3E01B

Hiv-rt with non-nucleoside inhibitor annulated pyrazole 2
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
424
structure length
401
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYATNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 108
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3e01B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e01B04
4TLRA 3KLIB 2CJQA 1T05A 4NLRA 4RNMA 4K4XA 3NGDA 5KFDA 2UVRA 1BQMA 4LSLA 1YVFA 2C22A 3KJVA 4NLOA 3QIPA 3IS9A 4Y2AA 3LANA 2EC0A 1SH2A 2WONA 2WONB 1N5YB 2BRKA 3TAMB 4FS1A 1S6PA 2FVCA 5F9LA 3UDLA 3IN5A 4RNOA 1C0TA 1C0TB 1HQEA 3QGIA 1JLFB 2HNYB 1TVRB 4NLUA 3M9MB 3MECA 3MECB 2FJVA 3PW7A 4R0EA 2J6SA 1JLQA 4ED0A 1NHVA 1BQNA 3CJ5A 3KLFA 3JSMB 3G6XA 2IC3B 3LP2A 3IRXA 4KKOB 4KKOA 1LWCA 2UVVA 4PUOA 2R2SA 3UPFA 3OL9A 4IDKA 4IDKB 2JEIA 4H4OA 2FLLA 2W7OA 2OPQA 2OPQB 3IG1B 3H4DA 1XR5A 2VG7A 3ICLA 3QZ8A 3OL7A 4ZPDA 5L1JA 4WZMA 5KFWA 3KMSA 1RT2A 2YNFA 4DL4A 3M8PA 1RYSA 5KFMA 1RT3A 4G1QB 5FDLA 2FVQA 5L1KA 5DQGA 3LAMA 3CO9A 4IRDA 1IKYA 4H4MA 4H4MB 5KFGA 1JLGB 4U7CA 1JLAB 1K1SA 4J9QA 2R8JA 1S1VA 3DI6A 3DI6B 3ISNC 1C2PA 2RDIA 4Q43A 4JV2A 4ED3A 1UWBB 4I2PB 5K14A 5DGAA 4QWAA 4WZQA 2RKIA 2RKIB 3I0RA 1SH0A 3V6DA 5J2QB 5HROA 5KT6A 2UVWA 2R8GA 5KG2A 3VQSA 2W9CA 4NZ0A 4URQU 4QWCA 3CJ0A 2W9CB 2I1RA 5JUMA 3T19A 2C2EA 5I42A 5I42B 3HKWA 1RT1B 2E9RX 3M9OB 4WFYA 4O4RA 4KAIA 1RT5B 2YNHA 2YNHB 4WFZA 3KLHB 3FFIB 2GIQA 1S4FA 4M94A 3T1AA 4ZVGA 4RZRA 4IOBA 5F8GA 5HLFB 4HKQA 4RW4B 2V9WA 3LP0A 3LP0B 1JLEA 4WE1A 4WE1B 4WFXA 3E01A 3E01B 4ZVFA 4ZHRA 4K4ZA 3UQSA 5EDWA 2J6UA 4KV8B 4O44B 4O44A 5D3GB 3BSCA 1TKZB 3MEGA 2VG6B 2JC0A 2OPRB 4URGA 3RB0A 1LWFA 1LWFB 3MR3A 5J2NA 5J2NB 2E9ZA 3T5JA 3M8QB 1RTJA 4KE5A 3GIJA 2V0NA 3DYAA 2VA3A 3MEDA 2B43A 2UUTA 3BQ2A 2RF2A 3G86A 2GIRA 2ZKUA 4KO0B 4FS2A 1RAJA 5EWEA 1JLBB 2BANB 2YKNB 2D7SA 1S1WB 1LW0A 3DMJB 5L9XA 2JLEA 2ALZA 2IM2A 3PHEA 1N56A 4K4UA 5KFQA 4J9MA 4O3OA 1LW2B 3KLEB 4ZPBA 4ZP9A 1TKTA 4RW7B 4IQXA 2BR0A 3PJWA 1TL3B 4Q44A 4RUCA 3V81A 4MH8A 4DL7A 2IAJB 3QGHA 4EYHB 2J6TA 3BSNA 4B3OB 3BGRB 4ZMMA 4ID5B 1FK9A 1FK9B 4ICLA 3NAIA 2AU0A 5J2PB 2XI3A 3PW2A 1S1UB 5KG0A 1T3NA 3HVTB 2ZD1A 1U09A 5C5JA 4G3IA 1JXLA 2XWYA 2AQ4A 3GV7B 3KLGA 3BSAA 5EWFA 5KG6A 3EZUA 1TL1A 1TL1B 1C1CB 2R2UA 4TY8B 4O3SA 4Y3CA 4IFVA 4IFVB 1T05B 2B6AA 5DG9A 4NLTA 4QW8A 3V4IA 3V4IB 2OH2A 1BQMB 4LSLB 4DL2A 3KJVB 5EUHA 1HNVA 1HNVB 3IS9B 3QIPB 3FQLA 4KB7A 2VG5A 3DRPA 3DRPB 5CYQA 4F4XA 3CVKA 5T14A 4EBDA 1S6PB 3H5SA 2IM3A 4O3RA 3T5HA 1HQEB 3LP1A 1RT6A 3SFGA 1JLCA 1Z4UA 2GC8A 4KHRA 2JEFA 4K4VA 5F8MA 3DLKA 3DLKB 4XPCA 2HAIA 1JLQB 3MR2A 3V6JA 2HNDA 2HNDB 1GX5A 3H98A 4J9RA 3DLEA 5KFAA 2AGPA 1BQNB 3IGVA 3KLFB 3LP2B 2B5JA 3IRXB 4TN2A 3N6NA 1RTHA 2HMIA 1LWCB 2HMIB 2E9TA 4PUOB 1SV5A 4R5PA 4H4OB 3TVKA 2QE5A 3NBPA 1D1UA 5JXSA 3H59A 4K4SA 3HVWA 5C25A 2VG7B 3HHKA 1S9FA 4ECRA 3T5KA 3QLHA 3QLHB 3OLAA 2JEGA 1S1XA 3QIDA 1S0OA 1NNDA 4ZP8A 4WXWA 4JV1A 4Q8FA 1RT2B 2YNFB 4O4GA 4O4GB 3PR4A 3M8PB 1DTTA 3E51A 1RT3B 5FDLB 4I7FA 3QGGA 5F8NA 2DPJA 4J9KA 4NLDA 1JKHA 3KHGA 2WTFA 2BRLA 5KFVA 1HYSA 1IKYB 2ZE2A 3DLGA 4ED6A 4NCGA 4NCGB 2IJNA 2OPPA 2OPPB 4ECTA 3H5UA 2AWZA 4NYZA 4XPEA 2WHOA 1S1VB 4YMEA 4YR2A 5K14B 2ASDA 5KT5A 2AGOA 1DTQA 4YQWA 4NLWA 4NLYA 3I0RB 3H5YA 3V6DB 1GX6A 5DQHA 5HROB 3CDUA 2AGQA 4TXSA 4EO8A 4NLSA 4QWBA 3C6TA 3DOKA 3DOKB 5KFHA 3KK1A 4FBTA 4IR1A 4IR9A 3GILA 2ASLA 3BREA 4X2BA 4Q0BA 4Q0BB 3BQ0A 3OHBA 4WXOA 5KFKA 3I5CA 1N4LA 4LQ9A 3MFIA 4ECWA 2XCPA 1QAIA 4LQ3A 3FQKA 1TQLA 1SUQA 1SUQB 4IG0B 4IG0A 4ED7A 3RB6A 2XCAA 1N48A 2IM1A 1JLEB 4ED2A 2D3ZA 1C1BA 1C1BB 1S1TA 4KFBA 5KFEA 4ZHRB 3Q8PB 2BQRA 5KFYA 5HP1A 3RAQA 2ILYA 1DLOA 1DLOB 3I0SA 1TV6A 3I0SB 4ZVHA 1QUVA 5DQIA 1IKWA 1IKWB 3T5LA 1IKVA 3MEGB 4M95A 3CDWA 3H5XA 4IG3A 4IG3B 3ISND 1NHUA 1MU2A 3OSNA 2YNIA 2YNIB 3CJ4A 2WOMA 1S6QA 2YKMB 2YKMA 2C2RA 2WB4A 1RTJB 4LSNA 3DYAB 3MEDB 4WYLA 2RF2B 1EP4A 1RT7A 1ZTTA 2YNGA 3RBEA 4DG1A 4DG1B 1KLMA 1KLMB 1LW0B 4F4YA 3RB4A 3NMAA 1RTIA 3TQ1A 1RDRA 3HVAA 1ZETA 5I3UA 1IKXA 3I5BA 4FBUA 4RW8A 4GC7A 5DLGA 3G6YA 2R8HA 1XR7A 3OL6A 1TKTB 4MK9A 4MKAA 4ECSA 3V81B 1N6QA 1REVA 2FVSA 3LAKA 3KK3A 3KK3B 2JC1A 3MR5A 1QAJA 2W9BA 3KHLA 3QO9A 3QO9B 4ICLB 3FSIA 4O3QA 2JEJA 3PW0A 4MFBA 4F4ZA 4ECVA 1S10A 3CIZA 2ZD1B 3MFHA 4TYAA 5KFJA 3PZPA 2ASJA 4IH5A 4DEZA 5L1LA 3Q8SB 3KLGB 4RNFA 5DG7A 5C42A 4H54A 3JYTA 5C24A 5C24B 4JUZA 3OHAA 4IRCA 4MKBA 5KT4A 4U6PA 1FKPA 3D5MA 1VRTA 4F4WA 5KFCA 3MF5A 4EO6A 2B6AB 4DL3A 3KNAA 4JV0A 1T94A 4KHMA 5KFPA 3H4BA 1S9EA 3OSPA 2VG5B 5J1EA 5J1EB 5CYQB 3MEEA 2O5DA 4YR3A 3DOLA 3DOLB 3RBDA 4R8UA 5KG4A 4R8UB 4RNHA 5EWGA 4MIAA 1HNIA 3H40A 1LWEA 3LP1B 1RT6B 3DRRA 2AX0A 3PR5B 1JLCB 2OPSA 1RTDA 2DPIA 1WNEA 5KT3A 2XGQA 1HQUA 1HQUB 1T03A 3QZ7A 5KFLA 3KLIA 3DLEB 3GV8B 5DLFA 2V4RA 3N6MA 2WCXA 2V4QA 4RUAA 2B5JB 3NAHA 3NKYA 4IH7A 4RW9A 4RW9B 1RA6A 1RTHB 3OL8A 2D3UA 3CDEA 1D0EA 4ED1A 1SV5B 4R5PB 4NLXA 1N5YA 3NL0A 2I5JA 2I5JB 3NBPB 3TAMA 2FJWA 3FDSA 3SFUA 5C25B 5KT7A 1S97A 4ZPCA 1JLFA 2HNYA 5HBMA 1S1XB 5HBMB 3LALA 1TVRA 2BE2A 2BE2B 1EETA 