3E0KA

Crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
146
Chain Sequence
AEQVRQAGIDDIGGILELIHPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFRKSKILALDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amino-acid acetyltransferase
publication title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
total genus 33
structure length 146
sequence length 148
ec nomenclature ec 2.3.1.1: Amino-acid N-acetyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3e0kA00
2B58A 3IWGA 4Y49C 4KOSA 2P0WA 4MHDA 1TIQA 1YLEA 2PRBA 1XMTA 2WPXA 3DR8A 4AB7A 3FYNA 2BEIA 4BMHA 2R7HA 2Q04A 2G0BA 2D4PA 1M4IA 2CNSA 1NSLA 4AVAA 1WK4A 3G3SA 4K30A 4B5PB 4Y49B 3T90A 1QSOA 1YVKA 3DDDA 3R9EA 5I0CA 4E2AA 1S7KA 2AJ6A 3S6KA 3TFYA 4JLYA 3KKWA 2HUZA 1MJ9A 4KOWA 2Q44A 1KZFA 1J4JA 4AG9A 3VWDA 4JXQA 4MBUA 2EVNA 3MGDA 4UWIA 1Q2CA 4KOVA 4B5OA 5CNPA 5IX3A 4KVXA 4PK2A 2REFA 3TT2A 1U6MA 4E8OA 2VBQA 2CY2A 4NEXA 3R9GA 1PUAA 2JDDA 2K5TA 4KUAA 1CM0A 5F49A 1VKCA 2QECA 5EBVA 4FD5A 3NE7A 5IB0A 4QB9A 2ZXVA 4NSQA 2Z11A 4XPDC 3GKRA 1YX0A 2J8RA 1N71A 2X7BA 3D8PA 4LUAA 3S6HA 2FT0A 4AVBA 2I79A 2F5IA 4IUSA 2R1IA 3D2PA 2B3VA 3CXPA 3PP9A 4XPDB 2P6EA 2Q4YA 2CNTA 3BJ7A 5KTDA 1M4GA 1Q2DA 4YRHA 3PGPA 1PU9A 4I49A 2P6GA 4FD7A 3DNSA 4KORA 1S7LA 2B5GB 5DWNA 3W6SA 2FSRA 1L0CA 2A4NA 5HH1A 4ONUA 2JLMA 1Q2YA 4F6AA 4U5YA 1Y9KA 1YGHA 4HNWB 2FIWA 2VI7A 3FRMA 4JXRA 3TOBA 3QB8A 5IV0A 3JVNA 4M85A 4M3SA 3DSBA 2B4BA 1XF8A 3R95A 4LX9A 4R87A 3EFAA 1XE4A 4HKFA 5C88A 2ZW7A 4E0AA 1YR0A 4FD6A 1IICA 5KTAA 3V8IA 3R1KA 4RS2A 1VHSA 4XNHC 3TCVA 5F46A 2EUIA 2RC4A 4CAVA 2G3AA 2FXFA 4OLLA 3I9SA 2IL4A 1Z4RA 4XNHB 2BUEA 2J8NA 4KUBA 1MK4A 1QSRA 3TE4A 3QAHA 2Y0MA 3FBUA 1S60A 2GANA 4H89A 3TO6A 3H4QA 3R9FA 2D4OA 2Z0ZA 2ZPAA 2PQ8A 2JEVA 3LD2A 4MI4A 1RXTA 1M44A 4CRZB 3W91A 1BOBA 4KOXA 4YFJA 4KOTA 3K9UA 4U9YA 2GIVA 2Q7BA 4KLVA 5H84A 2BSWA 4UBRA 4JWPA 4OAEA 3SHPA 3PZJA 2ZW5A 1Y9WA 4UA3A 5EC4A 1UFHA 5DWMA 2GE3A 5FVJA 4ZBGA 3JUWA 3TOAA 4H6ZA 1IYKA 1GHEA 4KLWA 4PSWA 5H86A 2J8MA 1KUXA 3FB3A 2PR8A 5J8FA 4QBJA 3EC4A 2Q0YA 1MJBA 1IIDA 4JD6A 4R3KA 3SXNA 1SQHA 1B6BA 2P6FA 4FD4A 4XPKA 2B4DA 2ZW6A 4CAXA 1M1DA 1XEBA 2OZGA 2PC1A 5JPHA 3ZJ0A 1KUVA 1NMTA 3R96A 3FIXA 3B8GA 3I3GA 4PK3A 1V0CA 1LRZA 1MJAA 4KVOE 4QUSA 1S3ZA 4L8AA 3GY9A 3VWEA 4KOUA 2FL4A 4RI1A 4ORFA 4GS4A 1FY7A 4R57A 3IGRA 2HQYA 4QC6A 2H5MA 2CNMA 3CXQA 2VEZA 2BL1A 1I21A 2KCWA 4NXYA 3OWCA 3F5BA 3GYAA 5GCNA 1RO5A 2OB0A 4U9ZA 3S6FA 1R57A 2HV2A 4AVCA 2O28A 2OZHA 4NF1A 2R98A 1Z9UA 3F0AA 2Z10A 1IB1E 2DXQA 2JDCA 4H6UA 4OADA 1B87A 3EY5A 2QIRA 4PSXA 4CAWA 4UWJA 1P0HA 2C27A 3DR6A 1K4JA 1BO4A 4L89A 4R9MA 5F47A 3F8KA 1QSNA 2FE7A 4B5PA 5J8CA 5JQ4A 2R8VA 1S7NA 3LODA 5F48A 1QSTA 2PDOA 1KUYA 3S6GA 4KOYA 2VXKA 4X5KA 3ZZIA 3TO9A 3D3SA 5C82A 4II9A 1NE9A 1WWZA 3P2HA 2OZUA 3EO4A 1S7FA 1Z4EA 4MY3A 4R3LA 2B3UA 4KZTA 1P4NA 4EVYA 2ZW4A 3CXSA 3EXNA 3UY5A 2G3TA 1YREA 2ARHA 4KVME 3BLNA 1I1DA 2VZZA 2B4DB 2AE6A 1I12A 3TO7A 3E0KA 3P2FA 2Q4VA 1OZPA 4JJXA 3SXOA 2VQYA 1IYLA 4AG7A 2VZYA 4MY0A 2REEA 3N7ZA 1QSMA 2I00A 3C26A 3BJ8A 2QMLA 5ISVA 4HNXB 1CJWA 4F0YA 4DNCA 3TTHA 2PSWA 2ATRA 3FXTA 4HNYB 1YK3A 2WPWA 4CRYB 3T9YA 4YGOA 2PR1A 2FS5A 3G8WA 4IF5A 4QVTA 3RYOA 2FIAA 3FNCA 4PV6A 3W6XA 1Y7RA 2OH1A 1XIXA 1ON0A 2OU2A 1S5KA 2B5GA 4NCZA 5HMNA 5KTCA 4CS0B 1M4DA 1YVOA 4XPLA 3WR7A 3D2MA 4J3GA 2NMTA 4MJ8A 2FCKA 5E96A
chains in the Genus database with same CATH superfamily
4UF4A 2YNDA 2B58A 3IWGA 4Y49C 4JZ0A 4KOSA 2P0WA 4MHDA 1VGYA 1TIQA 1YLEA 5CBMA 2PRBA 3NH5A 1XMTA 2BOAA 4MFPA 2WPXA 3DR8A 4AB7A 3FYNA 2BEIA 4M6HA 1BAVA 1XFOA 3B3SA 4BMHA 2R7HA 4A2ZA 2Q04A 2G0BA 2D4PA 3FX6A 1M4IA 2CNSA 2Z3KA 1HDUA 1NSLA 3FVLA 4AVAA 1LCPA 1WK4A 4FUUA 3G3SA 4UFWA 3I1UA 2CF4A 4K30A 4OC2A 4EMEA 2ZELA 4B5PB 4Y49B 2Q43A 4CGLA 3T90A 1QSOA 1YVKA 2EBJA 4B13A 4H2KA 3RAMA 2ANPA 3DDDA 1JQGA 3R9EA 5I0CA 4C7IA 2ZEMA 4E2AA 4MXUA 1S7KA 2AJ6A 2PVVA 4UCNA 2DF5A 4OC5A 2O4HA 2ZEGA 1DTDA 2PJBA 4R6TA 3S6KA 3TFYA 4JLYA 5AG4A 3KKWA 3GLJA 3WABA 1Z2LA 2HUZA 3D68A 1MJ9A 3IEHA 4KOWA 2Q44A 2Q4ZA 1KZFA 5HVHA 