3E01B

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 108
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B04
1S48A 2YNIB 4NCGB 3BSAA 3RB3A 2ZD1A 2ASDA 4KFBB 4WE1A 1K1QA 1OS5A 2IM1A 2DPIA 3PJWA 3H59A 4ED7A 3SFUA 1S9EB 1S9GA 2ILYA 2HNDB 3M8PB 4URGA 2IAJA 4QW9A 4I7FB 4KO0B 2AX1A 2XGPA 2E9RX 1TV6A 5J2NA 4Y2CA 4IRCA 3DOLA 1C2PA 1FKOB 4Y2AA 3DYAB 3CVKA 5D3GA 1C0TA 2ZKUA 5F8NA 1EETA 3E01B 1VRTB 2D3ZA 4ZVFA 1DLOB 4Q44A 4ECQA 2J6TA 3T5HA 2HWHA 2C2EA 3BQ2A 1N48A 3Q8RB 3QO9A 2R8IA 2RF2B 4QPXA 4NLVA 4ZVEA 3NAHA 4ZP7A 1DTTA 3H4DA 4K4WA 2RKIA 3DMJA 2W9CA 1LW2B 3QZ8A 3T19A 2F8EX 3BQ0A 2BE2B 2WOMA 4H54A 4ED8A 2UVWA 2YNFA 4G1QA 5KG3A 3H5XA 2R2SA 5L1IA 1REVA 4NRUA 1Z4UA 4O3PA 3IS9B 1CSJA 4O3NA 2BRLA 1C1BB 4IFVB 2AX0A 1RT3A 1TV6B 3OL8A 3DOLB 3FSIA 1RTHB 2JC1A 1RTJA 1RT7A 3GYNA 1RT5A 1LW0A 3UR0A 1LWFB 2BANA 4R8UA 4EO6A 3DM2A 4EEYA 1EETB 3DLEB 4LSLA 1R0AB 2OPQA 3NGDA 1FKPB 3PW0A 3PW4A 2AGPA 4NLRA 3BR9A 2QV6A 2XWYA 1IKVB 4Q0BA 3KNAA 2B6AA 1RTDB 3OL7A 3QO9B 1LWEB 3BSCA 3QIPB 2VA2A 2JEJA 2D3UA 4U7CA 4RNNA 5KFJA 2C28A 3Q8SB 2FLLA 1RT6A 3OLAA 2RKIB 3QGGA 3GIIA 1ZTTA 3DMJB 3KJVA 3T1AA 3D28A 2I5JA 5KFKA 2W9CB 1TKZA 2VG6A 4F4YA 4IRDA 4JV1A 5HP1A 4NLWA 2UVVA 2WK4A 1VRUB 4G1QB 3QYYA 1TVRB 3KLHB 4NLUA 1KHWA 1C1CB 1REVB 1FK9B 4KKOA 3MECB 4MKBA 1D1UA 3JYTA 2W9AA 3OL9A 2IC3A 1S1XA 2GIQA 5J1EA 2C2RA 4KV8A 1LW0B 4OL8A 1XR5A 2HWIA 2BANB 4TY8A 4R8UB 4IG3A 3M9NB 4FS2A 4ECTA 5KT6A 3RAQA 4NLOA 4JV0A 2OPQB 3NAIA 3LP1A 2FVPA 1S6PA 1JLQA 5CYMB 1BQNA 4Q0BB 3EZUA 1TL1B 4RNFA 4WZMA 5KFVA 1S0OA 2YKNA 3KLEA 4IKAA 5L1KA 2W8KA 2HAIA 2WONA 2W9BA 3BJYA 5K14B 2WRMA 4IH6A 2OH2A 3KJVB 4J9OA 2I5JB 2FJWA 1KHVA 1RT4A 3DRSB 2YKMA 3V6DB 3N6MA 4ED3A 4KB7A 2VG7B 2XI2A 4IG0B 3I0RB 5HLFB 1T03A 3UPFA 3IG1A 5KFPA 4O3RA 5HBMA 4XPCA 5F8GA 5EUHA 2HNYA 3DLKA 1HQEA 4KKOB 3V81A 4EO8A 1KLMA 1RTIB 3DI6A 3TAMA 4NLXA 2FLPA 3TVKA 2R8KA 4RW9B 3IGNA 4DEZA 3MFHA 2BQRA 1IM4A 4ECWA 4H4MA 4WYLA 1S1XB 4RW7A 1S1VB 5J1EB 4RNOA 3RBDA 3RB0A 2V9WA 4F50A 4TY8B 3H40A 2R8JA 4K4ZA 3KHGA 1S0MA 1RT1A 4Y34A 4TXSA 4IFYB 1IKWB 1RDRA 1BQNB 2IJFA 4NLQA 2RDJA 2C22A 3NBPB 4O44B 2J6SA 1TQLA 2D7SA 4TY9A 1C0UB 3H4BA 2W9BB 1MU2B 1S97A 3KLFB 5F8MA 1WNEA 5JXSA 1RT4B 2YKMB 1DTQB 4KHRA 5KG7A 3GIMA 1T03B 3IG1B 4URSA 4MH8A 4PWDA 2W8LA 2J6UA 4IR1A 5HBMB 1S4FA 3DLGA 4YR2A 2DPJA 3LP2A 3OSPA 5KFBA 3M8QB 3DLKB 3V81B 3KHLA 3LP0B 5L1LA 2IA6A 1QUVA 2IBKA 1S1WB 4PQUB 3IRXB 1TKTA 1N5YA 2BQUA 4RW4A 3BSOA 4K4XA 3T5JA 3CJ4A 4ZP6A 4MFBA 2IM0A 2HNZA 4HKQA 1SV5B 2FLNA 4ZVGA 4ZHRB 5KT5A 2E9ZA 3FFIB 2JLEA 5FDLB 2UUTA 4LQ9A 4HYKA 4DL5A 5DGAA 1GX6A 4RUAA 1LWCA 1XR6A 3I5BA 1N6QB 4RW8A 1EP4B 4QWAA 4J9SA 4DL7A 3KOAA 2YNHB 3DRPA 1GX5A 5EWEA 4FS1A 3V6HA 1HNIA 3QLHA 4DL3A 4EBEA 4O4RA 1J5OA 1RYSA 3GV7B 1D0EA 1JLCA 4IDKA 2C2DA 2OPRA 5C42A 4R5PA 1S9FA 4K50A 4MK8A 3Q8PB 4PWDB 4ID5A 1UWBA 2OPSA 2ZD1B 3V6JA 3DLGB 4WE1B 1JX4A 4ZP8A 4I2PA 1S9GB 3KK2A 4Y3CA 2IAJB 5KFCA 3QGIA 3GILA 4RW4B 5HROA 3KHRA 5F9NA 3ISNC 1SUQA 4MFBB 5J2NB 4ZVHA 4JUZA 2XC9A 5L1JA 4IOBA 3HVTA 5D3GB 1C0TB 3CIZA 1HARA 4NLYA 1RT2A 2VG5A 4RW6A 5KFAA 2JEIA 5CYQA 5DQHA 2AQ4A 1IKYA 2FVSA 3KLIA 1NHUA 3H5UA 4ECYA 2BQ3A 5KG0A 4WFZA 1J5OB 2B5JA 1DTTB 4IDKB 1K1SA 3BREA 2OPRB 5C42B 4MIBA 1MMLA 3DRRA 3MR6A 2GC8A 3GQCA 3ITHA 4ID5B 1JLAA 5F8JA 5KFTA 4RUCA 2WOMB 2V0NA 5J2PA 3MR5A 3OHAA 5C25A 2YNFB 2YNGA 5DG8A 2HMIA 3PW5A 3SI8A 4F4XA 4ED1A 3KK2B 3MEGA 3RB4A 4QW8A 1IKXA 4B3OA 4ZPAA 5KG5A 2XGQA 3GV8B 2BR0A 1NNDA 1QAIA 4TYAA 1JXLA 3KK3A 5KFGA 1T05A 3MR2A 1RT3B 3IGVA 2BRKA 4NLPA 3UQSA 1RT7B 1RTJB 1RT5B 1RA6A 3PZPA 2W7OA 4EBCA 3CJ5A 1S1UA 5F9LA 3DOKA 4WYWA 3DM2B 2VG5B 3V4IA 5I42A 4LSLB 1S1TA 3RAXA 5T14A 5J2QA 3KLIB 4ZPCA 3CDUA 2UVUA 3FRZA 2B6AB 4I2QA 2ASJA 1N4LA 2GIRA 4ZPBA 4PUOA 1HPZA 2O5DA 1S0NA 1RT6B 3CJ3A 3MEDA 4ECZA 3PW7A 3DRRB 4QWEA 3Q8QB 2EC0A 1TKZB 2VG6B 3OL6A 5I3UA 5HP1B 5J2PB 3JSMA 2AWZA 3CO9A 1NHVA 2YNGB 4ICLA 3D5MA 4ZPDA 4K4YA 2ATLA 5KFWA 1S10A 3MEGB 2OPPA 5DQGA 1IKXB 4B3OB 5KFOA 5KT7A 3KHHA 3C6TA 2ALZA 3KK3B 1T05B 1QAJA 4XO0A 3JYTB 1W25A 5KFHA 3M9OB 2E9TA 2IC3B 3G6YA 5J2MA 4KV8B 1JLEA 1JIHA 2WCXA 4IG3B 5I42B 1S1TB 3FDSA 4KE5A 4NLTA 1HYSA 3BSNA 3LP1B 4IRKA 3MFIA 1S6PB 1JLQB 5KFMA 4WFYA 2YNIA 4I2QB 3FQKA 1JLFA 5KFZA 2YKNB 4F4WA 3KLEB 4NLSA 1HPZB 4KFBA 2WONB 3I5CA 2FVCA 3C6UA 1S9EA 3PW2A 4JV2A 2HNDA 3M8PA 4ECSA 1SH2A 1T94A 5I3UB 2VA3A 4RZRA 5EDWA 4ED6A 4YMEA 4IQXA 4KHMA 4KO0A 4M94A 3EPIA 1S49A 1TP7A 3H98A 4QWCA 4GC6A 2OPPB 1ZETA 3CDWA 2HNYB 3KMSA 1HQUA 1HQEB 3DYAA 2UUWA 1KLMB 3EPGA 4ECUA 3DI6B 3TAMB 3LAMA 4YR0A 3N6NA 3GIKA 4DL2A 4H4MB 1HNVA 2AGQA 3E01A 1VRTA 4RW7B 2D41A 2ASLA 2IM3A 4MK7A 4O3QA 2R8GA 1HMVA 2AU0A 1SH0A 3V6KA 4QWDA 1RT1B 2RF2A 1HYSB 5KG1A 4O3OA 5KFXA 3KMQA 1JLFB 1RYRA 1LW2A 2BE2A 2FJVA 3C6UB 5KFUA 5KFFA 3IS9A 2W7PA 4RNMA 3N6LA 4O4GA 1C1BA 3PJXA 4IFVA 2IMWP 4NLGA 1XR7A 3TQ1A 3LP2B 1RTHA 5DG9A 4U6PA 1HQUB 2V4QA 4ECVA 2FVRA 4NRTA 1LWFA 1TKTB 1N5YB 4YP3A 3BQ1A 1HNVB 3I0SA 2IM2A 3DLEA 1R0AA 4ED2A 2V4RA 4K4TA 1FKPA 4Q45A 3GV5B 4FBTA 2HNZB 