1EETB 2D41A 3IGNA 3DDKA 5KFTA 4YR0A 1RA7A 2W9AA 4DL6A 2QV6A 1DTTB 2R8KA 4J9PA 3EPGA 4J9NA 4I7FB 4XO0A 3FRZA 4O3PA 4QPXA 2FLNA 4URSA 1JKHB 3JSMA 5KG1A 1XR6A 4QWEA 4F50A 2IC3A 2AX1A 2FLPA 2WRMA 1HYSB 5F8HA 2ZE2B 3DLGB 2HWHA 1VRUA 1VRUB 4I2QA 4I2QB 3C6UA 3C6UB 3N6LA 4IKAA 2HNZA 2HNZB 4ZP7A 3KHRA 4K4WA 2BQUA 2IM0A 2VA2A 4RW6A 4RW6B 1S49A 4Y2CA 2FVRA 3IG1A 3EPIA 1KHWA 5KFUA 1DTQB 5J2MA 5J2MB 1ZTWA 5KFNA 1HMVA 1HMVB 4IH6A 2C28A 2XGPA 3C6TB 2ATLA 3KK1B 3RB3A 4QW9A 4G1QA 4NRTA 5KFOA 5KFBA 4NLGA 3I5AA 3DM2A 3DM2B 1JLGA 1KHVA 1JLAA 3KMQA 4ZPAA 1R0AA 1R0AB 3BSOA 1TP7A 4Y34A 1JIHA 1QE1A 1QE1B 1UWBA 4I2PA 2BQ3A 4EBEA 5F8JA 2R2TA 4MIBA 3UR0A 4WYWA 5KFFA 1OS5A 5J2QA 4IRKA 1K1QA 2W8KA 3M9NB 1HPZA 1HPZB 3CWJA 5L1IA 4KFBB 1S1TB 1RT4A 1RT4B 3ITHA 3ITHB 2XI2A 3MR6A 4J9OA 3V6HA 5HP1B 4Q8EA 5CYMA 5CYMB 2R8IA 1TV6B 3SI8A 1I6JA 2FJXA 1IKVB 4MK7A 4GC6A 1RT1A 1IM4A 1S0MA 5KFIA 2R2RA 1MU2B 4RNNA 4K50A 2WOMB 1S6QB 2UUWA 1RT5A 4NLPA 2XC9A 3KLHA 3GYNA 3KHHA 3FFIA 5KT2A 2IA6A 1C0UA 1C0UB 4LSNB 3DRSA 3DRSB 3KK2B 3KK2A 3CJ2A 4NRUA 4K4TA 2F8EX 1CSJA 5F8IA 3BJYA 4TYBA 4ECXA 3KOAA 1EP4B 1RT7B 1FKOA 1FKOB 5HLFA 4RW4A 4J9SA 4ECQA 2UVUA 2YNGB 3H2LA 3OLBA 3KLVA 4KSEB 4ECUA 4ED8A 1JX4A 3PVXA 1RTIB 1J5OA 1J5OB 3D28A 1TKXA 1IKXB 1TKXB 4KV8A 4RW8B 5I3UB 5D3GA 1TKZA 3PJXA 3GQCA 2VG6A 4ZP6A 1MMLA 4TQRA 4YP3A 2OPRA 4EYIB 2HWIA 3PW5A 3V6KA 1S9GA 1S9GB 1N6QB 2CKWA 5KG5A 1REVB 4TY9A 3RAXA 3M8QA 4ZVEA 4KBIA 3G6VA 5KFZA 4EEYA 1HARA 5F8LA 2W9BB 1S48A 4ECZA 4EBCA 2IBKA 4KO0A 4MFBB 3QYYA 4K4YA 1JLBA 2BANA 2YKNA 3Q8QB 4RU9A 4O3NA 1S1WA 4TQSA 2W8LA 3DMJA 3Q8RB 4NLVA 5C42B 3MTKA 3JYTB 4Q45A 4PQUA 4PQUB 2ILZA 4IFYA 4IFYB 4ECYA 1LW2A 3KLEA 4QWDA 1FKPB 1VRTB 3GIMA 2IJFA 4HYKA 4RW7A 2FVPA 5DGBA 4J9LA 1SH3A 2W7PA 1TL3A 2IAJA 1W25A 3BR9A 5F9NA 4B3OA 1S9EB 3BGRA 4ID5A 2WK4A 1S0NA 4MK8A 3MEEB 5J2PA 2C2DA 2IMWP 1S1UA 3PW4A 3BQ1A 3HVTA 1HNIB 5KFSA 1LWEB 4NLQA 2RDJA 3DRRB 3CJ3A 5KFRA 4PWDA 4PWDB 2OPSB 3GV5B 5KG3A 1RTDB 1RYRA 4OL8A 3GIKA 1C1CA 3GIIA 5KG7A 5DG8A 4DL5A 4TY8A 5KFXA 1T03B
chains in the Genus database with same CATH superfamily
4X4UA 1NEEA 2EVZA 2UVRA 4Y2KA 5CQGA 3CTRA 1X0FA 1N5YB 4JB8B 3IN5A 2FVCA 3UDLA 1HWUA 4C3LA 1WJ9A 2DNNA 2P5VA 1XTZA 3A8IA 3PW7A 3D6MB 1ZOTA 1T8EA 5LXRA 4ZA1A 2CQDA 5IZHA 5HVFA 1UFKA 3ICLA 3K5LA 3EGZA 4J91A 4D3HA 3CE8A 3F41A 4USKA 3AODA 2HEKA 1U0HB 2WZ1A 3KKFA 4I69A 4ETXA 3H8YA 1UWBB 1M1HA 3VGUA 2RKIB 6FD1A 1ZYQA 2UVWA 4DR3F 4LF8J 2QIFA 2GO9A 2E9RX 1GMWA 1YZ6A 1P9QC 2YNHB 4C8OA 3QRPA 1S4FA 3FZBA 3FBEA 3M1VA 3CJ8A 3DKDA 3MM8B 4ZVFA 1IQZA 1RB0A 2X7IA 2E9ZA 3ZFVA 3TI0A 4A46A 4ZKAA 4DPUA 2HFNA 2K3KA 4I0WA 2WVBA 4DOZA 3HSJA 2A3JA 1KFDA 4ZCKA 2YPYA 3W5ZA 4EYHB 5E7OB 4B3OB 3EDRB 3KLGA 2ZITA 2RMLA 5D77A 2B51A 2NS1B 2DGXA 1S77D 4TKTA 2XYPB 3O5TB 1HNVB 3QIPB 5LSOA 1X5PA 2A10A 4F8RA 3H98A 4ILMA 2OP5A 1RTHA 4YB5A 3OR2A 2DKOB 3TUPA 3D2WA 1S9FA 4QYZJ 5ETSA 2AEFA 5FDLB 3AXMA 4RBUA 5SUHA 3RG6A 4NEYA 3C16B 2AWZA 2WHOA 3QAUA 4DV7J 3CDUA 2B4UA 3K0JA 1EKRA 4EO8A 2JFKA 3DOKB 4B3SF 2J5AA 3ETOA 5EN1A 3MCSA 3VR1A 3I5CA 4OZ0A 4LQ9A 4NCAA 3TZZA 1GNKA 1HNWJ 4P6QA 4M95A 4FYYB 1JJ4A 3OPKA 1VJQA 1EP4A 5HSPA 2X51A 4AYBD 3LWMA 2GZOA 3FK4A 4CLUA 2F65A 2ACMA 3GSIA 3MFHA 1S4EA 3MM5A 2ROGA 5IC4B 1VLYA 3R7SB 5KT4A 1VQPS 4Z7CA 3QSIA 3MF5A 1EKSA 4P7TA 4PXBA 5EWGA 4MIAA 3H40A 3JSBA 4BWJA 1RTDA 2XGQA 4P72A 4B9LA 3GV8B 2X1BA 2BE7D 5ETQA 3RW7A 2XS2A 3M2VB 3NBPB 2HFVA 1JJ2R 4I6AA 5I3QA 2HNYA 1HNXF 4YR0A 3CMQA 1Q5YA 2Q43A 4ZVTB 3M2RA 1G7CB 3IG1A 4B02A 3MURP 1BHNA 1KQGB 3U1MA 2ZZNA 2ZOMA 2E29A 3RRHA 3KK1B 3RB3A 1Y5LB 2KHDA 3ZTOA 3CJQA 1SCJB 2KFYA 1X4EA 5FLXY 2M8HA 4CRJA 2DRDA 4Y34A 3D9BA 1QE1B 2AMCB 2VF3A 4MIBA 1W7WA 3M9NB 3HZGA 2VQEF 7AT1B 2FC8A 1ZBTA 2HKEA 2XTJP 3SI8A 1XJWB 4YDXA 1NHKL 1IM4A 3PRDA 5F8JA 1C0UA 5GADU 7FD1A 3VQTA 2ZM6J 1J5OA 3A8EA 4OZ3A 2YBVA 3HPOA 3MM7B 3KG1A 3HXMA 3FMWA 1JLBA 2DIVA 2ZH6A 5HO4A 8RUCA 5C42B 2DK2A 3KLEA 1S0VA 4MMOA 1Q78A 1M5KC 2RQMA 2DHGA 1UEUA 2WK4A 2NXUA 3DCAA 1L3KA 1X5TA 2RDJA 1HWJA 4TY8A 1RABB 3KXDA 1ZH5A 5D6GA 1Q8IA 2C3OA 1VR6A 2FGCA 4LF2A 2I6WA 1JXVA 1UVKA 4W92B 4DBQA 5LL6d 1NB7A 4DR6F 4WP3A 1WSRA 1NDLA 4ANEA 1UZHA 1JK9B 2Z8QA 2WVCA 3RW6A 3CCVS 5JJBA 2P9GA 3PEJA 1JLAB 2RDIA 4IYQA 3B8HA 4CNYA 3DGPA 5BXIA 3AQOA 1MWYA 5E2QA 2ZZMA 1CJKB 2M9KA 3NGSA 5F8GA 2OEKA 1UAWA 4WE1A 1L3TA 4QR2A 1UEVA 3NMRA 4URGA 1T9TA 4A8MP 1PCAA 2RF2A 5HVGA 3HHLC 2GIFA 2YKNB 5IOLA 4NX9A 1CQNA 3U1LA 1CLFA 2BKNA 3PJWA 4MH8A 2PGCA 3BR8A 2MSSA 3NAIA 3MMAB 5DDQC 2WVFA 3BEGB 5C5JA 4ZLLA 2KM8C 2L9NA 1C1CB 3R9LA 1RU2A 4IFVA 2XMMA 1EJ7L 4LF1A 4C3KA 1LXNA 3NNHA 3JTNA 4CH1A 2VG5A 3MCOA 2YQ3A 4CO2A 2ADCA 1HBMB 4OYBA 3M8ZA 2B7CB 1X0PA 1MWQA 1AUDA 2JEFA 2QA4S 1UMJA 2AGPA 3LP2B 4Y2IA 4FZVA 2R3VA 4R5PA 1T11A 2MGZB 2ZC3A 2KRRA 4FNHA 4O4GA 2Z4PA 3BKTA 3KHGA 1XNRJ 1Q4RA 4C98A 1MSWD 2OPPA 1KBRA 1E6YA 3LQVA 3E2EA 1ZA2B 5DQHA 4TXSA 1ZPWX 4QWBA 4HACB 2PIIA 2M7SA 2N7CA 2ZHOA 3GILA 2BJ1A 2GMHA 1Z2ZA 4HTJA 4RPFA 5HK4A 1KTQA 3AB2B 3BM7A 2R7RA 4BS2A 3CULA 2C3PA 1VOMA 1QUVA 3MEGB 3UD4P 1NJWA 2EBGA 2F3JA 