2FVGA 2Z3PA 1J4JA 4A33A 2CTBA 4AG9A 4PXEA 3VWDA 4NJQA 1YMEA 4JXQA 2JBKA 2PJ4A 2EVNA 3MGDA 4MBUA 4PPZA 4UWIA 5LYLA 4B6ZA 1Q2CA 4X3RA 2ZEHA 4KOVA 3BXMA 1XBUA 4B5OA 3NH4A 5CNPA 5IX3A 4KVXA 4PK2A 2REFA 4MCQA 3TT2A 1X12A 2YGWA 3TX8A 2PJCA 2NYQA 4MHYA 1U6MA 2DPSA 4E8OA 2VBQA 3KHZA 2CY2A 1FT7A 4OC4A 4RUHA 4NEXA 3NA6A 3R9GA 1PUAA 2JDDA 3V7ZA 2K5TA 5J1QA 4KUAA 2ZEOA 4ONWA 1QQ9A 3FF3A 1CM0A 1VIXA 5F49A 2V8DA 2Z3NA 1VKCA 3NE8A 5HVFA 2QECA 3NH8A 5EBVA 4UIBA 4YWYA 3KR4A 4FD5A 3NE7A 5IB0A 4PXBA 4QB9A 1Z8TA 2ZXVA 4B11A 4CGPA 4NSQA 2Z11A 5A27A 1QMUA 4XPDC 4X8IA 3GKRA 5AG6A 4CGMA 1CP7A 3S9MA 1YX0A 2J8RA 4Z65A 3ISZA 1JWQA 1N71A 4YU9A 2X7BA 3D8PA 2WSAA 8CPAA 4LUAA 3S6HA 2Z3MA 4PXDA 3QAYA 2FT0A 3WC5A 3DGVA 4AVBA 4NJRA 4WJBA 2WYRA 2I79A 2Q7SA 2F5IA 2HB6A 4IUSA 2R1IA 1GYTA 2AFSA 2QYVA 3D2PA 2B3VA 1Z8WA 3CXPA 3HUVA 3PP9A 4Q38A 4XPDB 4ZX9A 2P6EA 1TKHA 2Q4YA 2CNTA 3BJ7A 4O23A 5KTDA 3KHXA 3S9LA 1M4GA 3IFEA 1Q2DA 4YRHA 3PGPA 4G1PA 3IWWA 2ZENA 4P4JA 1PU9A 3SJFA 4I49A 3GIUA 2P6GA 4FD7A 1EE3P 3DNSA 4KORA 4PQAA 1CP6A 1S7LA 2Q51A 4OMEA 3RZAA 4NGSA 2O53A 2B5GB 4KSAA 2PJAA 5DWNA 3W6SA 2FSRA 1L0CA 2A4NA 5HH1A 2ODFA 4ONUA 2JLMA 2DPTA 4MRIA 1ELLP 1Q2YA 1YW4A 3B3VA 4IHMA 4F6AA 3WC7A 4U5YA 2PJ9A 4P10A 5I4MA 1Y9KA 1YLOA 1YGHA 4F9UA 4HNWB 5THWA 2FIWA 2VI7A 6CPAA 4MCSA 3FRMA 4JXRA 2PJ6A 2PIYA 3TOBA 1Z5RA 2PJ5A 1H8LA 3IU1A 4P4BA 4FBEA 3QB8A 3GB0A 1CPSA 1TKFA 2GLFA 3JVNA 4M85A 4M3SA 4OC0A 4P44A 5IV0A 3DSBA 2B4BA 2PJ7A 1XF8A 4KSFA 2PVWA 3R95A 4EFDA 4MCRA 4LX9A 4CAFA 3IC1A 4R87A 3EFAA 1XE4A 3D7GA 4CAEA 4P4IA 4HKFA 2RFHA 1PYTB 1DE4C 3LMSA 4ZGYB 3LWUA 2ZW7A 1CX8A 5C88A 4E0AA 2GU2A 4OKOA 1Y0YA 3NFZA 4DYOA 1YR0A 4FD6A 5G20A 1IICA 4ZY2A 5KTAA 4MFKA 4R7MA 2HC9A 2AFMA 3V8IA 3R1KA 4RS2A 5DS0A 4IAVA 5JGFA 1VHSA 3QNVA 4RN7A 4XNHC 3PB4X 3TCVA 5F46A 4MFZA 2EUIA 2RC4A 4CAVA 2CXAA 4CGNA 4UEFA 2JBJA 5G22A 3CPXA 2IJZA 4F0XA 2G3AA 2FXFA 2XEIA 4TNUA 5LYDA 5HXDA 3FEDA 4MFLA 2Z3OA 2IMOA 4OLLA 3I9SA 2IL4A 1Q7LA 1Z4RA 4R76A 3PB9X 2PJ8A 1IY7A 4OIDA 5LRKA 4XNHB 4ZY1A 2BUEA 2J8NA 2V8GA 4NFRA 4B10A 4KUBA 1MK4A 1QSRA 1TXRA 1YSJA 3TE4A 3QAHA 3WC6A 4A31A 4A30A 2Y0MA 3FBUA 3BI1A 3D4UA 4CYPA 2EK8A 5LYFA 1S60A 4UFVA 2GANA 4H89A 3TO6A 3H4QA 3R9FA 3H8GA 2D4OA 3L2NA 3KGQA 4P4EA 2Z0ZA 2ZPAA 3PB8X 2C6PA 4NGNA 3SI2A 2PQ8A 3PEIA 4A32A 2JEVA 5JH9A 4NGMA 5F09A 3LD2A 2YNEA 3ISXA 3SJEA 4ZYQA 2C1CA 1CBXA 4MI4A 4TWEA 4A39A 2EK9A 1RXTA 1M44A 3KZWA 4A37A 3JTKA 3PB7X 4W9YA 4CRZB 3W91A 1BOBA 2C6CA 4OIWA 4OC1A 3PBBA 4OP4A 4UFXA 3IIBA 4CYOA 4KOXA 4P45A 3FH4A 4YFJA 4KOTA 5HVGA 3K9UA 5G21A 4U9YA 2GIVA 2Q7BA 4KLVA 5AG5A 5H84A 2BSWA 4UBRA 4NGPA 3KQXA 4JWPA 4OAEA 3SHPA 5K8MA 5D29A 3PZJA 2ZW5A 1Y9WA 4C2XA 5K8OA 4UA3A 5EC4A 3H5ZA 2PCUA 4WWVA 1UFHA 5DWMA 4EWTA 2GE3A 5FVJA 5A28A 3PFOA 1Y7EA 4NGQA 5CPAA 4ZBGA 1F57A 3JUWA 3CPAA 3TOAA 1FNOA 3SI0A 4H6ZA 1IYKA 1GHEA 4KLWA 1IU8A 4PSWA 1ZG9A 5H86A 3V38A 2J8MA 2V8HA 1KUXA 2PJ2A 1ELMP 2AFWA 3FB3A 2PR8A 3HLPA 5J8FA 3KQZA 4QBJA 5D8NA 5AGEA 1VHEA 2Q0YA 3EC4A 1MJBA 4P4FA 5K8NA 3D7FA 3K2KA 1IOFA 4OC3A 1IIDA 4JD6A 4AXVA 4R3KA 1M4LA 3B35A 4A95A 3SXNA 3KI9A 1B6BA 1SQHA 2P6FA 1HEEA 1UWYA 4FD4A 4XPKA 2DEAA 2B4DA 2ZW6A 3RNZA 4CAXA 1M1DA 1XEBA 2OZGA 3B7IA 2PC1A 5JPHA 3ZJ0A 1KUVA 2EO8A 1NMTA 1LOKA 2PJ0A 3R96A 3FIXA 3B8GA 3IU2A 3I3GA 4PK3A 3BI0A 4MFJA 2AFXA 1V0CA 1LRZA 3SI1A 1MJAA 4KVOE 4QUSA 1S3ZA 4MCPA 1Z8XA 3FMCA 4L8AA 3GY9A 1ZG7A 3VWEA 1VHOA 2IQ6A 3CDXA 2FL4A 4KOUA 4RI1A 3KASA 2ZEEA 4ORFA 4GS4A 1FY7A 4ZY0A 3B3WA 5EMIA 1Y0RA 4CGOA 4R57A 4C2YA 4DUKA 3IGRA 2HQYA 4QC6A 2H5MA 2ZEDA 1TF8A 1AMPA 4C7HA 2CNMA 4UCPA 3CXQA 2VEZA 1LANA 1A2ZA 4R8FA 2BL1A 1I21A 3PB6X 2KCWA 3PBEA 4NXYA 3T8WA 3OWCA 3F5BA 3GYAA 5GCNA 1RO5A 4FWUA 2OB0A 4U9ZA 3S6FA 4UEEA 1R57A 2V8VA 3N5FA 3RO0A 2HV2A 1XOVA 1YQEA 2O28A 3D7DA 3D66A 1ZG8A 2OZHA 4Q36A 2OOTA 4AVCA 4NF1A 2R98A 4Q7AA 1XRYA 1Z9UA 3F0AA 4UCMA 1BPNA 2Z10A 1IB1E 3FECA 5LYIA 3CT9A 1PCAA 2DXQA 1NSAA 2JDCA 5JM6A 4IK2A 2ZEPA 2WZNA 4H6UA 4OADA 1B87A 3EY5A 2QIRA 1BLLE 4PSXA 4MFQA 4BD9A 4MHNA 4X2TA 3A9LA 1CG2A 4CAWA 1XMBA 2XEJA 4UWJA 