3E0KA

Crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
146
Chain Sequence
AEQVRQAGIDDIGGILELIHPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFRKSKILALDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
molecule keywords Amino-acid acetyltransferase
total genus 33
structure length 146
sequence length 148
ec nomenclature ec 2.3.1.1: Amino-acid N-acetyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3e0kA00
1P4NA 2HV2A 5IX3A 4CRZB 1Y9KA 2WPWA 4MBUA 1QSNA 3W6SA 1ON0A 1B6BA 2ZW4A 2C27A 2Z11A 4KVOE 4KUBA 4JXQA 2VEZA 4OADA 3R9EA 2FL4A 1B87A 2QMLA 1QSRA 5F46A 3CXSA 2ATRA 4J3GA 3K9UA 2VI7A 2B5GA 1XF8A 2G3TA 1IB1E 4CS0B 2Y0MA 3R1KA 2G0BA 3R9FA 1NMTA 2PC1A 3TOAA 5ISVA 1PU9A 4YRHA 4KZTA 4YGOA 4MY3A 2Q4VA 5FVJA 3B8GA 1RXTA 2Q44A 3QB8A 2FE7A 4JD6A 1SQHA 2VXKA 3BJ8A 3S6HA 2JEVA 2OZGA 3TE4A 3D2PA 1M4IA 2NMTA 1Z9UA 2PR8A 2PR1A 3FB3A 4U9ZA 4PK3A 4XNHB 4EVYA 1J4JA 2Z0ZA 2VZZA 4KOYA 4H89A 1YREA 3TFYA 5F48A 3SHPA 4QC6A 5J8FA 3FYNA 2G3AA 4AVAA 1OZPA 1M1DA 2JDDA 4UA3A 3F8KA 1YK3A 4OAEA 4ONUA 5KTCA 3PZJA 4FD5A 4F0YA 1TIQA 5H84A 1YX0A 4U9YA 3ZZIA 1LRZA 4FD6A 1MJ9A 1S7LA 4KVXA 5E96A 2PSWA 1Y9WA 2R1IA 4DNCA 2EVNA 1BO4A 4BMHA 3SXOA 3TO6A 5C88A 1Z4RA 4E8OA 3FBUA 2B4DA 2OU2A 4AB7A 3LODA 1Q2YA 4XPDB 3VWDA 5KTAA 1S5KA 1YR0A 2PQ8A 4KOXA 2GE3A 1R57A 1WK4A 3SXNA 4KORA 3OWCA 2Q04A 5GCNA 2B5GB 3D3SA 2FS5A 3S6GA 1KUYA 2BSWA 4PV6A 4X5KA 3EO4A 4H6ZA 2FIAA 3CXQA 3EC4A 2ZXVA 4HNWB 1NE9A 2A4NA 4XNHC 2FCKA 5DWMA 4KLWA 4M85A 2R8VA 1QSTA 2J8MA 3R95A 1XMTA 1YVKA 2IL4A 2JLMA 3FNCA 5JQ4A 1QSMA 1MJBA 1K4JA 1I21A 2P6EA 4ZBGA 3F0AA 2B3VA 3KKWA 2ARHA 4KOVA 2J8RA 1XEBA 2EUIA 2FSRA 1PUAA 3TOBA 1CJWA 1KUXA 2GIVA 3NE7A 3D2MA 1Q2CA 4OLLA 2Q4YA 4B5PB 1VHSA 3EFAA 3E0KA 3H4QA 4HNYB 3DSBA 1QSOA 1I12A 1Z4EA 1MK4A 4MY0A 1IICA 2AJ6A 1M44A 4L8AA 4M3SA 2CNMA 5I0CA 5IB0A 1IYKA 2BUEA 4QUSA 2R7HA 2R98A 1I1DA 3W91A 1L0CA 2F5IA 3S6FA 1GHEA 4NSQA 3FRMA 4NXYA 4CRYB 4ORFA 3R96A 4R3LA 4UBRA 2HUZA 5F47A 2P0WA 4Y49C 3UY5A 4B5PA 3F5BA 4MJ8A 2WPXA 1S3ZA 2VBQA 1S7NA 3VWEA 4H6UA 2Q7BA 4JJXA 1V0CA 2I79A 4KOWA 1IIDA 4XPDC 5DWNA 1BOBA 3EY5A 2REEA 4R57A 4FD7A 4E2AA 4GS4A 2RC4A 3P2HA 2JDCA 3IWGA 3C26A 2ZW5A 5EC4A 2AE6A 5H86A 1S60A 1NSLA 3PP9A 4B5OA 4UWJA 4PSXA 3G3SA 4CAVA 5CNPA 4HKFA 1WWZA 2QIRA 3I3GA 1Y7RA 3GY9A 3JVNA 2CNTA 3WR7A 3ZJ0A 3DDDA 2ZPAA 5KTDA 4AVCA 2CY2A 2QECA 2FIWA 4K30A 3QAHA 2BL1A 2OZUA 3D8PA 2DXQA 4E0AA 2B3UA 4NEXA 4IF5A 4QBJA 4AG7A 3JUWA 4I49A 4R87A 3TO7A 5J8CA 4UWIA 4MHDA 2VZYA 1KZFA 5EBVA 4NF1A 1KUVA 3GKRA 3IGRA 2ZW6A 4NCZA 3TO9A 2HQYA 1M4GA 3MGDA 2J8NA 4YFJA 4PK2A 3EXNA 3I9SA 3DR8A 2PRBA 4QB9A 2OH1A 2P6GA 1FY7A 4XPKA 1YLEA 3TT2A 3LD2A 2B4DB 4JLYA 4Y49B 1U6MA 1UFHA 3G8WA 5JPHA 1VKCA 1XE4A 2VQYA 4AG9A 3FIXA 4JWPA 4XPLA 4CAWA 1P0HA 4II9A 2FXFA 3DR6A 1RO5A 2Q0YA 4LUAA 4KVME 2PDOA 3P2FA 2Z10A 1N71A 3T9YA 3BLNA 5C82A 