2YKMB 4I68A 3AY0A 1DARA 4U96A 1R27B 3G8TA 4ID8A 1RTIA 4NZ6A 3ZNJ1 3V81B 1F5CA 2AIRB 4DF4A 4RL1A 1U7LA 5LMUF 1WEXA 4B9NA 4Y28C 2OHDA 1URNA 4DUYJ 3P49B 2BJ3A 2J8AA 3TUZC 1RHJB 3OSPA 5T7LB 3MEEA 4RNHA 2AX0A 2DPIA 2YWHA 2H9ZA 3M30A 2XO6A 1VQKS 2WCXA 3UVJB 2LQ8A 2I5JA 2HBYB 3FDSA 1MW7A 1KEKA 5KT7A 3D66A 1VHIA 4XO0A 2GVDA 1TR0A 2VDHA 1K73T 3NY0A 3SEOA 3DLGB 1R43A 1ICEB 3TEGA 2BKOA 2OMOA 3R1LA 2XM3A 3MR7A 3LOUA 2VFUA 4JI5J 2C2KB 3OUYB 3JAMY 1O8BA 3DM2A 4FNIA 4YY3F 1QLNA 2V94A 1I51B 1CS4A 2XB2D 4LF5J 1U6ZA 5BR8J 1BWEA 1HR0F 1S1TB 1V5VA 3G71S 2ZH7A 1IKVB 4USTA 1RT1A 1X4FA 3GFXA 4NLPA 2P9EA 2KFNA 5A8RB 3NGKA 4ECUA 1TL7A 1BMQB 1VJWA 1YBAA 3FBCA 3PJXA 4IOCQ 1AA1B 2IRXA 3VZIA 4EMDA 4TU7A 4MFBB 1BGXT 4FXWA 1S1WA 4PQUA 1HBOB 3R7NB 1VRTB 4J9LA 4J7CA 3ILOA 1KQKA 2UXDJ 4CH7A 4CP5A 1OY8A 1FDAA 3SQOP 2PI4A 4BCAA 3DRRB 5KFRA 1O6XA 4DX7A 1SL1A 3QQCD 1ELOA 1ZAVA 2C22A 4Y2AA 4LFCF 3GG1A 1QAXA 4C0BA 3BN7A 2CZ9A 2GJ2A 5H9FK 1KLNA 2XLKA 2MZJA 1AYEA 2J7WA 3IRXA 4AXJA 3QGPA 2CPXA 1K9MT 2MYFA 3R8YA 3MAAB 3NEKA 2YWGA 5KFMA 4IRDA 4FVMA 3FEXB 3Q2SC 1VQ8S 3T9ZA 5D4NA 3N5FA 1VQ9S 3RR7A 1FDNA 3TZXA 2W9CB 4QWCA 2F1FA 2E5IA 2CPHA 2IVFB 2BUNA 3CEDA 3SZ2A 3T1AA 1TUGB 3E01A 3UDCA 3IR7B 4ILLA 1UPPA 2HIYA 1LWFA 4L76A 3MR3A 1XC9A 2NXCA 5A0YA 2DR9A 2NSBA 4FS2A 2B0GA 4D3GA 1N56A 2HRUA 4ZP9A 1CJVA 1Y0HA 2OLWA 3BGRB 3PW2A 1WI8A 2BMBA 2EK1A 2CWXA 5IXUA 4DR1F 4DV5F 2CYYA 2YWWA 4DL2A 5EUHA 4DZ6A 1QTMA 3VAFA 4NXMJ 2FUG9 2YTCA 4RBTA 5C2GA 3CCJS 1JLCA 1E6VA 5F8MA 4DR5J 2DY9A 4DV6J 4QBUA 1OQ6A 3R2DJ 3KJQB 1X4AA 4M63A 2H1YA 2JEGA 4PABA 2YNFB 3BYRA 3HULA 1W26A 4JOUA 2GVZB 4CTAB 1JKHA 4FYDA 1TK8A 1HYSA 3BB5A 2IJNA 1QUPA 1RBOB 1WORA 4XPEA 4YMEA 1C4CA 3H5YA 1IBMF 2AGQA 1MNEA 2QZ8A 3GYXB 2PC6A 3J80Y 3OHBA 5KFKA 4B17A 2F8MA 5CD4H 4B3TF 2DHXA 2QLBB 1FF2A 2MZTA 4IG0A 1SUQB 4GO5X 1JLEB 4ILRA 2QYCA 2FDNA 3GJQB 3OFHA 1MU2A 1XIQA 1RTJB 3DYAB 4P73A 4ZCMA 3P45B 5GAGI 4F4YA 1TZ0A 1X7VA 3HVAA 1IKXA 2GHVC 2BDPA 1Q86T 1Q1KA 1RU1A 4CO0A 1HHTP 3KK3A 3T1YJ 1HNZF 3QT8A 3JTOA 1F5AA 3CJKB 4MKBA 4U6PA 4I4BA 3L09A 4LRFA 3KNAA 5CH7B 4JV0A 4KHMA 1S9EA 3MPYA 4R8UA 4DF8A 1RT6B 1UKUA 1T03A 4J9VA 3QZ7A 3DLEB 5J1PA 2RHQB 4F3MA 3UDEA 1RA6A 2CQIA 3ENWA 2R7XA 4ED1A 3B4MA 2IYIA 3K8WA 1S97A 1FWLA 2YKPA 2MTLA 1KRPA 4QWEA 4ALZA 3TJAA 3JB9k 4Q2LA 4RW6A 3DU5A 5KFNA 2NREA 3EXCX 2IDEA 3I5AA 3HSGA 2C2NA 4L3NA 1Q5VA 3CD6S 1TP7A 2DNOA 4DLGA 4X66F 5J2QA 4AQYF 4DR7J 2CPEA 3CWJA 1RAFB 5CYMA 5LJ3Y 5D8HB 5KFIA 2M0GB 1WOOA 1UFLA 2EBEA 3KLHA 2IA6A 3R5BA 2N7YA 1RCOB 4ECXA 4RW4A 2YNGB 3OLBA 5AXLA 1CJUB 3GQCA 4QIFA 4CLKA 4RWXA 1R8HA 1FI4A 3BV8A 1Q16B 2HHTA 2Z30B 4JI6J 2C3UA 1NZ8A 3U7JA 3DMJA 1HR0J 1QD1A 5HVHA 1MG7A 1FXDA 3NLCA 1U2RA 4ECYA 4CWBA 3THPA 1FKPB 1M1KT 2N4CA 1VBXA 3EZOA 2LXFA 3GV5B 4ZPTR 2DH7A 5KG7A 1UWAA 2CJQA 1RZMA 4K4XA 4ED4A 4LR7A 1TU0B 3KJVA 4WJBA 4JI2F 3OXLA 2E7WA 5L38A 3TX0A 1HI8A 2DNRA 3EVOA 2ZBQA 1WC3A 5BYQA 2YX7A 3JSMB 2CQBA 5A2QU 4JI7F 2WVDA 2ZDPA 2OPQB 3CDAA 3HMJG 1WOPA 2YQ0A 1HBNA 2MHEA 3PX0A 1Y00A 3PFOA 3D1OA 2VBWA 1IKYA 4N8OA 1K1SA 4J9QA 1WC5A 3ISNC 4RUBA 1UZDA 3QT5A 2XO7A 2AKWB 4J9UE 1RT5B 4UUWA 4WFZA 3CF5Q 3W2VA 5IV4A 3LP0B 1AZSA 5K20B 3ELHA 1R89A 2KKHA 3RB0A 5B09A 5CABA 5J2NA 1KQFB 2GFFA 1RWKB 1YGYA 4USWA 1RHMB 2D7SA 4CYUA 2KXNB 4I6YA 2VFTA 5DZ6A 4FPRA 2BJ8A 4LFBJ 3QGHA 1M5VC 1ZM3A 4F4KA 1FK9A 4ICLA 4OYOA 5J2PB 4HT7A 3SSRA 1NSPA 2AYBA 3O1LA 1JXLA 2W25A 1WC4A 4L75A 1NXIA 4W98A 3BO4A 1MROA 1XK8A 4C2MA 3I55S 2RU9A 3DLKB 2HAIA 3V6JA 3IMQJ 1WWHA 4F26A 4NI2A 1X4DA 1WDDA 2OELA 2RQ4A 5E3RA 1IBLJ 1PSDA 5C25A 3QLHB 2XMTA 2DXEA 2CZVC 2WTFA 2BRLA 4ZDNA 2ZE2A 3J7AN 4ECTA 1SB6A 1DTQA 1V3SA 1ACMB 4F67A 3T1HJ 2OI2A 2DD8S 3DNCA 4Q0BA 3BQ0A 4LT6A 3PO5A 2P6SA 4LF9F 3M1VB 3AB4B 4USUA 1DLOA 2EW9A 3W60A 4LSZB 2D74B 3Q23A 1JMTA 4USVA 2ZHAA 1RISA 2UUCF 4M5LA 4C8ZA 4OI3A 4OJ1A 3K5NA 4ECSA 1XN9A 1NK0A 2VOPA 1I5OB 2V4JA 3QO9B 1S99A 2ASJA 4TYAA 1IBKF 1IUJA 2IMOA 4DEZA 3KLGB 2LU1A 2OEMA 5C24A 3CUNA 4JV5J 1BXNA 1EZZB 3SV3A 5J1EB 2DXDA 4DFKA 4B9UA 4OI0A 4BC9A 2C1EB 3G9CA 4LF4J 2CVEA 3D1QA 4IH7A 1RTHB 2OJ3A 2MY8A 3CDEA 1RAGB 3OR2B 2K1RA 1U1PA 5IWAF 4LFAF 1OO0B 1NM2A 3WC2A 4EWTA 3O3LA 1U47A 4NYOA 1YLXA 1NJXA 2Z2MA 2MKJA 2A1BA 4ZP7A 4K4WA 4QW9A 4PXDA 3W66A 3L95X 4OYIA 1R0AA 4DV2J 3BSOA 5IQQA 3VAJA 4OLOA 3SIPB 4MK7A 5G0RA 4UTGA 1VBZA 3ILJA 1XQIA 3BJYA 4TYBA 1EP4B 1NJYA 2PT0A 3D28A 3PIPQ 3KUHA 4ETZA 1RWUA 3RAXA 2HHHF 2DCUB 2MQLA 4X66J 4K4YA 2BANA 4AQYJ 3MM5B 1VIOA 4QWDA 2CPIA 1FRKA 4MK8A 5DZ7A 2HVIA 2CVIA 5L39A 2D3O1 4PWDA 1RTDB 4OL8A 3TEHB 2XHCA 2QL9B 3CD0A 2LEBA 3NGDA 4LF6J 3FUYA 3NCQA 4XAKA 1APSA 2UXCF 1AB8A 2H5JB 1SC4B 2MHNA 4FS1A 3MM6B 1S6PA 4O23A 4X62F 1BLUA 2HNYB 3DHWC 3KLFA 3G6XA 3CC7S 1U4BA 3LW5C 4C8YA 4BLGA 3IG1B 1T95A 3IWLA 1S6UA 5ITHA 1RWWB 5BJRA 5L1KA 4A4JA 3DU6A 2WSEC 2R7SA 3GG0A 4QYZK 3P3DA 4JI2J 2Z58B 4ED3A 4PCQA 2J0QD 4Z7YA 6FDRA 2GX8A 4M5DA 2C2EA 3HKWA 2MQOA 1S59A 3QFWA 4ZJLA 2W01A 1AT1B 4HKQA 4DR2F 1WTBA 2VFSA 3AOBA 2E5JA 4C8LA 2AJ0A 1H98A 3DDNA 3T5JA 1Y3KA 3QJJA 1JLBB 3I31A 4USHA 1ZM2A 2FD2A 3OXFA 4WU3A 