1P0HA 2EWBA 2C27A 2I3CA 2GLJA 3DR6A 2OR4A 1K4JA 2J9AA 1BO4A 7CPAA 5IB9A 2YNCA 5AG7A 4L89A 4R9MA 1F2OA 5F47A 3F8KA 1QSNA 2FE7A 4NGRA 2F8HA 4B5PA 5J8CA 5JQ4A 3PRTA 1CPXA 2R8VA 1S7NA 3LODA 5F48A 1QSTA 1ARLA 1ZLHA 1KUYA 2PDOA 4KOYA 4ZX8A 3D7HA 2PJ1A 2VXKA 3S6GA 1X10A 4FAIA 2POKA 4MMOA 4X5KA 3TO9A 3ZZIA 3D3SA 2AFZA 3MN8A 3MRUA 4NGTA 5C82A 3JRUA 4II9A 4M6IA 1NE9A 1WWZA 3IJ3A 3P2HA 2OZUA 3EO4A 1S7FA 1Z4EA 2ZOFA 2VL1A 4MY3A 4R3LA 1ARMA 2B3UA 4KZTA 1YW6A 1R3NA 1OBRA 3PFEA 2GFQA 1AYEA 1P4NA 2CTCA 1Z8LA 4EVYA 5BWAB 2QJ8A 2ZW4A 3CXSA 3EXNA 5ELYA 3GUXA 4B14A 3UY5A 1HDQA 4P4DA 3B3TA 2G3TA 1KWMA 2ZOGA 1YREA 2CIJA 1XJOA 2NSMA 2ARHA 4KVME 2PIZA 2Z3LA 1I1DA 2VZZA 3BLNA 3DLJA 3H8EA 3KR5A 2C6GA 4HPSA 1IOIA 2B4DB 2G9DA 4C2ZA 2AE6A 1I12A 1TF9A 4JYWA 3TO7A 3E0KA 3KL9A 4F8ZA 3P2FA 4MHPA 5LRGA 2ZEFA 2GREA 1IGBA 2QVPA 2RB7A 3D67A 2Q4VA 1OZPA 3FEEA 4JJXA 3SXOA 2VQYA 4ZI6A 1LFWA 1BPMA 1IYLA 4AG7A 2VZYA 4MY0A 2JEWA 4B12A 2REEA 1RTQA 2AFUA 4CPAA 4GM5A 2BCOA 2BO9A 2V77A 3N7ZA 1QSMA 4BINA 2I00A 3BHXA 3C26A 3BJ8A 4PXCA 2QMLA 1ZLIA 2PE3A 3IWEA 3CZXA 4UIAA 1LAMA 1AUGA 5ISVA 4HNXB 3SJGA 1CJWA 4F0YA 3VATA 4DNCA 3B3CA 3TTHA 4F9VA 2PJ3A 3IO1A 2PSWA 4LQ6A 2ATRA 3FXTA 3B2YA 4HNYB 1YK3A 2WPWA 1TKJA 4CRYB 3LACA 3T9YA 3K9TA 1F2PA 4YGOA 4LQGA 2PR1A 2FS5A 3G8WA 4IF5A 4QVTA 3TC8A 2XEGA 3RYOA 5K8PA 2FIAA 3FNCA 4PV6A 1ZO0A 3RBUA 3W6XA 2XEFA 4A94A 4C68A 2PRQA 5LRJA 1Y7RA 2OH1A 3VARA 4KS9A 4M6GA 1XIXA 1ON0A 2OU2A 3WT4A 4K3NA 1S5KA 2B5GA 4NCZA 3S9NA 2F7VA 4CYNA 4P6YA 4BBHA 5HMNA 5KTCA 4CYQA 4CS0B 1M4DA 1YVOA 1R43A 4XPLA 4DJLA 3VH9A 4UEZA 3H8FA 2AFOA 2YNCC 3D2MA 4J3GA 3WR7A 5G1ZA 1LAPA 2NMTA 4MJ8A 2FCKA 2WUUA 4MHZA 2ABZA 5E96A 4A38A 4GXHA 3SJXA 4KSIA 3FJUA
chains in the Genus database with same CATH topology
2YNDA 2B58A 3IWGA 4Y49C 4KOSA 2P0WA 4MHDA 1TIQA 1YLEA 2PRBA 1XMTA 4MFPA 2WPXA 3DR8A 4AB7A 3FYNA 2BEIA 4BMHA 2R7HA 4A2ZA 2Q04A 2G0BA 2D4PA 1M4IA 2CNSA 2Z3KA 1NSLA 4AVAA 1WK4A 3G3SA 4UFWA 4K30A 4B5PB 4Y49B 4CGLA 3T90A 1QSOA 1YVKA 4B13A 3DDDA 3R9EA 5I0CA 4C7IA 4E2AA 1S7KA 2AJ6A 4UCNA 3S6KA 3TFYA 4JLYA 5AG4A 3KKWA 2HUZA 1MJ9A 4KOWA 2Q44A 1KZFA 2Z3PA 1J4JA 4A33A 4AG9A 3VWDA 4JXQA 4MBUA 2EVNA 3MGDA 4UWIA 1Q2CA 4KOVA 4B5OA 5CNPA 5IX3A 4KVXA 4PK2A 2REFA 3TT2A 2YGWA 1U6MA 2DPSA 4E8OA 2VBQA 2CY2A 4NEXA 3R9GA 1PUAA 2JDDA 2K5TA 4KUAA 1CM0A 5F49A 2Z3NA 1VKCA 2QECA 5EBVA 4FD5A 3NE7A 5IB0A 4QB9A 2ZXVA 4B11A 4CGPA 4NSQA 2Z11A 5A27A 4XPDC 3GKRA 5AG6A 4CGMA 1YX0A 2J8RA 1N71A 2X7BA 3D8PA 2WSAA 4LUAA 3S6HA 2Z3MA 2FT0A 4AVBA 2I79A 2F5IA 4IUSA 2R1IA 3D2PA 2B3VA 3CXPA 3PP9A 4Q38A 4XPDB 2P6EA 2Q4YA 2CNTA 3BJ7A 5KTDA 1M4GA 1Q2DA 4YRHA 3PGPA 1PU9A 4I49A 2P6GA 4FD7A 3DNSA 4KORA 1S7LA 2B5GB 4KSAA 5DWNA 3W6SA 2FSRA 1L0CA 2A4NA 5HH1A 4ONUA 2JLMA 2DPTA 1Q2YA 4F6AA 4U5YA 1Y9KA 1YGHA 4HNWB 2FIWA 2VI7A 3FRMA 4JXRA 3TOBA 3IU1A 3QB8A 5IV0A 3JVNA 4M85A 4M3SA 3DSBA 2B4BA 1XF8A 4KSFA 3R95A 4CAFA 4LX9A 4R87A 3EFAA 1XE4A 4CAEA 4HKFA 4ZGYB 5C88A 2ZW7A 4E0AA 1YR0A 4FD6A 5G20A 1IICA 5KTAA 4MFKA 3V8IA 3R1KA 4RS2A 1VHSA 4XNHC 3TCVA 5F46A 4MFZA 2EUIA 2RC4A 4CAVA 2CXAA 4CGNA 5G22A 4F0XA 2G3AA 2FXFA 4MFLA 2Z3OA 4OLLA 3I9SA 2IL4A 1Z4RA 4XNHB 2BUEA 2J8NA 4B10A 4KUBA 1MK4A 1QSRA 3TE4A 3QAHA 4A31A 4A30A 2Y0MA 3FBUA 4CYPA 1S60A 4UFVA 2GANA 4H89A 3TO6A 3H4QA 3R9FA 2D4OA 4A32A 2Z0ZA 2ZPAA 2PQ8A 2JEVA 3LD2A 2YNEA 4MI4A 1RXTA 1M44A 3JTKA 4CRZB 3W91A 1BOBA 4UFXA 4CYOA 4KOXA 4YFJA 4KOTA 3K9UA 5G21A 4U9YA 2GIVA 2Q7BA 4KLVA 5AG5A 5H84A 2BSWA 4UBRA 4JWPA 4OAEA 3SHPA 3PZJA 2ZW5A 1Y9WA 4C2XA 4UA3A 5EC4A 3H5ZA 1UFHA 5DWMA 2GE3A 5FVJA 5A28A 4ZBGA 3JUWA 3TOAA 4H6ZA 1IYKA 1GHEA 4KLWA 4PSWA 5H86A 2J8MA 1KUXA 3FB3A 2PR8A 5J8FA 4QBJA 5AGEA 3EC4A 2Q0YA 1MJBA 1IIDA 4JD6A 4R3KA 4A95A 3SXNA 1SQHA 1B6BA 2P6FA 4FD4A 4XPKA 2B4DA 2ZW6A 4CAXA 1M1DA 1XEBA 2OZGA 2PC1A 5JPHA 3ZJ0A 1KUVA 1NMTA 3R96A 3FIXA 3B8GA 3IU2A 3I3GA 4PK3A 4MFJA 1V0CA 1LRZA 1MJAA 4KVOE 4QUSA 1S3ZA 4L8AA 3GY9A 3VWEA 4KOUA 2FL4A 4RI1A 4ORFA 4GS4A 1FY7A 4CGOA 4R57A 4C2YA 3IGRA 2HQYA 4QC6A 2H5MA 4C7HA 2CNMA 4UCPA 3CXQA 2VEZA 2BL1A 1I21A 2KCWA 