5KFYA 2JC0A 1IKVA 4K4SA 3LAKA 3CJ2A 1QE1A 1HMVB 1RTDA 3CWJA 1LWEA 3ICLA 3T5KA 3QIPA 2R2TA 4KAIA 4YR3A 4ECXA 3PVXA 5L9XA 3QGHA 5DQIA 4ZMMA 4IH7A 4J9KA 1LWCB 3KK1A 4RU9A 3UDLA 4RW8B 5KFDA 1BQMA 3MEEA 4DG1A 4J9LA 4LSNA 3SFGA 3DRPB 1VRUA 1JLGA 1JLBA 1HNIB 3QLHB 1TVRA 3KLHA 1U09A 5F8IA 3IN5A 1C1CA 3KLGA 1JLCB 3HVAA 3ISND 3GIJA 4R5PB 1S6QA 1FK9A 2ILZA 4O4GB 4KSEB 3NMAA 1UWBB 2OPSB 3MECA 2WB4A 4QWBA 1RA7A 5KG4A 2CKWA 5KT3A 4IH5A 3QZ7A 4J9NA 4G3IA 3FQLA 4J9PA 3CJ0A 3BGRA 4I2PB 5C24A 4XPEA 4FBUA 4Q8FA 2IJNA 3PR5B 5F8LA 4K4VA 4TQRA 3I0SB 5HROB 2JEFA 4TYBA 1SUQB 4DL4A 4LQ3A 1JKHA 5CYMA 1QE1B 1TL1A 3HVTB 4WFXA 4EYHB 4DL6A 3NL0A 3H2LA 3HKWA 4URQU 1TL3A 2FJXA 3PHEA 5KG6A 1RT2B 1ZTWA 4RW6B 5K14A 3KK1B 2R2RA 3MF5A 5CYQB 4TQSA 1IKYB 1BQMB 3MEEB 4DG1B 2RDIA 4LSNB 3DRSA 3V6DA 3PR4A 2VG7A 1JLGB 1JLBB 3I0RA 4IG0A 5HLFA 1RAJA 4H4OA 1YVFA 2B5JB 2QE5A 3KLGB 4GC7A 3QIDA 4M95A 4RNHA 2ZE2A 5DG7A 1I6JA 2FVQA 5KFLA 3DDKA 1S6QB 4EYIB 1RTIA 3ITHB 1JLAB 2CJQA 4RW9A 4NYZA 1T3NA 5C25B 5KT4A 2HMIB 3BGRB 1S1VA 5C24B 2JEGA 3LALA 4ED0A 5KFNA 3OLBA 4J9MA 5KFQA 3G6VA 4ZP9A 3OHBA 5KT2A 1TKXA 1JKHB 1IKWA 4IFYA 5C5JA 3E51A 3NBPA 4O44A 2R8HA 4ECRA 1S1UB 1TL3B 3DOKB 1C0UA 2I1RA 3H5SA 3KLVA 3V4IB 1MU2A 5EWFA 4J9QA 2R2UA 3HVWA 4MKAA 4O3SA 3NKYA 4WXOA 5J2QB 3KLFA 3LANA 1DTQA 4NCGA 5DLFA 5DGBA 4YQWA 4H4OB 3HHKA 5KG2A 2XCAA 4PUOB 4Q43A 4IR9A 2ZE2B 3MEDB 5DLGA 2XCPA 4EBDA 3M8QA 4J9RA 2UVRA 3LP0A 5KFSA 2AGOA 1S1WA 4PQUA 4K4UA 3IRXA 3H5YA 3JSMB 2B43A 4ICLB 3VQSA 4I7FA 4X2BA 2WHOA 4MK9A 4Q8EA 5KFRA 5F8HA 2XI3A 1N56A 4WZQA 1SV5A 1FKOA 3C6TB 4ZHRA 3G86A 4TN2A 4WXWA 2WTFA 3RBEA 3OSNA 3RB6A 3FFIA 5FDLA 3T5LA 5EWGA 5JUMA 4TLRA 1TKXB 3MR3A 3M9MB 3I5AA 4F4ZA 4KBIA 4NZ0A 1N6QA 1EP4A 5J2MB 1DLOA 1JLEB 4NLDA 1SH3A 3CDEA 3G6XA 3MTKA 2YNHA 5KFIA 4MIAA 4R0EA 5KFEA
chains in the Genus database with same CATH superfamily
2M8HA 4F3MA 4ED7A 4YDDB 3M8PB 3AA9A 2Y1LB 4CO2A 1HBNB 4LFAJ 1TV6A 3RTVA 2UXBF 2MQNA 4Y2AA 2DRAA 1GMVA 4DN0A 2V9KA 2CDRB 1VRTB 2BJ3A 3NCPA 2KFYA 3I9V9 4QPXA 1FTCA 4C0HA 1AUSL 1RAGB 2EI5A 2ZBIA 3S01A 3CMAS 1X4CA 4O3NA 1N5QA 4X4QA 1Q95G 2ZHOA 2GZOA 3DM2A 3A1YG 3HK2A 3PW4A 1IKVB 3A8IA 2XM3A 5T41A 5HQ8A 1NPRA 5DRKA 2W25A 1IBLJ 4NLUA 1C1CB 4KGZB 1AYEA 4JI7F 3OL9A 3FEXB 3LO3A 3M9NB 4IG3A 2GS8A 3NCQA 1FNXH 2VZ9A 2HAIA 3DLBA 3BGLA 4IH6A 4J9OA 2P5VA 1OQ3A 3V6DB 2V2QA 2VG7B 3IG1A 4AL7A 1U49A 3HHLB 1VQOS 3VALA 2H4WB 3P49B 3MFHA 4WYLA 3RBDA 5J1EB 3H40A 2R8JA 4MYTA 3P4UB 3LH2S 1CJVB 2RDJA 2GAGC 1UEKA 2N82B 1WNEA 5JXSA 3ENVA 1TL7A 4P72A 4FYVB 3L3CA 2DCLA 4RW4A 3Q83A 4MFBA 2IM0A 4KPYA 4ZHRB 2E9ZA 1Q4RA 4P74A 4QBUA 1IBMJ 2W2MP 1LWCA 1XR6A 3I5BA 1N6QB 2YH1A 4DQRA 3R5GA 3QLHA 5CQGA 1SJRA 3TX8A 4R5PA 5DJBA 4ID5A 4PXDA 3DLGB 1XEZA 2M5YA 3C16B 1S77D 1SJ3P 4OYZA 4ZP8A 3GFYA 2HHPA 3GB0A 4Y3CA 2MQ8A 3R1HA 1FEEA 1HARA 1RT2A 4U7UK 2AQ4A 4I6AA 1YBUA 3MM7B 2UV8G 1Q5VA 3MR6A 4ZVPB 3GQCA 1SC6A 3PJ9A 3JB9k 4TYAA 3O5TB 1RT3B 1PBUA 4IYQA 1XNRF 2ZOGA 3Q86A 2CZ4A 1S1TA 1A0OB 2H3EB 1RAAB 2B6AB 4GVBA 1H3DA 2PEBA 3MEDA 3CCUS 2VG6B 4DV6F 1G6BA 4ZPDA 2Z58B 3WX4A 2AT1B 4XO0A 5GMDA 5DDRC 5KFHA 2HS3A 5DM6Q 4E8UA 2WSFC 1WORA 3DLJA 1Y5IB 2AF6A 1WG4A 2CWXA 4V19X 1QTNB 2XMTA 4F4WA 3KLEB 2XS7A 4F26A 5SUHA 2M0GB 3M8RA 5I3UB 2CADA 4KHMA 1SQGA 1DQAA 3W63A 4RUBA 2DNQA 3IWLA 2JFKA 1G2EA 4QU6A 1DURA 4MK7A 2XO7A 3PV8A 5JMNA 3PFEA 1F6TA 3WQPA 5GAEU 1YSJA 3HSJA 5KFFA 4OYBA 2EEYA 1WACA 1GXUA 2AP6A 1UEUA 3GJSB 4FPRA 2R7UA 2MZ1A 3VVUA 3ZZRA 4YR3A 3B8HA 4ZMMA 1KOHA 1WOPA 1FD2A 1JLGA 4LFBJ 3PXGa 3NMAA 2I8EA 2AHOB 5KG4A 4IH5A 4DFMA 2OIHA 1RCOB 4I2PB 1FERA 4N76A 1VJWA 2IJNA 4K4VA 4ZK7M 3PHTA 4Q7AA 2DGUA 2VUGA 4DR1F 3BGUA 2NUUG 3OUYA 1WG5A 3CCMS 1JLBB 2W2PP 2CVIA 4B3SJ 1JLAB 5HANA 3FUYA 2B4OA 4ZPTR 3P45B 1IBKJ 4NXNJ 3JSRA 5ETSA 4DQSA 3N01A 1OY6A 4WXOA 4W4MA 4IR9A 3A12A 4IQMA 5L39A 1S1WA 1R8AA 2R7VA 4LR9A 3R1LA 1PYSB 3RBEA 2OKQA 4I6WA 1SB6A 3I5AA 2HG4A 3TA1A 1LEOA 1VHIA 5AJ3J 1EZZB 2KJWA 2ZWPA 2QMXA 5DDQC 5LMNF 4YB1P 2J9DE 3I6PA 2FJAB 1WDTA 2J9CA 2DR5A 5L9NA 1GMWA 1CS4B 4WTOB 4JV5F 4QIEA 1SL1A 2BOAA 4NMXA 2IMOA 4MMOA 3HFVA 3HT3A 1FRIA 2BE2B 2YPZA 5L1IA 1U6FA 4IFVB 3ET6B 1LW0A 3KG0A 1FKPB 4NLRA 3Q24A 3EMTA 2ZZNA 4RNNA 3GIIA 5K8MA 2QC3A 3LGHA 4NMLA 2X1FA 1HD0A 2GVZA 3A3PB 2IC3A 1OYDA 4PCQA 3M2RB 3RAQA 1NZAA 5M2UA 4LIWA 4JV0A 2KRBA 4Q0BB 1BQNA 2CQHA 1F9FA 3UCGA 4IKAA 2W8KA 3GE9A 4BDPA 3BJYA 4FVCA 4IG0B 3OTEA 3DLKA 2J7WA 3QWUA 2GMHA 4RNOA 2EG2A 5CZXA 4TY8B 4M5DA 2D7SA 5CD4A 4FVMA 3BKFA 1CJKB 3KLFB 3GIMA 2MTLA 4DFPA 1FJCA 1TKTA 1HD1A 2YQ0A 4QOTA 2C42A 2A3JA 3EJMA 3M8ZA 1FDBA 4XIUA 1S99A 4RUAA 2DNOA 1U45A 2YNHB 2DNMA 4C9DA 2BJ9A 4Y65A 1G3OA 3MPYA 2RDDA 2RD5C 2DVIA 1V3RA 3OR2B 1IR0A 3OW2R 1IM6A 4JUZA 5D3GB 4NLYA 1X60A 2HKEA 5DQHA 4AYBD 4XK8C 5GAEI 3A8EA 3PIPQ 3UN5A 2MQMA 1Q16B 1K1SA 2F9DA 5H9EK 2KJVA 3OHAA 4JI7J 2APOA 4ED1A 1U0HA 1PCAA 2ZHAA 2YTCA 1QAIA 4WK1A 1RT5B 4JBCA 2ZC3A 4K0KJ 3NEKA 3DRRB 3HCXA 4USUA 3MDFA 4LF4F 4ICLA 4ZIVA 1A7GE 3BPSP 2QG9B 3JYTB 2YWKA 2F8HA 2ZVSA 4EMDA 1GXLA 2Y9HA 3NXZA 