7FDRA 3PHEA 1R0CB 2QMXA 3KLEB 4QIWD 4ELTA 4ANCA 3UDVA 4DL7A 1YHQS 1VS3A 2RNEA 4ZMMA 1U2FA 1VMBA 1JJHA 3OVBA 3SMZA 2Q6BA 1K47A 3GV7B 3PRVA 3BN4A 2PD1A 3BS9A 4TY8B 5BYSA 3BZQA 3A13A 1N88A 4NLTA 4P52A 3HDSA 5CYQA 3BO2A 2VU5A 1T02A 3T5HA 1X8DA 2XYHB 3MMBB 1N33F 4FXVA 1SKWA 4F3OA 2HZCA 3RUBL 2XMJA 1RGVA 2W4CA 5CCMA 4LF7F 2J8SA 1QDUB 1YZ7A 5H9EJ 1KSPA 1I94J 4JI1J 3FCWA 3OLAA 5M2RA 1PGZA 4ZCIA 4DV3F 4I7FA 4F0HA 1CJTA 4NCGB 2UXBF 2CQ2A 2R7QA 4DPYA 1BWVA 2APOA 4DQRA 2RH3A 2E44A 1WC6A 1JNRB 5IT9Y 1Q0NA 1J5EJ 4ZPVR 4OYMA 1V3RA 2VV5A 4C4WA 2NZ4A 1FRIA 3VGSA 3RB6A 1Q8BA 1C1BA 1L5UA 5KFYA 1T9YA 3RGIA 1TV6A 1OJ4A 3O6QA 1IKWB 3POTA 4IG3B 2DNHA 1I3OB 2QL5B 2RF2B 2F8HA 2ZJRQ 1IR0A 1RCXB 1KLMB 3T3FA 3CO0P 2R7UA 1GFWB 2YXLA 3PCOB 2R8HA 1LFWA 2DGSA 2FVSA 3KHLA 4KC5A 1CC8A 4ECVA 1B0TA 3I9V9 2DNQA 3CD5A 3AA9A 1MMDA 3R5JB 2HQ3A 1FXLA 3ET6A 1NJIT 3HHLD 2VG5B 3WX4A 3CMAS 3DOLB 4K0KF 3GPAA 4KH1B 2KXFA 3WQPA 4LRBA 2GGPA 3QATA 1MWZA 4ZN1A 5LSRA 2N82B 3D3CJ 3QWUA 4R5PB 3TAMA 3W1YC 1JLFA 1TVRA 2BE2B 3DDKA 4CLYA 2PFDA 4J9PA 4DFJA 4O3PA 2V8GA 3FRZA 4ZVOB 4UZCA 1NK4A 3ENVA 3C6UA 2BQUA 3VVUA 2I38A 2R7VA 2CQCA 2QJ3A 1H2TZ 3SCLE 2XGPA 3W64A 1HD0A 5AE3A 2ZH8A 1PG5B 5E33A 3M8YA 2R2TA 2G2OA 5IWAJ 1HPZB 2CQGA 2K8GA 4TNOA 3UN5A 2FJXA 2RE1A 2YY3A 1N32F 2EI5A 3W5XA 2AHOB 2HS4A 3G82B 1RTIB 2BXJA 1NK9A 4KV8A 3MPWA 1TKZA 2IRYA 1HWLA 2PMHA 1SC3B 2AT1B 3PIOQ 3LWLA 2GCFA 4QZVB 4Y00A 5K8MA 1KWMA 2NR0A 2HGMA 2YQ1A 1TK5A 1LW2A 4PXEA 3I6PA 2IAJA 3MAQA 3MEEB 4P9SA 3W7BA 1A0OB 3D7SB 2HHWA 4U67Q 5KFXA 3M30B 4FP9A 3PKYA 2LCWA 2FJBB 1YVFA 4AE5A 2WBMA 5A6PA 1NPRA 3EX7B 2FJVA 1I1GA 4R0EA 1JLQA 4ED0A 4OLPA 4PUOA 4IDKB 4ER8A 3NCPA 1BY9A 1P27B 2W2QP 4WZMA 2LQ9A 4OZNA 1VC6A 4Q2MA 4FN5A 1S1VA 1NK7A 4HDHA 1FCAA 1QSLA 5HROA 5KT6A 3DXSX 4NZ0A 2R7OA 2I1RA 4LRCA 2KHCA 2CPYA 1RT1B 2GHWA 3NS7B 4DV0J 4QIEA 1RACB 1FNMA 4F7VA 1TL7B 4ZHRA 3UQSA 4O44A 1UFWA 1R8PA 2JC0A 2LECA 5A8WA 2CQ4A 2HFSA 2VA3A 3G86A 4OX9J 1RAJA 4NXNJ 1S1WB 1LW0A 2IM2A 2XLJA 4K4UA 1OSCA 4PXCA 4C48A 2BR0A 3TR5A 2MLZA 3NGTA 1YJNS 2B9XA 2EFOA 2AU0A 4KHPJ 2YKOA 3CCUS 5KG6A 1TL1B 2VPWB 5K8PA 4X65J 1F3VA 4CLZA 2E7XA 2EFNA 4N56A 4TU8A 5B0CA 2RRNA 4QU7A 4ES1A 2HNDB 1GX5A 3IRXB 5ETOA 2YH1A 4L73A 1P8GA 3UNYA 4BBYA 2M52A 4X4QA 4OZ5A 4J9KA 1RXOB 4ED6A 5GAEI 3KTQA 4P74A 1FDDA 4YR2A 4WK1A 5E0OA 5E3CA 3MMCA 1ZA1B 2F7VA 5DS7A 4DV4F 1WD6A 2CNOB 1NDPA 4LQ3A 1M5SA 4DPTA 2AZ3A 1ZM9A 1N48A 4N5SA 4WFAQ 3PJ9A 4GMKA 2LEAA 4DR4F 2X1AA 4PG5A 3JXOA 3M05A 2YNIB 1FFGB 1S6QA 2XMWA 3ZO7A 2ZJPQ 2EWHA 4WYLA 2QMUB 3P5TL 2QRRA 3RBEA 2VHGA 5AXKA 1RSCA 4UY85 4MK9A 1CJVB 1SC6A 3EZ5A 1REVA 3I32A 1SBRA 1PYTA 1S10A 3JYTA 2P8IA 5F3TA 3NOGA 5CAAA 2F4VF 4CM0A 3DLJA 4DU8A 1JLCB 4X84A 3UNGC 5B08A 1SJ3P 3KUEA 1VBKA 2YH0A 3LPYA 2JH3A 4GKKJ 3ZZZA 1F5BA 2KXHA 4DV1J 3GCXP 1HW8A 3OT9A 3NL0A 1XMQJ 4OYWA 1PC4A 1B0VA 3DXBA 1NK5A 3X3UA 4AUKA 4QPXA 2FPHX 1JKHB 1WG4A 1PIEA 1FVSA 3PFEA 1HYSB 3ZZ0A 3N6LA 3QJPA 2HNZB 2IM0A 1TELA 2FVRA 3HT0A 4CLSA 4BC7A 2QEXS 3G2XA 4B9VA 4NRTA 1U24A 1DBDA 3MHYA 4JI3F 2L48A 3WZ0A 2ABYA 4ZLJA 4IRKA 3M6VA 3P96A 1RT4B 1QAYA 3L4BC 5E41A 2OKQA 2IIHA 1MU2B 1FA0A 4UY8T 4YB1P 2A0FB 3KHHA 3D4JA 1QSSA 4J9SA 5HLFA 1WC0A 1IKXB 1AUSL 2OPRA 3GR1A 4ZVEA 4KBIA 4B9SA 2RUSA 4EEYA 1CQMA 4KO0A 1Q7YT 1CVJA 3MPVA 4NLVA 4X4OA 3JAMU 3VAHA 4U8VA 5IT4A 2YPZA 1GEHA 2QA2A 3BKUA 2LQ5A 1W25A 1KNZA 2CJKA 3LA0A 1WF0A 1S9EB 2YWEA 3UWTA 2RILA 2MKSA 2VD3A 4ANDA 1T03B 4DSJA 4OX6A 4X64F 1GXTA 3NS5A 3Q2TC 3LANA 3VVTA 1N36J 4HHHA 3TUIC 1L3VA 1OQ3A 1GXUA 4K5RA 3BBCA 4NLUA 4M5HA 2ZEJA 3V5RA 2QC3A 3Q0AA 1JQGA 3IM9A 5GVQA 4H4OA 2SXLA 2MZRA 2ZWPA 5LMNJ 2G0IA 3K7RA 1FRLA 3H4DA 4FKXA 2RDDA 1EQMA 2J7UA 1VQMS 5DQGA 1NBEB 2DB1A 1SC1B 3L7PA 1VI7A 4Q43A 5AE1A 4U7UK 4ZVRB 2UU9J 2RKIA 1X4BA 5J2QB 5KG2A 3H2UB 4MJKA 2HHXA 2VICA 5I42B 4BWMA 1FKAF 4I6WA 2YNHA 4JI4J 1B7FA 3KLHB 1SKSA 4M94A 3K2YA 3WDOA 4RW4B 3OW2R 6AT1B 2XYGB 3M32B 4HT5A 3N9UC 1WHVA 2HQIA 3OR1B 5B0AA 3BQ2A 2C2ZB 1B7YB 5A8KA 3DMJB 2QFIA 3CCSS 4CLPA 4IQXA 1TKTA 2B9EA 1REGX 1KOOA 5HL7Q 1GMWD 3IO1A 4LR8A 5JVHQ 4J37A 3BSAA 2F5GA 1VHFA 2ZBCA 2E66A 2DNZA 2J0WA 4HI1A 2OO4A 5DG9A 2K2PA 3V4IB 2OH2A 3KJVB 3RAMA 1HNVA 1X31C 3W63A 5CD4A 2FJAB 1FHTA 1OY9A 1FX4A 3CCMS 3T41A 3TUJC 1PYOB 1SJRA 3SV4A 2V8DA 3CB4A 2MQ8A 1VC0A 2HHSA 3H0PA 2VBYA 2Z56B 2RJZA 4NA1A 2Y1JA 1HBNB 1RHRB 2AF6A 4NLDA 3IWNC 1IKYB 2KL8A 3SDEB 1WKLA 4XTTA 2YKQA 4G65A 3MOZA 3DOKA 5AE2A 3TO8A 3IWXA 1FFWB 4DN0A 1DFDA 3V2UC 2RQCA 4WXOA 1L3UA 3G96A 1QAIA 3W2VB 1UETA 4L6V3 2RD5C 5HP1A 3RAQA 3I0SB 3HF5A 1H3DA 3RRKA 2LDIA 3ISND 2DVIA 3F73A 2OTJS 4LSNA 1RQ0A 3KFWX 3DFEA 4DPOA 2V2ZA 1S6OA 1VK8A 3KG0A 2V8HA 3SXLA 4G6VB 4YOEA 4MKAA 3KYLA 3SQGB 3LAKA 2W9BA 4ICLB 2UV8G 4QU6A 2KT3A 5L1LA 3AT1B 2NYHA 3BYPA 3J80U 1Q95G 2C42A 5T41A 2LDYA 3NRBA 5KFCA 2QLWA 1UVJA 1VDHA 1T94A 1MROB 1LWXA 4OYAA 3OTEA 5B0EA 1WNEA 2CQ0A 3ISZA 1RKIA 4V19X 1QJHA 4RW9B 3M2VA 1F0XA 3M8RA 5C25B 1WHYA 1UW9A 5J1NA 3EGNA 3AXKA 2ZE2B 3VALA 1SL0A 1VRUB 1GQEA 3EUNA 5K8OA 2HVZA 1DTQB 1WEZA 2QA1A 4C8NA 2B56A 2E5LF 3J7Z5 2AJFE 