4NXYA 3OWCA 3F5BA 3GYAA 5GCNA 1RO5A 2OB0A 4U9ZA 3S6FA 1R57A 2HV2A 4AVCA 2O28A 4Q36A 2OZHA 4NF1A 2R98A 1Z9UA 3F0AA 4UCMA 2Z10A 1IB1E 2DXQA 2JDCA 4H6UA 4OADA 1B87A 3EY5A 2QIRA 4PSXA 4MFQA 3A9LA 4CAWA 4UWJA 1P0HA 2C27A 3DR6A 1K4JA 1BO4A 2YNCA 5AG7A 4L89A 4R9MA 5F47A 3F8KA 1QSNA 2FE7A 4B5PA 5J8CA 5JQ4A 2R8VA 1S7NA 3LODA 5F48A 1QSTA 2PDOA 1KUYA 3S6GA 4KOYA 2VXKA 4X5KA 3ZZIA 3TO9A 3D3SA 5C82A 4II9A 1NE9A 1WWZA 3P2HA 2OZUA 3EO4A 1S7FA 1Z4EA 4MY3A 4R3LA 2B3UA 4KZTA 1P4NA 4EVYA 5BWAB 2ZW4A 3CXSA 3EXNA 4B14A 3UY5A 2G3TA 1YREA 2ARHA 4KVME 2Z3LA 3BLNA 1I1DA 2VZZA 2B4DB 4C2ZA 2AE6A 1I12A 3TO7A 3E0KA 3P2FA 2Q4VA 1OZPA 4JJXA 3SXOA 2VQYA 1IYLA 4AG7A 2VZYA 4MY0A 4B12A 2REEA 3N7ZA 1QSMA 2I00A 3C26A 3BJ8A 2QMLA 3IWEA 5ISVA 4HNXB 1CJWA 4F0YA 4DNCA 3TTHA 2PSWA 2ATRA 3FXTA 4HNYB 1YK3A 2WPWA 4CRYB 3T9YA 4YGOA 2PR1A 2FS5A 3G8WA 4IF5A 4QVTA 3RYOA 2FIAA 3FNCA 4PV6A 1ZO0A 3W6XA 4C68A 1Y7RA 2OH1A 4KS9A 1XIXA 1ON0A 2OU2A 1S5KA 2B5GA 4NCZA 4CYNA 4BBHA 5HMNA 5KTCA 4CYQA 4CS0B 1M4DA 1YVOA 4XPLA 3WR7A 2YNCC 3D2MA 4J3GA 5G1ZA 2NMTA 4MJ8A 2FCKA 2WUUA 5E96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B58 A;  3IWG A;  4Y49 C;  4KOS A;  2P0W A;  4MHD A;  1TIQ A;  1YLE A;  2PRB A;  1XMT A;  2WPX A;  3DR8 A;  4AB7 A;  3FYN A;  2BEI A;  4BMH A;  2R7H A;  2Q04 A;  2G0B A;  2D4P A;  1M4I A;  2CNS A;  1NSL A;  4AVA A;  1WK4 A;  3G3S A;  4K30 A;  4B5P B;  4Y49 B;  3T90 A;  1QSO A;  1YVK A;  3DDD A;  3R9E A;  5I0C A;  4E2A A;  1S7K A;  2AJ6 A;  3S6K A;  3TFY A;  4JLY A;  3KKW A;  2HUZ A;  1MJ9 A;  4KOW A;  2Q44 A;  1KZF A;  1J4J A;  4AG9 A;  3VWD A;  4JXQ A;  4MBU A;  2EVN A;  3MGD A;  4UWI A;  1Q2C A;  4KOV A;  4B5O A;  5CNP A;  5IX3 A;  4KVX A;  4PK2 A;  2REF A;  3TT2 A;  1U6M A;  4E8O A;  2VBQ A;  2CY2 A;  4NEX A;  3R9G A;  1PUA A;  2JDD A;  2K5T A;  4KUA A;  1CM0 A;  5F49 A;  1VKC A;  2QEC A;  5EBV A;  4FD5 A;  3NE7 A;  5IB0 A;  4QB9 A;  2ZXV A;  4NSQ A;  2Z11 A;  4XPD C;  3GKR A;  1YX0 A;  2J8R A;  1N71 A;  2X7B A;  3D8P A;  4LUA A;  3S6H A;  2FT0 A;  4AVB A;  2I79 A;  2F5I A;  4IUS A;  2R1I A;  3D2P A;  2B3V A;  3CXP A;  3PP9 A;  4XPD B;  2P6E A;  2Q4Y A;  2CNT A;  3BJ7 A;  5KTD A;  1M4G A;  1Q2D A;  4YRH A;  3PGP A;  1PU9 A;  4I49 A;  2P6G A;  4FD7 A;  3DNS A;  4KOR A;  1S7L A;  2B5G B;  5DWN A;  3W6S A;  2FSR A;  1L0C A;  2A4N A;  5HH1 A;  4ONU A;  2JLM A;  1Q2Y A;  4F6A A;  4U5Y A;  1Y9K A;  1YGH A;  4HNW B;  2FIW A;  2VI7 A;  3FRM A;  4JXR A;  3TOB A;  3QB8 A;  5IV0 A;  3JVN A;  4M85 A;  4M3S A;  3DSB A;  2B4B A;  1XF8 A;  3R95 A;  4LX9 A;  4R87 A;  3EFA A;  1XE4 A;  4HKF A;  5C88 A;  2ZW7 A;  4E0A A;  1YR0 A;  4FD6 A;  1IIC A;  5KTA A;  3V8I A;  3R1K A;  4RS2 A;  1VHS A;  4XNH C;  3TCV A;  5F46 A;  2EUI A;  2RC4 A;  4CAV A;  2G3A A;  2FXF A;  4OLL A;  3I9S A;  2IL4 A;  1Z4R A;  4XNH B;  2BUE A;  2J8N A;  4KUB A;  1MK4 A;  1QSR A;  3TE4 A;  3QAH A;  2Y0M A;  3FBU A;  1S60 A;  2GAN A;  4H89 A;  3TO6 A;  3H4Q A;  3R9F A;  2D4O A;  2Z0Z A;  2ZPA A;  2PQ8 A;  2JEV A;  3LD2 A;  4MI4 A;  1RXT A;  1M44 A;  4CRZ B;  3W91 A;  1BOB A;  4KOX A;  4YFJ A;  4KOT A;  3K9U A;  4U9Y A;  2GIV A;  2Q7B A;  4KLV A;  5H84 A;  2BSW A;  4UBR A;  4JWP A;  4OAE A;  3SHP A;  3PZJ A;  2ZW5 A;  1Y9W A;  4UA3 A;  5EC4 A;  1UFH A;  5DWM A;  2GE3 A;  5FVJ A;  4ZBG A;  3JUW A;  3TOA A;  4H6Z A;  1IYK A;  1GHE A;  4KLW A;  4PSW A;  5H86 A;  2J8M A;  1KUX A;  3FB3 A;  2PR8 A;  5J8F A;  4QBJ A;  3EC4 A;  2Q0Y A;  1MJB A;  1IID A;  4JD6 A;  4R3K A;  3SXN A;  1SQH A;  1B6B A;  2P6F A;  4FD4 A;  4XPK A;  2B4D A;  2ZW6 A;  4CAX A;  1M1D A;  1XEB A;  2OZG A;  2PC1 A;  5JPH A;  3ZJ0 A;  1KUV A;  1NMT A;  3R96 A;  3FIX A;  3B8G A;  3I3G A;  4PK3 A;  1V0C A;  1LRZ A;  1MJA A;  4KVO E;  4QUS A;  1S3Z A;  4L8A A;  3GY9 A;  3VWE A;  4KOU A;  2FL4 A;  4RI1 A;  4ORF A;  4GS4 A;  1FY7 A;  4R57 A;  3IGR A;  2HQY A;  4QC6 A;  2H5M A;  2CNM A;  3CXQ A;  2VEZ A;  2BL1 A;  1I21 A;  2KCW A;  4NXY A;  3OWC A;  3F5B A;  3GYA A;  5GCN A;  1RO5 A;  2OB0 A;  4U9Z