA 3DLGB 2W9AA 3NL0A 4K4WA 3H5UA 2R8JA 3VQSA 1N4LA 3DYAB 3KJVA 4KB7A 4DL7A 3M8PB 2IM0A 4KHRA 1DTTB 3H4DA 2WHOA 4ECYA 1Z4UA 2OPRA 3FFIA 1JLCB 3KHHA 1CSJA 5KFRA 2AU0A 3BR9A 3NBPB 1C1BA 2D3UA 4YMEA 4NLDA 3OHAA 3QO9B 3OL6A 1S1WB 3NKYA 4URGA 3OLAA 4DL6A 4TN2A 1RT2B 1RTIA 1VRUB 1C1CA 4TLRA 5DG9A 5J2PA 4DG1B 5DG7A 1MU2B 2ZD1B 4OL8A 1JLFB 1XR6A 2GIRA 1NHVA 4RZRA 3OHBA 3OL8A 1S9EA 4ECRA 2IMWP 3V6DA 2VA2A 4KKOA 2CJQA 1RT6A 1S6QB 5CYQB 2XCPA 2IM3A 3DOLA 2YNIA 1DLOB 3KK2A 3QIDA 4YQWA 3KLHB 3DM2A 3D5MA 1N48A 4I2PA 1QUVA 4TYAA 1S1UB 3NGDA 4O44A 2B5JA 4O3RA 5DQGA 3KLEB 1TVRA 1TP7A 2HAIA 2IM2A 5KFYA 4O4GA 3QGIA 5F8LA 2XC9A 1TL3B 3T5KA 1REVA 3V6DB 3GV8B 3E01B 5J1EA 1SV5B 4NLYA 1JLBB 5DG8A 2RKIB 1IKYA 4QWBA 3C6UB 5J2NA 1BQNB 2D7SA 3BSOA 1N5YA 1SUQA 1HQEB 4R5PA 4YR2A 1SH2A 4IRDA 3KMQA 1IKWA 3CVKA 3BSAA 3KLIA 3CDWA 3I5BA 3KLEA 5J2MB 2BRLA 1HQUA 2WCXA 5JXSA 2VG6B 2JLEA 4O44B 4KFBB 1NHUA 1LW0B 5KFNA 1JIHA 3KMSA 1KHWA 3MEEA 4GC6A 4ECTA 3V6HA 4NYZA 2RDIA 4IH5A 4RW7A 2R8KA 1HYSA 4YR3A 1YVFA 3KLVA 1VRTB 4WYLA 4HYKA 3IRXA 3M9NB 3HVTB 3KJVB 3IS9A 4WZQA 1HARA 5J2MA
chains in the Genus database with same CATH superfamily
3ZNJ1 2CZ9A 2BZ2A 2FC9A 2R7QA 2W9CA 4DG1A 1RTHB 2AHOB 1SUQB 2YY3A 3L9ZA 4UOGA 2HPUA 4ZPBA 4ZP6A 3Q22A 3W9JA 4J9KA 2FZCB 3POTB 4JP8A 5CD4A 1N32J 5KFPA 4GVBB 4AYBD 3TJ9A 2ZD1A 4NL5A 2L48A 2ZNZA 2JH3A 3EDQB 3MCSA 4IQMA 3J80U 3CWJA 4OHVA 2DNPA 2N82B 4RPFA 1PC4A 4EBCA 4EEYA 4C8OA 2XQCA 5LL6d 1ZOTA 3B78A 3L4BC 3TQ1A 2J6UA 1TKXB 4NXNJ 1A7GE 3ISNC 2H5EA 2EFVA 3BBBA 1NPRA 4I2PB 2AGOA 2KTQA 3BYRA 5KG4A 1KLMB 1FDBA 1GXTA 2JC0A 3PG9A 2ZH6A 1UEVA 3DLGA 2HIQA 4PYAA 3MEGA 1JLGB 5K20B 4LSNB 3TVKA 1F5AA 3AA8A 1OQ6A 1QUPA 4CT9A 5GAGI 4NXNF 1BLUA 1D0EA 5KFHA 2BACA 2C3UA 2BE2B 4NLPA 1QTMA 2C2DA 4DZDA 2JFDA 2IMOA 4YUDA 3CJSA 4DQIA 3BS9A 4QU6A 1WTFA 1FEEA 1Q8LA 3LGNA 3HZEA 4N47A 2CVIA 4IH7A 4MK8A 5J1PA 2HHVA 5HVHA 3LAMA 2D3OR 5KFEA 3D6TB 2HHTA 1HBUA 3C8YA 2P6SA 4IUFA 5T41A 2IY5B 1NAQA 1YLXA 4MK7A 3CCZA 2FUG9 3GJTB 3RUBL 4N77A 2Y1IA 1N6QA 2C2EA 1I94J 2EEYA 2F8EX 4B08A 4LF4F 4EO6A 1JXEA 2HBRB 2COLA 1YGYA 2IVMA 4NPOA 4NYPA 4EUVA 1KHVA 3NG8A 3PJWA 1UWAA 3RZAA 4DR3J 2KN4A 4OV1A 1X4CA 2XMWA 4UUWA 4ILMA 4RNNA 3LP0B 1ZTTA 3BO4A 2Y8WA 4RW4A 2AV5A 2LEBA 3KHRA 3J81j 2OEKA 1HHSA 4PKDB 2XM3A 4KHMA 2LKZA 2R2RA 3GMGA 3Q8YA 3UN3A 1RT1B 2Q43A 1VQSA 2V9KA 3B82A 3IWLA 1U8WA 4FKYA 3HMJG 2WOMA 3KLFB 3TWZA 2HMIB 3QFWA 4DPOA 2LFVA 3KK3B 2VFVA 3ILIA 1EETA 1PIEA 1TL7A 1UPMB 3MM6A 2RKIA 2CQHA 4J9UE 1K1QA 1YJUA 1YRUA 4CLFA 3Q8PB 4DUTA 4WJBA 4USIA 3TARA 1N36J 2VG7A 4PUOA 4F2RA 2GJ2A 2LA4A 9ATCB 1VR6A 4WFXA 3KHLA 2BM1A 4YDXA 1GTHA 4KC5A 2V8DA 3MFHA 4PWWA 2CNKB 4U95A 1HLWA 4RW7B 3GIKA 3Q8VA 8ATCB 1S0MA 1HD0A 1VRTA 1NH7A 4I2QB 3RYLA 1HQUB 1UFKA 4IFYB 2XYPB 3QT7A 3SMZA 5GAGU 4X4OA 1WWHA 5K8NA 4WWSA 5I42B 1RT3A 3J7AN 4M5IA 4RJVA 5IT9U 2UUTA 1NH8A 2XWYA 4OZNA 4LQ9A 3OFGA 1U2FA 1REVB 3GFYA 3LPEA 4ED8A 3M9OB 1L3VA 2BOPA 2DR9A 2AJ0A 2GS8A 4QR1A 3W7BA 1WG1A 3SSQA 3ZZZA 1WSVA 3E01A 1H98A 2CKWA 2OKQA 2CZVC 4OYXA 4WF9Q 3DLKB 2GVDA 3A12A 1T9XA 3I56S 1NRKA 1HBNB 4NMXA 4H54A 3G6YA 4Q8EA 5LOQA 4HL9A 1T9WA 3QLHB 4MAKA 3ZTOA 4CNYA 4GKKJ 1S79A 2BVZA 2MZ1A 5K8MA 2VG6A 2FVCA 3GV7B 1YRTA 4IH6A 1RSCA 1RABB 2HURA 4HHUA 5ETTA 4ZVHA 3MMAB 5EHHA 5A2QU 3HP6A 3KK2B 1YHQS 1P1TA 2UU9F 2GA7A 4ZKAA 4ZCLA 3TNVA 1YIJS 1HR0F 1ROFA 1NSKL 4DUYJ 4KJIA 2HQCA 2YNFB 2MLZA 2XZDB 3JYTA 1VHFA 4CLKA 2YH1A 4WK3A 2QT7A 3MXHP 1XR5A 4P52A 1Y0HA 4I68A 5ETQA 4DV6J 1NJWA 2BANB 2KRBA 1HI8A 3ETMA 4LUBA 4LVOP 4DV7F 2JEFA 2VFSA 2ZC4A 4FNHA 1WC4A 4OLPA 3BJYA 2GQCA 1S1UA 3CSKA 1YRXA 3QT5A 4DN9A 3ET6A 2ASYA 1Z2ZA 3H59A 2XWXA 3CJ0A 1NZ8A 2ROPA 4ER8A 3GG0A 1IBMJ 3GP9A 2ZH4A 3QBCA 4KBIA 4ECSA 4JBCA 4LJMA 2FC8A 2VU5A 1WTBA 1N5VA 2MJNA 1FJGF 2RH3A 2DXDA 2HVIA 2OTJS 3UVJA 3PHTA 2ROGA 1RT2A 3QGHA 1M1HA 1B70B 3BV8A 3LA0A 2AZ3A 5DQIA 2V2VA 1HHTP 1R0CB 1UWBB 2HIYA 2DR5A 3AODA 3TZXA 4C3KA 5F3ZA 2C2RA 4MH8A 4UQGA 4F3MA 1HWKA 1LWCB 2EBGA 5KT7A 2MQQA 1YJNS 1S10A 4ELTA 3IR5B 5GMKa 1T7PA 2YNHB 2VV5A 1XNQF 3SYZA 3QFHA 4M5DB 4DFKA 1DURA 3IP0A 4ZOSA 5IOLA 5HL7Q 2BKOA 4LFBJ 4ED2A 4HI2A 2CJXB 3QT8A 2K7JA 3BDEA 5D6GA 1RZMA 4M5NA 4J9NA 4EYHB 2O01C 1RTDB 3H0PA 3DI6B 3Q8QB 3T19A 2XMVA 4DR5J 3HI9A 4W90B 3P5TL 4DI6A 3H2UB 4DQRA 2DNHA 2DKOB 1PJ5A 4YDDB 