3N7ZA 3W6XA 4FD4A 4QVTA 5IV0A 2CNSA 3S6KA 4JXRA 3DNSA 4L89A 2REFA 1IYLA 4R3KA 1S7FA 1XIXA 3FXTA 3TCVA 1MJAA 3CXPA 3V8IA 3RYOA 4MI4A 2BEIA 2B58A 4RS2A 1CM0A 5F49A 1S7KA 4KOUA 4F6AA 2P6FA 4AVBA 4RI1A 5HH1A 4CAXA 2OB0A 2B4BA 2K5TA 2FT0A 2X7BA 1YVOA 4LX9A 3R9GA 4KOTA 2KCWA 4PSWA 2H5MA 3TTHA 2D4PA 3PGPA 1M4DA 2D4OA 2GANA 4U5YA 1Q2DA 3GYAA 2O28A 4KLVA 3BJ7A 4R9MA 5HMNA 4HNXB 2I00A 1YGHA 2ZW7A 4KOSA 2OZHA 4KUAA 3T90A 4IUSA
chains in the Genus database with same CATH superfamily
1P4NA 3D7HA 2HV2A 4UCPA 4OIDA 4ZGYB 2ZEHA 5IX3A 1X10A 4CRZB 2ZEDA 1Y9KA 2WPWA 4MBUA 1QSNA 2FVGA 3W6SA 1ON0A 1YW4A 8CPAA 1B6BA 2ZW4A 3IFEA 2C27A 2Z11A 4KVOE 5LYDA 4KUBA 4UCMA 3QAYA 4BBHA 4JXQA 2VEZA 4OADA 3R9EA 2PJ9A 2FL4A 1B87A 5G21A 4CYQA 2QMLA 2GLJA 3KASA 1QSRA 3A9LA 5F46A 3CXSA 2PJ8A 3SJEA 2ATRA 4J3GA 2ZEPA 3K9UA 4B5PB 3PFOA 1IOFA 2VI7A 1JQGA 2YNCC 3B3VA 5G20A 4OKOA 3WC7A 1VIXA 2B5GA 4JYWA 3H8FA 5D8NA 5HVHA 1XF8A 2NYQA 2G3TA 3KGQA 4F9UA 1IB1E 3HUVA 4CS0B 1BAVA 4YU9A 4P4EA 2Y0MA 3SJFA 3R1KA 4A33A 2G0BA 3R9FA 1NMTA 2PC1A 3TOAA 3IIBA 3TC8A 5ISVA 1PU9A 4YRHA 4KZTA 3IJ3A 3LMSA 4K3NA 4YGOA 4MY3A 4C7IA 4ZYQA 4UFWA 2Q4VA 2Z3LA 5FVJA 3B8GA 1RXTA 3KQXA 5AGEA 3WC6A 2Q44A 3JRUA 3QB8A 2FE7A 4JD6A 1SQHA 3RNZA 2VXKA 3BJ8A 3S6HA 2OZGA 2JEVA 4DUKA 3TE4A 3FH4A 3D2PA 4CYOA 3NA6A 1HEEA 1M4IA 2NMTA 1Z9UA 4R7MA 2PR8A 2PR1A 4P4JA 1YW6A 3IEHA 5AG6A 3FB3A 4U9ZA 5K8PA 3RBUA 2Q43A 2ZEOA 2POKA 4PK3A 4UF4A 4XNHB 4EVYA 1AUGA 1J4JA 2Z0ZA 2VZZA 1M4LA 3D67A 4H89A 1YREA 4KOYA 4M6IA 4MFZA 4P4DA 4PPZA 3V38A 3VATA 5JM6A 3TFYA 5F48A 2BOAA 3CPAA 4JZ0A 2PJ1A 1X12A 4FWUA 4QC6A 3SHPA 4A31A 5J8FA 2PJ3A 3FYNA 1TKJA 2G3AA 2O4HA 3D7FA 4AVAA 1IY7A 4PXCA 1OZPA 4UIBA 1M1DA 4B11A 4FUUA 4P4BA 4A32A 2JDDA 4UA3A 3F8KA 1YK3A 2WSAA 3ISZA 2DF5A 4OAEA 4OP4A 4ONUA 3D68A 5KTCA 3PZJA 2EBJA 1F2PA 2C6CA 4FD5A 4F0YA 1TIQA 4MHZA 4NGQA 5H84A 4EMEA 2PCUA 4NFRA 1YX0A 4U9YA 1Z5RA 2BCOA 3ZZIA 1LRZA 4FD6A 4OC1A 5J1QA 1MJ9A 1S7LA 3KHZA 3KR5A 4KVXA 5E96A 4A38A 2PSWA 1Y9WA 2R1IA 1AYEA 4DNCA 2EVNA 2GLFA 5K8OA 3IO1A 2PJ2A 3CT9A 1BO4A 3S9NA 1OBRA 3SXOA 4BMHA 2ANPA 3TO6A 3PBEA 5C88A 1Z4RA 4M6GA 4MXUA 4E8OA 1ARLA 3FBUA 2B4DA 2OU2A 4AB7A 1TKHA 4Z65A 3LODA 1Q2YA 4XPDB 2WYRA 3VWDA 1BLLE 5KTAA 4NGRA 1S5KA 3KR4A 4UCNA 1YR0A 4Q36A 2BO9A 2PQ8A 2V8VA 4KOXA 2GE3A 1R57A 1WK4A 3SXNA 2I3CA 4KORA 3OWCA 2Q04A 3ISXA 2VL1A 2QJ8A 2B5GB 3D3SA 5ELYA 5GCNA 4A94A 2FS5A 3S6GA 2C6GA 4CAEA 5CBMA 1KUYA 2BSWA 1LAMA 4PV6A 4X5KA 2CIJA 2PIZA 2WZNA 1TF8A 1ZLIA 3EO4A 4P45A 4H6ZA 3H8EA 2ZEFA 3IU1A 3RZAA 3SJGA 2YGWA 4CYPA 2FIAA 3CXQA 4C7HA 3SI0A 1Y7EA 1AMPA 1IGBA 5BWAB 5LRKA 2CF4A 2PJAA 4M6HA 3EC4A 2ZXVA 5I4MA 4ZY2A 4HNWB 1NE9A 2A4NA 3CPXA 1LCPA 4ZX9A 2PRQA 4XNHC 4MCPA 3SI2A 4ZY0A 2FCKA 5DWMA 2V8DA 4R6TA 1CBXA 1CP6A 2XEIA 4KLWA 2R8VA 4M85A 5D29A 2AFXA 1QSTA 2J8MA 3VH9A 3R95A 1XMTA 4EWTA 1YVKA 2ZEEA 4X3RA 