1RWKB 4KFBA 5HL7Q 3O8WA 3VAJA 4AD6A 3LWMA 2O3DA 3IXQA 2NSCA 3CDWA 4C11B 3CJKA 5CXTA 2R7XA 2PFFB 3HXMA 4UUXA 2MKJA 2RF2A 1HYSB 4GO7X 1RYRA 1OPIA 1RJJA 3W9JA 2OELA 5DZ7A 4O4GA 2ZZMA 5ETLA 1PC5A 2HHWA 2ZWOA 3BQ1A 3I0SA 2IM2A 5G0RB 3IA0A 4NE9C 4DX5A 2X51A 1QE1A 2Z2LA 1LWEA 1VQ8S 4RW8B 2CAJA 3HZGA 4OX9F 3MEEA 3DRPB 3JTNA 2KTQA 3JSYA 2XY7A 2OD4A 3GLJA 4EGLA 3ISND 4K2XA 1UWBB 3FNNA 5D0RA 3QZ7A 4X64F 2LQJA 1XK8A 3NL0A 4UQGA 2VONA 1RK8A 2QE5A 4OI6A 2M3DA 3JTOA 1M5SA 3DDNA 1YHQS 3THTA 3OD2A 4ED4A 2KXHA 2HHTA 2G1HA 4CYUA 2QL7B 2DO4A 4NA1A 3EICA 4JI1F 1RKJA 3TNVA 5KG2A 3W2VB 2ZE2B 2MLZA 4IO1A 2D9PA 2DO0A 5IZHA 3IRXA 3JSMB 4I7FA 5MLCV 1FWPA 2E29A 1EKSA 4F4AA 4NA3A 3AB2B 1HBUB 1EKRA 5HQMA 3O6QA 4DQQA 4B9VA 4IRCA 1FKOB 4DJBA 4P2MA 1C0TA 5E3QA 1YZ6A 4FXVA 2IYGA 1R8PA 4ECQA 1HR0F 2NXNA 5AE2A 1DTTA 1OY8A 3J7AN 1TAQA 2AX0A 5LSOA 3GFXA 2JC1A 1JMTA 2WAQD 1FX2A 1LWFB 3DLEB 3MAHA 5U47A 3NOGA 3GG1A 4WK3A 3DMJB 2W9CB 1TKZA 2K3IA 1KHWA 1REVB 1WF2A 2B9XA 3NP5A 4ETZA 4DPWA 2D3O1 3MAAB 1JLQA 1R6VA 3CCVS 4H4KA 2DB1A 1HWUA 1RISA 2CQCA 3N6MA 5HLFB 1T03A 3B54A 2IVFB 2YBVA 1P8GA 2FLPA 2BUNA 4X65F 4ECWA 1S1XB 4F50A 1NRKA 1NK9A 2KFZA 4Y34A 4WP8A 1N5SA 2NXCA 2ADCA 2AKWB 4ELTA 1SKWA 2GHVC 2L9DA 3Q2SC 1H38A 4DBQA 4OI3A 4MIWA 3OFHA 1T02A 5HVFA 2JLGA 3MMBB 1HI0P 5HI7A 4CH1A 2AYBA 2CPYA 2MB0B 3LF0A 5L1LA 2NS1B 1YRTA 5LMNJ 3CJ4A 1KD1T 4BC9A 4YS2A 5ADZA 2UUTA 3L9ZA 1GX6A 3D54A 4DQIA 4KGVB 4WE1B 1FJGF 3KK2A 2JH3A 2DGXA 5J2NB 4KQZA 3VAMA 3T1HF 3HVTA 2ZH8A 1PBAA 1VC6A 4N77A 3SCJE 2VKRA 4G1IA 3KDOA 2RQKA 5F3TA 1REGX 1VK8A 3ZZPA 5F8JA 2BR0A 4OIXA 5A8WB 3M32A 3D0IE 1GTHA 1RT7B 5LXYA 3DFEA 2OP5A 2WVBA 5I42A 4CI0B 4YHHF 2JLFA 3GPAA 2HS4A 2DIVA 4B9TA 3CO9A 1NHVA 2KFNA 1IKXB 1GAOA 2ALZA 3JAMY 1KTQA 4OQJA 1W25A 2C2KB 3MM6B 4QIVA 4RPFA 3FDSA 3LP1B 3OR1B 1DARA 2FVCA 3OVBA 3MM5A 1YG0A 2DCUB 1UJ4A 5A0YB 2IRUA 3NS5A 3CD7A 2DNRA 2IRXA 3SCKE 1LW2A 1QM9A 2UP1A 4FNIA 1HQUB 2FVRA 3D9BA 4OI2A 2F1FA 3QGHA 1KN6A 1BQMA 2PMWA 1SIZA 3Q23A 3HVAA 4NZ6A 1JJHA 1HBOA 3GIJA 2C3PA 4BBYA 2ILZA 4CQ1A 4P71A 1Q81T 2PIIA 5G4DA 4OV1A 1X8DA 4M5MA 1WHVA 5IS2A 1YJRA 2P6TA 3KG1A 3FRYA 1ZTWA 3PM9A 1U4BA 1H2TZ 1VQPS 5CYQB 2HFZA 1IKYB 1RQ0A 4Q5VA 4B3RF 1RAJA 4LF4J 1GMWD 4F02A 2BJDA 1CPZA 3CCTA 2BKPA 1BWVA 1YBTA 1UEVA 1NZ8A 2AJ2A 3N79A 4ZP9A 1WI6A 3SV4A 1D8ZA 4O44A 2V68A 2R8HA 5B08A 3H5SA 2XNQA 2R2UA 1Q78A 1HNWJ 1IBCB 3LWLA 4YQWA 2HRYA 5AE1A 2HK3A 2XCAA 3FSXA 3M8QA 3LP0A 1X4GA 2HYIB 3Q22A 4Q8EA 3ILOA 3CT9A 4KBIA 3ZO7A 1LNQA 1NDLA 3OJUA 2CQ2A 3PJWA 4U95A 3KUEA 2CG4A 4ZVUB 2IAJA 4LT6A 2JJ4D 2F3JA 3U27A 3DYAB 1HNZJ 3PO4A 4OX9J 1Q8LA 2BMBA 2Y3YA 1MWZA 3ULHA 3JAMU 4JOUA 2DNKA 1QDUB 3FJ2A 1ZS6A 2WVEA 2KHDA 2LKZA 5CZVA 5THWA 4OZ3A 3ZTSA 3TI0A 3BSCA 3QIPB 1FDAA 5KFJA 4DV5J 2AEJA 1UTAA 1WC4A 4AQYJ 5KFKA 2OI2A 3QYYA 3KLHB 3HHLA 1FK9B 3OFEA 2ZUGA 5J1EA 2E5GA 4R8UB 1Q1KA 2ZM6J 4RU2A 1GXTA 4JI1J 1Q8BA 3Q8VA 8ATCB 2J0QD 1NJXA 2FY8A 5CCLA 4CH0S 4DR6F 2V8VA 5ETKA 1M90T 2LQBA 3D6HB 2NPIA 4H4MA 4C98A 1S0MA 1RT1A 2RILA 4L76A 5HVGA 3NBPB 3D7SB 2VOOA 1AA1B 1YK9A 2F8MA 1Y11A 1S4FA 3DLGA 5HMXA 3W8GA 2HQCA 2K1RA 4K4XA 2R7QA 1SV5B 4A8MP 2FQQB 2P2CB 4NL5A 1HR0J 3RW6A 3R5CA 3L09A 4C0BA 1F0XA 3CDBA 1HNIA 1U7LA 3MM7A 3GV7B 5HVHA 2LQ9A 3BKUA 1BWEA 3FC9A 2QLBB 2MJNA 2CVEA 2AYEA 1JXVA 1UW4A 3KKFA 3T9ZA 3VTIA 4GO5X 2NUHA 5F41A 2A2DA 2GHPA 2GA7A 1PO6A 4X62F 1UPMB 2OD6A 3SIPB 2F7VA 1KVIA 4DR3F 3F41A 3IGVA 1KS2A 4ZVOB 2W7OA 3D0GE 2QMWA 1O6XA 3KLIB 3CDUA 1B3TA 4HH1A 1M1GA 3OVSA 2NXEA 2HIYA 3DLLQ 5I3UA 5HP1B 2A0FB 4X65J 3KHHA 4B3OB 3NS7B 3FVYA 1PG5B 4C3KA 3LPYA 2FC9A 3KYLA 1QJHA 4A8WA 1Y0HA 3Q8YA 5C2CA 1TMMA 2F4VF 3BF4A 3KMSA 1RHRB 1PIEA 3NWGA 2CZVC 3LAMA 2AYMA 2B3TB 3BGFA 4ES2A 3GIKA 4DL2A 4RW7B 1M0SA 4USWA 4O3QA 3CF5Q 4F67A 2N3LA 1XN9A 1TUGB 2X7IA 3MMJA 3DXBA 2FJVA 5IM0A 1QUPA 4I67A 3N6LA 2YXLA 2PGCA 2A18A 2CPIA 1NKBA 3T1HJ 1N5YB 1U1QA 2KVQE 2HVZA 2DGQA 3LAKA 3P5BP 1RYSA 4UOFA 4P10A 2ZBPA 5HJXA 1JLBA 3DXSX 2MKIA 5KAKA 2FZKB 2N3OA 3DGPA 2Y1JA 1EQ0A 3CGIA 3FQLA 3WHIA 2YKAA 2U2FA 4TYBA 3TJ8A 3W64A 3WX8A 2V63A 5ETRA 3MF5A 3KK1B 1IR1A 2JHEA 4YHHJ 2LQ5A 1N54B 1WEYA 4BS2A 3TA2A 1RTIA 3ITHB 4C6AA 3RZAA 3LALA 1MROA 4QCLA 1OIAA 5C2GA 4KH1B 5F0UA 1UW9A 3S7RA 5I3QA 2K8GA 3KLVA 1WKJA 1WI8A 3NKYA 5IQ6A 2XCPA 1S59A 3LGNA 1T0TV 5AXKA 4U7UD 4DUTA 1EARA 2PA8D 2Z2YB 3B6BA 1UPPA 4F4ZA 3NLCA 3G4SS 3KUGA 4C2MA 3GCXP 2YNIB 4JB8B 4CO5A 4OZNA 2IRYA 5A6WA 3ET6A 3AQOA 4Q2MA 2GQCA 2J6TA 3SCLE 3T5HA 2C2EA 4YDXA 3GWCA 2I38A 2X3GA 1IJEB 1DQ9A 2EG1A 3TQEA 3QZ8A 4ANEA 2YNFA 4CM0A 2MLYA 1OMSA 3EZ5A 4F8RA 4UTGA 3GYNA 3GR1A 2DH7A 4Q0BA 4F2RA 3OL7A 1RTDB 2C28A 1D09B 2HFNA 5AXMA 4B3RJ 2Y1IA 3TVYA 2V94A 1VR6A 1XBWA 1ITPA 1VRUB 1TVRB 4P2FA 3OVAA 2WB1D 5LSRA 1V6HA 5AXNA 2C2RA 4KV8A 3H20A 4OL8A 4TY8A 1FHTA 1SI9A 4C8YA 2KHCA 1VI7A 1NAQA 4RNFA 1A6LA 3M6UA 3PO5A 4J5OA 1CJKA 3M2VA 4OX6A 1URRA 2FJWA 4LUBA 2W2OP 4ED3A 5IXUA 3UO0A 5ETNA 2UUAF 2LDYA 2R8KA 4RW9B 4HTJA 2EFVA 2DD8S 4PAAA 2UV8A 4TXSA 1FO1A 1TQLA 3D1HA 2RMLA 1RU1A 1SIWB 5SZTA 1KFSA 