2DH9A 3LH2S 1LWCA 2FZKB 4FYVB 2IM1A 4Y34A 2BQRA 4JI4F 1NEEA 2PMWA 5FDLB 2DNQA 2VF3A 4K0KF 2K1RA 4P71A 2ZOGA 5CD4H 4DCOB 2YKMB 4KO0B 2KJVA 4C7QA 2RDJA 1H73A 2XS5A 1SXLA 4A8KA 5KFCA 1AB8A 4Q44A 1D9FA 2EKYA 2IAJB 2NZCA 1NKBA 4NZ6A 3C15B 4R25A 2A2DA 5HMXA 2L41A 3BBCA 3PHEA 1VQ5S 3RB4A 1NK9A 2NUUG 1SC1B 3MWBA 3LAKA 1B0TA 2HHPA 1VGYA 4R0EA 4DSKA 2ZOFA 1YDLA 2HS3A 2BJ9A 3IR7B 4A8XA 3U7JA 1MWZA 5CYJA 3PACA 5GAEU 4OI6A 1FRLA 2DY1A 3AHPA 3UD3P 1X0PA 1CJKB 1X60A 1Y9OA 1L3TA 2LLZA 2JRSA 1RB0A 3IRXB 4CQ1A 4DR6F 3TUPA 2BJEA 2R2TA 3UDLA 5AJ3J 1RUSA 3PEHA 3S8SA 5DLFA 2N3LA 3B8HA 3JAMY 4EGLA 3P45B 1WC1A 4Y28C 1PSDA 1RHQB 1NMEB 3WZ0A 1H38A 2QMUB 3C3LA 2FGCA 3VHQA 2HGNA 1WHWA 1C0TA 2H1YA 1RTIB 2QSWA 1FRHA 4LRAA 4YB7A 5A0YA 4ED7A 2QC3A 1L3UA 2ZDOA 3BPDA 3M8SA 2IYGA 5D4LA 1YSJA 5DJBA 3AOBA 5M2PA 3FBEA 3MMCB 1XMQJ 2QJ3A 5F8HA 1NDCA 4YR0A 1FKOA 4BWMA 4RW4B 2J8SA 2UVVA 1F1BB 1GQEA 3LP2B 2DGVA 2ZHOA 3GFHA 4OV6A 1HBNA 4ZJOA 2KU7A 5LJ5Y 2HNDA 2PN6A 1N56A 1N54B 1U1MA 3M8RA 4Y2AA 1FA0A 1ZPWX 3KLHA 2NS1B 2DGUA 3MUVP 4ZPTR 1X31C 1B7YB 1HWUA 1N6QB 1O0PA 3M9MB 1OY8A 1Q4RA 4NWBA 1X8DA 2FB0A 1HA1A 2NPFA 3CCQS 5H9FJ 3W60A 1RGVA 2ZBRA 3MM8B 4EFAC 4DUZJ 4A8MP 2MLYA 2HQIA 4M5JA 4TNOA 2WTFA 1NSQA 1RHJB 1EZZB 3HLUA 2RB7A 4I2QA 2KG1A 3KFWX 5B09A 4OJ3A 3T3FA 2DBBA 1ELOA 2FLPA 1CJVB 3H2LA 5LT5A 4LSLB 3IN5A 2G2OA 2L3MA 3MCMA 1UL3A 2FPHX 2XI3A 5A2QY 3R7NB 3PW0A 2DGOA 3C16B 2FHJD 2RUGA 3OR1B 1UMJA 4JV5F 3FCWA 4CO2A 4IG3A 2XHCA 1HNIA 4MYTA 4YN3B 2KRRA 3K5NA 3R97A 4MYUA 1HW8A 3Q8RB 4H4KA 3I0RB 1X5SA 2B43A 2ZJQQ 1FDDA 3MPUB 2OGUA 2HYIB 2HFZA 4OX9F 4DF4A 5C42B 4MKVA 5IM0B 1RT7B 1TUWA 4YHHJ 4ILLA 3R3TA 4HTIA 1A0OB 3A8IA 1OJ4A 5CA5A 2KI2A 3HSDA 2LQ8A 4X62J 4ZJQA 4DPUA 1R0AA 3KYLA 4XK8C 5U47A 2RF2A 3QJLA 4RKUC 2E1RA 2G0JA 1SL0A 2DNMA 3G71S 3F41A 4IRKA 3T1HJ 4DHVA 1TK5A 3EYZA 2W9BB 3R5GA 1K73T 4F8RA 3NS7B 4LFAF 2WB1D 4DFJA 4JYAJ 2J9DA 4GKJJ 3PJ9A 4TYBA 5I3UB 3K0JA 2ZDPA 2M5YA 3LWLA 1HHQA 4MJKA 3HVRA 1I6JA 4ZHRB 3IG1B 5KT5A 1DQ9A 4L75A 3W61A 3DMJB 2XI2A 4B3OB 1M5PC 1IVZA 3DGPA 1R43A 1IKVB 3QZ8A 2XNRA 4O4GB 1HNXF 3IGNA 1F9HA 1X5OA 1RAOA 2XHWA 2NCKL 2NSBA 3QMQA 2CPHA 5DDRC 2XGQA 4YB6A 3CCUS 4DR5F 1XC9A 4WP3A 1E6VB 1EKSA 4B3TJ 1RWUA 3BGOP 2RU9A 5IC6B 2W2NP 1PGZA 4U8YA 1EP4A 1UVIA 1MMNA 3HT0A 4K5SA 3VZHA 3R6GB 3GYNA 1LW0A 3ILOA 3K8WA 2UV8G 3TYTA 3CD6S 2UP1A 1XR7A 3UO0A 4HHJA 4ELUA 2B9EA 3SIPB 2HG4A 3ZZYA 1A9NB 5IZHA 4ED6A 1V3SA 1PILA 2MKHA 2OH2A 3MM7B 4RU9A 4WZMA 1PC5A 1DTQB 1LK7A 3KHGA 3U27A 3TRGA 2QFJA 3C46A 3JSMB 3GJQB 4J9RA 2E66A 2XMJA 3CXCR 1W25A 2VODA 2FJDB 3IFEA 1J5OB 2XSJB 2YBVA 3P3DA 1U26A 3DRRB 1VQYA 1S99A 1Q79A 2VBWA 3FBFA 3TJ8A 4ED3A 4YOEA 1KS2A 4K2XA 3IBWA 4EI2A 4HR2A 4ZIWA 2HVZA 3M6VA 4LR8A 5EWGA 3OVSA 5F8JA 2OFHX 3P6YC 3J81U 2FVRA 1R8PA 3TUJC 3OVAA 3HPOA 1TUGB 5D4OA 4FZVA 3PZPA 4P73A 3M1VA 2AIRB 1G2EA 4FXWA 3ZFVA 3K7RA 4ZHRA 2C2OB 2HFOA 2V34A 3EMTA 3QJJA 3MOJB 2DNGA 1MLAA 2W7AA 3D4JA 2JDJA 2FVPA 3QNWB 2HLTA 4RNFA 2OPSA 3UCZP 2GHPA 4NLWA 2HWIA 2Y3YA 3FEYB 4O23A 3D0IE 3P8BB 2HFUA 1PKUA 1KFSA 1TL1A 1RWKB 3HKWA 4ZCMA 2E5LJ 3FEZA 5GVQA 5DM6Q 4E8UA 5HAOA 1B64A 1E6VA 4ZVQB 3LP1A 2MKJA 2ZJPQ 4ZPVR 3O3LA 1H2TZ 4DLEA 1IWAA 2FY8A 3C66A 4UOCA 2D9PA 2X51A 2OI2A 3DLEB 1IR0A 1JJ2R 4ECWA 1HI0P 2CJKA 4FXDA 5CYQA 4EO8A 3PW5A 3UDVA 3KTQA 1HD1A 4A8SA 2MEWA 3RB0A 2BKNA 4OYZA 2ASLA 2MZRA 3DOMB 4LF7J 3MEDA 4ED4A 3VCDA 2H65B 1H7WA 3W65A 2CPFA 4LSLA 2D3ZA 2PDAA 2DK2A 5KFZA 2K3IA 2ZE2A 1SH0A 2E5IA 2M88A 3DOKB 2EG1A 2NXEA 4CTAB 2KB2A 2PA8D 3HHKA 4DX8H 1CS4B 1LEOA 5HLFB 1B4SA 1C2PA 3U02A 3PX6A 1Y7PA 4NLGA 4RUAA 2HS0A 4DR7J 4CO5A 4I7FA 2AX1A 1TK8A 3I0RA 2VPYB 2YWFA 4QIWD 2PMZD 4NXMJ 2XCAA 1KSPA 3SSSA 1HNIB 4ZPWR 3DLJA 1JLEB 2UZAA 4LFCF 3UFCX 5AXMA 1PJ6A 1LWEA 4RW6A 1UCNA 2W9AA 4MT1A 3MMJA 5HVGA 4WTYA 4KGMA 1N4LA 5GAEI 1U8SA 3DXBA 4DL7A 3GSIA 4KHRA 3GPAA 4KPCA 4R0JA 5F41A 3CC2S 2AT1B 1JLCB 3CCTA 2EG2A 2HHUA 2MY7A 1BE4A 3GJRB 3NBPB 3BN7A 2D3UA 1IR1A 1U48A 1KD1T 2J9CA 3OHAA 2CQDA 2IRUA 1CBKA 1S1WB 3NKYA 2WW4A 3M4XA 1RTIA 1VRUB 4LBPA 5A0YB 1RU1A 3H90A 4OL8A 1PYSB 3M2VA 1JLFB 1ZM2A 2GIRA 4ZVSB 1NHVA 3SDEB 3TEGA 2NREA 1WI8A 4ECRA 2IMWP 3V6DA 1ULRA 2HQFA 3CDAA 4HVZA 5K8OA 1RT6A 1RP5A 3C16A 4P2FA 4I6AA 2IM3A 4X4SA 3D5MA 3DM2A 1B99A 1V5VA 3VWSA 2F40A 4YB5A 4U7UK 4D3HA 3NGDA 3R5JB 4K5RA 