3LWUA 2IL4A 2JLMA 1GYTA 3FNCA 1VHEA 5K8NA 5HVGA 5JQ4A 1QSMA 1MJBA 2AFUA 1BPNA 4PXEA 1K4JA 4R76A 1I21A 2P6EA 3PB8X 4CGLA 2ZEMA 2QYVA 2Z3MA 2V8HA 4OC5A 3S9LA 4ZBGA 2GFQA 2YNDA 3F0AA 1DE4C 4MMOA 4KS9A 2B3VA 2EK8A 2ARHA 3KKWA 4KOVA 4P4IA 4MHYA 4Q7AA 2J8RA 3RO0A 4ZI6A 1XEBA 4OC4A 1Z8LA 2EUIA 1Z8XA 1PUAA 2FSRA 4UIAA 4FBEA 3TOBA 4H2KA 3B3SA 5IB9A 1CJWA 1KUXA 2GIVA 3NE7A 3SJXA 3D2MA 2CTCA 5A28A 1CG2A 1Q2CA 2XEFA 4OLLA 2DPSA 2Q4YA 3BXMA 3L2NA 1VHSA 1XRYA 3B2YA 1XFOA 3EFAA 4MFQA 3E0KA 3WT4A 2AFMA 3H4QA 4R8FA 4HNYB 3DSBA 1FNOA 1QSOA 5JGFA 1I12A 1HDUA 1Z4EA 4A37A 1Z2LA 3FF3A 3FECA 4CGMA 1XMBA 3NH4A 1MK4A 4MY0A 5LRGA 1IICA 4BD9A 2YNCA 2AJ6A 1M44A 4L8AA 4OC2A 4OC0A 4M3SA 2CNMA 5HVFA 2OOTA 3D66A 1YLOA 1NSAA 3BI0A 4MFJA 2YNEA 4AXVA 5I0CA 5IB0A 2EWBA 2GREA 1IYKA 1Y0RA 2BUEA 2PJ6A 1RTQA 4QUSA 4KSIA 4RN7A 4C68A 2R7HA 2R98A 1I1DA 3W91A 5K8MA 1L0CA 2Z3PA 3D4UA 1TKFA 2F5IA 1XJOA 3NH5A 2J9AA 1GHEA 3PEIA 4NSQA 3S6FA 2HB6A 4A30A 5AG4A 2IJZA 3FRMA 4NXYA 4PXBA 3NFZA 4CRYB 4ORFA 4PXDA 3R96A 4NJQA 4R3LA 3PB9X 4UEZA 3WABA 4UBRA 2HUZA 5F47A 2P0WA 4Y49C 3UY5A 4B5PA 3KL9A 2Z3KA 3K9TA 3F5BA 4CPAA 4MJ8A 2WPXA 4W9YA 3GLJA 1S3ZA 2VBQA 3SI1A 1S7NA 1YSJA 3DGVA 3VWEA 1TXRA 4B12A 4B6ZA 4H6UA 4BINA 7CPAA 2Q7BA 4B13A 1ZO0A 4JJXA 5LYLA 1V0CA 2I79A 4KOWA 4RUHA 4UFXA 1IIDA 4XPDC 5AG7A 5DWNA 2PJBA 1BOBA 3EY5A 3NH8A 2REEA 4R57A 4FD7A 4E2AA 4GS4A 2Z3NA 3IWWA 4A95A 2RC4A 4TWEA 2ZOGA 3P2HA 1Q7LA 2JDCA 3GUXA 1CX8A 3IWGA 4GXHA 3C26A 2ZW5A 4O23A 5EC4A 3V7ZA 2AE6A 5JH9A 2PJCA 5H86A 2AFSA 1BPMA 1R3NA 1S60A 1NSLA 2PIYA 3PP9A 4P4FA 4FAIA 4B10A 4OIWA 4UEFA 4PSXA 4UWJA 4B5OA 6CPAA 3G3SA 4CAVA 5CNPA 2PJ4A 3IU2A 4HKFA 1IOIA 2ZEGA 4OMEA 1WWZA 3FEDA 2QIRA 5AG5A 1LOKA 3I3GA 4MHPA 1Y7RA 3GY9A 3JVNA 2CNTA 2ZELA 3WR7A 3K2KA 3ZJ0A 3DDDA 2CTBA 1IU8A 1QQ9A 3MN8A 2NSMA 2ZPAA 5LYFA 4F0XA 5KTDA 3QNVA 3KI9A 4AVCA 4HPSA 3KZWA 2XEGA 2CY2A 2QECA 2Q51A 2FIWA 3FX6A 3JTKA 3QAHA 4K30A 4DYOA 2BL1A 1YQEA 2OZUA 3D8PA 2DXQA 3MRUA 3B3TA 2B3UA 2V77A 4E0AA 2PJ7A 3D7DA 4NEXA 2V8GA 4IF5A 5LRJA 4QBJA 4GM5A 2ZENA 4AG7A 3JUWA 4I49A 2CXAA 2AFZA 2PJ0A 4R87A 3TO7A 1Z8TA 2ABZA 3PBBA 4X2TA 4B14A 5J8CA 1DTDA 1YMEA 3B7IA 4UWIA 2DPTA 1ZG7A 5G22A 3KHXA 1LAPA 1FT7A 4G1PA 4MHDA 4PQAA 3GIUA 2VZYA 1KZFA 3PB6X 3IC1A 3RAMA 5EBVA 4MHNA 1Z8WA 4NGMA 4NF1A 1ZG8A 4KSAA 1TF9A 1KUVA 3VARA 3GKRA 3IGRA 2ZW6A 4NCZA 3TO9A 4NJRA 4MCQA 2HQYA 1M4GA 4IK2A 3MGDA 2J8NA 2ODFA 1ZLHA 5F09A 4YFJA 4PK2A 2JBKA 2WUUA 2Q7SA 3EXNA 1EE3P 1UWYA 3I9SA 4A39A 1KWMA 2IMOA 3DR8A 4CGOA 2PRBA 4QB9A 2OH1A 2P6GA 1FY7A 2JEWA 3DLJA 4XPKA 1PCAA 2EO8A 1YLEA 3TT2A 5HXDA 3LD2A 2B4DB 2G9DA 3KQZA 3PFEA 4UFVA 4JLYA 4Y49B 1U6MA 1UFHA 1ZG9A 3G8WA 5JPHA 2F7VA 1VKCA 1XE4A 2VQYA 4LQGA 4AG9A 3FIXA 1ELLP 1CPSA 4JWPA 4XPLA 4CAWA 1P0HA 2RB7A 1R43A 4NGTA 4C2ZA 1QMUA 4IHMA 3PB4X 4CGPA 1F57A 3WC5A 4II9A 2FXFA 3DR6A 2Q4ZA 2IQ6A 