3HHLC 3IWNC 2YKMB 5KG7A 2YPYA 2KN4A 4NCBA 3TO8A 3BDEA 3BO4A 1T3OA 1ZZFA 3OR2A 3GYGA 3MMAB 4ZCIA 2XWXA 3C19A 1SQFA 4PKDB 2HNZA 4CDIA 1G4CA 2NXUA 1P9QC 2X1GA 4JI5F 1GEHA 1KBRA 2C3MA 1KQGB 4OYXA 3GMGA 5D0HA 1VQSA 1D0EA 1JLCA 3D4JA 5A76A 4HHHA 1RAHB 3T6BA 3QT8A 1B0VA 3RRGA 2HHHF 2A6MA 5D4LA 1UVJA 2FVSA 3F56A 2L3MA 5K8OA 2BQ3A 1F3VA 5IV4A 1J5OB 1N36F 2W01A 1M1KT 4DR7F 3DRRA 2MGZB 2Q79A 2V0NA 3TWZA 4UZBA 1RWNB 2CJ9A 4ZDNA 3FSYA 2XMWA 5KG5A 1N5VA 3ELHA 1S6OA 4BWMA 4EBCA 3DOKA 1NDCA 4LSLB 4CLPA 3RAXA 2UZAA 3PY8A 1N4LA 4ZPBA 5B0AA 1RT6B 3CJ3A 2KZZA 4ERDA 2R7SA 2ZVIA 2G9OA 4HHJA 3D6TB 3BDPA 2VDHA 3NRBA 3R27A 2MKHA 1IJFB 2MKSA 1JB0C 2ZKTA 1MN9A 2K06A 4NLTA 1HYSA 4F7VA 2DHSA 1S6PB 4WFNQ 2YKNB 3DRYA 2BOPA 3D2WA 3R5JB 2VH7A 1NCLA 3PKMA 2QA1A 1UP1A 3PX6A 4HACB 1TP7A 3B4MA 3ETMA 4ECUA 4Y0FA 3ILIA 2AGQA 2I9SA 5G0RA 1X5TA 1VFJA 2R8GA 1LWXA 1FVSA 4FDFA 3L4BC 4USIA 1JLFB 4ILRA 4ZPVR 3HLUA 2GMLA 3TQ1A 1RTHA 1T9TA 1F1BB 3KWMA 2RS8A 3MHYA 4Q45A 2V4RA 3GV5B 1HHQA 3W9IA 3ILLA 2W4DA 4F04B 1TL4A 2DY1A 4KIAA 2GQQA 2V6AA 4KSEB 4YB5A 3MECA 4DR3J 4ILMA 2HBZB 4J9PA 2GJ2A 3KXDA 1X9SA 4LF1A 1VC5A 4RR5A 2CJXB 1TL1A 5EX0A 3W66A 2FJXA 4F4KA 2FUG9 2MDAA 1T8EA 4LSNB 4KHPJ 2ATCB 2ZE2A 2ZH1A 5KFLA 1S6QB 1KP6A 1DQ8A 5C25B 3PYGA 4ED0A 1CBKA 1AFIA 2MHNA 4W92B 1IKWA 4E2FB 3E51A 1S1UB 3BO2A 2QGFB 1QAYA 4C0OC 4DR4J 1DTQA 4H4OB 4KGKA 2UVRA 3THVA 1PJ5A 3PX4A 2M9KA 3VQSA 3DKDA 1FKOA 3C6TB 3EGZA 2PI5A 3OSNA 2J8AA 2J7KA 4ZLPA 3CJRA 1JK9B 1FA0A 1Z2ZA 5GAGU 1ZYQA 4E0DA 2XMKA 1K1QA 3J80U 1S9EB 3QJLA 1FJ7A 4Y2CA 1BE4A 2UU9J 2FJEB 4LF2A 3CTRA 1B64A 1PKUA 2ZFHA 3SSQA 4DV3J 3DMJA 2W9CA 3ONQA 1H0HB 2YX4A 2HRTA 2R2SA 5IQQA 1REVA 2LA6A 2FHOB 1V9OA 1OQ6A 3PNIA 2FD2A 3SDEA 1TELA 2EKYA 2EK1A 4JI8F 3DC2A 2XWYA 4DS4A 3KNAA 2FLLA 2VFVA 3U1MA 3DGVA 4X4PA 4LF7J 3W61A 2J0XA 2CWKA 4DV2F 1WJ9A 1D1UA 4CLLA 1IN0A 4G6VB 1S1XA 2L41A 3MTJA 2BANB 2EBEA 3W62A 3NAIA 1WC3A 5A8RA 5M2PA 2AJQA 4JI0F 4PWWA 1K44A 3M2UB 1KHVA 3HD1A 3MMBA 1BQXA 2B51A 3MM9B 3S8SA 3VZHA 2POKA 2JVRA 2ZBRA 3GR0A 2GQ2A 3I9ZA 2W9BB 3UWTA 1MU2B 1TMJA 2Q1LA 4KH0B 2E5JA 4DV0J 3P6YC 1BMQB 3V81B 3F44A 3J7ZT 5HK4A 5KTQA 3A4TA 3MMCB 3L7OA 5B0EA 5KT5A 3NGRA 2GJIA 1YKWA 4HYKA 2F65A 3B4DA 3VAHA 1EP4B 4QWAA 3KOAA 3V6HA 2B8QA 1I3OB 5LMUF 2OPSA 4O0NA 3UI3A 5A8WA 2HK2A 3ZZTA 2LXFA 3MM8B 4OYOA 2WVFA 1ZM2A 2GNKA 1VDHA 4EWTA 1NSKL 2J0WA 2PC6A 4MIBA 5B0BA 4ED8A 3MR5A 1HI8A 4ZA1A 3PW5A 1IKXA 1ZBTA 3L95X 4F25A 1RTJB 1WOSA 2VG5B 1R3NA 1X5OA 3OR1A 1T95A 3M4XA 5BXIA 4OI4A 2RAQA 4ZCKA 2AWZA 5DQGA 2HFVA 1HBMA 1T05B 4PXBA 4CM2A 5HQLA 3LGMA 3G6YA 3W3SA 4USTA 2ACYA 4LF6J 3ENQA 2CQ3A 1H7XA 1FT8A 2HVHA 2E7WA 2WONB 3K2YA 4AFFA 1LK7A 4L74A 4M94A 4J37A 1AXQA 2HNYB 1HQUA 1RCXB 3TAMB 2MZJA 3Q8UA 3M6WA 1ZOTA 2HLTA 1ZM3A 4V19J 2C2OB 3VGTA 2HLUA 1PYTA 3GZ7A 3IS9A 3GSIA 4RNMA 1C1BA 3E2EA 4USMA 1NEEA 1RE1B 2RU9A 4CIOA 5A2QY 1AB8A 2HHHJ 5KFYA 2JC0A 5GAGI 3T5KA 2QA2A 1CJTB 4OHWA 1X9MA 4IH7A 2E66A 3UDLA 1RKIA 3FZ2A 3SSSA 1N36J 2MKYA 4RKUC 2E44A 2DEJA 2QYGA 3BYPA 2BKOA 4BCAA 4G3IA 2IVMA 1SUQB 2GO8A 3G82B 4EYHB 1SJ1A 2DGWA 5K14A 1YBAA 2IBOA 2PD1A 1NMEB 2DH8A 1KQSR 4FYWB 5DG7A 2FVQA 2HQFA 2HVDA 4EFAC 4KJIA 5D0GA 4RX6A 1HWIA 3EVOA 5JVHQ 3AJ2A 1QSYA 3QWPA 5KFQA 3TZZA 1ZAVA 2FHJD 3HZEA 1JKHB 1VRQC 4PABA 4HR2A 2HEKA 3UFCX 1QY7A 2YVSA 2HHUA 4WCEQ 3IR5B 4K59A 5DLGA 4DF8A 1AZSA 2RU3A 4DXLA 2A10A 4PEOA 3DDIA 5KFRA 3G86A 3J81j 2DISA 3NG8A 3I96A 5JUMA 2Q43A 2YKOA 4QR0A 3QAUA 4FPIA 3EX7B 1TZ0A 4ENOA 3BH7B 2LEBA 3MTKA 2CPZA 4M5HA 1F9HA 3HO1A 4CTAA 4D3GA 4WWSA 1NU4A 1S7IA 2ZD1A 5D4OA 3SQGB 3U1NA 4NWBA 5AT1B 1S9GA 2HNDB 4QW9A 2M7SA 3UD4P 2AX1A 3HSZA 4A8OA 2YX7A 3CVKA 2ZKUA 4OJ3A 2DR7A 1DLOB 4LF8F 1BD6A 3CD0A 1UL3A 2BA9A 4NLVA 3MURP 3CCQS 2GMJA 1SXLA 3BQ0A 2UXDJ 7FDRA 4NEZA 4G1PA 1YJ7A 2HRUA 2Z8QA 2N7YA 4R8UA 3N9UC 3NGDA 1FI4A 3CMES 2HVEA 4TLQA 4DSLA 3T1AA 4F4YA 1UVMA 2LFVA 1GT8A 2CNLB 1YRXA 2W9AA 2V2KA 2DT9A 4NLGA 3MEKA 3PG9A 1WUUA 2FVPA 3TR5A 1IXKA 3BV8A 4ES3A 4OHXA 3DRSB 3M30B 5F8GA 2QX0A 1HQEA 4KKOB 4M1KA 3ZNUA 2Y8YA 2UXCF 1JNZB 3RB0A 2V9WA 2Z30B 1RTZA 4ER8A 1VCTA 1QLNA 2GVDB 2GFFA 3AQPA 3EGVA 3M05A 2C22A 2BZ2A 1VBZA 5F8MA 1RT4B 1GNKA 3CCES 1DHMA 3BB5A 4FXWA 3E8OA 3HP6A 4LFCJ 2LA4A 1TK0A 1VIXA 1SJFA 2QT7A 1U1KA 3D0HE 4Z37A 1OJ4A 4DL7A 2QSWA 3DU5A 1UKUA 1S9FA 1Y00A 2CQ1A 3Q8PB 3FBCA 4CLYA 2VV5A 4AE5A 5BYRA 5E7OB 1PYOB 3T1YJ 2W24A 3KHRA 3IM9A 4IOBA 4BHQA 1S79A 3KLIA 3H5UA 4PG8A 4WFZA 2BBEA 1VHFA 2CJYB 2XO6A 3K5OA 3WIUA 3IR6B 4B3OA 4ZPAA 2XGQA 1APSA 3GJRB 3AOAA 1M5VC 4A8YA 2HQ3A 1AFJA 4L3NA 1KRPA 3DM2B 2HQGA 1V5IB 2VBXA 4LRBA 4B9SA 3TVZA 4DV1F 1S0NA 2ZH7A 1E6VA 1F5BA 4UZCA 5J2PB 4LR7A 2COLA 3OTCA 4G65A 1CEZA 2RT3A 2OMOA 5J2MA 2B7CB 4IG3B 2AD9A 2D3OR 4I2QB 4YMEA 3QAEA 4KO0A 4QWCA 4UW2A 2QTWA 1ZETA 4HT5A 4YR0A 3E01A 2RRBA 4AXJA 2GHWA 4P75A 1SJ4P 3V6KA 3NWRA 5KG1A 4O3OA 5KFXA 2FY1A 3DNCA 1H2UX 4J90A 1ZA2B 3C6UB 4PWUA 5HAOA 4KT0C 1L3UA 2B9YA 4WBFA 4NYPA 4NRTA 3K8VA 1FRMA 2ZH5A 2WZ1A 4KAIA 1FRJA 1LWCB 3KK1A 3TAQA 4WFBQ 2CA9A 4DFJA 2ZDPA 2OFHX 