5H9EJ 3NEKA 5KFYA 2HAIA 1IR2A 2IM2A 1HR0J 3AA9A 2XMMA 1LWXA 4G1IA 2Z8QA 4P9SA 3GV8B 4DV0J 3MHYA 5F0UA 5J1EA 4NLYA 2QL7B 1W26A 5ETVA 3MTJA 2FY1A 1IKYA 3HO1A 4DL0C 2ZHAA 3F0NA 3VALA 4R5PA 4HACB 4YR2A 3D2WA 1SH2A 1WEYA 4IRDA 3KMQA 5L39A 4DCJB 1BXNA 2IBKA 1V6HA 1DBDA 4ENOA 2F5GA 4O44B 3JQMA 4DX5A 2HSEB 1LW0B 1YX2A 4CP5A 4GC6A 3V6HA 1D3WA 2EXUA 2LXIA 2RIJA 2XULA 3P96A 4HI1A 4IH5A 2A6MA 5E3QA 3UE2A 1RWOB 2EW9A 3JS9A 5LXRA 4FYDA 5G0RA 1SPBP 1YVFA 4HYKA 4WZQA 1QM9A 3D1HA 1Q86T 1AT1B 3KJVB 3IS9A 3KK1A 1F0XA 2CPJA 1HARA 5J2MA 4ZK7M 4JI2J 2KFNA 1U0HB 2KHDA 2Z2YB 3CEDA 1BWEA 2FQQB 3MM5A 1VC6A 1RTJA 3MEKA 4N7TA 3I5CA 3MR3A 4PXBA 3IG1A 5LM7E 4HH0A 1MU2A 2IJRA 1PCAA 4IG0B 3MFIA 2BA9A 2QA4S 2VHGA 3BDPA 3SV4A 1N32F 3KXDA 4PWDA 2CJYB 4EK2A 4YEAA 5HBMA 2MKKA 2ATCB 4K4SA 2JL9A 5ETKA 1NDLA 5BYSA 5D3GB 2YQ0A 1YJVA 4QZVB 3R9LA 4F02A 3HHLB 3DYAA 3M32A 1XTZA 2NXJA 4ED0A 1NPKA 2GVZA 4MKBA 2D9OA 1GFWB 1SQFA 1GMVA 2B7BB 4ZITA 4OYPA 1VQ7S 3OL9A 4CH7A 5L9NA 1TELA 2ZM6F 2DR7A 1W2IA 2R8GA 2ASJA 3LW5C 1U49A 4KE5A 3GQCA 5EN1A 1UFWA 5HP1A 4N76A 4UQTA 3SQOP 2HHHJ 2UUWA 4JI3J 5IQ6A 2WONB 1QTNB 1UWBA 2NYHA 2XLKA 2ZITA 2L9NA 3KWMA 4FDFA 4ZN3A 2FIUA 3NGSA 2W7PA 4DL3A 3M8QB 1GXLA 3ISND 5ETLA 5IM0A 2ALZA 3CDBA 2RQMA 5HP1B 3H20A 1VC5A 2ZJRQ 2LXFA 4F67A 2VB6A 3I32A 5D0RA 4AXIA 1WF0A 6FDRA 4NRUA 3TANA 1I1GA 4F7VA 5L38A 4ECVA 2K7KA 1S1XA 5KT3A 3VAIA 1EIYB 1B7FA 2D41A 4KGXB 5EUHA 3IM8A 3OTCA 3KK1B 4X2BA 5HATA 3CT9A 4RW9B 5J2QA 4DS4A 2DO0A 1FERA 4EU0A 3J7YU 3QLHA 4OZ1A 3DLLQ 5AXKA 3MF5A 1CJVA 2PEHA 4EZ6A 1NDKA 3GTYX 5B0EA 2W1BA 2VA3A 5DGAA 4B9VA 1NPPA 1NJYA 2LQ9A 4LT6A 4NLVA 2DRAA 3IAS9 2BJ8A 1OYDA 4NCGA 2YNFA 4J9LA 3EXCX 1NK0A 5HQ8A 3W5ZA 2WSFC 4LIRA 2QA2A 3GLJA 1CJTB 2CQCA 3CCWA 3SCLE 5EDWA 1Q8BA 1S4FA 4K2JA 4IDKB 4U8VA 1VBYA 1VBZA 3HHNB 1YKWA 2KT2A 5CYMB 2YX1A 1U1OA 4RBTA 2D69A 1UKUA 2FHKA 4QPTA 4DX7A 3EM1A 2AYMA 5DS7A 5D8HB 2WVFA 3MCNA 4F3OA 4EZ9A 4OYIA 1NJZA 2CZ4A 1QSLA 2X1FA 2V67A 3TZYA 3DLKA 3BO2A 2YWWA 4IOCQ 1NK6A 1CPZA 1RAAB 2CRLA 7AT1B 1I5OB 4LREA 4DWIA 2Z0GA 5B0DA 3NMRA 3TA1A 2BYCA 2BUNA 5LMNF 1TKZB 2AZ1A 2GGPB 3DDNA 1O8BA 1RHMB 3GILA 4OHYA 3ICLA 4ZPDA 2U1AA 2C3OA 3DDKA 1TMJA 3CMES 1BQMB 1K44A 4J90A 4WKRA 4DSLA 4JI6J 2HGLA 3KNAA 1OPZA 5IV4A 1N52B 2V8HA 1PO6A 1SV5A 2XBPA 3OFEA 1RT5B 3RRGA 1AUSL 1T03A 4ANDA 4NOHA 5KG7A 2JFKA 3UQSA 2BJ7A 2HRUA 2W2QP 4OJHA 4DV4J 4EBDA 1S9GA 5K8PA 4WFBQ 2OEJA 1F9EB 1WI6A 1T8EA 2HS4A 3TAMA 1OY9A 1ZA2B 3GYXB 4UZCA 4J7CA 3FQLA 3GSDA 5BJRA 5C25A 4ZMMA 1XIQA 1EETB 1TL7B 3MR6A 5K5MA 3CJ3A 5DQHA 3T5HA 3W9HA 3RB6A 4PEOA 1M5HA 3EGNA 2PFFB 4UT4A 2Q6CA 3HD1A 3I0SA 1UZDA 2MDAA 2W2OP 3NOCA 2HHQA 2RT3A 3KJNB 4OYOA 1UA0A 2IAJA 1S1VB 4H4MB 4KIAA 1Q8KA 3LO3A 4OYAA 3JAMU 3IM9A 1CC8A 2DITA 3OQ2A 2GCFA 1F3FA 3ZXWA 2YKMA 3M8YA 1QAIA 5T14A 1KVKA 2YKNB 1PYOB 1KOHA 3I6PA 2B5JB 4DV1J 1Q16B 2FJEB 3OL7A 3EGVA 4KGVB 5G4DA 4LFCJ 4NXMF 2UUBJ 3KJFB 2R2UA 4RNMA 2CJAA 4B9TA 1VS3A 1RYSA 2LVWA 1RU2A 4F0MA 3R1HA 3Q2TC 3FBBA 2PA3A 2E5HA 4C3MA 2R7TA 4WE1B 4FF1A 2PT0A 3CCJS 1KLMA 1UFLA 2EPIA 3JSRA 2J9DE 3DXSX 1TKXA 3EJMA 3NS6A 4FYXB 2WOMB 1KTQA 2OSRA 4Y2KA 3C19A 1FF2A 2VKRA 3T9NA 2K2PA 3BGFA 4LF6F 4IR9A 2HNYB 2UXCF 2J5AA 3HJVA 5ETSA 4M63A 4CLPA 4RUHA 4MMOA 2RSQA 4OYWA 5GADU 2UUAF 3QRQA 3POTA 3PYFA 4O3SA 4MK9A 4AE5A 1YBTA 2KT5A 3IGVA 1VJWA 2G1DA 3HT3A 2W9CB 2FLNA 1ZETA 1WF1A 4B3SJ 5A6PA 4PCQA 5DDOC 2E9ZA 5HQMA 3I9ZA 3DRPB 1VI7A 1VDHA 3PFOA 4USMA 7FDRA 1JX4A 1HWLA 4GMKA 2B8PA 2LDIA 4DCPB 4EYIB 2I8EA 4ED1A 1WEXA 3M6XA 3B4DA 4J9SA 3PX4A 5HROA 3M30A 3UWTA 4X65F 1HMVB 2KM8B 5HSPA 5D3GA 2QLXA 1VISA 4S0MA 2VOPA 1SCJB 2RQ4A 2ZWPA 5FLXU 3MECB 3LGMA 2MQOA 4ZP8A 4OJ1A 3TZWA 2BV3A 1RQ0A 3DGVA 3KLGB 3UD4P 4U96A 3BREA 1FTRA 1RAFB 4Q0BA 3HFZB 3PM9A 1Q82T 1VQ8S 4M94A 2CG4A 3L7OA 1X9MA 4F4KA 3MTKA 1DZ5A 1OIAA 3GE9A 5L9XA 4Y6IA 1FX2A 1RBLA 1Q5VA 1U0HA 3G86A 4TU8A 3Q0AA 4DLGA 2HZAA 2OUGA 1TAQA 4WFYA 4BC7A 1JXLA 1GH8A 4LRCA 4QW9A 3CCMS 2P5VA 3BN4A 1HPZB 2BXJA 3TI0A 2HFNA 1DTQA 5BR8F 1FXRA 2YX7A 2J7UA 1Y10A 2F3JA 3DMJA 1C4CA 3OPKA 4LF9F 2DNKA 4NLRA 1KQSR 2OLWA 1CULA 1D9DA 3SSRA 3GWCA 1OQ3A 2LCWA 2B56A 1FNMA 3N5FA 4RBUA 4ECUA 4NEZA 5AXLA 2A6OA 2B9XA 3BPSP 1CEZA 1IKYB 2E1AA 2FLLA 1VFJA 4NZ7A 2IBOA 4JI0J 1V5IB 3G6XA 1HQ2A 5D4PA 1JB0C 3TUIC 1S7IA 4OZLA 5A8RB 3NNCA 1K0VA 1KFDA 