1A9NB 2FGOA 4I1TA 1FDBA 5C2CA 2LXUA 1QE1A 4KGKA 2JLFA 4QJVA 3V6HA 3ITHB 2M8DB 2VQFF 2GMJA 3AOCA 4IO9Q 4FF4A 4RNNA 1YITS 5DRKA 3GYNA 3FFIA 2PMZD 5F8IA 3MI7X 3PKMA 2MJUA 2A18A 3H2LA 4ED8A 3S1TA 3P5BP 5LT5A 2HZAA 4CM2A 4HEA9 2FZKB 3K57A 4TQRA 1B99A 2BBEA 3PW5A 1VBYA 4TY9A 3MM7A 3G6VA 5ETPA 3TQEA 1B70B 2ZC4A 4RU9A 4TQSA 1VIXA 4IFYB 1A7GE 2IJFA 4HYKA 3UN2A 2FY8A 3MUVP 2IMWP 1FXRA 5KFSA 2NSCA 2RRBA 4KGVB 4NA3A 2LVWA 3IS9A 5GAHU 2EC0A 1SH2A 3GYGA 2BRKA 1YIJS 2K1RB 3DHXA 4E0DA 3MPUB 3CJ5A 2CZ4A 2HVDA 3J7ZT 4KKOB 1XMOF 4CLWA 1PO6A 4P71A 4YB7A 2W2MP 3NGRA 4OHVA 3M8PA 1U49A 2JNJA 4HDGA 3MUTP 4UOFA 3NNAA 4W90B 2OD4A 3CW2C 3BGFA 4F0MA 2XMUA 1UL3A 3W8GA 1HQ2A 1T9UA 3IP0A 4WBFA 1CJKA 2LMIA 1DRZA 1YWXA 4RZRA 4EGLA 2CPZA 2FB0A 3HKZD 4WFXA 4LJMA 1DZ5A 5K5MA 1H38A 5DM6Q 3TRGA 2C2MB 1R8CA 2XS5A 1SL2A 2BANB 3K8VA 4O3OA 3NP5A 3BBFA 4Q44A 2VKZG 4JI8J 1ZM4A 3UR3C 2OAUA 3MMAA 2MQPA 1T3NA 1U09A 4DUZF 1RUSA 2AQ4A 2KZZA 2XEXA 2M4MA 4DU7A 4ZIWA 3PDNA 4U9RA 4QW8A 5A6WA 4DPXA 4F4XA 1HBMA 1S6PB 3H5SA 1OY6A 3LP1A 3SFGA 1Z4UA 4OYXA 4MYUA 1J27A 3HI9A 3FGVA 1QTNB 2HYIB 3KLFB 4NCBA 2I2YA 3EE3A 2JRSA 2O01C 1VQLS 1SIWB 2H4WB 3H59A 3MMJA 3HHKA 4ECRA 3T5KA 3C15A 3FSXA 4GKJF 4DSIA 2UZAA 1S57A 4MAKA 1NDCA 3OVSA 2V68A 4KR0B 1MMNA 4O0IA 2H3EB 4M5DB 4FBTA 3ZTPA 5DDRC 1T3OA 2BYCA 2XNRA 1RWMB 2CWKA 5I4MA 1EX8A 3M6WA 4QYRA 3T5LA 3IBWA 5HJYA 3CJ4A 2YKMA 2WB4A 4B3RF 1RT7A 2U2FA 3Q8YA 5E3AA 2B4OA 3FJ2A 1ZETA 1WG5A 4M5GA 2MMYA 1HIYA 4KYZA 1YG0A 4A8FA 4A8WA 3UW1A 4IRCA 4F4WA 2BJ7A 5HQLA 1IXKA 1UVNA 1FJGF 1UJ4A 1D9DA 2O5DA 5CYQB 5E5NA 5KG4A 2GA7A 2Y1IA 1ZAWA 1NDKA 1SQGA 2E1AA 5KFLA 4N47A 4I56A 4U7UD 4BDPA 3CGIA 2VASA 4UW2A 2PN6A 4OYPA 1P9YA 4EI2A 4YHHF 1U26A 2R8KA 4J9NA 4I7FB 4CDIA 3T9NA 2IC3A 3TA0A 4L3KA 4RJVA 3M2UA 2D3OR 3H20A 1HMVB 4RWWA 3FCHA 5CYJA 3FEYB 4UUXA 4G1QA 3A8JA 1SKUB 5KFOA 3OTOJ 4NLGA 3LGMA 1VFJA 2UUAF 1U25A 2F9DA 3SCIE 2FYXA 2BQ3A 3OTCA 1ZAXA 3MR6A 3GP9A 1TV6B 1M90T 4DSFA 5AJ3F 2W4DA 2R2RA 1NRKA 1RP5A 1SJQA 4NPOA 2UUWA 3BO3A 3DRSB 3CJ2A 2XY6A 2Z0GA 4PR6A 5A8RA 3KLVA 3GCWP 3SSQA 3TZYA 4I64A 1TL5A 1S9GB 5D15A 5KG5A 3M8QA 3KJFB 4NOHA 3MAHA 1MN7A 2W8LA 3M6UA 3ZTQA 2OUGA 4DR3J 2PFFB 5M2PA 1NK8A 4Z2XA 1HBOA 4JI0F 3THTA 4N77A 2OMLA 5K8NA 2QA4G 3PM9A 2EEYA 4J5OA 2C2DA 2B9YA 3IR6B 2EC2A 2QYGA 5D78A 5DG8A 4TLRA 5HMZA 1NJZA 2W1BA 5KFDA 4LSLA 1WKKA 1AFJA 2ZVIA 2RAQA 1S76D 3TAMB 5EGYA 1C0TB 4DXLA 1JLFB 5DDPC 1TVRB 1TFWA 3T6BA 3OVAA 1RBLA 3LGHA 4DJBA 1SJ1A 1UVIA 4PWUA 1XR5A 2AEMA 2VG7A 3OL7A 2DJWA 3PYEA 1RT2A 4YFUA 1RADB 3QNWB 5H9EK 1DQ9A 2HVHA 2W4PA 3D6FB 2W2PP 1C2PA 2LYVA 1WHWA 1YBTA 2BM0A 1YJVA 5DGAA 4GO7X 3B6BA 1XNQF 5B7WA 2EXUA 2VODA 2W9CA 4KT0C 2QFJA 2KRBA 5CXTA 4C6AA 1C4AA 3TZWA 4DQSA 1XWLA 5D0HA 1D9AA 4KV8B 2CJXB 3RZAA 1TKZB 3H25A 3OBIA 3ZZOA 2HRTA 3AFGA 2B43A 1RE1B 3VAKA 5L9XA 2AJ4A 4B3SJ 1LW2B 3W9HA 2GQ2A 2G13A 2IAJB 5CCLA 4NEZA 1DAXA 1RWOB 4G3IA 2CG8A 3FVYA 1SIZA 2FJEB 4CT8A 2L9DA 1JB0C 1G1XA 3EM1A 1EQ0A 1QVFR 2FHMA 2JSXA 2XMKA 3DRPB 3CVKA 5T14A 3WIUA 3O8WA 2JVOA 2GC8A 4KHRA 2HBRB 4K4VA 3TQ1A 1JLQB 1GAOA 4LF8F 4RLEA 2HMIB 4PUOB 2ZHBA 2G4BA 1O51A 3J81j 4V19J 4CZCA 4PZVA 2VBXA 4WXWA 3E51A 2MLXA 2MB0B 2DPJA 5IC6B 3EICA 1H2UX 4Y65A 1S1VB 3A3PB 2AGOA 3HFZB 4M5JA 5HROB 4CNZA 2DYAA 2LQBA 4MKVA 2H65B 1YRXA 1YJ9S 4CO5A 1SUQA 1G2EA 1HNXJ 4KFBA 2V67A 4ZHRB 2G1HA 1KQSR 2M5YA 1O5JA 4DSEA 3HHLB 3C66A 2WW8A 3TA2A 1MN9A 1LW0B 4GVBB 2HFZA 3I5BA 4Q5VA 1UW4A 2HS0A 3RR8A 2KM8B 4LMZA 5RUBA 2VQEJ 4HH0A 5HI7A 4EO6A 2NCKL 4FYVB 4XDCA 4KRWA 3S7RA 2BV3A 2EFGA 4DV7F 2FHJA 3BH7B 1HQUB 3IAM9 5AXNA 1H6KX 2KVIA 1TFYA 3HVRA 3UFCX 1RWPB 2BX6A 5HBMB 2UUBF 2D41A 3LALA 4OYZA 1U8SA 3HD2A 1HNWF 5E3PA 1FJGJ 5D0GA 1FRHA 4KJIA 2BKPA 4Y2CA 5KFUA 1ZTWA 4IH6A 1NMEB 1FJCA 1FFSB 4ED5A 2BOPA 1HI1A 3NGUA 1TK0A 2XHWA 3CCQS 2I0XA 2B7BB 2NXNA 3UR0A 3W61A 1Q7LB 4DR6J 4DSLA 3AHPA 3MD1A 4K50A 1NKCA 1S6QB 5KT2A 3KK2B 2JDJA 2CAJA 4ECQA 3K17A 3PVXA 1GT8A 3W8PA 1CJUA 2D1CA 2U1AA 2V34A 4OHZA 1FNXH 1REVB 3ULHA 4BHQA 1DJ0A 2HPUA 3JYTB 1SQFA 1NUEA 2GO8A 4RW7A 3R97A 3TNVA 2AZ1A 1SJFA 3L7UA 3TW0A 3KUGA 2DHHA 1T7PA 1RBAA 3GIKA 3C14A 3GIIA 2MKHA 3W2WA 2RB7A 4FPIA 2DXFA 4DMZA 5B0GA 2WONB 3L7OA 3M9MB 3MECB 4ZLNA 4E8UA 4K7QA 3E3XA 4OHWA 3ZC4A 3BH6B 3HT3A 3OFFA 4WWSA 4EU0A 2D69A 3QBCA 5BYRA 2OPQA 2ZM6F 3LPEA 3QZ8A 1GTHA 1SXLA 1UJ6A 4DL4A 1B64A 2M70A 1IBCB 2KVQE 4H4MB 4U7CA 3MCMA 3MM9A 4FVCA 5I3PA 2YVSA 4DL0C 3TARA 1ROFA 2XULA 3DI6B 3IM8A 5K14A 5G4DA 4QWAA 1WF2A 3OJSA 4URQU 2D9PA 3AAWB 4CLLA 2HURA 4WFYA 3IXQA 1FJ7A 4O4RA 1Q81T 2XZWA 4AT1B 4Z37A 4ZVGA 2XZDB 5HLFB 1YRUA 3LP0A 5F41A 2HW3A 4K4ZA 1ULRA 2OPRB 2IPOB 1WTFA 1FVQA 1H7XA 4L74A 5HANA 4KO0B 3QWPA 3N79A 3Q89A 1NPPA 1YSJA 1H2VZ 5KG0A 2LA6A 5DETA 3ZNUA 2HQCA 3EZUA 3W65A 3G87A 1U1QA 4LBHA 1B4SA 2B6AA 2MKYA 2F40A 3F56A 2EKNA 3Q8UA 4ZCLA 3NS6A 4JP8A 4B9MA 2EFQA 3DLKA 1UA0A 1F9FA 2PEBA 4C0OC 2QO3A 3ADAC 4H4OB 5LMUJ 2W24A 1XMBA 5EHHA 5JXSA 4K4SA 3H2VE 3QLHA 2MQNA 2GAHC 2HHQA 1TTHB 1NLKL 4JV1A 3AD8C 3RYLA 1SPBP 4N7TA 2VFRA 5KT5A 4OI2A 2KT2A 4DQPA 4X2BA 2NYIA 4LRDA 4TVAB 