1Q82T 2OTLS 1B0PA 3QLHB 1SC4B 9ATCB 4PXEA 4R5PB 2BW2A 2BABA 3IAS9 4DUYJ 2V69A 3U1LA 2QLJB 4DL4A 5CYMA 4JYAJ 3FEYB 1VJQA 1RT2B 3M8YA 5LL6d 2H9ZA 1X4HA 1ZZNA 3R7BB 1YLXA 2B4UA 2H54B 2VPYB 2NYHA 3PEHA 5HJYA 3BGRB 1S1VA 3OLBA 3OTDA 3OHBA 1TU0B 1U6ZA 4EU0A 2G2YA 2YQ3A 3M8WA 1HW8A 4WF9Q 2KT2A 4EUVA 3H2VE 1W26A 3OQ2A 1JQGA 1R43A 4M5NA 4HH0A 1XMQJ 4GVBB 5DLFA 3D1QA 1A9NB 3MEDB 3N5FA 3R7NB 1U1PA 1SJQA 5E3AA 4DZ6A 4MK9A 1N56A 3D3BJ 2B4VA 2WTFA 3FCVA 4TLRA 1TKXB 1W2BR 2HHXA 1ZPWX 4A8KA 4LREA 3PFOA 4UOHA 1Y9OA 3A3NB 2QIFA 3RB3A 4WKYA 5DDOC 3THPA 5BYSA 4RLEA 1N8RT 2H65B 2C2NA 1O5JA 3LW5C 4NEYA 5GAHU 4I56A 2VFSA 2GAHC 4OZ5A 4YUDA 2XMVA 3NAHA 3OXFA 3H4DA 4K4WA 3QFWA 4FZVA 2WOMA 4Y00A 4CWBA 4NZ7A 1FXRA 3UR0A 1RGVA 5L8RC 1U6BA 3FBFA 3PW0A 3FKBA 2I2YA 4KRWA 2JEJA 4U7CA 2VA2A 3Q8SB 3QQCD 4GKJF 3LPEA 3D28A 4YY3F 2E1RA 1D9AA 3OPKA 5IT4A 4G1QB 4ETXA 2DGSA 2V4JA 2IVYA 3W2WA 3UW1A 3K5LA 1YITS 3PACA 2HWIA 4B9MA 4QZVB 2DIUA 5ITHA 2UUBJ 3U02A 4JI2J 1M5HA 1FWLA 1KEKA 5L1KA 1PAUB 2RSQA 2J0SD 2R4FA 2I5JB 2YKMA 2JEIA 3PX0A 4ZPWR 1ELOA 4O3RA 3GP9A 1KLMA 1WEZA 3DI6A 4NI2A 2ZZTA 4PYDA 1O8BA 4CLFA 2HQIA 5E5NA 1N33F 1RWMB 2XLJA 4DWIA 3AB4B 2J6SA 3ZZOA 4Y2IA 1Y5NB 1S76D 3GSDA 2FC8A 2J6UA 4YR2A 3LP2A 1QUVA 1S1WB 1YTYA 2BQUA 2E1CA 1X4EA 4B08A 4LF8J 3CCLS 2R42A 1O0PA 3EDQB 1J5OA 1AUDA 1FRXA 2M2BA 1N32J 3HDSA 2MGZA 1NK0A 1R8HA 4OYAA 1VQ4S 1WC0A 1X5SA 5CAAA 1KFDA 1NSPA 1S12A 5L1JA 3LQVA 4RW6A 3C46A 4CT9A 2IFXA 4NXMF 1K47A 1B70B 2YWWA 2HMIA 2VL1A 4PPZA 1N34J 1RA6A 3CJ5A 3BPDA 2DR8A 3Q89A 4WYWA 4YB6A 2JZ5A 4ZPCA 2UVUA 1RWOB 4LBIA 1PGZA 1FRLA 5KOWA 4ANCA 3ZZ0A 4DOZA 3I56S 2XYGB 1RHJB 4LVNP 4HACA 3MEGB 3FZBA 2DRDA 2GVZB 1QAJA 3G96A 3M9OB 4B9NA 2AYGA 2IC3B 1QVGR 1JLEA 4OZ0A 4BWJA 2V34A 1W2IA 4YEAA 1YI2S 1JLFA 2CRLA 5KFZA 1ZM4A 3PW2A 1VBYA 3PDNA 3MPUB 3EPIA 4NASA 2CQDA 4GC6A 2K7KA 5LJ3Y 5D0EA 1KR4A 1CVJA 4QIGA 1JXEA 1UWAA 2D41A 3V5RA 4WKRA 1D9FA 2K3KA 4M5DB 1SVDA 2AZ3A 4IO9Q 3QGPA 3I82A 1V3ZA 2RHSB 1RABB 1Q86T 1JJ4A 1TKTB 1HNVB 4FBTA 1R0AA 5B7WA 1Q7YT 5LSLA 3CJ2A 1FNOA 3PVXA 4FF4A 5L9XA 2XSJA 3HMJG 4Q2LA 4X66F 3KG4A 2HW3A 4LSNA 2CJAA 1TAUA 5IC6B 1S6QA 2MKCA 2Z56B 4ZCLA 5GAHI 3C15A 5E33A 3VR1A 4AXIA 4WFXA 3HULA 4DV1J 1K0VA 5E3PA 4H4OA 3N4WA 4CNYA 3M1VB 1ZM9A 1UAWA 4LRCA 4HTIA 5C24B 4J9MA 3G6VA 2RQCA 3S1TA 4LSZB 2V8HA 2EFOA 1OWXA 4A8QA 1C0UA 1NPPA 1CQNA 1CJUA 1RI7A 3UNYA 2RRAA 1J5EJ 4PQUA 4ICLB 3ZTQA 2D69A 3PRVA 4WXWA 5FDLA 1XC9A 3Q2TC 1KKHA 5KFIA 1RHUB 1JWWA 2MSTA 2BDPA 1L3SA 5I3PA 2AV5A 2A6OA 2LU1A 1RAIB 1SBRA 4KFBB 3H59A 2WVDA 1D3WA 3WC2A 2UXBJ 2HFOA 2E9RX 4OMFG 2XMJA 2EFQA 3CJKB 2LLZA 1HIYA 1N48A 3BQ2A 5BYQA 2RF2B 2QZ8A 1Z1ZA 2FZGB 2ZH9A 1QAXA 2QO3A 2BRLA 3OL8A 4X4RA 4L72B 3D68A 2BANA 5C7PA 1EETB 4M8LA 3MZIA 3US5A 1LWEB 1KSPA 5GVQA 2VB6A 3MPDA 3CJTA 4QYRA 3I4HX 5D6GA 3R6GB 4ZCMA 5CABA 3CCJS 3MUVP 1HA1A 1RWUA 1CQMA 3G8SA 3MCNA 4ECTA 1RLCL 4PXCA 5K8PA 5A8KA 4WZMA 2KM8B 1NJWA 3FK4A 1S0OA 2GIFA 3KJQB 2W9BA 2DNPA 2WRMA 5KOXA 3K89A 2DNHA 4XPCA 2D9OA 3V81A 4EO8A 1C4CA 3IGNA 2N4CA 3BBFA 1URNA 3KHGA 4CYUB 2IJFA 1R6YA 3MPWA 3R5BA 2BKNA 3ZXWA 2W8LA 3UVJB 3IRXB 1LV5A 1IWAA 4AL5A 1XJWB 2FLNA 1T9UA 2MPUA 4OX8A 1WC5A 4NOHA 3HJFA 1YJWS 3V6JA 3AA8A 4OHVA 5HROA 2CQIA 1YWXA 1RAFB 3AD7C 3R6LB 1GK8A 1C0TB 2VG5A 1WC6A 2Q3PA 4RBUA 4YY3J 4IUFA 1DTTB 2HBRB 5C42B 2RHQB 1VQLS 2DGTA 4X4UA 1ULRA 1SKRA 1EAYC 3POTA 4OHYA 2PT0A 5EHHA 1T05A 5IT9Y 1XNRJ 1U1MA 2HPUA 4QIWD 1X4DA 1Y10A 3W65A 2LYVA 5AXLA 4UQTA 1FKAF 3W5ZA 3VF0B 4DV6J 1JJCB 1TKZB 4K4YA 1S10A 3VVTA 5KT7A 3TX0A 2QA4G 1N33J 3KJFB 2DBBA 2KZMA 2C3OA 4DCOB 1JIHA 5GADU 2BYCA 3R3TA 4C8ZA 2VDIA 4ZVQB 2W4PA 3TUJC 1Q53A 1JLQB 1WOOA 3FQKA 4NLSA 2PN6A 1P27B 1RP5A 3R7SB 1KDNA 4P2SA 4EK2A 3UDCA 4ZVSB 4WP9A 3EPGA 2UUWA 3AY0A 3N6NA 2CNOB 3ISZA 3CC4S 4C7QA 1FRKA 1KVJA 1SH0A 2LCWA 5B0FA 4N56A 4WPAA 2PDAA 2XY5A 1UMJA 1E6YA 4F0MA 2DXDA 3N0VA 1MNEA 3HHDA 2ZJQQ 3HI9A 5HMZA 1Q8KA 4F2SA 3JXOA 4F3QA 2EPIA 2YX1A 3UDVA 2MKKA 2YKPA 3QJJA 4LVOP 1NKEA 4NXMJ 4RU9A 3SV3A 2NSBA 4OX7A 4LFBF 4ZJLA 1UVIA 4DR1J 5H9FJ 1JKHA 3HVTB 2IA0A 2R2RA 4TQSA 2B56A 4P7VA 3I0RA 3K17A 4RNHA 2P9GA 4N7TA 3MOZA 1NK8A 4J7CA 1R89A 4IFYA 1IBKF 1YJTA 1SKUB 1H74A 2HFSA 2SXLA 2EFNA 3LANA 4XTTA 2EBGA 4Q43A 2CUYA 2FLOA 3QSIA 3NMRA 4X2BA 1SL0A 2ACMA 2IHR1 3FFIA 2VBWA 2FHMA 3GTYX 1OO0B 1WKLA 1DLOA 3KTQA 3PCOB 1WTBA 4R0EA 1MN7A 1U0SA 2IIHA 4NPOA 2PEHA 2C2MB 2K7JA 5IT9U 2ASDA 2ILYA 5AJ3F 1TFYA 3P5TL 3KNGA 4RJVA 2R7WA 4JV5J 1NJZA 2XULA 1CG2A 1P9YA 2VOPA 3W60A 4A46A 1B7YB 4DFKA 1ICEB 4X66J 4ZP7A 4B17A 2PSZA 1LW2B 3T19A 4QPTA 3FBEA 2DNGA 5CCMA 4U8VA 3G9CA 3TJ9A 5T7LA 1U8SA 3SMZA 1VISA 2GGPA 3OLAA 1EHWA 4HT7A 2W4CA 2WK4A 2NR0A 1NDKA 3M30A 2EFPA 4FYXB 4KKOA 1ZPVA 1RADB 3C14A 4DX8H 4ZJOA 1FESA 1UZDA 2ABYA 4KR0B 3ZFVA 2GVDA 2OPQB 2FHKA 3W9HA 4USJC 3JQJA 1VQKS 2H5JB 1RT4A 2ZH2A 2XI2A 4JP8A 5J1PA 3EUNA 2V2ZA 4LBHA 2G4BA 2IJRA 3AAWB 3G71S 3D6FB 4K4ZA 2EXUA 1ZAWA 1MWYA 4O44B 2DTJA 4ELVA 2MQLA 2G0IA 2R7TA 2D1CA 3OFFA 1IQTA 2DPJA 3OSPA 3M8QB 1VQ7S 3KHLA 3LP0B 4DZDA 3BN4A 