2X3GA 3VGVA 2JLGA 3N79A 1FRMA 1SL2A 2Z56B 3QT6A 3N4WA 2I5JB 4KGZB 2AP6A 2AWZA 4E98A 5A8KB 2F4VJ 4Z37A 1K47A 5HI7A 4KFBA 1FWLA 1JXVA 2V68A 3CD7A 3QAEA 3MUTP 1R89A 2P9GA 2RF2B 3G4SS 1VQMS 1J5EF 5DRKA 3I82A 4OYMA 4C4WA 1RWVB 3R27A 1J2VA 3LALA 3SV3A 2N4CA 1FFGB 4B3TF 2F9DA 2Z30B 4M5HA 3OTOF 1HBOB 5THWA 1SIZA 1U09A 3EICA 4I0WA 4WXWA 3MR5A 3EPGA 3GCXP 2IRYA 3GR0A 3EVOA 1LW2A 2F9JA 2V4QA 2AJFE 3OTOJ 5H9EK 1F9FA 4BHQA 3CJ4A 3CCRS 4X4RA 1WC5A 4NLSA 2DGXA 2Q3PA 4GVLA 2XS2A 3FRYA 1GX5A 1NM2A 3NGRA 1O51A 1DTTA 3TUZC 4C11A 4ZIVA 1U1NA 1S6PA 5ETMA 4A4JA 1QLNA 3D68A 2BE7D 4V1Ak 4M1KA 4NYOA 4F0KA 2RHQB 1RAHB 5DDPC 2F8HA 2CWKA 1S6QA 1FK9A 4WYWA 2F4VF 3NCPA 3R7SB 2BR0A 1NBEB 4ICLA 2DTJA 2Z2LA 1M0SA 2XYHB 2LEAA 2YWGA 4UOFA 5KFGA 3BO3A 4DR1F 4D3GA 5FIIA 2ZH7A 4KGKA 4NI2A 4OJGA 5B08A 1LV5A 3MCOA 2AKWB 4LMZA 5F8NA 5A8WA 2B4VA 2HNZB 3W8PA 4H4OA 3H7HB 3V6JA 4CZCA 2BKPA 1X7VA 2OPRB 2EC2A 3IXQA 4Q2LA 2VPZB 4MIWA 5JVGQ 2XZWA 2IC3A 4FBUA 1XNQJ 2PO4A 3DRSB 2W4DA 3TQEA 3DU5A 1LWFA 1TKTB 2KXHA 2PI5A 2RVJA 4OX7A 3FCHA 4J37A 1OMSA 4M5LA 2V6AA 1UJ4A 3Q89A 2WVCA 4Y0FA 3CNQP 2HNDB 1BD6A 1MMDA 2J9EA 2YWKA 3QYYA 5GAHU 3IRWP 1OPIA 4P2MA 3RBEA 4A8WA 4L73A 4XO0A 2AMCB 1WACA 3VAFA 3M2UA 1QAJA 3RR7A 1H7XA 1KP6A 2PGCA 3LANA 2A2CA 4HH1A 4KV8A 2B4UA 2ACYA 3CIZA 1C0TB 3OTBA 2JEIA 5B0CA 2KYXA 2OPSB 3NRBA 5E33A 3LWMA 5HANA 3PJXA 1RA6A 2CNLB 1S1TB 2M8DB 3TAMB 2MPUA 1F60B 1QJHA 1LOUA 1FK9B 1FWKA 3AD9C 2J8AA 2NXCA 1RAGB 5E7OB 1KWMA 4WFZA 1F2GA 3G82A 3OJUA 1FT8A 2WBMA 5F0WA 1AA1B 1WHXA 1G4CA 1IBLF 1FDAA 3D6FB 3ZZ0A 4DF8A 4URQU 1VQ4S 3I5AA 3VVTA 2GV1A 3RGIA 1RKJA 1CJKA 4ZJLA 2I5JA 3EGZA 2M70A 5H1SV 3CJQA 3DRRA 1RAIB 2RAQA 2UUAJ 1BQNA 2BOAA 2FZGB 2VFTA 4NLOA 1EARA 3BYPA 4FF3A 2DNOA 2NPIA 3NGUA 1SC6A 2CJBA 2NYIA 4C48A 3CJTA 5KFUA 2GGPA 3KUGA 3NNHA 2XSFA 1I51B 3FNNA 3OSNA 3K5LA 2DNNA 1FKPB 1PAEX 2KVIA 4HHHA 1UW9A 3TP2A 4YS2A 3R2DJ 4EWTA 1FJCA 2DD8S 3TJAA 2YXLA 3HVTA 5KFSA 1MMLA 3ZZRA 1B3TA 4JI0F 1R0BG 3FSXA 5HMZA 3OW2R 3PW2A 3RR8A 1R6YA 1DFDA 1WC6A 3GG1A 4DQPA 2BJ1A 4PG6A 2UVUA 2Y1LB 3CJKA 3UR0A 3D6HB 2J6TA 1Q7LB 2RUSA 2AQ4A 5CYMA 4OI3A 1T3OA 3WC0A 5KFWA 3MAAB 2BJ3A 2ASDA 2QO3A 4DN0A 4IOAQ 3C15A 1UVJA 1FDNA 1QDUB 1UTAA 4B9NA 1NUEA 1K9MT 5J2NB 4B3RJ 4ETZA 3PNIA 2LECA 1HWJA 4RWXA 2DGSA 1U4BA 3J7A1 3KLGA 1Q8IA 3K5OA 4PZVA 1FE0A 3BKUA 4C8LA 1TQLA 2OMLA 3NP5A 3UPFA 5C5JA 2BW7A 3FDSA 1CJUB 1VLOA 3ELHA 3D3BJ 3AD7C 3EWGA 3GFXA 4K7QA 4AL7A 4MIAA 1H3DA 2GHVC 1U6ZA 2FLOA 5HROB 3M30B 4QYRA 2R2SA 3PW4A 1G6BA 2JC1A 2UXBF 3FSYA 4QYZJ 3SEOA 4PYDA 4LIWA 4LQ3A 2QMXA 4KHPF 1RT4B 5KFFA 2QTWA 2U2FA 1JLAB 2EFQA 1VQ9S 4IYQA 2DHHA 1VQLS 3HZGA 4ZCIA 1P8GA 5KOXA 2F8MA 4NCBA 4DPXA 2H4YB 4K59A 1ZBTA 1X5PA 1SKUB 2E5GA 2WVBA 3BBFA 3I4HX 4DR3F 1FKAF 2FGOA 1NKCA 2Q66A 1IBMF 2V4JB 2AEFA 3TAQA 2YH0A 1UETA 5C42A 2XG8A 1TTHB 3U1NA 3IAM9 4ZVGA 4F04B 1RT4A 2DISA 4ZVFA 4BCAA 3CPWR 4LF2A 3AY0A 3W1YC 2VJVA 3NL0A 3BKTA 2CPYA 4F0HA 5A76A 2GVZB 3FBCA 3OVBA 3DYAB 3M32B 4KB7A 4QBUA 1XMBA 2H54B 4XDDA 2JHEA 2VL1A 1KRPA 5LXYA 3H4DA 2V2ZA 2WHOA 2JJ4D 2R7VA 2HQDA 3KHHA 2W4PA 3D0HE 3BR9A 2GVDB 5HQLA 4NLDA 1P27B 1PAUB 2FJBB 4KRWA 3OLAA 1RWMB 4TN2A 5DETA 3MM5B 5J2PA 5DG7A 3AT1B 3LPYA 4X66J 3MMAA 3QPIA 4RZRA 3OHBA 2DIVA 3N01A 3DNCA 1Y3KA 4I6WA 4KKOA 1S7HA 2V69A 2C3YA 3OT9A 1Q7YT 4KHPJ 4USVA 4PG7A 2YNIA 3QIDA 4LVNP 2JNJA 4ZN1A 3KLHB 1YJRA 2XO6A 2RQCA 1SC3B 2HVHA 1OSCA 2FTRA 3W2VB 1YBUA 3ZZPA 2L08A 2CPIA 4O44A 2B5JA 4Q5VA 4BS2A 2VOOA 4LFBF 3Q83A 4WU3A 2Y0SD 3QGIA 3RG6A 1SJQA 5DM7Q 1YBAA 1NK7A 3NXZA 1TL3B 2GMJA 1T0TV 1REVA 3K17A 3T5KA 1AFJA 1MSWD 4FKXA 1SV5B 1KDNA 1JLBB 2CXEA 2RKIB 3HFVA 2UXCJ 3C6UB 1MW7A 1BQNB 3BSOA 1N5YA 1X4BA 2Q6BA 3V5RA 3ZZOA 3TVZA 3IWXA 2FHMA 2HAFA 2GHWA 3CO0P 4XIUA 3IO1A 1HQUA 4RUBA 1Q5YA 1QD1A 1M5VC 1JIHA 2ZH3A 1KHWA 2WZ1A 3HSJA 2IIHA 4OLOA 2RDDA 2RDIA 2R8KA 4RW7A 3A13A 1HYSA 4YR3A 3MR7A 4DV5F 3IRXA 1U1PA 2M4MA 4PAAA 5JMNA 1XNRJ 1H74A 4OZ5A 1S1TA 5DDQC 2JWNA 4WCEQ 1WG4A 4WIIA 4ES3A 3H98A 1DAXA 4J9QA 3TAPA 4JV1A 1S5ZA 5A6WA 2R9LA 2BDPA 1KNZA 2DGTA 2X1BA 3P5BP 3PDNA 4NA3A 4LF8F 2QIFA 1R8HA 2E9TA 1RT1A 4RO0A 2CDQA 1U0SA 4WXOA 3THPA 4CT8A 3CUNA 1SJ3P 2CQ0A 4PXCA 4DXLA 3ADAC 4TXSA 4LF8J 1GEHA 3G8SA 4NCGB 2CQ1A 2KVQE 3O8WA 4B9MA 4QWCA 2WVEA 2Z2ZA 1G3OA 5KFTA 2K1RB 4UZBA 3VV2B 4E0DA 2DO4A 2O5DA 5FDLA 