2Z3OA 1RO5A 3D7GA 5G1ZA 3GB0A 2Q0YA 2ZOFA 4LUAA 4A2ZA 3N5FA 4KVME 2PDOA 3P2FA 2Z10A 1N71A 3FMCA 2PVWA 3T9YA 4CGNA 3BLNA 1VHOA 3H5ZA 2PJ5A 5C82A 1PYTB 1LANA 1XOVA 2AFOA 3N7ZA 3W6XA 5LYIA 3B35A 3T8WA 4FD4A 4NGSA 4QVTA 5IV0A 2CNSA 3S6KA 4JXRA 3DNSA 4KSFA 2EK9A 2QVPA 2RFHA 4L89A 2F8HA 2REFA 1IYLA 4R3KA 2HC9A 1ARMA 1JWQA 1S7FA 1XIXA 2GU2A 4UEEA 5DS0A 3S9MA 3FXTA 2C6PA 3TCVA 1MJAA 4C2YA 3CXPA 4F9VA 4P6YA 4P44A 5CPAA 1HDQA 4MCRA 1CP7A 4TNUA 2XEJA 3V8IA 1XBUA 3HLPA 2BEIA 2B58A 3PB7X 4MI4A 1A2ZA 4MRIA 4P10A 3RYOA 4RS2A 1CM0A 1Y0YA 1S7KA 3I1UA 3CZXA 2P6FA 4KOUA 5F49A 4F6AA 4WWVA 1CPXA 4AVBA 2OR4A 4RI1A 5HH1A 1H8LA 3IWEA 4IAVA 4ZY1A 4CAXA 4WJBA 2OB0A 2B4BA 2O53A 2AFWA 3BI1A 4EFDA 2DEAA 2PVVA 2K5TA 3B3CA 2JBJA 2PE3A 3H8GA 2FT0A 3TX8A 1VGYA 2X7BA 1YVOA 4LX9A 3R9GA 4KOTA 4ZX8A 2KCWA 4MFPA 4MFLA 5A27A 4NGPA 1F2OA 4PSWA 3FJUA 3LACA 2H5MA 3B3WA 3FEEA 4Q38A 4CYNA 3TTHA 2C1CA 3PRTA 4C2XA 4CAFA 4X8IA 1ELMP 2D4PA 3CDXA 4ONWA 4OC3A 3PGPA 1M4DA 2D4OA 2GANA 4U5YA 1Q2DA 3GYAA 2O28A 4KLVA 3BJ7A 4MFKA 4R9MA 4HNXB 4YWYA 5HMNA 4MCSA 4NGNA 2I00A 5THWA 4F8ZA 5EMIA 1YGHA 2ZW7A 4KOSA 2OZHA 1LFWA 4LQ6A 4KUAA 3T90A 3BHXA 3FVLA 4DJLA 4IUSA 3NE8A
chains in the Genus database with same CATH topology
1P4NA 2HV2A 4UCPA 4ZGYB 5IX3A 4CRZB 1Y9KA 2WPWA 4MBUA 1QSNA 3W6SA 1ON0A 1B6BA 2ZW4A 2C27A 2Z11A 4KVOE 4KUBA 4UCMA 4BBHA 4JXQA 2VEZA 4OADA 3R9EA 2FL4A 1B87A 5G21A 4CYQA 2QMLA 1QSRA 3A9LA 5F46A 3CXSA 2ATRA 4J3GA 3K9UA 2VI7A 2YNCC 5G20A 2B5GA 1XF8A 2G3TA 1IB1E 4CS0B 2Y0MA 3R1KA 4A33A 2G0BA 3R9FA 1NMTA 2PC1A 3TOAA 5ISVA 1PU9A 4YRHA 4KZTA 4YGOA 4MY3A 4C7IA 4UFWA 2Q4VA 2Z3LA 5FVJA 3B8GA 1RXTA 5AGEA 2Q44A 3QB8A 2FE7A 4JD6A 1SQHA 2VXKA 3BJ8A 3S6HA 2JEVA 2OZGA 3TE4A 4CYOA 3D2PA 1M4IA 2NMTA 1Z9UA 2PR8A 2PR1A 5AG6A 3FB3A 4U9ZA 4PK3A 4XNHB 4EVYA 1J4JA 2Z0ZA 2VZZA 4KOYA 4H89A 1YREA 4MFZA 3TFYA 5F48A 3SHPA 4QC6A 4A31A 5J8FA 3FYNA 2G3AA 4AVAA 1OZPA 1M1DA 4B11A 4A32A 2JDDA 4UA3A 3F8KA 1YK3A 2WSAA 4OAEA 4ONUA 5KTCA 3PZJA 4FD5A 4F0YA 1TIQA 5H84A 1YX0A 4U9YA 3ZZIA 1LRZA 4FD6A 1MJ9A 1S7LA 4KVXA 5E96A 2PSWA 1Y9WA 2R1IA 4DNCA 2EVNA 1BO4A 4BMHA 3SXOA 3TO6A 5C88A 1Z4RA 4E8OA 3FBUA 2B4DA 2OU2A 4AB7A 3LODA 1Q2YA 4XPDB 3VWDA 5KTAA 1S5KA 4UCNA 1YR0A 4Q36A 2PQ8A 4KOXA 2GE3A 1R57A 1WK4A 3SXNA 4KORA 3OWCA 2Q04A 5GCNA 2B5GB 3D3SA 4CAEA 2FS5A 3S6GA 1KUYA 2BSWA 4PV6A 4X5KA 3EO4A 4H6ZA 3IU1A 2YGWA 2FIAA 3CXQA 4C7HA 5BWAB 3EC4A 2ZXVA 4HNWB 1NE9A 2A4NA 4XNHC 2FCKA 5DWMA 4KLWA 4M85A 2R8VA 1QSTA 2J8MA 3R95A 1XMTA 1YVKA 2IL4A 2JLMA 3FNCA 5JQ4A 1QSMA 1MJBA 1K4JA 1I21A 2P6EA 4CGLA 2Z3MA 4ZBGA 2YNDA 3F0AA 4KS9A 2B3VA 3KKWA 2ARHA 4KOVA 2J8RA 1XEBA 2EUIA 2FSRA 1PUAA 3TOBA 1CJWA 1KUXA 2GIVA 3NE7A 3D2MA 5A28A 1Q2CA 4OLLA 2DPSA 2Q4YA 4B5PB 1VHSA 3EFAA 4MFQA 3E0KA 3H4QA 4HNYB 3DSBA 1QSOA 1I12A 1Z4EA 4CGMA 1MK4A 4MY0A 1IICA 2YNCA 2AJ6A 1M44A 4L8AA 4M3SA 2CNMA 