5GADI 2ZH4A 1CC7A 2E1AA 4C48A 2OGUA 1YX2A 2Z2MA 3C66A 4KTQA 2HQDA 3DCAA 2XS5A 3AXKA 2IAJB 4WIIA 1HLWA 2KT3A 3MXHP 5B09A 1FJEB 2ZOMA 3CIZA 3X3UA 4FYDA 3K5MA 2B5JA 4IDKB 1MMNA 2QLFB 5KFTA 5J2PA 3TP2A 3SI8A 2FJBB 1FF2A 1JNRB 2HBYB 3V4IA 2EVZA 5J2QA 3H42A 3FRZA 3K59A 4I2QA 1X5PA 4K0KF 4PUOA 2W7AA 3K57A 4UUWA 1WSRA 3Q8QB 3PYDA 2EC0A 3EVWA 1GMUA 2OTJS 1J2VA 4QR1A 5KFOA 3O44A 4M63A 2VU5A 4WTYA 2Q6CA 1QSLA 2JFDA 1AT1B 2Y8WA 1NK5A 1XMBA 2DR9A 3VGVA 3CJQA 3C6UA 4JV2A 3M8PA 4IQXA 1HBNA 1S49A 1U24A 4EI2A 2ASYA 4HLBA 4H4MB 3GFZA 1VRTA 4OYPA 2VHGA 2AU0A 4QWDA 1RT1B 1NO8A 2QN6B 2BVZA 1O51A 2X3DA 1KNZA 4DQPA 3BS9A 3KJNB 2H5EA 4L75A 5DG9A 1AW0A 4DSFA 2VASA 2K1RB 4K4TA 4OJGA 1IKVA 5FLXY 2BXJA 3BBBA 2F40A 4MAKA 4J9LA 4CO3A 1HNIB 2HFUA 3HM9A 1C1CA 4OYWA 2K2PA 3N28A 3CUNA 1NPKA 3I31A 4X64J 4DPUA 3CNQP 4J9NA 1U1LA 3R2DJ 3BGRA 4GVLA 4HDHA 2L9WA 5F8LA 3OT9A 7AT1B 3AD9C 3GIRA 4URQU 3PHEA 1N0UA 4RWWA 1R0BG 3MPVA 1BY9A 2HGMA 3V6DA 2VG7A 2F9JA 1XNQF 4OLPA 4M95A 4USHA 4EYIB 2ZJRQ 3PRDA 3ENAA 4DSJA 1HI1A 1T9YA 1NKCA 4B3TF 2KKHA 3P3DA 3FCWA 1TKXA 1CJVA 2MJUA 1TL3B 2H1YA 4L6V3 2WVCA 5DGBA 2E7XA 2W2QP 2OUGA 2WW4A 2P6SA 4TU8A 2AGOA 3IP0A 2VD3A 3CC7S 5F8HA 4ZHRA 1KONA 2NLWA 3AODA 3EZOA 4ZIWA 1UJ5A 1N6QA 4DHVA 2J9EA 3H0PA 4M5JA 5KFEA 2XS2A 3BSAA 2DPIA 3C16A 4B3MF 2GW8A 1R31A 4Y28C 2RQ4A 1F5CA 4P9SA 1FNMA 3ENWA 4H4KC 5AE3A 1PJ7A 1OPZA 3SXLA 3BGOP 4DUZF 2KYZA 4BLGA 4WU2A 3TEHB 4G1QA 5KG3A 3PTWA 3OXGA 5IM0B 2VJVA 1DRZA 4P52A 2UUCF 4PG4A 1RT3A 3BM7A 3DOLB 3BYRA 2HSEB 1S4EA 4PZVA 2YWFA 2B6AA 2GX8A 3QO9B 4WIQA 1VIOA 2I5JA 2VG6A 3QFHA 3WC0A 1V5VA 2C3UA 1K9MT 3DGPB 4MKBA 4I69A 2N7CA 2VPXB 1XR5A 2QL9B 2VPZB 2RH3A 3KLEA 5H1SV 1N52B 3KJVB 4RUHA 2H48B 1Y4ZB 5FLXU 1H98A 1RTIB 1EJ7L 4I4BA 2BQRA 1IM4A 2PFDA 1MROB 3QT7A 2EK6A 3CE8A 4CLSA 1RDRA 3CMQA 2F4FA 4TY9A 2DKOB 2B4PA 4TKTA 2DJWA 3PRBA 2IA6A 3AXMA 3H2UB 1NJIT 1QD1A 1YIJS 1YJUA 4DL0C 4CP5A 5EN1A 3D66A 1FTRA 3O3LA 2OO4A 4O4RA 3QT5A 1NXIA 1FJGJ 1I94F 2CPHA 3CCRS 1Y3KA 4CLKA 4I2PA 4M5IA 3QGIA 5F9NA 4DCPB 4LMZA 3ISNC 4DV7F 4I68A 2IDEA 3GJTB 3I87A 5DZ6A 2XYHB 2KXNB 3ADAC 3EWGA 2XZDB 1IQZA 2G0JA 5H9FK 4PG5A 2V8DA 1Q8IA 4GRSA 3AOBA 1JLAA 2VJUA 2YNFB 1U1NA 4IOAQ 2AEMA 3RB4A 3MEGA 4FXDA 1JXLA 2BW7A 5KFGA 2RIJA 2E1MC 4NLPA 3HFKA 3PZPA 3BR8A 6AT1B 3W5YA 2AW0A 4PG7A 5T14A 1K8AT 1NJYA 5RUBA 2DY9A 1I5OB 4HL9A 3P96A 5KFWA 2AJFE 3C3LA 2HIQA 4ITSA 4EZ6A 5D8HB 1K0TA 3KK3B 5ETTA 1SL2A 4KV8B 4C8NA 2WCXA 2E5LF 1BGXT 4KE5A 3OTOF 5DS7A 4WFYA 3TUPA 1HPZB 3IBCB 3M2VB 2ZH6A 2MZTA 3WIVA 3H98A 1FXDA 2OPPB 2Z0GA 2B9EA 2EWHA 3VAIA 3EYZA 2L9NA 4HVZA 1HNVA 1CS4A 1N88A 4WU3A 1VQMS 2IM3A 3TJAA 1TUVA 4DMZA 2KG1A 2BE2A 5L46A 1MWQA 4IFVA 1RWPB 1RUSA 3AJ1A 4QYZK 4UT4A 4P73A 2XNRA 4YP3A 2MEWA 1FKPA 2HNZB 1HMVB 3GYXB 3DOMB 3ICLA 2MMYA 2R2TA 3VWSA 2OJ3A 2J8SA 2AZ1A 3ZZZA 1HFEL 3ZC4A 1U09A 3M1VA 1JLCB 4OFZA 3TUIC 5CYJA 1UFLA 2XHWA 2WB4A 1WG1A 4X84A 2XLIA 5C24A 3M2RA 4TQRA 2DHAA 4MTPA 3QNWB 4ZOSA 3N5BA 4IG0A 2CPEA 3KLGB 4GC7A 3D67A 1I6JA 4NYZA 2CPFA 3D3CJ 2JEGA 2QFIA 2KL8A 4A48A 4KY3A 3J7YU 4CCHA 2WBRA 2EKNA 2LXIA 4DLGA 3DOKB 3KLFA 4M5KA 1HNWF 3HHKA 3HJVA 1VYAA 4EBDA 4YFUA 1RAEB 4FNHA 3MR3A 5ETVA 3V2UC 3F73A 3CDEA 3CD6S 2YNHA 3OTBA 4DR2F 3SFUA 4URGA 2DYAA 2L48A 5B0GA 3AH6A 2G1DA 5D3GA 1TTHB 1EETA 1HNZF 4ZVFA 3IR7B 2ADBA 2LDIA 3DHWC 4K5RA 5HATA 4LRAA 3TEGA 2XG8A 4ILLA 3DN9A 3UCUP 3H5XA 4B9UA 1Z4UA 2O67A 1CSJA 3PIOQ 3FSIA 3NOCA 1RTHB 1TUWA 1RT5A 5DM7Q 2NQPA 3BR9A 3MUTP 1VQ5S 3HFZB 3QGGA 1XNQJ 1U02A 4DV5F 4AQYF 4N41A 2FZCB 2AJ1A 3MECB 3JYTA 3GFHA 4B3TJ 1XQIA 1MMDA 2QSFA 3J80Y 3QSYB 2NXJA 3UDEA 1JJ2R 4ANDA 1F3FA 1TL1B 3HF5A 4FN5A 5KFVA 3NNHA 2ZM6F 1RACB 2OH2A 2QFJA 4HDGA 4C3LA 4DR6J 4C8MA 2YH0A 2QJ3A 4FF3A 3D6MB 4JI6F 4C11A 2FGCA 4CNZA 3OJSA 2CIMA 3FGVA 3UVJA 1XTZA 1L5UA 3M7VA 1HW9A 3TANA 3HHEA 3I4PA 1IKWB 1RHQB 3SZ2A 4JI4F 3CIMA 3M6XA 2NPFA 3EGWB 2E1PA 1S97A 3TARA 1DTQB 1FRHA 4B3MJ 3OV7A 3MD3A 3BSOA 2VQEF 1FE4A 4HKQA 4OJ1A 1UVKA 2DXEA 4DL5A 4RW8A 4J9SA 1HWKA 4DUZJ 3DRPA 4DL3A 4ZN1A 5C42A 1R8CA 4MK8A 4PWDB 1UWBA 3BKTA 2UUCJ 4OHZA 3WZ0A 3RW7A 1VQ9S 1U48A 9RUBA 1OSDA 2NZCA 2LVWA 3EGNA 4X62J 2B0GA 2OPRB 4K5SA 2GC8A 1BHNA 4ZS6A 4USKA 1D8YA 1NNDA 3RBXA 3SDEB 1YZ7A 2CQGA 4W90B 3EVMA 2LQ8A 3KFWX 4QQBA 1BLUA 2GIRA 4LF5F 2V67A 3W2VA 2RS2A 3JSMA 2YNGB 3RR7A 3IM8A 4PQAA 1X4FA 3CDAA 4E98A 2C3YA 2CYYA 5M2RA 3BEGB 2F4VJ 2YWHA 2MHEA 5EGYA 1HBUA 4UF4A 5A8RB 4AT1B 4YOEA 5DO2A 3WDOA 4ECSA 4HI1A 4LBPA 1M5PC 3P8BB 1KQFB 2CPXA 3J7YI 2W2NP 1GFWB 3BBCA 3HHLD 4PR6A 3TA0A 1GTEA 2RE1A 1I94J 4K8RA 3PJXA 4U6PA 4ECVA 4DV7J 1BC6A 1LWFA 2CPJA 4OYMA 3DLEA 4YB7A 2KU7A 1WEXA 3MWBA 2P9EA 5KFDA 1TR0A 3D1OA 3SFGA 5F8IA 2JWNA 2ZEJA 2RRNA 2KYXA 1NHKL 2OPSB 2CKWA 3NGSA 4FBUA 1DAXA 3MAAA 4N8OA 2BM1A 3OFGA 4LIRA 4S0MA 3GG0A 4KPCA 4I0WA 3H2LA 4DS5A 3PR4A 5HLFA 2WSCC 1B4SA 4EZ9A 5LOQA 1D9DA 2PA3A 3QBCA 2CQ0A 1HNXF 2E5LJ 5KT2A 3HSDA 5C5JA 2BJ7A 3OTOJ 2I1RA 2XMAA 2R3VA 3CJSA 4O3SA 5EX3A 2NZ4A 3EM1A 1S57A 4BC7A 2IPOB 2CDQA 3VAGA 2MXYA 1NM2A 2B8PA 3J81Y 1HBMB 