4XDCA 4YFUA 2WB4A 4ECZA 3TO8A 3FSIA 1XK8A 3OBIA 2YNIB 2E7XA 1X4GA 2AYGA 4KAIA 2OJ3A 4PABA 4RW6B 4F4YA 4CLSA 4X4QA 5M2RA 4DSIA 2JEGA 5DLGA 2ZKTA 5LMUJ 2XB2D 4M5DA 4FF4A 1VRQC 5CABA 1KOOA 5A8WB 3HJFA 1GT8A 5EGYA 3HSZA 4ECXA 3VQTA 2ILYA 3BZQA 3LOUA 4K4TA 1YITS 3D28A 2FYXA 3RAMA 4N56A 1RHRB 5DGBA 2QV6A 2MZQA 3EUNA 5KFQA 3CULA 4DPYA 3FCVA 1EHWA 1FFWB 4OZ2A 1NKEA 3UCUP 1NDPA 1RKIA 3RRKA 2DXFA 5IT4A 1JLGA 4F4XA 2B4PA 3NNAA 3MEGB 3PIPQ 3BQ0A 1K8AT 1V3ZA 2W25A 1KTVA 2CYYA 4YY3J 2HEKA 3C6TA 3IBCB 5KG2A 1NK8A 2XY5A 9RUBA 4JI8J 5ETPA 2EKNA 4HDGA 5CCLA 1OYEA 3RJMB 2MQ8A 4X84A 5H9FK 3HFKA 3NOGA 2M3DA 1NB7A 2DPJA 3KJQB 2J7KA 3N9UC 3M8QA 3AAWB 3WIVA 4ZDNA 3KG0A 4LF5J 1PG5B 4ZLPA 4OHWA 3Q2SC 4UW2A 2IVFB 3OTDA 3W63A 2VPWB 1CJUA 1U6FA 2K06A 5KG5A 3R6LB 4DS5A 3PVXA 2BANA 1M1GA 2CADA 4C8ZA 4IG0A 4N5SA 3FGVA 4DV0F 2YKPA 1F3VA 2OAUA 1JJ4A 3SQGB 3M1VB 2GAHC 4LR9A 3V4IA 1GNKA 4WIQA 1KEKA 4Y2CA 3B4MA 2HGMA 5FD1A 4ANEA 3ZTQA 2ZM6J 3M8ZA 2WW8A 2H51B 3MAAA 4OI1A 2YKQA 3G2XA 2KFZA 1RWPB 2G2ZA 3SCKE 1IBKJ 2PC6A 1QE1A 1RCXB 1LXNA 3T5LA 2ZZNA 1BGXT 3W5XA 4PWUA 1DLOA 5L46A 3NY0A 1I94F 4QIEA 2I2YA 2EFPA 2HQGA 2Y1JA 5CXTA 4J9OA 3THVA 2B8QA 1CULB 2GJFA 3PO5A 1JWWA 2R7SA 3MPWA 1IKXB 2B6AB 4U7UD 1FKPA 2CNOB 3FKBA 1NSAA 1RTJB 4JB8B 3CGIA 4ZS6A 3WX4A 4L76A 2IFXA 1RWWB 1TVRB 3TR5A 2KJWA 2OD4A 5J1EB 5HVFA 3VF0B 2ZH2A 1X0FA 4FBTA 3JXOA 4HEA9 1GTEA 2DXEA 4I1TA 5CZXA 5JVHQ 1RHKB 1FCAA 4WKYA 3SFUA 3FFIB 4NLXA 3W2WA 3DC2A 1WD6A 2HKEA 3MPYA 1VBXA 2WK4A 3N0VA 3OR2A 4LRDA 2XLJA 2V4RA 4QCLA 4B3OA 4RNHA 2YX4A 4F2SA 1L3SA 2MZJA 2ZKUA 1RT6B 1U2RA 4JI7J 3B6BA 4OIXA 2E5LF 5KAKA 2VC1A 4B3MF 1RK8A 3A8KA 3PX0A 4DR7F 3X3UA 2H4WB 5KTQA 3D0GE 4DR2F 1RISA 3M6UA 2H3EB 3ONQA 1HMVA 4Q7AA 3KLFA 5DZ7A 1N0UA 2YKOA 1WJ9A 3H25A 4IFVB 3MMBA 2HZVA 5IWAF 2QE5A 4F3QA 1YQHA 2HWHA 1U7LA 3IMQJ 3DFEA 2DJWA 2H5JB 3M2UB 5ITHA 4UY85 1VQKS 3HXMA 2GQQA 2QL5B 5D0GA 1MG7A 5KFDA 4ZLLA 2R8IA 4ZVEA 1VQ6S 1JKHB 3US5A 1IQTA 1Y00A 3SFGA 2RRNA 3QGPA 1C0UB 2QMWA 3HHLD 3AOCA 1UVLA 4ZPCA 1X4AA 4TQRA 2ZUAA 2NZ4A 4GKJF 1JLFA 4OMFG 4A48A 2I9SA 2VKZG 1YZ6A 2HK3A 1URRA 2MKSA 5HN0A 3QZ7A 3GIJA 1VRUA 1IJEB 1RA7A 2ZHBA 1U02A 4G1QA 3OXLA 4CO1A 2AW0A 2QEXS 4AD6A 4IFVA 2D74B 2G0IA 3GCWP 2DY9A 3KDNA 2YQ1A 3VTIA 2KYZA 4O4RA 2V0NA 4AXJA 4DZ6A 3TEHB 2OELA 3DU6A 3HULA 4QR0A 5KFJA 1XERA 2HK2A 2AYBA 1IWGA 5LJ3Y 2KG0A 4X64J 2BE2A 3A1YG 4IOBA 2HQ3A 4NZ0A 1IXKA 3DDIA 2MQPA 3NMAA 4ICLB 2ACMA 2LEPA 2CQ3A 5CQGA 1SJRA 2MSTA 2SXLA 4X4NA 1Q95G 5KFBA 1NJIT 3IC1A 3OR2B 2FD2A 1FO1A 3G8TA 3DLEA 4ES1A 2R7XA 4EMDA 1FNOA 4G65A 4RBVA 3LP1B 2LXUA 1S1VA 2HNZA 4H4MA 4DR1J 4MFBA 4F50A 1R7IA 3FRZA 2JSXA 3VAKA 1B0PA 3KLIB 3M8WA 4IO1A 3RW6A 3EPIA 3ZZUA 5C7PA 2ZE2B 4M95A 4CTAA 2UXDF 2RNEA 3AJ2A 1U2CA 2EBEA 2APOA 1SBRA 1WKLA 4LBHA 3Q86A 4PG4A 5E3CA 3DHXA 2HVDA 2JLFA 1HBMB 4P7VA 1S97A 4P6QA 1RTHA 1OO0B 4P10A 1HPZA 2XO7A 4FS2A 2F7VA 1FJEB 2W2MP 1S0VA 4GO7X 1S9GB 1MWYA 3HVAA 1S6PB 3JTPA 4C11B 4RW8B 3MMCA 4RLEA 2BW2A 2C3PA 4DEZA 2W8KA 2E7WA 2G1HA 2J7WA 4Y2IA 2C22A 4WPAA 3T6JA 5IFMA 2E1CA 4DSEA 2DPIA 2CPXA 3PEJA 3V4IB 3GYGA 1AZSB 1Y3JA 2ATLA 3CB4A 2C2ZB 5F8IA 2RILA 3AJDA 3HSGA 4OZJA 4QU7A 3JSMA 1XEZA 1IKWB 1XBWA 1PBUA 1V3RA 5GMEA 2OO4A 2ZBCA 2VONA 2VICA 3G8QA 5KG3A 1N33J 1NB2A 1R6VA 3QO9A 2R3VA 4B02A 1RHUB 1KONA 3DLBA 1M5SA 1YJ9S 1S4EA 3AOAA 4PXDA 5E0OA 1IN0A 1L3KA 3S01A 1EP4B 2Z2MA 4MKAA 1C4AA 2G13A 1VJQA 4TLQA 1DJ0A 3MEEB 3RBXA 4XPCA 2QG9B 3DRPA 2RD5C 2E44A 3ENVA 4IDKA 1M90T 2HBZB 2V8PA 1CJTA 5KFMA 1BHNA 3AQPA 2V9WA 2YPYA 1M5KC 4PPZA 1JJHA 1FI4A 1FD2A 2HLUA 2BRKA 4Q0BB 1LKZA 3G87A 4Y2MA 2VQEJ 4JI1J 1WORA 3BM7A 4ID8A 2VQFF 3FC9A 4X4TA 3CF5Q 2EFOA 4DSJA 1C1BB 2GJIA 4OI2A 2OP5A 1HNXJ 1S77D 3MECA 4W98A 2BMBA 3PYDA 2PSZA 1QE1B 1FRKA 2V5HG 1SQGA 4RW9A 3DN9A 2XNQA 3LF0A 3TOQA 3ITHA 1CG2A 1YG0A 4YP3A 1MROB 1IKVA 1UVMA 3BEGB 4CLYA 3OUYA 3DGPB 4F4WA 2CFXA 4EBEA 1SB6A 3R1LA 2YNHA 4YB1P 1S9EB 1AW0A 1LFPA 1OS5A 2F1FA 1O6XA 2AYEA 5D0EA 4PQUA 1CQNA 1S49A 1R0AB 4LFAJ 4OQJA 2Y9HA 2HHXA 2VBZA 2ALYB 3HHLC 2R42A 2DEIA 2I0XA 5D78A 3CE8A 5T7LA 1UJ5A 4J9PA 1IM4A 4ZVTB 4ED5A 3FJ2A 2CQBA 4P72A 2HNYA 3N28A 4ITSA 3OV7A 1VC0A 3UDEA 3RBDA 3BB5A 1T05A 2CQ4A 4PPDA 4C0OC 3C6TB 2MGZB 1CC7A 1JK9B 1N5SA 2ZOMA 5DO2A 4OHZA 4C0HA 1SH3A 4B3MJ 2UXDJ 3BGRB 2QYCA 4PXEA 3OSPA 4B9SA 3A8JA 1XMQF 