4ECWA 2YWFA 2IM1A 1Q79A 2ILYA 2XSJA 3CDWA 1TMMA 2WOMA 4WPAA 3AJ1A 4DG1B 5A8KB 1HW9A 1ITPA 3J7YI 3G6YA 1YTYA 1TKTB 3VF0B 3E8OA 4YY3J 1QAJA 3QO9A 3FSIA 1K0VA 4IH5A 3Q8SB 5DG7A 3HFKA 3D0HE 1FE4A 2VH7A 1NK6A 1XNRF 3H42A 1X5OA 4KGZB 3AH6A 1XEZA 5KFPA 3H4BA 5J1EA 5D4PA 2EG1A 4RKUC 4X4NA 1IJEB 1KP6A 2O66A 5MAOA 2OD6A 4RR5A 4NLXA 2FJWA 1N5TA 4M5KA 4DFPA 1EETB 2DR5A 2QV6A 3M6XA 5HQ8A 2FLNA 4PG8A 1FX2A 1X5SA 1N52B 4I2QB 1S49A 5ETRA 5K9FA 5J2MB 4NE9C 3N01A 1KVKA 4ZVSB 2PDAA 3U1NA 1LKZA 4A8YA 4DLEA 1S12A 2QSWA 4DSKA 4LFCJ 1TUWA 4I2PA 4EBEA 1FWPA 1Y3JA 2UUBJ 3AJ2A 4DUYF 1CG2A 5L1IA 5HP1B 2AYGA 2EFVA 4GC6A 4LSNB 1LOUA 1PJ7A 2F8EX 1CSJA 1FKOB 4IO1A 4MIWA 1F60B 1TKXB 5D3GA 2RS8A 2IY5B 4OI6A 2MQMA 4ZP6A 2HWIA 4CI0B 2OEJA 1P1TA 5KFZA 2OFHX 2A2CA 2W9BB 4ECZA 2CA9A 4A8KA 2PMWA 1PYSB 3MUMP 2FIUA 2ILZA 3MDFA 3J81U 3QT6A 1U48A 4CT9A 2J9DA 4ID5A 2MKIA 3HD1A 2KFZA 2CADA 4J90A 3C19A 3CJ3A 3EVMA 4JI5F 1R7IA 4DL5A 3A4TA 3BPSP 5IT0A 3D0GE 2R7TA 2XNQA 2NXJA 3MM6A 4LF5F 2G1DA 5F9LA 4RNOA 1HQEA 5BR8F 3QPIA 4WK3A 2J6SA 3R27A 5D0RA 1EARA 2CXEA 1LWCA 1AXQA 1UCNA 3ZZTA 1IM6A 3EXYA 3ZZYA 1AW0A 2FVQA 2A6MA 4DR1J 1M5HA 4DV5J 3SSSA 2R8JA 3K5PA 2HG4A 4JV2A 3CCES 1SH0A 3V6DA 2CPFA 2GV1A 3VTIA 1IR2A 3MCNA 5JUMA 1S79A 3M9OB 3FFIB 2UXDF 2O3DA 1NSAA 2VC0A 2BZ2A 1ZZNA 2J6UA 2IYGA 4Y6IA 1Z1ZA 2XZTB 3ZTRA 1WC1A 3MEDA 2DGWA 4RUHA 1PAEX 1IBMJ 2MJNA 2ALZA 2ROEA 5EX3A 4ZPBA 4RUCA 1Y11A 2BA9A 1H72C 2HGNA 4WTOB 1R3NA 4B3TJ 4CO1A 1PBUA 3P6YC 3EDQB 4ZS6A 2JHEA 1M1GA 3BGLA 1CULA 1YJRA 3UD3P 2E1RA 3MD3A 2JZ5A 3IS9B 3I9ZA 4EFAC 1RK8A 4ATNA 4FYWB 3MMBA 1Y5IB 5F0WA 4J9RA 5KFAA 2J0XA 1FD8A 2IVMA 2NPFA 2DEIA 3UE2A 3TVKA 4ZN3A 4FDFA 8AT1B 1T0TV 1W2IA 4M5MA 1HNZJ 1S1XA 2Y0SD 3M8PB 1DTTA 3HSZA 2K7JA 2HQFA 4NCGA 4OI4A 3WHIA 1VQSA 1KFSA 3H5UA 2H5IB 2P9CA 1W2BR 3B54A 4NLSA 3C6TA 2KG0A 4CLTA 3G6ES 3HSDA 2NPIA 5GMKa 4FKYA 1BC6A 2AJ2A 3ENQA 4UT4A 4PG6A 2QLXA 4M5NA 2D3ZA 4QQBA 3Q8PB 3KDNA 1IKWA 4WF9Q 2OSRA 4IG3A 2DHAA 2C2RA 4JBCA 1YRTA 1HWKA 4NXMF 2KG1A 3GFHA 5D0EA 1KLMA 1OWXA 3RB4A 2A6OA 2UV8A 4DR5F 1BE4A 4DV6F 3HJVA 3C46A 1RHQB 3CIZA 3HHEA 2MQQA 1UVMA 3W5YA 3D6HB 4NZ7A 1YJUA 3IAS9 2CRLA 3RBDA 5ETLA 3DOLA 2VB6A 1LWEA 3LP1B 3PR5B 2CJ9A 3WIVA 4DUTA 2V4QA 1X60A 4RUAA 3NAHA 5JVGQ 4CQ1A 2J0SD 4HHJA 4ZPCA 5L8RC 2BE2A 3C15B 3IGNA 4HLBA 2DNGA 1U6FA 2E7VA 1KOHA 1LXJA 2DEJA 3M2RB 2KYXA 1KHWA 4QIVA 2MXYA 1IVZA 2ATLA 5LOQA 1X4CA 2LKZA 2RS2A 2H51B 3Q22A 3IRWP 3L9ZA 1JLGA 1KHVA 1JIHA 1D09B 3T1YF 2MZSA 4WYWA 3JQKA 1K1QA 1HPZA 3VGVA 2LFVA 3LGNA 1FRMA 1S0MA 4JI7J 3VHQA 1C0UB 3FC9A 3R1HA 2CPJA 1QM9A 1RT7B 2UVUA 1T9WA 3G82A 1JX4A 1J5OB 4KGMA 3CXCR 2VG6A 4YP3A 3ZZUA 2VL1A 4A8SA 2MEWA 1HARA 5F8LA 4CLFA 2IBKA 4A8XA 2HIQA 2D9OA 1D9FA 2BM1A 4KIAA 1RKJA 3GIMA 1UA1A 1T9VA 2QGFB 3OJUA 2RU3A 3NXZA 5CA5A 5F9NA 2CQ1A 2B3TB 1Q82T 1S1UA 3HVTA 1K8AT 2V63A 2JLGA 2XBPA 1AFIA 4UOGA 4RNMA 1BQMA 2HHVA 4Q7AA 2V2KA 1RLDA 4DR7F 2ZVSA 1U8WA 1BQNA 2ACYA 2IC3B 3FNNA 2VFVA 2F9JA 4IDKA 1CC7A 2GMLA 2PI5A 2VUGA 3M2UB 3VWSA 1GTEA 5L1JA 3KMSA 1RT3A 4G1QB 2ZUAA 3LAMA 3CO9A 3B4DA 1FE0A 4EK2A 1OIAA 2ZKTA 4JI6F 1U45A 1OPZA 2CJYB 5LXYA 4R0JA 4A8OA 2R8GA 2C3YA 3DGPB 2DR8A 2FTRA 2CUYA 1NH8A 2ZNYA 1TL4A 3MTJA 2ZH1A 1DQAA 2GIQA 2HGLA 4WE1B 3MZIA 3UO0A 1ZS6A 3NCRA 2RT3A 1LEOA 4MTPA 3M8QB 3GIJA 3KJNB 3K59A 2JLEA 3FEZA 3QFHA 4J9MA 2WB1D 2COLA 4NWBA 1WEYA 1RAEB 4O0NA 4QPTA 4LF9J 1U1NA 3Q83A 2ZD1A 1ZZFA 3I56S 2XWYA 4YS2A 4P2FA 4PQAA 1TL1A 1V9OA 2CIMA 3L3CA 3TP2A 5E3QA 1VQ7S 4WKYA 4IFVB 3FMBA 2DITA 4PPZA 4LSLB 3FQLA 4KB7A 2RHSB 3EJMA 4EBDA 5HMWA 1OSDA 2W7AA 2UUCJ 2ZDOA 2EG2A 2XMVA 4LBPA 2HNDA 4AD6A 3ZXWA 3CCTA 2B5JA 3N6NA 1D1UA 3K58A 3HVWA 2VG7B 3R6GB 1IBKJ 1S0OA 1GMVA 1RT2B 4O4GB 2OTLS 3JSYA 3R5DA 4ELUA 1X9WA 2OPPB 2ZH9A 4NYZA 2RVJA 3R5GA 1X4HA 2R7WA 1E6YB 5IS2A 2G9OA 3WX8A 5LM7E 1RAAB 5KFHA 4PAAA 4WFNQ 4ENOA 4LFBF 5FD1A 4C11A 2HHUA 1KKHA 3BREA 1X9MA 3CC2S 2HLUA 1N4LA 3MFIA 3M8SA 2XCPA 3UN3A 3FQKA 3U27A 5IQ6A 4LFAJ 3GR0A 4CCHA 1UTAA 1LNQA 5KFEA 2K3IA 2KH9A 2E1PA 3OSNA 2YNIA 3HHNB 3LH2S 1ZTTA 2E1CA 5I3UA 3BGOP 4P75A 1HBUA 4ZVPB 1Y4ZB 4M5IA 1D8ZA 2MZ1A 4OFZA 2JC1A 4WFBQ 3PW0A 1IBLF 3RJMB 3MGJA 2CFXA 2K7KA 3VAMA 5SZTA 2OIHA 5FLXU 2ZH2A 2NUUG 1Q8LA 3DLLQ 3T1HF 3PXGa 2QT7A 3ILLA 2BOAA 3KLIA 4LREA 2VPZB 2V4RA 5DLFA 4OMFG 3TWZA 2HHHJ 4C9DA 2I5JB 4IQMA 2MKCA 4KH0B 5KFTA 1YX2A 5ETTA 2GVDB 4TLQA 4URSA 4F50A 5JMNA 1U2CA 2HWHA 3S01A 3EGVA 2HNZA 2VA2A 4YEAA 2DRAA 1NO8A 1VQ5S 2ZBRA 2C28A 4P2MA 2CNNB 3F44A 3HK2A 3DM2B 1U0SA 2H48B 2UXCJ 1CS4B 5IM0A 2DNMA 4OIXA 4X4RA 4YUDA 1MLAA 4X62J 1OS5A 2E5HA 3TOQA 4KFBB 1RT4A 1SJ4P 2HVEA 4JV5F 2R42A 4LIRA 3ILIA 3B82A 4ZLPA 2DY1A 2VOOA 1ZPVA 3N0VA 2FZGB 4JYAF 1RWVB 1MMLA 3JQJA 1HL6A 4LF4F 3RTVA 3GWCA 2M88A 1FO1A 1N54B 5IV3A 4PQUB 9RUBA 4ZITA 2FVPA 3CC4S 1TL3A 1YKWA 2QX0A 3BPDA 2NLWA 3T6JA 2BVZA 4DR2J 4USJC 4B08A 2O1PA 3S8SA 3H90A 3CDBA 3HZEA 1T9XA 4F04B 1T05A 2VJVA 2ZBIA 4DV2F 3GU0A 3N4WA 2V50A 3PNIA 3JSRA 3W9IA 3CJTA 5ETVA 2I9SA 2R2SA 3P4UB 3NOCA 4ZPDA 1U02A 1RYSA 3D54A 5B0DA 3ENAA 2HLTA 1NAQA 4CO3A 4DPWA 2OGUA 