2X1BA 3T5LA 3IO1A 3OBIA 4CLZA 2OAUA 3RAMA 4MIAA 3JQKA 1UA0A 4HI2A 4F0KA 4X4SA 4NCGB 1SC3B 2GCFA 4WE1A 1ZA1B 2VODA 3QATA 3H25A 5J2NA 4DPTA 4A47A 4KYZA 4MT1A 2J9DA 5F8NA 2R7RA 1U2RA 1RWWB 1F60B 1DBDA 5HO4A 2BJ8A 3EDRB 4Z7CA 2R9LA 3IS9B 3QPIA 1C1BB 2VKZG 1RT7A 4EEYA 3PEJA 2AGPA 2OPQA 5K20B 3G8TA 3T9NA 3PYFA 3T6JA 2RKIB 1WTFA 1Y5LB 2HZVA 4DU7A 1P6TA 4J9VA 2GIQA 3MM6A 2Y0SD 3X1LB 2H4YB 3LP1A 2J7UA 3EZUA 3R97A 1LFPA 5K14B 1U47A 2GV1A 3AD8C 1RSCA 2UUAJ 5KFPA 4PG6A 5A0YA 4DEZA 3NGUA 1VOMA 2KM8C 1TFWA 1Q0NA 2LEAA 1ROFA 1X7VA 3CCZA 3TAPA 4DR2J 2XY6A 2DK2A 3H4BA 3UD5A 3IFEA 2MZSA 3R5AA 1F9EB 3CULA 5HBMB 2CPDA 1UVNA 1AZSB 4DU8A 3T5JA 1RWXB 3K8WA 2AJ0A 3T3FA 4JI5J 1VLOA 2JLEA 3LOUA 4LQ9A 2A2CA 2DITA 2ZUAA 1PC4A 2H51B 5EWEA 4FS1A 1FWKA 4CTAB 4IDKA 1EIYB 2C2DA 3GONA 2O1PA 6FD1A 2ZD1B 5CD4H 3SSRA 3ZZYA 1S9GB 1LFWA 5KFCA 4ZVHA 2XC9A 3O2IA 4A8SA 2Q66A 5CYQA 1FFGB 1IKYA 1RWVB 1RHMB 4DR7J 1U25A 4F0HA 3J81U 2M88A 1UJ6A 1VLYA 3G2XA 1WWHA 4OI0A 1M1HA 3WBZA 2FJDB 1RAOA 4AL6A 1HWJA 4B02A 1M5KC 1WSVA 2HZAA 2X1AA 3W5XA 2ZBCA 4QWEA 4UOGA 1H6KX 3ZZUA 4JI6J 1R0CB 4NA2A 2VQFF 3NY0A 5CHCB 2BX6A 2CG8A 5E41A 3J7A1 2C1EB 2BV3A 2ROEA 4JI4J 3B78A 3BSNA 4IRKA 3RRHA 1AROP 4WJBA 2DNLA 4WFAQ 1V3SA 4LR8A 1WELA 1VS3A 1SH2A 3IWXA 3MAQA 4OJHA 1HQEB 3DYAA 2VQEJ 2V50A 2XTJP 4ZN3A 4JI3F 2MQOA 4NYOA 5BR8F 3FEZA 1LXJA 1RZMA 1WHYA 2U1AA 4A8XA 1H7WA 1CULB 1TK5A 1HHTP 3TUZC 2VBYA 4USVA 3CW2C 2OFGX 4DPXA 2FGOA 3PYEA 1IVZA 3K0JA 4X4NA 1TL5A 3QIPA 1QSSA 2ZH3A 4MJKA 1I51B 1WF0A 1N5TA 3KLHA 5IT0A 1FK9A 2Z2ZA 3IC1A 1MSWD 1UETA 4B9LA 2ZC4A 3PR5B 1WKKA 2EW9A 4FKYA 1HL6A 2MQQA 1TL3A 2DHHA 1FD8A 4LF5J 4DG1B 2E5IA 4KHPF 2YWGA 1MW7A 3RRKA 1T3NA 4O23A 2FB0A 3T41A 5K8NA 1VGYA 1NB7A 3TOQA 2BJ1A 4ZJQA 3NBPA 3NGKA 4ECRA 2Y0BB 2ALYB 5D78A 1VBXA 4J9QA 4C8KA 5EWFA 3EE3A 4MKAA 3SYZA 4L73A 1U2FA 1RBOB 1UCNA 4DPYA 3H8YA 1T9VA 1NK4A 4DR4F 2CZ9A 1E6VB 4NX9A 3H5YA 2CQPA 2HHVA 1SV5A 5DDPC 4C3MA 5EWGA 3M9MB 4NZ0A 3JS9A 5J2MB 1SPBP 1NSAA 3G87A 4Y2MA 4QR2A 2MLXA 1OS5A 2ZDOA 4U67Q 1RXOB 2DGOA 4KO0B 4DV4F 3DOLA 4CLWA 3E01B 2L08A 4I6YA 2FTRA 2ERRA 3VZIA 4K2JA 2UU9F 3QO9A 2XYPB 2HHSA 4CLTA 2NCKL 2WW8A 3AFGA 5HMWA 3MI7X 4DV3F 3MOJB 4NRUA 2CJBA 2LECA 2E5HA 1TV6B 2MZRA 4JI8J 1HKAA 3A8KA 5F0WA 2EFGA 4OZ1A 1EB0A 2QV6A 2DHGA 1CLFA 3W1YC 2G0CA 4Z7YA 2W1BA 3KJVA 4DV2J 4JV1A 3IBFB 2I6WA 5HP1A 4NLWA 4O0IA 3IAM9 5A6PA 2YQ1A 4LF7F 1B7FA 1HWLA 1HNXJ 2LXUA 3CB4A 2HAFA 5D4PA 4FS2A 2MQPA 1TK8A 4NLOA 1YRUA 4JI0J 1R27B 5CYMB 4TVAB 3CCWA 1G1XA 7FD1A 4OZLA 3CC2S 5ETOA 4KB7A 3UPFA 8AT1B 5EUHA 1FFSB 3EXYA 3F0NA 2Q6BA 5IWAF 4RW7A 1S1VB 1RHKB 2MYFA 2J5AA 2M4MA 2DRBA 4ZLLA 2GO9A 8RUCA 4DSEA 3S6EA 3VQTA 2HGLA 1NH7A 1FDDA 4A8FA 1YJVA 3IG1B 3MUMP 3UN2A 4PPDA 1FFWB 4DV0F 1FVQA 4ZLJA 3CEDA 3CSKA 1N5YA 3FBBA 4TNOA 5DGAA 4DSIA 2P8IA 2XQCA 3QJPA 1GX5A 4A4JA 4N5SA 2BE7D 5LMUJ 4EBEA 4UY85 5D77A 1RLDA 1TL7B 2FHJA 4X4VA 4C97A 1R7IA 4RW4B 1VMBA 4MFBB 4NCAA 3NGTA 1X31C 2G13A 2HURA 3M8SA 4DCJB 2BACA 3ITHA 4ID5B 4RUCA 2WOMB 3E3XA 3AHPA 5E3CA 5E2QA 3KK3A 1UFKA 2BRKA 1U26A 3UQSA 3W7BA 5FIIA 4TU7A 4XAKA 1NDPA 1Q5YA 1HPZA 2P9CA 3OL6A 1LK5A 2OEMA 4J91A 2OPPA 2BE9B 2V4JB 3W2WB 1YJNS 2AMCB 2CQBA 1T9WA 2O66A 1PILA 1S1TB 4IOCQ 2YNIA 4LF6F 1WC1A 1SC1B 3BH6B 4OYIA 3I5CA 1KC8T 2B9WA 1KVKA 2V2VA 2VA3A 5D4NA 5ETPA 3QRQA 1KLMB 3DI6B 4NI2B 3MCMA 1T9XA 2XB2D 3RYLA 3CO0P 1HMVA 3DOMA 5GMKa 3KMQA 2DNNA 1NB2A 5IC4B 1VQNS 3A3OB 2MY8A 2MY7A 5KFUA 1VC0A 3O1LA 2W7PA 3TZXA 4FYYB 2IMWP 1XR7A 1KQKA 3LP2B 2AJ4A 2RVJA 3K5PA 1QTMA 4GMKA 4UY8T 4K4SA 1U8WA 1RTDA 3DRXA 3CWJA 2HBQB 1GH8A 1OYEA 2ZNZA 4QIFA 2KDOA 1VRUA 1TVRA 3KLGA 1C4AA 1DZ5A 1MLAA 1RA7A 4P7TA 3CJ0A 4XPEA 2FPHX 5GMEA 2JVOA 2JEFA 2GJFA 2OEKA 5HSPA 1FE0A 3RU0A 3SEOA 5J1NA 4RW6B 1F5AA 4K7QA 3VHQA 1JLGB 1YVFA 2VICA 1L3TA 2FYXA 2VQFJ 1DFDA 3CXCR 4RW9A 2HMIB 2IYIA 4QJVA 3QMQA 3DHXA 2JX2A 3IBWA 1YDLA 3OUYB 2DGVA 2CNKB 5B0DA 3G6ES 1EX8A 4OZ2A 1Q7LB 1Q79A 1U1RA 2OHDA 2QMUB 4K4UA 3CD5A 3VAKA 3MMAA 2WHOA 1KOOA 4WZQA 4JI3J 3BN7A 1X0PA 1I1GA 2QA4S 2JDJA 3KUHA 2WBMA 1JLEB 4NLDA 1SH3A 3G6XA 5BR8J 2HHQA 3MCOA 3C2PA 3GCWP 2JL9A 2KVIA 1YGYA 2VFUA 1W7WA 4ELUA 3RJMB 2OSQA 1T7PA 4CO0A 1PJ6A 3ILJA 3RGIA 2RUGA 4DX6A 4ATNA 3QRRA 4RBVA 4TU9A 4DN9A 1X4BA 2BEFA 2HWHA 2XSFA 2D74B 1UVLA 1XMOF 1LKZA 1LOUA 2F8EX 4H54A 2UVWA 2V8PA 1L3KA 1PSDA 2UXDF 4PYAA 1SKSA 1RU2A 1L3VA 4EO6A 5B0CA 3UCZP 4LSLA 1R0AB 1H2VZ 4J9UE 2QYCA 1S6UA 1RT6A 3I32A 2XSJB 3R9LA 1OSCA 4IRDA 1OY9A 3TRGA 1G7CB 4GKKF 2PMZD 3IRWP 3NS6A 1LW0B 3IMQJ 3C15B 3I55S 1S6PA 3ZTRA 3MD1A 2YKNA 4ZITA 2LMIA 1NSQA 2RJZA 5JJBA 3U7JA 2UXCJ 2ROGA 3NCRA 4NLXA 4OLOA 4LJMA 1N0VC 4U96A 1WF1A 2XZWA 4OI1A 2DNZA 3BO3A 4HEA9 1BQNB 4NLQA 4OZJA 3J7Z5 3HKZD 1C0UB 4DR5F 4F3OA 4KHRA 3JQMA 4URSA 4MH8A 4PWDA 1CJUB 4DPOA 1YJ9S 2KI2A 4Y6IA 4YN3B 4DSKA 3DLKB 4DV4J 2OLWA 4DX7A 4PQUB 2ZITA 3L7PA 1U1OA 1SQEA 2V8GA 2LU2A 4LF9F 4LFCF 5FDLB 4F36A 4XDCA 1ACMB 4MKVA 5IV3A 2OPRA 3DU6A 3K7RA 3CPWR 3HPOA 4R0JA 4CLUA 6FDRA 1RBAA 2VC0A 2XBPA 1NH8A 2ZJPQ 4Y2KA 3T1YF 3CCSS 1X4AA 