4MFJA 2YNEA 5I0CA 5IB0A 1IYKA 2BUEA 4QUSA 4C68A 2R7HA 2R98A 1I1DA 3W91A 2Z3PA 1L0CA 2F5IA 5AG4A 3S6FA 1GHEA 4NSQA 4A30A 3FRMA 4NXYA 4CRYB 4ORFA 3R96A 4R3LA 4UBRA 2HUZA 5F47A 2P0WA 4Y49C 3UY5A 4B5PA 2Z3KA 3F5BA 4MJ8A 2WPXA 1S3ZA 2VBQA 1S7NA 3VWEA 4B12A 4H6UA 2Q7BA 4B13A 1ZO0A 4JJXA 1V0CA 2I79A 4KOWA 4UFXA 1IIDA 4XPDC 5AG7A 5DWNA 1BOBA 3EY5A 2REEA 4R57A 4FD7A 4E2AA 4GS4A 2Z3NA 4A95A 2RC4A 3P2HA 2JDCA 3IWGA 3C26A 2ZW5A 5EC4A 2AE6A 5H86A 1S60A 1NSLA 3PP9A 4B10A 4UWJA 4B5OA 4PSXA 3G3SA 4CAVA 5CNPA 3IU2A 4HKFA 1WWZA 2QIRA 5AG5A 3I3GA 1Y7RA 3GY9A 3JVNA 2CNTA 3WR7A 3ZJ0A 3DDDA 2ZPAA 4F0XA 5KTDA 4AVCA 2CY2A 2QECA 2FIWA 3JTKA 3QAHA 4K30A 2BL1A 2OZUA 3D8PA 2DXQA 4E0AA 2B3UA 4NEXA 4IF5A 4QBJA 4AG7A 3JUWA 4I49A 2CXAA 4R87A 3TO7A 4B14A 5J8CA 4UWIA 2DPTA 5G22A 4MHDA 2VZYA 1KZFA 5EBVA 4NF1A 4KSAA 1KUVA 3GKRA 3IGRA 2ZW6A 4NCZA 3TO9A 2HQYA 1M4GA 3MGDA 2J8NA 4YFJA 4PK2A 2WUUA 3EXNA 3I9SA 3DR8A 4CGOA 2PRBA 4QB9A 2OH1A 2P6GA 1FY7A 4XPKA 1YLEA 3TT2A 3LD2A 2B4DB 4UFVA 4JLYA 4Y49B 1U6MA 1UFHA 3G8WA 5JPHA 1VKCA 1XE4A 2VQYA 4AG9A 3FIXA 4JWPA 4XPLA 4CAWA 1P0HA 4C2ZA 4CGPA 4II9A 2FXFA 3DR6A 2Z3OA 5G1ZA 1RO5A 2Q0YA 4LUAA 4A2ZA 4KVME 2PDOA 3P2FA 2Z10A 1N71A 3T9YA 4CGNA 3BLNA 3H5ZA 5C82A 3N7ZA 3W6XA 4FD4A 4QVTA 5IV0A 2CNSA 3S6KA 4JXRA 3DNSA 4KSFA 4L89A 2REFA 1IYLA 4R3KA 1S7FA 1XIXA 3FXTA 3TCVA 1MJAA 4C2YA 3CXPA 3V8IA 3RYOA 2BEIA 2B58A 4MI4A 4CYPA 4RS2A 1CM0A 5F49A 1S7KA 4KOUA 4F6AA 2P6FA 4AVBA 4RI1A 5HH1A 3IWEA 4CAXA 2OB0A 2B4BA 2K5TA 2FT0A 2X7BA 1YVOA 4LX9A 3R9GA 4KOTA 2KCWA 4MFPA 4MFLA 5A27A 4PSWA 2H5MA 4Q38A 4CYNA 3TTHA 4C2XA 4CAFA 2D4PA 3PGPA 1M4DA 2D4OA 2GANA 4U5YA 1Q2DA 3GYAA 2O28A 4KLVA 3BJ7A 4MFKA 4R9MA 4HNXB 5HMNA 2I00A 1YGHA 2ZW7A 4KOSA 2OZHA 4KUAA 3T90A 4IUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4N A;  2HV2 A;  5IX3 A;  4CRZ B;  1Y9K A;  2WPW A;  4MBU A;  1QSN A;  3W6S A;  1ON0 A;  1B6B A;  2ZW4 A;  2C27 A;  2Z11 A;  4KVO E;  4KUB A;  4JXQ A;  2VEZ A;  4OAD A;  3R9E A;  2FL4 A;  1B87 A;  2QML A;  1QSR A;  5F46 A;  3CXS A;  2ATR A;  4J3G A;  3K9U A;  2VI7 A;  2B5G A;  1XF8 A;  2G3T A;  1IB1 E;  4CS0 B;  2Y0M A;  3R1K A;  2G0B A;  3R9F A;  1NMT A;  2PC1 A;  3TOA A;  5ISV A;  1PU9 A;  4YRH A;  4KZT A;  4YGO A;  4MY3 A;  2Q4V A;  5FVJ A;  3B8G A;  1RXT A;  2Q44 A;  3QB8 A;  2FE7 A;  4JD6 A;  1SQH A;  2VXK A;  3BJ8 A;  3S6H A;  2JEV A;  2OZG A;  3TE4 A;  3D2P A;  1M4I A;  2NMT A;  1Z9U A;  2PR8 A;  2PR1 A;  3FB3 A;  4U9Z A;  4PK3 A;  4XNH B;  4EVY A;  1J4J A;  2Z0Z A;  2VZZ A;  4KOY A;  4H89 A;  1YRE A;  3TFY A;  5F48 A;  3SHP A;  4QC6 A;  5J8F A;  3FYN A;  2G3A A;  4AVA A;  1OZP A;  1M1D A;  2JDD A;  4UA3 A;  3F8K A;  1YK3 A;  4OAE A;  4ONU A;  5KTC A;  3PZJ A;  4FD5 A;  4F0Y A;  1TIQ A;  5H84 A;  1YX0 A;  4U9Y A;  3ZZI A;  1LRZ A;  4FD6 A;  1MJ9 A;  1S7L A;  4KVX A;  5E96 