A;  3S6F A;  1R57 A;  2HV2 A;  4AVC A;  2O28 A;  2OZH A;  4NF1 A;  2R98 A;  1Z9U A;  3F0A A;  2Z10 A;  1IB1 E;  2DXQ A;  2JDC A;  4H6U A;  4OAD A;  1B87 A;  3EY5 A;  2QIR A;  4PSX A;  4CAW A;  4UWJ A;  1P0H A;  2C27 A;  3DR6 A;  1K4J A;  1BO4 A;  4L89 A;  4R9M A;  5F47 A;  3F8K A;  1QSN A;  2FE7 A;  4B5P A;  5J8C A;  5JQ4 A;  2R8V A;  1S7N A;  3LOD A;  5F48 A;  1QST A;  2PDO A;  1KUY A;  3S6G A;  4KOY A;  2VXK A;  4X5K A;  3ZZI A;  3TO9 A;  3D3S A;  5C82 A;  4II9 A;  1NE9 A;  1WWZ A;  3P2H A;  2OZU A;  3EO4 A;  1S7F A;  1Z4E A;  4MY3 A;  4R3L A;  2B3U A;  4KZT A;  1P4N A;  4EVY A;  2ZW4 A;  3CXS A;  3EXN A;  3UY5 A;  2G3T A;  1YRE A;  2ARH A;  4KVM E;  3BLN A;  1I1D A;  2VZZ A;  2B4D B;  2AE6 A;  1I12 A;  3TO7 A;  3E0K A;  3P2F A;  2Q4V A;  1OZP A;  4JJX A;  3SXO A;  2VQY A;  1IYL A;  4AG7 A;  2VZY A;  4MY0 A;  2REE A;  3N7Z A;  1QSM A;  2I00 A;  3C26 A;  3BJ8 A;  2QML A;  5ISV A;  4HNX B;  1CJW A;  4F0Y A;  4DNC A;  3TTH A;  2PSW A;  2ATR A;  3FXT A;  4HNY B;  1YK3 A;  2WPW A;  4CRY B;  3T9Y A;  4YGO A;  2PR1 A;  2FS5 A;  3G8W A;  4IF5 A;  4QVT A;  3RYO A;  2FIA A;  3FNC A;  4PV6 A;  3W6X A;  1Y7R A;  2OH1 A;  1XIX A;  1ON0 A;  2OU2 A;  1S5K A;  2B5G A;  4NCZ A;  5HMN A;  5KTC A;  4CS0 B;  1M4D A;  1YVO A;  4XPL A;  3WR7 A;  3D2M A;  4J3G A;  2NMT A;  4MJ8 A;  2FCK A;  5E96 A; 
#chains in the Genus database with same CATH topology
 4UF4 A;  2YND A;  2B58 A;  3IWG A;  4Y49 C;  4JZ0 A;  4KOS A;  2P0W A;  4MHD A;  1VGY A;  1TIQ A;  1YLE A;  5CBM A;  2PRB A;  3NH5 A;  1XMT A;  2BOA A;  4MFP A;  2WPX A;  3DR8 A;  4AB7 A;  3FYN A;  2BEI A;  4M6H A;  1BAV A;  1XFO A;  3B3S A;  4BMH A;  2R7H A;  4A2Z A;  2Q04 A;  2G0B A;  2D4P A;  3FX6 A;  1M4I A;  2CNS A;  2Z3K A;  1HDU A;  1NSL A;  3FVL A;  4AVA A;  1LCP A;  1WK4 A;  4FUU A;  3G3S A;  4UFW A;  3I1U A;  2CF4 A;  4K30 A;  4OC2 A;  4EME A;  2ZEL A;  4B5P B;  4Y49 B;  2Q43 A;  4CGL A;  3T90 A;  1QSO A;  1YVK A;  2EBJ A;  4B13 A;  4H2K A;  3RAM A;  2ANP A;  3DDD A;  1JQG A;  3R9E A;  5I0C A;  4C7I A;  2ZEM A;  4E2A A;  4MXU A;  1S7K A;  2AJ6 A;  2PVV A;  4UCN A;  2DF5 A;  4OC5 A;  2O4H A;  2ZEG A;  1DTD A;  2PJB A;  4R6T A;  3S6K A;  3TFY A;  4JLY A;  5AG4 A;  3KKW A;  3GLJ A;  3WAB A;  1Z2L A;  2HUZ A;  3D68 A;  1MJ9 A;  3IEH A;  4KOW A;  2Q44 A;  2Q4Z A;  1KZF A;  5HVH A;  2FVG A;  2Z3P A;  1J4J A;  4A33 A;  2CTB A;  4AG9 A;  4PXE A;  3VWD A;  4NJQ A;  1YME A;  4JXQ A;  2JBK A;  2PJ4 A;  2EVN A;  3MGD A;  4MBU A;  4PPZ A;  4UWI A;  5LYL A;  4B6Z A;  1Q2C A;  4X3R A;  2ZEH A;  4KOV A;  3BXM A;  1XBU A;  4B5O A;  3NH4 A;  5CNP A;  5IX3 A;  4KVX A;  4PK2 A;  2REF A;  4MCQ A;  3TT2 A;  1X12 A;  2YGW A;  3TX8 A;  2PJC A;  2NYQ A;  4MHY A;  1U6M A;  2DPS A;  4E8O A;  2VBQ A;  3KHZ A;  2CY2 A;  1FT7 A;  4OC4 A;  4RUH A;  4NEX A;  3NA6 A;  3R9G A;  1PUA A;  2JDD A;  3V7Z A;  2K5T A;  5J1Q A;  4KUA A;  2ZEO A;  4ONW A;  1QQ9 A;  3FF3 A;  1CM0 A;  1VIX A;  5F49 A;  2V8D A;  2Z3N A;  1VKC A;  3NE8 A;  5HVF A;  2QEC A;  3NH8 A;  5EBV A;  4UIB A;  4YWY A;  3KR4 A;  4FD5 A;  3NE7 A;  5IB0 A;  4PXB A;  4QB9 A;  1Z8T A;  2ZXV A;  4B11 A;  4CGP A;  4NSQ A;  2Z11 A;  5A27 A;  1QMU A;  4XPD C;  4X8I A;  3GKR A;  5AG6 A;  4CGM A;  1CP7 A;  3S9M A;  1YX0 A;  2J8R A;  4Z65 A;  3ISZ A;  1JWQ A;  1N71 A;  4YU9 A;  2X7B A;  3D8P A;  2WSA A;  8CPA A;  4LUA A;  3S6H A;  2Z3M A;  4PXD A;  3QAY A;  2FT0 A;  3WC5 A;  3DGV A;  4AVB A;  4NJR A;  4WJB A;  2WYR A;  2I79 A;  2Q7S A;  2F5I A;  2HB6 A;  4IUS A;  2R1I A;  1GYT A;  2AFS A;  2QYV A;  3D2P A;  2B3V A;  1Z8W A;  3CXP A;  3HUV A;  3PP9 A;  4Q38 A;  4XPD B;  4ZX9 A;  2P6E A;  1TKH A;  2Q4Y A;  2CNT A;  3BJ7 A;  4O23 A;  5KTD A;  3KHX A;  3S9L A;  1M4G A;  3IFE A;  1Q2D A;  4YRH A;  3PGP A;  4G1P A;  3IWW A;  2ZEN A;  4P4J A;  1PU9 A;  3SJF A;  4I49 A;  3GIU A;  2P6G A;  4FD7 A;  1EE3 P;  3DNS A;  4KOR A;  4PQA A;  1CP6 A;  1S7L A;  2Q51 A;  4OME A;  3RZA A;  4NGS A;  2O53 A;  2B5G B;  4KSA A;  2PJA A;  5DWN