2IYIA 1SL1A 1Q78A 4CM0A 3UR3C 2LU2A 4C6AA 3K58A 1TK0A 3ZZTA 2OSQA 4UTGA 1VBKA 3NAHA 4I56A 2YTCA 2OPQA 2YKNA 2YKAA 1RT5A 2RRAA 1VQOS 4QWAA 1YJWS 1P9QC 3KUEA 4YHHF 2B9WA 4DFMA 4B17A 3MM8A 3VGSA 1TU0B 4IQXA 4ZP9A 4JV0A 3ULHA 1ICEB 4OX8A 1D8YA 4C8YA 3HHDA 1IJFB 3BSNA 4Y00A 4WP8A 2V94A 4XTTA 4MKYA 1URNA 3CC4S 4WE1A 4O0IA 2HW3A 3MM9B 1UAWA 4JUZA 4AQYJ 2BX6A 1Q0NA 5C25B 2C42A 1KQGB 2J76E 2MTLA 1FRXA 2RS8A 4NMLA 4USUA 3AQOA 5IC4B 3UW1A 2JEJA 1E6YB 2F4FA 3EX7B 2VQFJ 5KG6A 2FHOB 4X4UA 1RAEB 3J81Y 4DL5A 2M52A 2AD9A 3K57A 3PRBA 3MOZA 2CNNB 2I38A 4NE9C 4CRJA 3NS5A 3PRVA 5F9LA 1N5TA 1B0VA 1FKOB 1T9YA 1P9YA 2KH9A 2QA4G 2BM0A 2KHCA 4HACA 3WDOA 1RBOB 2VZ9A 3PR5B 3MM9A 2WBRA 3ISZA 3H5YA 2IDEA 3D3CJ 4TVAB 4USWA 5BYQA 3TA0A 1HFEL 1TL4A 2WVDA 3BKFA 4QPXA 4TU9A 4USJC 2VIHA 4FP9A 5I42A 1BY9A 3MAHA 1U1RA 1QVGR 1DHMA 3NLCA 2CWXA 1HNVA 6FD1A 2BQUA 2V2QA 3BH7B 2AEMA 1X4FA 2R7WA 1WDDA 4QIVA 1UEKA 5KFVA 3OFFA 3T1YF 2AGQA 3TVYA 3AJ1A 2NSCA 2POKA 1Q81T 1PBAA 1IQZA 1VIXA 2X1GA 4BC9A 1L5UA 2UVWA 3BF4A 3DM2B 2HHSA 1GX6A 3VGUA 1CQMA 1GAOA 5MAOA 5KT4A 2DIUA 4DSFA 4B3SF 4I67A 4DQQA 2UVRA 1VK3A 4XAKA 3C14A 1LFWA 2J6SA 1HNVB 3TZZA 1A6LA 4JI4J 2X7IA 3I96A 3K5MA 1N5YB 1TKDA 4AFFA 4NX9A 3C6UA 2ZVSA 1S1WA 2XMTA 1WKJA 4NCAA 1TL5A 4TKTA 2LMIA 4DR2J 2VDHA 4DJBA 4J9MA 2MHNA 1TKZA 3VVUA 2VQEF 2G4BA 3DCAA 4JI5F 2BJDA 2LA6A 2QLFB 4ZCKA 1FXDA 4X62F 3HHEA 3R5DA 5BR8J 1R27B 4ALZA 1KBRA 1E6YA 3TA2A 1KLNA 3VR1A 4USTA 3GV5B 2ZBQA 2DGWA 2Z4PA 4KKOB 1LWEB 4FYWB 4LF6J 1MROA 1NSPA 2QN6B 1JLEA 3M7VA 3UN5A 1VIOA 4L74A 5D77A 4X65J 2ZH1A 4DV4F 5M2UA 1OWXA 1SVDA 5EX0A 5J1NA 5KFXA 5IS2A 2ADCA 1RWXB 4CO4A 4CIOA 3UCGA 4N8NA 4KO0A 1NXIA 5HBMB 1NHKL 3KG4A 4PWDB 1WOPA 4A46A 4KPYA 4BDPA 2FDNA 5K14B 1XWLA 1YJTA 4LF9J 2Z58B 2C2MB 2YWEA 1X9WA 3HDSA 3MEDB 3BSCA 2R7UA 2A1BA 3GFZA 1HNWF 2MQNA 3ILJA 1RLDA 3DI6A 3A3OB 3TX0A 2E29A 5JUMA 3GB0A 3DLGB 2X1AA 4CLTA 3V2UC 1ZAVA 1X9SA 4K4WA 4FF2A 4U9RA 4TU7A 1SJFA 2R8JA 2ZFHA 3RBZA 3KJVA 3M8PB 2IM0A 3AH6A 3MD3A 4CM2A 4C9DA 2N4DA 3EZOA 2QZ8A 4N41A 1SJ4P 4DUYF 4O0NA 4A8QA 4DV2F 3D1QA 2XMUA 4NA1A 5KFRA 3QJPA 3THTA 2VBXA 4ZVRB 4BBYA 2V4JA 1C1BA 3A3PB 2PE8A 4GVBA 3SCJE 4P2XA 3QO9B 3DRXA 2DYAA 2MKCA 4URGA 1XN9A 2DHSA 2RMLA 2MKIA 1RT2B 4TLRA 4QYZK 1FTCA 3PRDA 4DG1B 3O1LA 1MU2B 4USKA 5ETNA 3UVJB 1ZZNA 3FK4A 3RTVA 4J91A 2Z57B 3I9V9 3F44A 3MPDA 4NASA 4DV1F 1S9EA 2VA2A 2ROEA 3W3SA 1HI1A 3U1LA 3DOLA 4BWJA 3ZO7A 4YQWA 3KK2A 2MY8A 3LGHA 3FEXB 1DARA 1QUVA 1S1UB 2XSJA 1KR4A 4DPWA 4ATNA 1EKRA 4YY3F 2V8GA 2UV8A 1Y11A 1H2UX 5DQGA 4DQSA 1U1KA 3ENQA 3DKDA 3M6WA 3WIUA 3JQKA 3DRYA 4LRBA 2XY6A 3V6DB 3NWGA 3E01B 3H2VE 4ILRA 5CH7B 5DG8A 4CO3A 2HFVA 1AZSA 5J2NA 1N0VC 2D7SA 1REGX 1N5QA 4GRSA 4UOHA 3A8EA 4QWBA 1HNZF 2J0QD 2PI4A 2PMHA 2H48B 2H5IB 3AXKA 3CVKA 3T41A 3KLIA 1EAYC 3RRHA 4A8FA 3KLEA 4WBFA 5J2MB 2BRLA 2WCXA 5JXSA 2GNKA 2VG6B 2YVSA 3KUHA 5E3PA 1NHUA 5KFNA 2MHEA 1YJ7A 2ZBPA 3HKZD 3MEEA 1X4EA 3R5BA 4F4AA 1WOOA 4NYZA 1VMBA 4P7TA 4QOTA 4UY8T 2CDRB 1R8AA 4GKKF 3KLVA 1KVIA 1VRTB 1HBMA 4WYLA 4UF4A 2PIIA 2BEFA 3HVTB 3U1MA 3EVWA 3W9IA 2OPPA 3A3NB 1WNEA 2ZUGA 3JSBA 2BABA 4HT5A 1LK5A 4R5PB 1WC0A 1C1CB 2A10A 1T11A 1WF2A 3H8YA 1KQFB 2DEJA 3H40A 2C1EB 3HX9A 1U25A 3SDEA 5FLXY 4G1PA 2O67A 3M2VB 1S6UA 3D7SB 1UA1A 3MM6B 4MFBB 2P9CA 4H4OB 2ZC3A 4OX6A 4I7FB 3DLHA 2MXYA 3F56A 1CS4A 3RU0A 2IDLA 3MGJA 2VFRA 1UZHA 3R2CJ 2KO1A 1R31A 3A4TA 3PW7A 3G96A 1TZ0A 2IJNA 2M9KA 2W8LA 4JI2F 2EI5A 2RE1A 2W01A 4DV5J 1S9FA 4FVCA 1FRIA 2J0XA 5KFIA 4O3QA 2WSCC 5F9NA 4LF5F 1ZS6A 3CJ8A 3CDEA 4KYZA 5KFAA 3VAHA 3QWUA 5C2GA 2R7RA 2OTLS 2LP4A 5E2QA 3EZ5A 2ZZTA 2HHHF 2PEBA 1RT7A 3VAGA 4KV8B 2W7OA 2ZZMA 3D6MB 4P74A 2DCUB 3D54A 2RQKA 3MMBB 4JI8F 3J7ZT 3PIOQ 3G6VA 2DRBA 4X4PA 4CYUB 4HDHA 4RNOA 3NBPA 4Q8FA 5DZ6A 4WK1A 3TX8A 3FZBA 5HK4A 2MYFA 4F26A 2I1RA 2JX2A 5IT9Y 1WEZA 4I6YA 1SIWB 2MB0B 3ENAA 1NCLA 2VJUA 2BBEA 2Q79A 3O2IA 1KKHA 3QGGA 3H4BA 4UUXA 1JKHA 3T1AA 2MZTA 1R8CA 4HLBA 2HRTA 4ZA1A 2JVOA 2A0FB 5A8KA 2L9WA 1EX8A 2MLXA 3W2WB 4JI3F 5HJXA 1I3OB 3ITHB 1JLQA 2HZCA 1X5TA 2CIMA 2IJFA 1TV6B 1FD8A 1ZM3A 2F63A 2XEXA 2DRDA 4URSA 5A8RA 5KG0A 1N34F 4DFPA 3VGTA 4LF7F 4NA2A 5ETOA 4ZLNA 2G2YA 2CUYA 2IPOB 2P2CB 1TL1B 3MI7X 3K5PA 4I4BA 5LSLA 2XMAA 4RU2A 2CG8A 2P8IA 4I64A 2RJZA 4Z7YA 4NI2B 4U6PA 3PY8A 2A3JA 2CQ2A 2VPXB 3AFGA 