4ECYA 5KG0A 3FCHA 3M6VA 3V4MA 5CH7B 3BREA 1MMLA 1VQ6S 3L7UA 2DNYA 5C25A 5BJRA 2YNGA 1HHSA 5DG8A 4FF1A 4ES1A 4F4XA 2HS0A 4DF4A 3GV8B 2CQ4A 2Z4PA 2AEFA 3GJQB 1TKDA 1S1UA 3TZYA 1Y7PA 2IDLA 4ECZA 2CXEA 3PW7A 1F2HA 2ATLA 3D5MA 1U0HB 5IWAJ 3C6TA 2V5HG 4HHUA 4W98A 5DETA 5HMYA 3NNAA 5A8KB 4ED5A 3MFIA 5KFMA 5JVGQ 1MG7A 2OEJA 4FP9A 1S9EA 4RZRA 3AJDA 4X4OA 2PI4A 2HGNA 5K5MA 4ID8A 4Z2XA 2PMHA 3R5DA 4I1TA 1BUXA 2JRSA 2QL5B 3MR7A 2ZHBA 2V4QA 3DLHA 4LFAF 4ED2A 2FDNA 2XZTB 3A8JA 3B82A 1LXNA 4RO0A 5D15A 4X4TA 4J9KA 3R2CJ 1FXLA 1YQHA 2BJEA 3QT6A 3IN5A 4ZKAA 2BM0A 2M8DB 3JTPA 1KWMA 4O4GB 4D3HA 1U2CA 2VFTA 2DXFA 3HX9A 4QWBA 3C8YA 5KT3A 3VAFA 1BXNA 4Q8FA 4KC5A 4DUYF 3I0SB 5HROB 4CRJA 2VFRA 2KB2A 5L38A 1FEHA 2QEXS 2KT5A 4LRDA 1QE1B 3HKWA 3HVRA 5KG6A 2J76E 2LEPA 4JYAF 3M2UA 1ZAXA 3MEEB 2M70A 5HN0A 5LM7E 3LTOA 3MM9A 3DDKA 1IBLF 2KH9A 2CJQA 2DHXA 4L3KA 3POTB 5FD1A 3HT0A 4M5LA 2I0XA 2N4DA 3VGSA 1MU2A 4P2XA 4NCGA 1H72C 1XMQF 1WD6A 4CZCA 1ZH5A 2B43A 2JNJA 3MMCA 3UR3C 2XI3A 4R25A 1J27A 1EP4A 2YKQA 5KFAA 3BZQA 5ETMA 3QRPA 1S48A 4ZLNA 1IUJA 1UA1A 3NNCA 3FMWA 3MGJA 2IM1A 1FCAA 1IR2A 1H73A 1VBKA 3ETOA 4I7FB 3VV2B 2XGPA 3MM8A 1C2PA 2IY5B 1Z2LA 5LJ5Y 2D3ZA 1FDNA 4Q44A 2QRRA 1S72S 2ZBQA 3G8QA 3Q8RB 1IBMF 2R8IA 1FX4A 3UE2A 1RBLA 4ZVEA 2RUSA 1E6YB 5IOLA 2RKIA 4OV6A 2G2ZA 4O3PA 2ZOFA 1RTJA 3R8YA 3SCIE 4XDDA 2G2OA 4DDFA 2VPWB 4GKJJ 2HWTA 3TZWA 2QLWA 2D3UA 1X9WA 1ZTTA 2XMMA 2UVVA 1RB0A 2KG0A 3TYTA 2JSXA 4CO4A 4RL1A 1UFWA 2DH9A 5KT6A 1PAEX 4N47A 4C4WA 2VBZA 3ZTPA 2UUBF 2WONA 4RBTA 3LUYA 3ZTOA 4JI2F 1P1LA 2FIUA 4ZVRB 3I0RB 1WHXA 3UD3P 5HBMA 2HNYA 4ALZA 3K5NA 3TW0A 3ZNJ1 4MKYA 3TAMA 2OSRA 3TVKA 4DLEA 1NK6A 3Q0AA 3AT1B 4CT8A 4C8OA 1VK3A 1K73T 4IFYB 2YY3A 4P6QA 2C2ZB 2H5IB 4C8LA 5IFMA 2XMUA 3AOCA 1T03B 4IR1A 1R8BA 1VQYA 1KTVA 5KFBA 2IBKA 5E0OA 3W8PA 4ZP6A 4ZVGA 3JSBA 3FFIB 2ROPA 1CJTA 3HD2A 5FJ4A 4RWXA 1XIQA 1CC8A 1NUEA 2XLKA 1XMOJ 3UN3A 4K50A 1JX4A 5LXRA 1N32F 4U8YA 3GILA 2F5GA 1SUQA 3K58A 5ETQA 3G82A 3RBZA 2KXFA 4CH7A 2B7BB 1NHUA 1NLKL 2NREA 4GKKJ 4KGXB 2PO4A 3KK2B 4QW8A 2MSSA 2YWEA 4M5GA 3MR2A 5K9FA 2DR6A 1N34F 2A1BA 5F9LA 3H90A 2CNNB 3RR8A 5T7LB 2MZQA 3HHNB 2ASJA 2GGPB 2O5DA 5MAOA 5F3ZA 1S7HA 2HZCA 5A2QU 2PE8A 4B3SF 3M32B 2RB7A 3C14B 2E9TA 4LRFA 4NXNF 1NBEB 5I42B 1P1TA 2AIRB 4DR5J 3SQOP 3EXCX 3UNGC 3SQGA 1SCJB 1LQ9A 2HNDA 1CULA 1T94A 2KO1A 5EDWA 3OXLA 4ED6A 2LP4A 3FMBA 3HSGA 4LF9J 2JOQA 5I4MA 2ASLA 2F63A 4AUKA 2O01C 1IWGA 2QLXA 1Y3JA 2ZNYA 1QVFR 1B0TA 2WSEC 3MCSA 3MM5B 1WHWA 2CJKA 3CJ8A 1B99A 2E7VA 3GU0A 4ECXA 5DQIA 4DG1A 4QYZJ 1KLNA 4N8NA 1S0VA 2EC2A 4QU7A 2Y1RI 5CA5A 1XWLA 1F2GA 1UZHA 3PKYA 1T11A 2M52A 4U9RA 4LQ3A 3VCDA 2Z57B 2XHCA 4DL6A 4FKXA 2KRRA 5H9EJ 2CFXA 2VC1A 1BQMB 1EQMA 2RDIA 4MYUA 3DRSA 1DY3A 1HQ2A 2B5JB 1GQEA 3QIDA 1HBOB 2R7OA 4FF2A 2OMLA 4PRFA 3H7HB 5KT4A 3LA0A 1WDDA 2HVIA 5KFNA 3A13A 4WP3A 4DI6A 1NK7A 4CO1A 3VGUA 3V4IB 3HVWA 5J2QB 2NYIA 4UOCA 4I64A 2VF3A 4ZVTB 4PUOB 5LT5A 2DEIA 1S5ZA 4J9RA 1XERA 4V1Ak 5KFSA 1M5OC 5E3RA 2RQMA 2VIHA 1X0FA 1J5EF 4TN2A 3RB6A 1DJ0A 3RG6A 4KGMA 3RUBL 2RNEA 3KDNA 2XEXA 3SBMA
chains in the Genus database with same CATH topology
2BDPA 2M8HA 4HI2A 2AV5A 5I3PA 4C2MA 4X4SA 1L3SA 2YNIB 4NCGB 2LU1A 1SBRA 2GCFA 4KFBB 4WE1A 4F3MA 3H59A 4ED7A 2VODA 1D3WA 4CO5A 4YDDB 3M8PB 3AA9A 3WC2A 2HFOA 4OZNA 2IRYA 3H25A 5A6WA 4CO2A 1HBNB 4OMFG 2E9RX 1TV6A 2XMJA 5J2NA 3AQOA 4Q2MA 2MQNA 3RTVA 2EFQA 2GQCA 3CJKB 4Y2AA 4A47A 2UXBF 2J9DA 2DRAA 2LLZA 4DN0A 5F8NA 2V9KA 2R7RA 1U2RA 1VRTB 3NCPA 2J6TA 3SCLE 3T5HA 2KFYA 4YDXA 3BQ2A 2C2EA 5BYQA 1N48A 1F60B 3I9V9 3GWCA 2RF2B 2QZ8A 4QPXA 1FTCA 1DBDA 2I38A 4C0HA 2X3GA 1IJEB 1DQ9A 2EG1A 1Z1ZA 3QZ8A 2YNFA 5HO4A 2ZH9A 2EI5A 2ZBIA 3S01A 3EZ5A 3CMAS 1QAXA 1X4CA 2R9LA 3IS9B 2QO3A 3QPIA 4O3NA 1N5QA 2BRLA 1C1BB 4F8RA 3OL8A 4X4RA 4X4QA 2VKZG 2ZHOA 1RT7A 3GYNA 4L72B 2BANA 3GR1A 3DM2A 3A1YG 4EEYA 3HK2A 1EETB 3PEJA 4M8LA 2AGPA 2OPQA 2DH7A 3PW4A 3G8TA 3T9NA 3MZIA 1IKVB 4Q0BA 4F2RA 3OL7A 1RTDB 3US5A 1LWEB 1KSPA 5GVQA 2C28A 2VB6A 2HFNA 5AXMA 3T6JA 2Y1IA 2RKIB 5T41A 4QYRA 5HQ8A 3TVYA 1WTFA 2V94A 5DRKA 1XBWA 1Y5LB 1VRUB 2W25A 3I4HX 1TVRB 5D6GA 4NLUA 1C1CB 3OVAA 2WB1D 4ZCMA 3CCJS 3MUVP 1P6TA 5LSRA 1HA1A 4JI7F 1V6HA 5AXNA 3OL9A 1RWUA 3FEXB 1CQMA 2GIQA 3MM6A 3G8SA 2C2RA 4KV8A 3H20A 3LO3A 4OL8A 3M9NB 4TY8A 1FHTA 4IG3A 1SI9A 2Y0SD 4ECTA 3X1LB 4C8YA 4PXCA 3NCQA 5K8PA 3LP1A 2KHCA 5A8KA 1VI7A 1FNXH 1NAQA 2J7UA 2VZ9A 4RNFA 3EZUA 4WZMA 2KM8B 1NJWA 1S0OA 1A6LA 3M6UA 3PO5A 2HAIA 3DLBA 3BGLA 2DNPA 4J5OA 1LFPA 2W9BA 5K14B 2WRMA 4IH6A 5KOXA 3M2VA 4OX6A 4J9OA 1U47A 1URRA 2GV1A 2P5VA 2FJWA 4LUBA 1OQ3A 3V6DB 4ED3A 2VG7B 2DNHA 5KFPA 3IG1A 5IXUA 4PG6A 4AL7A 4XPCA 5A0YA 2D9OA 1U49A 3HHLB 1VQOS 3V81A 4EO8A 2UUAF 1C4CA 3VALA 2LDYA 2R8KA 4RW9B 3IGNA 4DEZA 3P49B 3MFHA 4HTJA 4WYLA 2EFVA 5J1EB 3RBDA 1VOMA 2DD8S 2KM8C 2N4CA 3H40A 2R8JA 4MYTA 1TFWA 1URNA 3LH2S 3KHGA 2UV8A 2LEAA 4TXSA 2IJFA 3K5NA 1FO1A 1ROFA 1X7VA 2RDJA 3CCZA 1R6YA 3MPWA 3R5BA 2XY6A 3TAPA 1TQLA 3D1HA 2DK2A 3H4BA 2RMLA 2N82B 3IFEA 1SIWB 5SZTA