A;  3W6S A;  2FSR A;  1L0C A;  2A4N A;  5HH1 A;  2ODF A;  4ONU A;  2JLM A;  2DPT A;  4MRI A;  1ELL P;  1Q2Y A;  1YW4 A;  3B3V A;  4IHM A;  4F6A A;  3WC7 A;  4U5Y A;  2PJ9 A;  4P10 A;  5I4M A;  1Y9K A;  1YLO A;  1YGH A;  4F9U A;  4HNW B;  5THW A;  2FIW A;  2VI7 A;  6CPA A;  4MCS A;  3FRM A;  4JXR A;  2PJ6 A;  2PIY A;  3TOB A;  1Z5R A;  2PJ5 A;  1H8L A;  3IU1 A;  4P4B A;  4FBE A;  3QB8 A;  3GB0 A;  1CPS A;  1TKF A;  2GLF A;  3JVN A;  4M85 A;  4M3S A;  4OC0 A;  4P44 A;  5IV0 A;  3DSB A;  2B4B A;  2PJ7 A;  1XF8 A;  4KSF A;  2PVW A;  3R95 A;  4EFD A;  4MCR A;  4LX9 A;  4CAF A;  3IC1 A;  4R87 A;  3EFA A;  1XE4 A;  3D7G A;  4CAE A;  4P4I A;  4HKF A;  2RFH A;  1PYT B;  1DE4 C;  3LMS A;  4ZGY B;  3LWU A;  2ZW7 A;  1CX8 A;  5C88 A;  4E0A A;  2GU2 A;  4OKO A;  1Y0Y A;  3NFZ A;  4DYO A;  1YR0 A;  4FD6 A;  5G20 A;  1IIC A;  4ZY2 A;  5KTA A;  4MFK A;  4R7M A;  2HC9 A;  2AFM A;  3V8I A;  3R1K A;  4RS2 A;  5DS0 A;  4IAV A;  5JGF A;  1VHS A;  3QNV A;  4RN7 A;  4XNH C;  3PB4 X;  3TCV A;  5F46 A;  4MFZ A;  2EUI A;  2RC4 A;  4CAV A;  2CXA A;  4CGN A;  4UEF A;  2JBJ A;  5G22 A;  3CPX A;  2IJZ A;  4F0X A;  2G3A A;  2FXF A;  2XEI A;  4TNU A;  5LYD A;  5HXD A;  3FED A;  4MFL A;  2Z3O A;  2IMO A;  4OLL A;  3I9S A;  2IL4 A;  1Q7L A;  1Z4R A;  4R76 A;  3PB9 X;  2PJ8 A;  1IY7 A;  4OID A;  5LRK A;  4XNH B;  4ZY1 A;  2BUE A;  2J8N A;  2V8G A;  4NFR A;  4B10 A;  4KUB A;  1MK4 A;  1QSR A;  1TXR A;  1YSJ A;  3TE4 A;  3QAH A;  3WC6 A;  4A31 A;  4A30 A;  2Y0M A;  3FBU A;  3BI1 A;  3D4U A;  4CYP A;  2EK8 A;  5LYF A;  1S60 A;  4UFV A;  2GAN A;  4H89 A;  3TO6 A;  3H4Q A;  3R9F A;  3H8G A;  2D4O A;  3L2N A;  3KGQ A;  4P4E A;  2Z0Z A;  2ZPA A;  3PB8 X;  2C6P A;  4NGN A;  3SI2 A;  2PQ8 A;  3PEI A;  4A32 A;  2JEV A;  5JH9 A;  4NGM A;  5F09 A;  3LD2 A;  2YNE A;  3ISX A;  3SJE A;  4ZYQ A;  2C1C A;  1CBX A;  4MI4 A;  4TWE A;  4A39 A;  2EK9 A;  1RXT A;  1M44 A;  3KZW A;  4A37 A;  3JTK A;  3PB7 X;  4W9Y A;  4CRZ B;  3W91 A;  1BOB A;  2C6C A;  4OIW A;  4OC1 A;  3PBB A;  4OP4 A;  4UFX A;  3IIB A;  4CYO A;  4KOX A;  4P45 A;  3FH4 A;  4YFJ A;  4KOT A;  5HVG A;  3K9U A;  5G21 A;  4U9Y A;  2GIV A;  2Q7B A;  4KLV A;  5AG5 A;  5H84 A;  2BSW A;  4UBR A;  4NGP A;  3KQX A;  4JWP A;  4OAE A;  3SHP A;  5K8M A;  5D29 A;  3PZJ A;  2ZW5 A;  1Y9W A;  4C2X A;  5K8O A;  4UA3 A;  5EC4 A;  3H5Z A;  2PCU A;  4WWV A;  1UFH A;  5DWM A;  4EWT A;  2GE3 A;  5FVJ A;  5A28 A;  3PFO A;  1Y7E A;  4NGQ A;  5CPA A;  4ZBG A;  1F57 A;  3JUW A;  3CPA A;  3TOA A;  1FNO A;  3SI0 A;  4H6Z A;  1IYK A;  1GHE A;  4KLW A;  1IU8 A;  4PSW A;  1ZG9 A;  5H86 A;  3V38 A;  2J8M A;  2V8H A;  1KUX A;  2PJ2 A;  1ELM P;  2AFW A;  3FB3 A;  2PR8 A;  3HLP A;  5J8F A;  3KQZ A;  4QBJ A;  5D8N A;  5AGE A;  1VHE A;  2Q0Y A;  3EC4 A;  1MJB A;  4P4F A;  5K8N A;  3D7F A;  3K2K A;  1IOF A;  4OC3 A;  1IID A;  4JD6 A;  4AXV A;  4R3K A;  1M4L A;  3B35 A;  4A95 A;  3SXN A;  3KI9 A;  1B6B A;  1SQH A;  2P6F A;  1HEE A;  1UWY A;  4FD4 A;  4XPK A;  2DEA A;  2B4D A;  2ZW6 A;  3RNZ A;  4CAX A;  1M1D A;  1XEB A;  2OZG A;  3B7I A;  2PC1 A;  5JPH A;  3ZJ0 A;  1KUV A;  2EO8 A;  1NMT A;  1LOK A;  2PJ0 A;  3R96 A;  3FIX A;  3B8G A;  3IU2 A;  3I3G A;  4PK3 A;  3BI0 A;  4MFJ A;  2AFX A;  1V0C A;  1LRZ A;  3SI1 A;  1MJA A;  4KVO E;  4QUS A;  1S3Z A;  4MCP A;  1Z8X A;  3FMC A;  4L8A A;  3GY9 A;  1ZG7 A;  3VWE A;  1VHO A;  2IQ6 A;  3CDX A;  2FL4 A;  4KOU A;  4RI1 A;  3KAS A;  2ZEE A;  4ORF A;  4GS4 A;  1FY7 A;  4ZY0 A;  3B3W A;  5EMI A;  1Y0R A;  4CGO A;  4R57 A;  4C2Y A;  4DUK A;  3IGR A;  2HQY A;  4QC6 A;  2H5M A;  2ZED A;  1TF8 A;  1AMP A;  4C7H A;  2CNM A;  4UCP A;  3CXQ A;  2VEZ A;  1LAN A;  1A2Z A;  4R8F A;  2BL1 A;  1I21 A;  3PB6 X;  2KCW A;  3PBE A;  4NXY A;  3T8W A;  3OWC A;  3F5B A;  3GYA A;  5GCN A;  1RO5 A;  4FWU A;  2OB0 A;  4U9Z A;  3S6F A;  4UEE A;  1R57 A;  2V8V A;  3N5F A;  3RO0 A;  2HV2 A;  1XOV A;  1YQE A;  2O28 A;  3D7D A;  3D66 A;  1ZG8 A;  2OZH A;  4Q36 A;  2OOT A;  4AVC A;  4NF1 A;  