3CCVS 3I55S 3QRRA 4K4UA 2QRRA 1H6KX 2AX0A 1IKXA 2VH7A 3J7Z5 2NXUA 1S57A 2AF6A 2E5JA 2FJAB 2OFGX 3ETOA 3DOMA 4J9VA 3V4MA 4LSNA 1BMQB 3W8GA 1VYAA 2DNZA 2RHSB 1FESA 3ILLA 4K4YA 1F2HA 1U47A 4JI6F 4V19J 5C2CA 4BLGA 1U1LA 1WUUA 5EWEA 1YI2S 2G0CA 2H9ZA 1HNZJ 1QSSA 1ZM9A 4USHA 4K50A 2P6TA 4DMZA 3T9ZA 2KFYA 1WDTA 2I6WA 2WSEC 3TW0A 3NGKA 5L1JA 4DL2A 1EB0A 3N5BA 3NGTA 1LW2B 2KL8A 4M5GA 4LR7A 2ZH5A 1S76D 2IA6A 1FJ7A 1XNRF 1T9TA 4A47A 2QA1A 5F8GA 2RRBA 4R8UB 1R8BA 4KH0B 1TMMA 1H2VZ 5GAHI 2AJ4A 2Q1LA 1FXLA 4C8MA 2MJUA 2ZNYA 5F3TA 2ZEJA 8RUCA 4U7CA 4WFAQ 2XY7A 2DNYA 3E3XA 4OYBA 2ERRA 1HL6A 1S0OA 2XTJP 3ZNUA 3B54A 5KT6A 1RWNB 1LXJA 2CPZA 1LNQA 3R8YA 2AJQA 4FXVA 1HWIA 1Q53A 2QLBB 3FVYA 4DPTA 2NXNA 3QAUA 3N6MA 4RW8A 3CO9A 1J5OA 2HWTA 3JSYA 2FVSA 3OXGA 1ZAXA 4TY8A 2BQ3A 2M2BA 4DBQA 1N34J 2CJ9A 4KQZA 2CQPA 2VDIA 1M5OC 4HTJA 1WOSA 3SBMA 2GAGC 2GC8A 5E41A 3PKYA 2UUCJ 1ZH5A 3HF5A 3UN2A 5L1IA 4MIBA 4OHXA 4G3IA 1YK9A 3JQJA 1YZ7A 4L72B 4QWEA 3J80Y 5L1KA 1ZM4A 4F25A 3L3CA 3T6BA 3W66A 4A8YA 5K14A 3ZTPA 2ILZA 2NQPA 1BQXA 3QATA 4DR4F 2HHWA 5F8MA 2E7VA 2V8VA 3NWRA 3HVWA 2M8HA 4LF4J 2EK1A 5KFLA 1IBCB 5I3UA 3Q8UA 3MUMP 4NLQA 3M2RA 4CLLA 3QSYB 3M8PA 2GO8A 4F4ZA 1SQEA 2VBYA 1GK8A 1DQ8A 2BE9B 4IG3B 1N36F 4AUKA 4FNIA 1T94A 1V9OA 4QIGA 1DQAA 2MKYA 1BWVA 2JVRA 3NCRA 1WC3A 1VQPS 3GZ7A 1YWXA 2LDYA 2C2KB 2JOQA 5L8RC 1W2BR 3H5SA 3KKFA 4M8LA 5LMUF 3T1YJ 3CC7S 2QSFA 4H4KC 3GJSB 1RBAA 4DU7A 5IXUA 3FUYA 1XMOJ 2IA0A 4ERDA 1M1KT 4KR0B 5D0HA 4HT7A 1MNEA 2KDOA 3AXMA 2HRYA 3HM9A 1KC8T 3EZUA 3FMWA 2UXBJ 1D8ZA 5HJYA 3CCSS 2YNGB 5LSOA 1S6OA 1RTZA 4CNZA 4B3RF 3RW7A 5SZTA 2W9BA 1G7CB 4ZPAA 2FJXA 2DHAA 3MPVA 4FPRA 2DNLA 4G1QB 4K8RA 2F65A 2EK6A 3UDCA 5B7WA 4IR1A 1PJ7A 2IVYA 3WX8A 1T95A 2B9YA 1QY7A 4TY9A 1AXQA 1VK8A 1ACMB 2KT3A 2GX8A 3OR1A 2CA9A 2AGPA 3PKMA 4LBIA 3QIPB 2OD6A 3FMBA 4JOUA 3K59A 3HK2A 3BQ2A 1Q1KA 1JMTA 4PG8A 3S6EA 2X3DA 3W5YA 3I87A 4WU2A 2K8GA 4ZVPB 3CMAS 1CVJA 4IRCA 2NR0A 3IWNC 3JYTB 2W24A 2DVIA 2B51A 3PTWA 2CAJA 4KY3A 8AT1B 3OD2A 5C24B 1BQMA 1ZTWA 4F36A 2B4OA 1BC6A 1S12A 2R7OA 3PYGA 2ADBA 3C14B 4O3PA 1ZA1B 1GXUA 1FE4A 2O3DA 1VQNS 4IKAA 3OJSA 2DR6A 5SUHA 3O5TB 3HCXA 5KG1A 2FJVA 1HYSB 2OPPB 4B9UA 3RAQA 5CHCB 4O3OA 4CLZA 1S48A 4V19X 1S59A 2O1PA 3W2VA 1LQ9A 4GO5X 5KFKA 1SKRA 1X4DA 5EWFA 3LP2A 1IUJA 1D09B 3WHIA 4AQYF 2ABYA 3H5XA 1N33F 5JJBA 4QQBA 3P49B 4ELVA 2GIFA 2Y0BB 2A18A 2YQ3A 1TUVA 3CIMA 1N88A 3L7UA 4RL1A 4DL4A 1PYTA 1RXOB 5B0GA 4QIFA 3I0SB 1P1LA 1VCTA 2B3TB 2OIHA 2EVZA 2PFDA 4RR5A 4NEYA 1APSA 3H42A 3RB3A 1H0HB 1S72S 4DX6A 2KM8C 1AUDA 4PG5A 2VFUA 5I4MA 2D1CA 2B6AA 3S1TA 3V81B 1QAYA 5E5NA 3CJRA 1UVKA 5E3RA 1XQIA 4X66F 4C98A 2DHGA 3GU0A 5CCMA 2N3OA 1RAJA 5IV3A 3C2PA 4NLUA 2J0SD 3M05A 4KTQA 2KXFA 5ADZA 3VAJA 3OLBA 1QVFR 1T03B 3EGWB 3BGRA 1WSRA 4O3NA 2R8HA 4K4ZA 1ITPA 1DY3A 5AXNA 1NK4A 1DRZA 2VASA 2NUHA 4CI0B 1J27A 3DOLB 3L7PA 4ETXA 4DV2J 3QRPA 1T9UA 3QWPA 4OFZA 5C24A 5BYRA 4Y65A 5LSRA 3T1HF 1F6TA 1JNZB 3N6NA 1VOMA 3OTEA 4QJVA 4JI5J 2MMYA 2E9RX 1JLBA 2XZTB 1Y5NB 5HO4A 3HD2A 1UVNA 2OPQB 2O66A 3AB2B 3ENWA 1RLCL 2XLIA 1TL3A 1IBLJ 4OX9J 2QX0A 3S7RA 3CTRA 1WKKA 3CD0A 1IM6A 4GC7A 3UNYA 4L6V3 4A8OA 3LP0A 5IQQA 3UNGC 3ZC4A 4AL6A 2RS2A 1HNWJ 2DT9A 3CMQA 4CH1A 1RADB 2AJ1A 1FVSA 2EFGA 2QLWA 3N6LA 1O5JA 4PQUB 2V50A 3F73A 2ZH9A 4Q43A 1JLAA 1ZYQA 4X4VA 2ZWOA 2GMLA 1JJCB 4QWDA 5BXIA 3GR1A 4LRFA 5HMYA 1GMUA 1RACB 4OI0A 4K4VA 1RTDA 1T05B 2C3MA 2MQMA 4ES2A 1CLFA 3AB4B 1RI7A 3EXYA 3JB9k 2YPZA 3Q8SB 3CCLS 3PR4A 1S0NA 3ET6B 3PXGa 2M0GB 1WHVA 3R5CA 4JYAF 1T9VA 2QL9B 3KOAA 3WBZA 5D4NA 5CAAA 4C8NA 4K4XA 2OEMA 3KDOA 2C28A 2QFIA 4DOZA 5AE3A 1NLKL 7FD1A 3GIIA 1OY6A 4CCHA 4JI1F 1JQGA 4ID5A 3KNGA 3O6QA 4PQAA 3JTNA 3R7BB 4RX6A 1HW9A 1Z1ZA 1H72C 4WP9A 1D9AA 5ETRA 1K0TA 1SI9A 2ZVIA 1K1SA 2MSSA 4U67Q 3PO4A 5AT1B 2GIQA 5J2QB 1SKWA 2XS7A 3OUYB 4DV3F 1RDRA 3Q24A 3SI8A 5AJ3F 3CJ2A 1HIYA 3K89A 3FQKA 4DR6J 2HVEA 1S1XB 2UUBF 1R3NA 2XMKA 4FYYB 4CH0S 3CJKB 4WTOB 4DV3J 4KH1B 2VC0A 5B0BA 4OZ3A 2QYGA 3E8OA 4RWWA 1RE1B 4ID5B 3BGUA 1TR0A 2CPEA 4QR2A 1EJ7L 1Y4ZB 1J5EJ 3GONA 4AL5A 4Z7CA 3SXLA 5E3AA 4Z2XA 3L95X 6AT1B 2LQ5A 2DH8A 2CQIA 2FVQA 3JTOA 2WONA 2PD1A 1HKAA 4AT1B 4C97A 4FVMA 4MTPA 3BH6B 5KOWA 4M5MA 1EQMA 4L3KA 3I4PA 2ZH8A 1NU4A 3GIMA 4TY8B 2EFNA 1FVQA 5L1LA 1NO8A 3OXFA 4IFYA 2GQ2A 2L9DA 3HHLA 