A;  2PSW A;  1Y9W A;  2R1I A;  4DNC A;  2EVN A;  1BO4 A;  4BMH A;  3SXO A;  3TO6 A;  5C88 A;  1Z4R A;  4E8O A;  3FBU A;  2B4D A;  2OU2 A;  4AB7 A;  3LOD A;  1Q2Y A;  4XPD B;  3VWD A;  5KTA A;  1S5K A;  1YR0 A;  2PQ8 A;  4KOX A;  2GE3 A;  1R57 A;  1WK4 A;  3SXN A;  4KOR A;  3OWC A;  2Q04 A;  5GCN A;  2B5G B;  3D3S A;  2FS5 A;  3S6G A;  1KUY A;  2BSW A;  4PV6 A;  4X5K A;  3EO4 A;  4H6Z A;  2FIA A;  3CXQ A;  3EC4 A;  2ZXV A;  4HNW B;  1NE9 A;  2A4N A;  4XNH C;  2FCK A;  5DWM A;  4KLW A;  4M85 A;  2R8V A;  1QST A;  2J8M A;  3R95 A;  1XMT A;  1YVK A;  2IL4 A;  2JLM A;  3FNC A;  5JQ4 A;  1QSM A;  1MJB A;  1K4J A;  1I21 A;  2P6E A;  4ZBG A;  3F0A A;  2B3V A;  3KKW A;  2ARH A;  4KOV A;  2J8R A;  1XEB A;  2EUI A;  2FSR A;  1PUA A;  3TOB A;  1CJW A;  1KUX A;  2GIV A;  3NE7 A;  3D2M A;  1Q2C A;  4OLL A;  2Q4Y A;  4B5P B;  1VHS A;  3EFA A;  3E0K A;  3H4Q A;  4HNY B;  3DSB A;  1QSO A;  1I12 A;  1Z4E A;  1MK4 A;  4MY0 A;  1IIC A;  2AJ6 A;  1M44 A;  4L8A A;  4M3S A;  2CNM A;  5I0C A;  5IB0 A;  1IYK A;  2BUE A;  4QUS A;  2R7H A;  2R98 A;  1I1D A;  3W91 A;  1L0C A;  2F5I A;  3S6F A;  1GHE A;  4NSQ A;  3FRM A;  4NXY A;  4CRY B;  4ORF A;  3R96 A;  4R3L A;  4UBR A;  2HUZ A;  5F47 A;  2P0W A;  4Y49 C;  3UY5 A;  4B5P A;  3F5B A;  4MJ8 A;  2WPX A;  1S3Z A;  2VBQ A;  1S7N A;  3VWE A;  4H6U A;  2Q7B A;  4JJX A;  1V0C A;  2I79 A;  4KOW A;  1IID A;  4XPD C;  5DWN A;  1BOB A;  3EY5 A;  2REE A;  4R57 A;  4FD7 A;  4E2A A;  4GS4 A;  2RC4 A;  3P2H A;  2JDC A;  3IWG A;  3C26 A;  2ZW5 A;  5EC4 A;  2AE6 A;  5H86 A;  1S60 A;  1NSL A;  3PP9 A;  4B5O A;  4UWJ A;  4PSX A;  3G3S A;  4CAV A;  5CNP A;  4HKF A;  1WWZ A;  2QIR A;  3I3G A;  1Y7R A;  3GY9 A;  3JVN A;  2CNT A;  3WR7 A;  3ZJ0 A;  3DDD A;  2ZPA A;  5KTD A;  4AVC A;  2CY2 A;  2QEC A;  2FIW A;  4K30 A;  3QAH A;  2BL1 A;  2OZU A;  3D8P A;  2DXQ A;  4E0A A;  2B3U A;  4NEX A;  4IF5 A;  4QBJ A;  4AG7 A;  3JUW A;  4I49 A;  4R87 A;  3TO7 A;  5J8C A;  4UWI A;  4MHD A;  2VZY A;  1KZF A;  5EBV A;  4NF1 A;  1KUV A;  3GKR A;  3IGR A;  2ZW6 A;  4NCZ A;  3TO9 A;  2HQY A;  1M4G A;  3MGD A;  2J8N A;  4YFJ A;  4PK2 A;  3EXN A;  3I9S A;  3DR8 A;  2PRB A;  4QB9 A;  2OH1 A;  2P6G A;  1FY7 A;  4XPK A;  1YLE A;  3TT2 A;  3LD2 A;  2B4D B;  4JLY A;  4Y49 B;  1U6M A;  1UFH A;  3G8W A;  5JPH A;  1VKC A;  1XE4 A;  2VQY A;  4AG9 A;  3FIX A;  4JWP A;  4XPL A;  4CAW A;  1P0H A;  4II9 A;  2FXF A;  3DR6 A;  1RO5 A;  2Q0Y A;  4LUA A;  4KVM E;  2PDO A;  3P2F A;  2Z10 A;  1N71 A;  3T9Y A;  3BLN A;  5C82 A;  3N7Z A;  3W6X A;  4FD4 A;  4QVT A;  5IV0 A;  2CNS A;  3S6K A;  4JXR A;  3DNS A;  4L89 A;  2REF A;  1IYL A;  4R3K A;  1S7F A;  1XIX A;  3FXT A;  3TCV A;  1MJA A;  3CXP A;  3V8I A;  3RYO A;  4MI4 A;  2BEI A;  2B58 A;  4RS2 A;  1CM0 A;  5F49 A;  1S7K A;  4KOU A;  4F6A A;  2P6F A;  4AVB A;  4RI1 A;  5HH1 A;  4CAX A;  2OB0 A;  2B4B A;  2K5T A;  2FT0 A;  2X7B A;  1YVO A;  4LX9 A;  3R9G A;  4KOT A;  2KCW A;  4PSW A;  2H5M A;  3TTH A;  2D4P A;  3PGP A;  1M4D A;  2D4O A;  2GAN A;  4U5Y A;  1Q2D A;  3GYA A;  2O28 A;  4KLV A;  3BJ7 A;  4R9M A;  5HMN A;  4HNX B;  2I00 A;  1YGH A;  2ZW7 A;  4KOS A;  2OZH A;  4KUA A;  3T90 A;  4IUS A; 