2R98 A;  4Q7A A;  1XRY A;  1Z9U A;  3F0A A;  4UCM A;  1BPN A;  2Z10 A;  1IB1 E;  3FEC A;  5LYI A;  3CT9 A;  1PCA A;  2DXQ A;  1NSA A;  2JDC A;  5JM6 A;  4IK2 A;  2ZEP A;  2WZN A;  4H6U A;  4OAD A;  1B87 A;  3EY5 A;  2QIR A;  1BLL E;  4PSX A;  4MFQ A;  4BD9 A;  4MHN A;  4X2T A;  3A9L A;  1CG2 A;  4CAW A;  1XMB A;  2XEJ A;  4UWJ A;  1P0H A;  2EWB A;  2C27 A;  2I3C A;  2GLJ A;  3DR6 A;  2OR4 A;  1K4J A;  2J9A A;  1BO4 A;  7CPA A;  5IB9 A;  2YNC A;  5AG7 A;  4L89 A;  4R9M A;  1F2O A;  5F47 A;  3F8K A;  1QSN A;  2FE7 A;  4NGR A;  2F8H A;  4B5P A;  5J8C A;  5JQ4 A;  3PRT A;  1CPX A;  2R8V A;  1S7N A;  3LOD A;  5F48 A;  1QST A;  1ARL A;  1ZLH A;  1KUY A;  2PDO A;  4KOY A;  4ZX8 A;  3D7H A;  2PJ1 A;  2VXK A;  3S6G A;  1X10 A;  4FAI A;  2POK A;  4MMO A;  4X5K A;  3TO9 A;  3ZZI A;  3D3S A;  2AFZ A;  3MN8 A;  3MRU A;  4NGT A;  5C82 A;  3JRU A;  4II9 A;  4M6I A;  1NE9 A;  1WWZ A;  3IJ3 A;  3P2H A;  2OZU A;  3EO4 A;  1S7F A;  1Z4E A;  2ZOF A;  2VL1 A;  4MY3 A;  4R3L A;  1ARM A;  2B3U A;  4KZT A;  1YW6 A;  1R3N A;  1OBR A;  3PFE A;  2GFQ A;  1AYE A;  1P4N A;  2CTC A;  1Z8L A;  4EVY A;  5BWA B;  2QJ8 A;  2ZW4 A;  3CXS A;  3EXN A;  5ELY A;  3GUX A;  4B14 A;  3UY5 A;  1HDQ A;  4P4D A;  3B3T A;  2G3T A;  1KWM A;  2ZOG A;  1YRE A;  2CIJ A;  1XJO A;  2NSM A;  2ARH A;  4KVM E;  2PIZ A;  2Z3L A;  1I1D A;  2VZZ A;  3BLN A;  3DLJ A;  3H8E A;  3KR5 A;  2C6G A;  4HPS A;  1IOI A;  2B4D B;  2G9D A;  4C2Z A;  2AE6 A;  1I12 A;  1TF9 A;  4JYW A;  3TO7 A;  3E0K A;  3KL9 A;  4F8Z A;  3P2F A;  4MHP A;  5LRG A;  2ZEF A;  2GRE A;  1IGB A;  2QVP A;  2RB7 A;  3D67 A;  2Q4V A;  1OZP A;  3FEE A;  4JJX A;  3SXO A;  2VQY A;  4ZI6 A;  1LFW A;  1BPM A;  1IYL A;  4AG7 A;  2VZY A;  4MY0 A;  2JEW A;  4B12 A;  2REE A;  1RTQ A;  2AFU A;  4CPA A;  4GM5 A;  2BCO A;  2BO9 A;  2V77 A;  3N7Z A;  1QSM A;  4BIN A;  2I00 A;  3BHX A;  3C26 A;  3BJ8 A;  4PXC A;  2QML A;  1ZLI A;  2PE3 A;  3IWE A;  3CZX A;  4UIA A;  1LAM A;  1AUG A;  5ISV A;  4HNX B;  3SJG A;  1CJW A;  4F0Y A;  3VAT A;  4DNC A;  3B3C A;  3TTH A;  4F9V A;  2PJ3 A;  3IO1 A;  2PSW A;  4LQ6 A;  2ATR A;  3FXT A;  3B2Y A;  4HNY B;  1YK3 A;  2WPW A;  1TKJ A;  4CRY B;  3LAC A;  3T9Y A;  3K9T A;  1F2P A;  4YGO A;  4LQG A;  2PR1 A;  2FS5 A;  3G8W A;  4IF5 A;  4QVT A;  3TC8 A;  2XEG A;  3RYO A;  5K8P A;  2FIA A;  3FNC A;  4PV6 A;  1ZO0 A;  3RBU A;  3W6X A;  2XEF A;  4A94 A;  4C68 A;  2PRQ A;  5LRJ A;  1Y7R A;  2OH1 A;  3VAR A;  4KS9 A;  4M6G A;  1XIX A;  1ON0 A;  2OU2 A;  3WT4 A;  4K3N A;  1S5K A;  2B5G A;  4NCZ A;  3S9N A;  2F7V A;  4CYN A;  4P6Y A;  4BBH A;  5HMN A;  5KTC A;  4CYQ A;  4CS0 B;  1M4D A;  1YVO A;  1R43 A;  4XPL A;  4DJL A;  3VH9 A;  4UEZ A;  3H8F A;  2AFO A;  2YNC C;  3D2M A;  4J3G A;  3WR7 A;  5G1Z A;  1LAP A;  2NMT A;  4MJ8 A;  2FCK A;  2WUU A;  4MHZ A;  2ABZ A;  5E96 A;  4A38 A;  4GXH A;  3SJX A;  4KSI A;  3FJU A; 
#chains in the Genus database with same CATH homology
 2YND A;  2B58 A;  3IWG A;  4Y49 C;  4KOS A;  2P0W A;  4MHD A;  1TIQ A;  1YLE A;  2PRB A;  1XMT A;  4MFP A;  2WPX A;  3DR8 A;  4AB7 A;  3FYN A;  2BEI A;  4BMH A;  2R7H A;  4A2Z A;  2Q04 A;  2G0B A;  2D4P A;  1M4I A;  2CNS A;  2Z3K A;  1NSL A;  4AVA A;  1WK4 A;  3G3S A;  4UFW A;  4K30 A;  4B5P B;  4Y49 B;  4CGL A;  3T90 A;  1QSO A;  1YVK A;  4B13 A;  3DDD A;  3R9E A;  5I0C A;  4C7I A;  4E2A A;  1S7K A;  2AJ6 A;  4UCN A;  3S6K A;  3TFY A;  4JLY A;  5AG4 A;  3KKW A;  2HUZ A;  1MJ9 A;  4KOW A;  2Q44 A;  1KZF A;  2Z3P A;  1J4J A;  4A33 A;  4AG9 A;  3VWD A;  4JXQ A;  4MBU A;  2EVN A;  3MGD A;  4UWI A;  1Q2C A;  4KOV A;  4B5O A;  5CNP A;  5IX3 A;  4KVX A;  4PK2 A;  2REF A;  3TT2 A;  2YGW A;  1U6M A;  2DPS A;  4E8O A;  2VBQ A;  2CY2 A;  4NEX A;  3R9G A;  1PUA A;  2JDD A;  2K5T A;  4KUA A;  1CM0 A;  5F49 A;  2Z3N A;  1VKC A;  2QEC A;  5EBV A;  4FD5 A;  3NE7 A;  5IB0 A;  4QB9 A;  2ZXV A;  4B11 A;  4CGP A;  4NSQ A;  2Z11 A;  5A27 A;  4XPD C;  3GKR A;  5AG6 A;  4CGM A;  1YX0 A;  2J8R A;  1N71 A;  2X7B A;  