3NNCA 3QT7A 3I0RA 2HFUA 1N33J 2FHOB 3OD2A 5I42A 4LF7J 3DLHA 3PYGA 1KD1T 1IWGA 3CNQP 3GFYA 9ATCB 2GAGC 4OV1A 5AXMA 2V9WA 2GNKA 3E01B 4FF1A 2YKAA 5EDWA 4DV3J 3M32A 3BSCA 2WAQD 4WKRA 4ZOSA 1LWFB 4LF6F 2UXBJ 3OR1A 4KE5A 1PJ6A 1KC8T 2DNLA 5A0YB 1JJCB 2ZKUA 2QSFA 2OFGX 1BD6A 1EAYC 1VGYA 2VBZA 4DX5A 4ZIVA 1V5IB 4RW7B 1NPKA 1FERA 2POKA 1Y10A 2VC1A 5EWFA 4HH1A 3C14B 2R2UA 3K5OA 2Z2YB 4F2SA 3W2WB 2O67A 2ZH5A 3FSYA 5IFMA 4ERDA 3V4IA 3G4SS 2NZCA 4F3QA 3GE9A 2Y1RI 1E6VB 4XPCA 5H1SV 3IGVA 2BW7A 4UZBA 2E9TA 3VCDA 1SV5A 4X4SA 3GMGA 2ZOFA 2QE5A 2QLFB 4DCJB 1NCLA 2Y8WA 1R6VA 2AYEA 4ZP8A 2LP4A 3PY8A 3K5MA 4P2XA 2B8PA 3MM9B 3SDEA 2LA4A 3DOMA 4K0KJ 5K14B 2YX1A 4NLYA 2DCLA 5ETMA 4MT1A 2Y9HA 3RBXA 3A12A 4DFMA 4OJGA 4IG0B 2XCAA 1Z2LA 3DGVA 3VGTA 2BQRA 3JS9A 2HQGA 3C8YA 3I0SA 2AYMA 2G2ZA 1KONA 4OHYA 4FBUA 2WW4A 4RW8A 1VK3A 1UVLA 4L72B 1N6QA 3SQGA 2L9WA 3KK3B 4DHVA 1I94F 1TAUA 3HO1A 4JI1F 4H4KA 1AROP 1X9SA 4H54A 3HJFA 4YB6A 4C7QA 1M5OC 3FBBA 2B6AB 4DL3A 1N32J 1KTVA 2HSEB 3OQ2A 2MPUA 4ZK7M 3TANA 4R8UB 1HNIA 1H0HB 2OPSA 1J5EF 1HI0P 1JWWA 1YQHA 3W62A 2AEJA 2V6AA 4RW9A 2LU2A 1U1MA 2D3UA 1D0EA 2AD9A 2JWNA 1N5YA 3SFUA 2PO4A 1U6BA 1KN6A 4QR1A 2B9WA 4DL6A 3EPGA 3CT9A 5F8HA 2LEPA 3JQMA 1VRUA 2I8EA 1F9HA 2FY1A 3KHRA 4RW6B 1HA1A 3EPIA 2B4VA 4NMXA 3CCLS 1NKBA 5GAHI 1RHUB 3V4MA 4IUFA 4X4PA 2QG9B 2Y1LB 3EMTA 5KFBA 2FQQB 5GAGU 1U0HA 1UWBA 3DC2A 1NSKL 3N28A 4YDDB 2N3OA 3ITHA 5CYMB 2R8IA 1I6JA 2XSJB 1KVJA 1URRA 4ES3A 3PX6A 2WOMB 2V2VA 2BACA 2XC9A 2VONA 4K4TA 1OPIA 2IJRA 4PYAA 2H4YB 4KSEB 3I4PA 3MM8A 3IBCB 1DURA 4HL9A 1IJFB 3JTPA 2CQPA 2HK2A 3V6KA 4IOAQ 3LUYA 4C0HA 3QAEA 1HD1A 2FZCB 4C3MA 3Q8QB 4KQZA 1Q53A 3MTKA 4WCEQ 4IFYA 2JL9A 1LV5A 2AJ1A 1SH3A 3BR9A 4B3OA 2NQPA 4PPDA 1VQYA 2HAFA 1N5VA 1RYRA 3UI3A 4JYAJ 2E5GA 4GRSA 4AL6A 3QRQA 4LR9A 4R25A 4NLRA 2Q3PA 3QIPA 3M4XA 1GK8A 4C8KA 2C3MA 3VV2B 3GLJA 1UPMB 4WIIA 3LO3A 2X3GA 4A48A 1PJ5A 4DCOB 5A76A 1U1RA 4KKOA 2DR6A 3Q8VA 3GTYX 3HHDA 1OYEA 2JEIA 2XS7A 2MDAA 3MOJB 5ETKA 1F6TA 1N0VC 5KFWA 2DGUA 5FDLA 4USMA 2KYZA 1FESA 1B3TA 4K5SA 1L3SA 4LRAA 3C16A 1CPZA 2DR7A 4I2PB 3J7YU 2ZOGA 3EGWB 3TX8A 1WDTA 4FYXB 2HRYA 2QTWA 3RU0A 3GJRB 4UQGA 2GQCA 4WU2A 1VQ6S 2V2QA 3CD7A 3D68A 1XBWA 1AZSB 2DH8A 2KB2A 3NG8A 1RLCL 1UEKA 2HBZB 5D3GB 4KTQA 5J2NB 2KI2A 5EWEA 4CYUB 1SVDA 1EB0A 4G1IA 2BABA 5KFQA 4WP8A 4DV4J 5F3ZA 2J6TA 4ID5B 1FK9B 2XI3A 1VISA 5KOXA 4ZJQA 2IBOA 5GADI 3BKFA 4O3SA 4DR4J 2IA0A 3CIMA 2QLJB 1O0PA 1NH7A 4O3RA 1HQEB 2BW2A 2DISA 3G8QA 4NI2B 4OZ2A 1LWCB 4DV0F 4AFFA 4QOTA 3NBPA 3HP6A 1NKEA 3QIDA 5FJ4A 4AL7A 4Q8FA 4OZLA 3PR4A 5F8NA 1N5SA 3FBFA 2F4VJ 4OJ3A 1H74A 2DNYA 4C97A 4A8QA 4WIQA 4OX9F 4GVLA 3V6DB 4CIOA 2VPYB 4NXNF 4USIA 3KK1A 2VZ9A 5KAKA 2PA8D 5D4OA 4IR9A 3BDPA 2ZWOA 1VQNS 1HWIA 4PG7A 4Q0BB 1YBUA 5F0UA 1WACA 3OTDA 1PBAA 1RWXB 3FRYA 1TQLA 4KHPF 2RUGA 3EYZA 4S0MA 1QY7A 1DLOB 1PILA 4X65F 4FF2A 4TU9A 3MEDB 3D67A 3AD9C 1F2HA 2VKRA 4GC7A 2AV5A 3NWGA 1EIYB 4LVNP 2ALYB 4JI3J 3DDIA 3MR5A 2V4JB 1KVIA 2JEJA 3R5CA 4DS5A 1FRJA 1KR4A 4RNFA 5C42A 5C24B 1CULB 4FXDA 4V1Ak 2ASYA 2RSQA 4OQJA 2H5EA 2L08A 4G1PA 4X4VA 2XG8A 2V5HG 1HKAA 3N6MA 5M2UA 3WBZA 5C7PA 4ITSA 1VLOA 3PTWA 2KT5A 3VAGA 2JFDA 1S1XB 2IDLA 2BJDA 1RA7A 2W9AA 1DTTB 3IC1A 1XR6A 1YJ7A 1DY3A 4IKAA 1HMVA 4P2SA 3C6TB 1JNZB 1R31A 3LTOA 3US5A 3I4HX 3X1LB 1PKUA 2QN6B 4X64J 1JLAA 3KMQA 4ZPAA 4PRFA 1R0AB 1H73A 4DDFA 1IN0A 4F2RA 4ELVA 3PV8A 4AL5A 3QJLA 1PC5A 1PAUB 1RAIB 4KGXB 3A8KA 5G0RB 3DRSA 4DS4A 1Q8KA 4B3MF 4UOCA 2ZH4A 3AD7C 5HMYA 4EZ9A 4EYIB 2YX4A 4GKKF 2DRBA 3OXGA 4NASA 1X4GA 5KOWA 3R7BB 1S9GA 2CKWA 1S72S 4DV1F 4AXIA 1UJ5A 1YI2S 4EBCA 1XMQF 3QYYA 2YKNA 4K8RA 4O3NA 2X3DA 2KU7A 3D6TB 5DM7Q 2YWKA 5DO2A 2PSZA 1LWEB 2Y3YA 5CHCB 4PWDB 1FEEA 1C1CA 1RTZA 3OV7A 2G2YA 1A6LA 2G0JA 2PE8A 2E1MC 2K06A 5AT1B 4KPYA 3QMQA 2KJVA 2DNPA 1C0TA 4A47A 2J9EA 3TJ9A 1NHVA 4DI6A 3LP2A 2CNKB 1JXEA 4QCLA 3VZHA 3OL9A 1D3WA 2MGZA 3GZ7A 4OZJA 5HJXA 3D1HA 2VJUA 4DN9A 3UCUP 3GSDA 2W2NP 2LLZA 3A1YG 1U1LA 4ZVQB 2XLIA 1JLGB 3ETMA 3KNGA 1V6HA 3D3BJ 3M7VA 3UD5A 3BGUA 4WZQA 3OFGA 2WBRA 3AJDA 4HACA 2CNLB 2XY7A 3CJ0A 3TAQA 3O44A 2KJWA 1J2VA 3F0NA 2ZBPA 1TUVA 2VIHA 5MLCV 4LVOP 1CEZA 1WI6A 2CQ3A 3TA1A 1FT8A 3EWGA 3MEGA 2VG6B 2DBBA 1NU4A 3HCXA 3H7HB 1TMJA 5HN0A 2V0NA 2UUTA 2CDQA 1N36F 2GIRA 4WP9A 3B78A 4MKYA 2BEFA 4NL5A 2A2DA 2ZFHA 3RRGA 2XY5A 3V81A 1YK9A 2LQJA 1QVGR 2RQKA 3BSNA 4N41A 2XQCA 2HFOA 3NWRA 5LMNF 1S1UB 3HVTB 2CDRB 2V69A 3IR5B 1HHQA 2XWXA 3CCZA 3UCZP 2V8PA 1LK7A 5H9FJ 2EPIA 3R5AA 1BQMB 5T7LA 3DRPA 2H54B 2UU9F 2MLYA 1CBKA 3I96A 3S6EA 4HI2A 3MR2A 2PEHA 1BQNB 2M3DA 3QRRA 3UVJA 2HMIA 4JI4F 2IFXA 5FIIA 1Y9OA 1U1KA 1NNDA 1NZAA 2ZUGA 2QMWA 4FF3A 1FRXA 1RT3B 4ZJOA 4LBIA 1R6YA 3QGGA 1N8RT 1CJTB 1VC5A 2FJDB 3DLGA 2DH9A 4M8LA 3IA0A 5HQMA 2M2BA 2ASDA 3PYDA 2G0CA 4YQWA 1VCTA 2GJIA 2KDOA 1N34F 3OUYA 3AA8A 2ASLA 2DT9A 5GMEA 1HHSA 2J7KA 4RBVA 3EVWA 2VPXB 2J9DE 1M5PC 4ED7A 1U1OA 4ED2A 1WUUA 1C1BB 1S1TA 2HQDA 4NA2A 4ZVHA 2CPDA 2Q1LA 2CQHA 1IKVA 2Q6CA 1FTCA 2RIJA 3POTB 3J7A1 2MSTA 3HHLA 1NHUA 3GJTB 4LUBA 4KY3A 3OFEA 2GJFA 1RAHB 