3CDUA 2LYVA 3EDRB 4Y3CA 1MN7A 5HMWA 3DHWC 2OMOA 2G9OA 1UEUA 3WC2A 1U6BA 4I69A 1BUXA 4M5KA 4Q45A 1QSYA 4JV2A 3D9BA 4JI7F 3NAIA 4X64F 3P4UB 1HQEA 2KXNB 4WFNQ 3MR2A 5D15A 4R8UA 1RCOB 3MDFA 4G6VB 2IHR1 3E2EA 2GZOA 2B0GA 3MAQA 2HMIA 5AE1A 5GMDA 3VZIA 3CD5A 1Y5LB 3BGLA 5MLCV 2XGPA 3G9CA 2WRMA 2AEJA 3FZ2A 4QW8A 1FEHA 3ZTSA 3IS9B 3IR6B 3K8VA 2N7CA 4CWBA 2EC0A 1TFWA 2V2KA 5KT2A 5G0RB 4JV5J 4P75A 2KZZA 3X1LB 3E51A 4ANCA 1JNRB 4PRFA 4NRTA 3LTOA 4TQSA 3CCES 1ZZFA 3KG1A 1NJXA 2Y1RI 4K0KJ 1WELA 3V81A 3R5AA 2DB1A 4ZVUB 5LMNJ 5GADI 3SZ2A 3RAXA 2HFSA 2GW8A 4DUZF 3CJ5A 4LF1A 2DGQA 3W64A 1T02A 1AFIA 4E2FB 4KSEB 2W2PP 4DR4J 1F5BA 3J7YI 5J2PB 4W92B 3MZIA 2XYGB 1RT3B 2IRXA 5KFOA 3BQ1A 1TV6A 4W4MA 4FS1A 1KVJA 1XMOF 1JLQB 1UP1A 1T3NA 5HLFA 4DDFA 3DOKA 4ECQA 4XPEA 3L09A 1FRJA 1UPPA 4IO9Q 5IT0A 4P2SA 3QIPA 3G82B 1LWFB 1NNDA 1TKTA 2VG5B 5B0AA 3DRSA 2C2NA 2R4FA 1C0UA 3D1OA 2IC3B 3QSIA 2VG7B 4PUOB 1VLYA 4ZP7A 3G6ES 1MN9A 1MWQA 1P6TA 4L3NA 3T5JA 2MGZA 1SKSA 1FHTA 5IWAJ 3KK3A 1FX4A 4CYUA 1Z2LA 3IA0A 3IBFB 4DV7J 1FJGJ 3D67A 1FWPA 2CPDA 3LQVA 3OFHA 1AROP 1WHYA 2YNGA 3I31A 1RYRA 2LQJA 2GMHA 1F5CA 3V6KA 3UD5A 1JLCA 1D1UA 4HKQA 5B0FA 5T7LB 4RUCA 1N8RT 1HBOA 1WG5A 1Y5IB 1SJ1A 4NLTA 2NLWA 2V63A 2VG5A 2FJWA 1QAXA 1XJWB 2P9EA 4PR6A 2MZSA 3H5UA 3PYEA 2N7YA 1IBKF 3VQSA 2M7SA 2VD3A 1DTTB 1ZAWA 1GMWD 4C2MA 1YTYA 2QGFB 5FJ4A 4ECYA 1Z4UA 3D66A 4CLUA 2OPRA 1RJJA 3FFIA 2YWHA 2JZ5A 1HBUB 1CSJA 2B7CB 2CQGA 1SC4B 3ZTRA 2AU0A 1NK5A 3UI3A 4YMEA 3O44A 3PFEA 3W62A 1KN6A 2DH7A 2VUGA 4Q2MA 5RUBA 3OL6A 3AD8C 1FNXH 4DL6A 2MQLA 4FN5A 3MD1A 3QQCD 2RU3A 5DG9A 1C1CA 3MM7A 2E1PA 2DR8A 2LU1A 2ZD1B 4C8KA 4C0BA 1XR6A 4KT0C 3SCIE 4DU8A 3OL8A 2CJQA 5AE2A 1S6QB 3PCOB 5CYQB 2DHXA 4ZVOB 2XCPA 3Q23A 1DLOB 4J5OA 1X4HA 4DV6F 1N48A 3K2YA 4CLWA 1TFYA 2CVEA 2Y8YA 4I2PA 2HBQB 4TYAA 1FFSB 2FHJA 1VHIA 1U24A 2AJ2A 2GFFA 3M2RB 4ZLJA 4O3RA 5CZVA 3KLEB 1TVRA 1AYEA 1TP7A 2ZBIA 2XC9A 4O4GA 3PV8A 5F8LA 4CDIA 2D3O1 2LQBA 5I3PA 2UU9J 2GO9A 4B9LA 3CW2C 2DCLA 5EX3A 2OHDA 1EQ0A 1W7WA 3SQGA 2EWHA 2QLJB 1U1QA 2E1MC 1NZAA 4N8OA 4C3LA 1SUQA 1HQEB 3BR8A 3EVMA 4CO0A 5I3QA 1IKWA 2W4CA 2J0WA 1OSDA 3BSAA 3CDWA 4OZ0A 3I5BA 2KKHA 3MURP 1U45A 2DNRA 2JLEA 1TAUA 4KFBB 1UJ6A 3WQPA 2K3KA 3GIRA 1KQKA 3KMSA 4ECTA 2HBYB 3EE3A 4LSZB 4OI4A 2UUCF 2KZMA 1ZPVA 2WAQD 3NCQA 5K9FA 3LUYA 3VAMA 1G1XA 4FPIA 3M9NB 1UW4A 1GMWA
chains in the Genus database with same CATH topology
2BZ2A 2FC9A 2R7QA 2W9CA 4DG1A 1RTHB 1SUQB 2YY3A 2HPUA 4ZPBA 4ZP6A 3Q22A 4J9KA 3POTB 5KFPA 4AYBD 2ZD1A 4NL5A 2L48A 2ZNZA 2JH3A 3MCSA 4IQMA 3CWJA 4OHVA 2DNPA 2N82B 4EEYA 1PC4A 4EBCA 4C8OA 5LL6d 1ZOTA 3B78A 3TQ1A 2J6UA 1TKXB 1A7GE 3ISNC 2H5EA 2EFVA 2KTQA 4I2PB 2AGOA 5KG4A 1KLMB 1FDBA 1GXTA 2JC0A 2ZH6A 1UEVA 3DLGA 2HIQA 3MEGA 1JLGB 4LSNB 3TVKA 1F5AA 3AA8A 1OQ6A 1QUPA 4CT9A 5GAGI 4NXNF 1BLUA 1D0EA 5KFHA 2BACA 2C3UA 2BE2B 4NLPA 1QTMA 2C2DA 4YUDA 2JFDA 2IMOA 4DQIA 3C2PA 3BS9A 4QU6A 1WTFA 1FEEA 1Q8LA 3LGNA 3HZEA 4N47A 2CVIA 4IH7A 4MK8A 5J1PA 2HHVA 3LAMA 2D3OR 5KFEA 2HHTA 1HBUA 3C8YA 2P6SA 4IUFA 5T41A 1NAQA 4MK7A 3CCZA 2FUG9 2Y1IA 4N77A 2C2EA 1N6QA 2F8EX 4B08A 4LF4F 4EO6A 1JXEA 2COLA 1YGYA 2IVMA 4NPOA 4NYPA 4EUVA 1KHVA 3NG8A 3PJWA 3RZAA 2KN4A 4OV1A 1X4CA 2XMWA 4UUWA 4ILMA 4RNNA 3LP0B 1ZTTA 3BO4A 4RW4A 2AV5A 2LEBA 3KHRA 1HHSA 4PKDB 4KHMA 2LKZA 2R2RA 3GMGA 1RT1B 2Q43A 1VQSA 2V9KA 3B82A 3IWLA 3HMJG 2WOMA 3KLFB 2HMIB 4DPOA 3KK3B 2VFVA 3MM6A 1EETA 4QJVA 4C8YA 2RKIA 2CQHA 3Q8PB 1K1QA 1YJUA 1YRUA 3TARA 4F2RA 4WJBA 4USIA 2VG7A 4PUOA 2GJ2A 2LA4A 4WFXA 3KHLA 2BM1A 4YDXA 1GTHA 4KC5A 2V8DA 3MFHA 3GIKA 4RW7B 1HD0A 1VRTA 1NH7A 4I2QB 3RYLA 1HQUB 4IFYB 4X4OA 3SMZA 5GAGU 1WWHA 5K8NA 5I42B 1RT3A 2UUTA 1NH8A 2XWYA 4OZNA 4LQ9A 3OFGA 1U2FA 1REVB 3GFYA 1L3VA 4ED8A 3M9OB 2BOPA 2DR9A 2AJ0A 4QR1A 3ZZZA 3W7BA 1WG1A 3SSQA 3E01A 1H98A 2CKWA 2OKQA 2CZVC 4WF9Q 3DLKB 3I56S 1NRKA 1HBNB 4Q8EA 4H54A 3G6YA 4HL9A 4CNYA 3QLHB 4MAKA 1S79A 2BVZA 2MZ1A 5K8MA 2VG6A 2FVCA 3GV7B 1YRTA 4IH6A 2UVVA 5EHHA 1BWEA 4ZVHA 3HP6A 3MMAB 1YHQS 3KK2B 2UU9F 1P1TA 2GA7A 4ZKAA 4ZCLA 3TNVA 1YIJS 1HR0F 1ROFA 4KJIA 2YNFB 2YH1A 3JYTA 1VHFA 4WK3A 2QT7A 3MXHP 1XR5A 1Y0HA 4I68A 1NJWA 2BANB 2KRBA 1HI8A 4LUBA 4DV7F 4LVOP 2JEFA 2VFSA 2ZC4A 4FNHA 4OLPA 3BJYA 2GQCA 1S1UA 3CSKA 1YRXA 4DN9A 2ASYA 1Z2ZA 3H59A 2XWXA 3CJ0A 2ROPA 3GG0A