3D8P A;  2WSA A;  4LUA A;  3S6H A;  2Z3M A;  2FT0 A;  4AVB A;  2I79 A;  2F5I A;  4IUS A;  2R1I A;  3D2P A;  2B3V A;  3CXP A;  3PP9 A;  4Q38 A;  4XPD B;  2P6E A;  2Q4Y A;  2CNT A;  3BJ7 A;  5KTD A;  1M4G A;  1Q2D A;  4YRH A;  3PGP A;  1PU9 A;  4I49 A;  2P6G A;  4FD7 A;  3DNS A;  4KOR A;  1S7L A;  2B5G B;  4KSA A;  5DWN A;  3W6S A;  2FSR A;  1L0C A;  2A4N A;  5HH1 A;  4ONU A;  2JLM A;  2DPT A;  1Q2Y A;  4F6A A;  4U5Y A;  1Y9K A;  1YGH A;  4HNW B;  2FIW A;  2VI7 A;  3FRM A;  4JXR A;  3TOB A;  3IU1 A;  3QB8 A;  5IV0 A;  3JVN A;  4M85 A;  4M3S A;  3DSB A;  2B4B A;  1XF8 A;  4KSF A;  3R95 A;  4CAF A;  4LX9 A;  4R87 A;  3EFA A;  1XE4 A;  4CAE A;  4HKF A;  4ZGY B;  5C88 A;  2ZW7 A;  4E0A A;  1YR0 A;  4FD6 A;  5G20 A;  1IIC A;  5KTA A;  4MFK A;  3V8I A;  3R1K A;  4RS2 A;  1VHS A;  4XNH C;  3TCV A;  5F46 A;  4MFZ A;  2EUI A;  2RC4 A;  4CAV A;  2CXA A;  4CGN A;  5G22 A;  4F0X A;  2G3A A;  2FXF A;  4MFL A;  2Z3O A;  4OLL A;  3I9S A;  2IL4 A;  1Z4R A;  4XNH B;  2BUE A;  2J8N A;  4B10 A;  4KUB A;  1MK4 A;  1QSR A;  3TE4 A;  3QAH A;  4A31 A;  4A30 A;  2Y0M A;  3FBU A;  4CYP A;  1S60 A;  4UFV A;  2GAN A;  4H89 A;  3TO6 A;  3H4Q A;  3R9F A;  2D4O A;  4A32 A;  2Z0Z A;  2ZPA A;  2PQ8 A;  2JEV A;  3LD2 A;  2YNE A;  4MI4 A;  1RXT A;  1M44 A;  3JTK A;  4CRZ B;  3W91 A;  1BOB A;  4UFX A;  4CYO A;  4KOX A;  4YFJ A;  4KOT A;  3K9U A;  5G21 A;  4U9Y A;  2GIV A;  2Q7B A;  4KLV A;  5AG5 A;  5H84 A;  2BSW A;  4UBR A;  4JWP A;  4OAE A;  3SHP A;  3PZJ A;  2ZW5 A;  1Y9W A;  4C2X A;  4UA3 A;  5EC4 A;  3H5Z A;  1UFH A;  5DWM A;  2GE3 A;  5FVJ A;  5A28 A;  4ZBG A;  3JUW A;  3TOA A;  4H6Z A;  1IYK A;  1GHE A;  4KLW A;  4PSW A;  5H86 A;  2J8M A;  1KUX A;  3FB3 A;  2PR8 A;  5J8F A;  4QBJ A;  5AGE A;  3EC4 A;  2Q0Y A;  1MJB A;  1IID A;  4JD6 A;  4R3K A;  4A95 A;  3SXN A;  1SQH A;  1B6B A;  2P6F A;  4FD4 A;  4XPK A;  2B4D A;  2ZW6 A;  4CAX A;  1M1D A;  1XEB A;  2OZG A;  2PC1 A;  5JPH A;  3ZJ0 A;  1KUV A;  1NMT A;  3R96 A;  3FIX A;  3B8G A;  3IU2 A;  3I3G A;  4PK3 A;  4MFJ A;  1V0C A;  1LRZ A;  1MJA A;  4KVO E;  4QUS A;  1S3Z A;  4L8A A;  3GY9 A;  3VWE A;  4KOU A;  2FL4 A;  4RI1 A;  4ORF A;  4GS4 A;  1FY7 A;  4CGO A;  4R57 A;  4C2Y A;  3IGR A;  2HQY A;  4QC6 A;  2H5M A;  4C7H A;  2CNM A;  4UCP A;  3CXQ A;  2VEZ A;  2BL1 A;  1I21 A;  2KCW A;  4NXY A;  3OWC A;  3F5B A;  3GYA A;  5GCN A;  1RO5 A;  2OB0 A;  4U9Z A;  3S6F A;  1R57 A;  2HV2 A;  4AVC A;  2O28 A;  4Q36 A;  2OZH A;  4NF1 A;  2R98 A;  1Z9U A;  3F0A A;  4UCM A;  2Z10 A;  1IB1 E;  2DXQ A;  2JDC A;  4H6U A;  4OAD A;  1B87 A;  3EY5 A;  2QIR A;  4PSX A;  4MFQ A;  3A9L A;  4CAW A;  4UWJ A;  1P0H A;  2C27 A;  3DR6 A;  1K4J A;  1BO4 A;  2YNC A;  5AG7 A;  4L89 A;  4R9M A;  5F47 A;  3F8K A;  1QSN A;  2FE7 A;  4B5P A;  5J8C A;  5JQ4 A;  2R8V A;  1S7N A;  3LOD A;  5F48 A;  1QST A;  2PDO A;  1KUY A;  3S6G A;  4KOY A;  2VXK A;  4X5K A;  3ZZI A;  3TO9 A;  3D3S A;  5C82 A;  4II9 A;  1NE9 A;  1WWZ A;  3P2H A;  2OZU A;  3EO4 A;  1S7F A;  1Z4E A;  4MY3 A;  4R3L A;  2B3U A;  4KZT A;  1P4N A;  4EVY A;  5BWA B;  2ZW4 A;  3CXS A;  3EXN A;  4B14 A;  3UY5 A;  2G3T A;  1YRE A;  2ARH A;  4KVM E;  2Z3L A;  3BLN A;  1I1D A;  2VZZ A;  2B4D B;  4C2Z A;  2AE6 A;  1I12 A;  3TO7 A;  3E0K A;  3P2F A;  2Q4V A;  1OZP A;  4JJX A;  3SXO A;  2VQY A;  1IYL A;  4AG7 A;  2VZY A;  4MY0 A;  4B12 A;  2REE A;  3N7Z A;  1QSM A;  2I00 A;  3C26 A;  3BJ8 A;  2QML A;  3IWE A;  5ISV A;  4HNX B;  1CJW A;  4F0Y A;  4DNC A;  3TTH A;  2PSW A;  2ATR A;  3FXT A;  4HNY B;  1YK3 A;  2WPW A;  4CRY B;  3T9Y A;  4YGO A;  2PR1 A;  2FS5 A;  3G8W A;  4IF5 A;  4QVT A;  3RYO A;  2FIA A;  3FNC A;  4PV6 A;  1ZO0 A;  3W6X A;  4C68 A;  1Y7R A;  2OH1 A;  4KS9 A;  1XIX A;  1ON0 A;  2OU2 A;  1S5K A;  2B5G A;  4NCZ A;  4CYN A;  4BBH A;  5HMN A;  5KTC A;  4CYQ A;  4CS0 B;  1M4D A;  1YVO A;  4XPL A;  3WR7 A;  2YNC C;  3D2M A;  4J3G A;  5G1Z A;  2NMT A;  4MJ8 A;  2FCK A;  2WUU A;  5E96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...