4NYPA 3FKBA 4RO0A 1WELA 2QL7B 4OX7A 1M0SA 4GVBA 2OSQA 2E5LJ 4DWIA 1R0BG 5DLGA 3OL6A 1FNOA 3DN9A 1S5ZA 3D0IE 4F36A 2V8VA 2DIUA 4XDDA 4MFBA 2ZD1B 1F2GA 5KFJA 3PZPA 1RHKB 4JUZA 2VQFJ 5HMXA 1VRTA 3CJRA 2IHR1 2GQQA 3ET6B 1LK5A 3IBFB 4W4MA 5GMDA 4I67A 4YR3A 1F3FA 1YJTA 4KPCA 3DRRA 1SKRA 1H7WA 2GGPB 5D4LA 1HQUA 2DGQA 2AJQA 4OZ1A 4U95A 2IRUA 2B5JB 3W9JA 1TAQA 3OL8A 5B0BA 1KDNA 1NB2A 2DTJA 4HTIA 4HHUA 2HWTA 5HBMA 3UPFA 2UVVA 2F4FA 3HM9A 5KG1A 2AX1A 2FLPA 2WRMA 3O2IA 3ZZRA 3CCWA 4E2FB 5LSLA 2GS8A 3PG9A 2XSFA 3I82A 3C6UB 2AW0A 2Y0BB 3AQPA 2LXIA 4DX6A 3MAAA 3G8SA 2FHJD 1IWAA 4C11B 2Y8YA 2L3MA 3QSYB 4MYTA 2ZNZA 2NUHA 2ADBA 2W8KA 4YN3B 2UP1A 3DRYA 3SCJE 1WF1A 5DDOC 3GJSB 1XMOJ 3A3OB 3KK2A 4XIUA 3KOAA 1VQOS 5KTQA 2HZVA 1DHMA 1IQTA 4F02A 1S7IA 5I3UB 1G3OA 1QSYA 1HBUB 5ADZA 2JOQA 3BDEA 5A2QY 2ZH3A 1VQ4S 1S48A 3R2CJ 2DGOA 3LF0A 3FCVA 3IFEA 3Q8RB 5U47A 4RU2A 4PG4A 3GIRA 2CG4A 2KO1A 4WTYA 3ZTSA 3BGRA 2KTQA 4B3MJ 1FJEB 2PA3A 3BQ1A 4NLQA 4QR0A 1YJWS 5EX0A 1RAOA 3KLIB 3DLBA 1DQ8A 2HK3A 1WSVA 4NLOA 2ATCB 4PWWA 3SCKE 2WONA 4X4TA 3QGIA 3A3NB 3MECA 4QIGA 3CSKA 4DCPB 1OMSA 2N4DA 3U02A 1FWKA 1YDLA 4M1KA 3KWMA 2FLLA 2W7OA 3MPDA 4DUZJ 1HLWA 3TYTA 4F4AA 5ETNA 2YNFA 4UOHA 1UP1A 5L46A 2P2CB 2GVZA 4CTAA 4PYDA 3CJSA 3J81Y 4H4MA 5KFGA 1TKDA 5IM0B 3DI6A 2EFPA 2B8QA 4K2JA 3VQSA 2JVRA 3T19A 4EUVA 3P8BB 4KAIA 2CJAA 4P7VA 2WSFC 3KDOA 4IOBA 2DO0A 4Y2MA 1JLEA 5HAOA 2BE9B 4GKJJ 4O44B 4ZPWR 2ERRA 4C8MA 3KG4A 1P6TA 1WG1A 2Z57B 4DQQA 5L9NA 1RJJA 1RTJA 3HLUA 5A8WB 3DYAA 2F63A 1IR1A 2WVEA 2V9KA 4OJHA 5B0FA 2R4FA 3FZ2A 4HVZA 2IVYA 2DGVA 1P1LA 2AP6A 1TL3B 2FLOA 1FD2A 3N5BA 4F25A 3HFVA 2GW8A 1KS2A 4F0KA 2HHPA 3WC0A 5CZVA 5IT9U 1V3ZA 1K0TA 3RBZA 4CH0S 2FC9A 3THVA 2DO4A 3CJKA 4H4KC 4Y3CA 1T05B 2JJ4D 4HR2A 3BF4A 4OHXA 1RI7A 1G6BA 4B3RJ 2IM3A 1RT6A 4ZVUB 1S7HA 3Q24A 2N3LA 2HBQB 4UF4A 2C2OB 3DLEA 4TN2A 2B4PA 3AOAA 3DRXA 3ONQA 5LJ5Y 3ZZPA 4UQTA 8ATCB 4XK8C 2L41A 2MY7A 2X1GA 2RRAA 2X1FA 2P6TA 2Q66A 2CJBA 4OV6A 5KFVA 4OI1A 4OX8A 1WOSA 4NLWA 3I0RB 1GX6A 3MMCB 2JX2A 1EHWA 4IR1A 1BUXA 1HFEL 1GXLA 4NMLA 1WHXA 3I87A 4JI8F 2ZJQQ 4EZ6A 3GB0A 1BQXA 3GFZA 4LIWA 4YHHJ 4K59A 1GMUA 5DQIA 3GONA 3H5XA 2GHPA 4Y0FA 1VYAA 3K89A 3W3SA 1OYDA 3VAIA 4PKDB 2YNGA 4DG1A 1LQ9A 3NMAA 1RDRA 2MZQA 2R9LA 1N34J 4RX6A 2EK6A 3MEKA 1XR7A 3TAPA 4N76A 2UUAJ 2EKYA 4O3QA 4F4ZA 3OTBA 3SBMA 3PEHA 2VDIA 2ZZTA 3OHAA 1LFPA 1FKPA 3D5MA 5AJ3J 2NXEA 2DGTA 1D8YA 2J76E 3TJ8A 4E98A 4ES2A 2Z2ZA 1R8BA 3PRBA 5GAEU 5KT3A 1RWNB 2J9CA 4B9TA 3NKYA 1NSQA 2KN4A 3CMES 3R3TA 1N5QA 1SV5B 2Z2LA 2W2OP 3PACA 1G4CA 1EETA 3C3LA 2KZMA 4JI0J 3JSMA 3CCRS 3PHTA 4I2QA 1R8AA 3MWBA 1GH8A 3DOMB 5J2MA 1K44A 3C2PA 3M8WA 3TVYA 4N8NA 1FTRA 4P10A 4DZDA 2BJEA 1F9EB 4CO4A 5KFFA 1WKJA 3BBBA 3SYZA 2XI2A 3CPWR 4Q8EA 4J9OA 2XMAA 4U8YA 1F1BB 4PEOA 1RT5A 2ROPA 4NRUA 3MXHP 1FKOA 5CZXA 2DNKA 3UCGA 1TKXA 4RW8B 1Y7PA 5DJBA 1N6QB 5THWA 1B0PA 3R6LB 2HS3A 4K2XA 1SI9A 2MKKA 4DQIA 5HATA 1XNQJ 2DHSA 2FHKA 1SQEA 1XERA 4Q45A 4DX8H 5DGBA 2W7PA 3PX4A 2WSCC 3HX9A 1S0NA 3TVZA 5J2PA 1FEHA 3PW4A 1Y5NB 3PO4A 2Q79A 1HNIB 2BJ9A 1VRQC 1N0UA 2OPSB 5KG3A 3PYFA 3Q86A 3OTOF
chains in the Genus database with same CATH topology
4TLRA 5HMZA 1T05A 1NEEA 1NJZA 3CD0A 4X4UA 2LEBA 3NGDA 2EVZA 5KFDA 2UVRA 4LSLA 3NCQA 4XAKA 2ZBIA 4Y2KA 5CQGA 2UXCF 4DV2F 1AFJA 1APSA 3CTRA 1X0FA 2MHNA 1N5YB 1S76D 3TAMB 5EGYA 4FS1A 3MM6B 1S6PA 2FVCA 4O23A 3UDLA 4X62F 3N4WA 3IN5A 1HWUA 1C0TB 4C3LA 1JLFB 1BLUA 2HNYB 2DNNA 2P5VA 5DDPC 1TVRB 1XTZA 1TFWA 3PW7A 3T6BA 3DHWC 3OVAA 3PNIA 3KLFA 3JSRA 3G6XA 1ZOTA 2I9SA 1T8EA 5LXRA 4ZA1A 2R2SA 2CQDA 3CC7S 4DJBA 1SJ1A 1U4BA 3LW5C 4C8YA 5IZHA 1UVIA 4PWUA 3IG1B 1XR5A 2VG7A 3ICLA 1T95A 3K5LA 3EGZA 3IWLA 1S6UA 4D3HA 4ZPDA 5ITHA 2DJWA 3OL7A 3CE8A 1RT2A 4YFUA 1RYSA 3D54A 5BJRA 5L1KA 3F41A 5B0DA 4A4JA 1DQ9A 2HLTA 1NAQA 2WSEC 3DU6A 2HVHA 2W4PA 3KKFA 2R7SA 3GG0A 4CO3A 4I69A 3P3DA 4ETXA 1C2PA 2LYVA 3H8YA 1WHWA 4ED3A 2BM0A 1UWBB 1YJVA 5DGAA 3NNCA 4GO7X 1XNQF 2RKIB 3I0RA 4PCQA 5B7WA 6FD1A 1ZYQA 2UVWA 2J0QD 4DR3F 2FHOB 6FDRA 2VODA 2GX8A 4M5DA 2W9CA 4KT0C 2C2EA 5I42A 2GO9A 2QIFA 3HKWA 2QFJA 2E9RX 2KRBA 2MQOA 3DLHA 1P9QC 5CXTA 2YNHB 1KD1T 4C8OA 1S4FA 3GFYA 3FZBA 4OV1A 1C4AA 4HKQA 5AXMA 3M1VA 4DR2F 2V9WA 4DQSA 2GNKA 3MM8B 3E01B 4ZVFA 1XWLA 1WTBA 2VFSA 1D9AA 4FF1A 2YKAA 1IQZA 5EDWA 4KV8B 3M32A 3BSCA 2E5JA 2WAQD 3RZAA 1TKZB 4C8LA 4WKRA 4ZOSA 2AJ0A 3H25A 1H98A 3DDNA 1LWFB 3OBIA 4LF6F 3ZZOA 2E9ZA 3ZFVA 3T5JA 3TI0A 4A46A 3OR1A 4KE5A 4ZKAA 1KC8T 1Y3KA 3QJJA 2DNLA 2B43A 5A0YB 2HFNA 2ZKUA 2QSFA 2OFGX 1JLBB 2K3KA 3I31A 1BD6A 4I0WA 4USHA 1ZM2A 3VAKA 2FD2A 3OXFA 5L9XA 1VGYA 4WU3A 4DOZA 7FDRA 2VBZA 2AJ4A 3PHEA 2A3JA 1LW2B 3KLEB 1KFDA 2QMXA 4QIWD 4ELTA 2GQ2A 4ZCKA 4RW7B 2G13A 4DL7A 2IAJB 1YHQS 4EYHB 1VS3A 5E7OB 2RNEA 4B3OB 5CCLA 4ZMMA 1DAXA 1U2FA 1VMBA 1JJHA 1FERA 2POKA 3OVBA 4G3IA 3SMZA 2Q6BA 3GV7B 3KLGA 3FVYA 2VC1A 1SIZA 2FJEB 5EWFA 4HH1A 3BN4A 4CT8A 2ZITA 2R2UA 2PD1A 3K5OA 3BS9A 4TY8B 2L9DA 2RMLA 5D77A 2B51A 2NS1B 2O67A 3W2WB 5BYSA 1JB0C 2ZH5A 2DGXA 3BZQA 1S77D 4TKTA 1N88A 3FSYA 4NLTA 5IFM