#chains in the Genus database with same CATH topology
 1P4N A;  3D7H A;  2HV2 A;  4UCP A;  4OID A;  4ZGY B;  2ZEH A;  5IX3 A;  1X10 A;  4CRZ B;  2ZED A;  1Y9K A;  2WPW A;  4MBU A;  1QSN A;  2FVG A;  3W6S A;  1ON0 A;  1YW4 A;  8CPA A;  1B6B A;  2ZW4 A;  3IFE A;  2C27 A;  2Z11 A;  4KVO E;  5LYD A;  4KUB A;  4UCM A;  3QAY A;  4BBH A;  4JXQ A;  2VEZ A;  4OAD A;  3R9E A;  2PJ9 A;  2FL4 A;  1B87 A;  5G21 A;  4CYQ A;  2QML A;  2GLJ A;  3KAS A;  1QSR A;  3A9L A;  5F46 A;  3CXS A;  2PJ8 A;  3SJE A;  2ATR A;  4J3G A;  2ZEP A;  3K9U A;  4B5P B;  3PFO A;  1IOF A;  2VI7 A;  1JQG A;  2YNC C;  3B3V A;  5G20 A;  4OKO A;  3WC7 A;  1VIX A;  2B5G A;  4JYW A;  3H8F A;  5D8N A;  5HVH A;  1XF8 A;  2NYQ A;  2G3T A;  3KGQ A;  4F9U A;  1IB1 E;  3HUV A;  4CS0 B;  1BAV A;  4YU9 A;  4P4E A;  2Y0M A;  3SJF A;  3R1K A;  4A33 A;  2G0B A;  3R9F A;  1NMT A;  2PC1 A;  3TOA A;  3IIB A;  3TC8 A;  5ISV A;  1PU9 A;  4YRH A;  4KZT A;  3IJ3 A;  3LMS A;  4K3N A;  4YGO A;  4MY3 A;  4C7I A;  4ZYQ A;  4UFW A;  2Q4V A;  2Z3L A;  5FVJ A;  3B8G A;  1RXT A;  3KQX A;  5AGE A;  3WC6 A;  2Q44 A;  3JRU A;  3QB8 A;  2FE7 A;  4JD6 A;  1SQH A;  3RNZ A;  2VXK A;  3BJ8 A;  3S6H A;  2OZG A;  2JEV A;  4DUK A;  3TE4 A;  3FH4 A;  3D2P A;  4CYO A;  3NA6 A;  1HEE A;  1M4I A;  2NMT A;  1Z9U A;  4R7M A;  2PR8 A;  2PR1 A;  4P4J A;  1YW6 A;  3IEH A;  5AG6 A;  3FB3 A;  4U9Z A;  5K8P A;  3RBU A;  2Q43 A;  2ZEO A;  2POK A;  4PK3 A;  4UF4 A;  4XNH B;  4EVY A;  1AUG A;  1J4J A;  2Z0Z A;  2VZZ A;  1M4L A;  3D67 A;  4H89 A;  1YRE A;  4KOY A;  4M6I A;  4MFZ A;  4P4D A;  4PPZ A;  3V38 A;  3VAT A;  5JM6 A;  3TFY A;  5F48 A;  2BOA A;  3CPA A;  4JZ0 A;  2PJ1 A;  1X12 A;  4FWU A;  4QC6 A;  3SHP A;  4A31 A;  5J8F A;  2PJ3 A;  3FYN A;  1TKJ A;  2G3A A;  2O4H A;  3D7F A;  4AVA A;  1IY7 A;  4PXC A;  1OZP A;  4UIB A;  1M1D A;  4B11 A;  4FUU A;  4P4B A;  4A32 A;  2JDD A;  4UA3 A;  3F8K A;  1YK3 A;  2WSA A;  3ISZ A;  2DF5 A;  4OAE A;  4OP4 A;  4ONU A;  3D68 A;  5KTC A;  3PZJ A;  2EBJ A;  1F2P A;  2C6C A;  4FD5 A;  4F0Y A;  1TIQ A;  4MHZ A;  4NGQ A;  5H84 A;  4EME A;  2PCU A;  4NFR A;  1YX0 A;  4U9Y A;  1Z5R A;  2BCO A;  3ZZI A;  1LRZ A;  4FD6 A;  4OC1 A;  5J1Q A;  1MJ9 A;  1S7L A;  3KHZ A;  3KR5 A;  4KVX A;  5E96 A;  4A38 A;  2PSW A;  1Y9W A;  2R1I A;  1AYE A;  4DNC A;  2EVN A;  2GLF A;  5K8O A;  3IO1 A;  2PJ2 A;  3CT9 A;  1BO4 A;  3S9N A;  1OBR A;  3SXO A;  4BMH A;  2ANP A;  3TO6 A;  3PBE A;  5C88 A;  1Z4R A;  4M6G A;  4MXU A;  4E8O A;  1ARL A;  3FBU A;  2B4D A;  2OU2 A;  4AB7 A;  1TKH A;  4Z65 A;  3LOD A;  1Q2Y A;  4XPD B;  2WYR A;  3VWD A;  1BLL E;  5KTA A;  4NGR A;  1S5K A;  3KR4 A;  4UCN A;  1YR0 A;  4Q36 A;  2BO9 A;  2PQ8 A;  2V8V A;  4KOX A;  2GE3 A;  1R57 A;  1WK4 A;  3SXN A;  2I3C A;  4KOR A;  3OWC A;  2Q04 A;  3ISX A;  2VL1 A;  2QJ8 A;  2B5G B;  3D3S A;  5ELY A;  5GCN A;  4A94 A;  2FS5 A;  3S6G A;  2C6G A;  4CAE A;  5CBM A;  1KUY A;  2BSW A;  1LAM A;  4PV6 A;  4X5K A;  2CIJ A;  2PIZ A;  2WZN A;  1TF8 A;  1ZLI A;  3EO4 A;  4P45 A;  4H6Z A;  3H8E A;  2ZEF A;  3IU1 A;  3RZA A;  3SJG A;  2YGW A;  4CYP A;  2FIA A;  3CXQ A;  4C7H A;  3SI0 A;  1Y7E A;  1AMP A;  1IGB A;  5BWA B;  5LRK A;  2CF4 A;  2PJA A;  4M6H A;  3EC4 A;  2ZXV A;  5I4M A;  4ZY2 A;  4HNW B;  1NE9 A;  2A4N A;  3CPX A;  1LCP A;  4ZX9 A;  2PRQ A;  4XNH C;  4MCP A;  3SI2 A;  4ZY0 A;  2FCK A;  5DWM A;  2V8D A;  4R6T A;  1CBX A;  1CP6 A;  2XEI A;  4KLW A;  2R8V A;  4M85 A;  5D29 A;  2AFX A;  1QST A;  2J8M A;  3VH9 A;  3R95 A;  1XMT A;  4EWT A;  1YVK A;  2ZEE A;  4X3R A;  3LWU A;  2IL4 A;  2JLM A;  1GYT A;  3FNC A;  1VHE A;  5K8N A;  5HVG A;  5JQ4 A;  1QSM A;  1MJB A;  2AFU A;  1BPN A;  4PXE A;  1K4J A;  4R76 A;  1I21 A;  2P6E A;  3PB8 X;  4CGL A;  2ZEM A;  2QYV A;  2Z3M A;  2V8H A;  4OC5 A;  3S9L A;  4ZBG A;  2GFQ A;  2YND A;  3F0A A;  1DE4 C;  4MMO A;  4KS9 A;  2B3V A;  2EK8 A;  2ARH A;  3KKW A;  4KOV A;  4P4I A;  4MHY A;  4Q7A A;  2J8R A;  3RO0 A;  4ZI6 A;  1XEB A;  4OC4 A;  1Z8L A;  2EUI A;  1Z8X A;  1PUA A;  2FSR A;  4UIA A;  4FBE A;  3TOB A;  4H2K A;  3B3S A;  5IB9 A;  1CJW A;  1KUX A;  2GIV A;  3NE7 A;  3SJX A;  3D2M A;  2CTC A;  5A28 A;  1CG2 A;  1Q2C A;  2XEF A;  4OLL A;  2DPS A;  2Q4Y A;  3BXM A;  3L2N A;  1VHS A;  1XRY A;  3B2Y A;  1XFO A;  3EFA A;  4MFQ A;  3E0K A;  3WT4 A;  2AFM A;  3H4Q A;  4R8F A;  4HNY B;  3DSB A;  1FNO A;  1QSO A;  5JGF A;  1I12 A;  1HDU A;  1Z4E A;  4A37 A;  1Z2L A;  3FF3 A;  3FEC A;  4CGM A;  1XMB A;  3NH4 A;  1MK4 A;  4MY0 A;  5LRG A;  1IIC A;  4BD9 A;  2YNC A;  2AJ6 A;  1M44 A;  4L8A A;  4OC2 A;  4OC0 A;  4M3S A;  2CNM A;  5HVF A;  2OOT A;  3D66 A;  1YLO A;  1NSA A;  3BI0 A;  4MFJ A;  2YNE A;  4AXV A;  5I0C A;  5IB0 A;  2EWB A;  2GRE A;  1IYK A;  1Y0R A;  2BUE A;  2PJ6 A;  1RTQ A;  4QUS A;  4KSI A;  4RN7 A;  4C68 A;  2R7H A;  2R98 A;  1I1D A;  3W91 A;  5K8M A;  1L0C A;  2Z3P A;  3D4U A;  1TKF A;  2F5I A;  1XJO A;  3NH5 A;  2J9A A;  1GHE A;  3PEI A;  4NSQ A;  3S6F A;  2HB6 A;  4A30 A;  5AG4 A;  2IJZ A;  3FRM A;  4NXY A;  4PXB A;  3NFZ A;  4CRY B;  4ORF A;  4PXD A;  3R96 A;  4NJQ A;  4R3L A;  3PB9 X;  4UEZ A;  3WAB A;  4UBR A;  2HUZ A;  5F47 A;  2P0W A;  4Y49 C;  3UY5 A;  4B5P A;  3KL9 A;  2Z3K A;  3K9T A;  3F5B A;  4CPA A;  4MJ8 A;  2WPX A;  4W9Y A;  3GLJ A;  1S3Z A;  2VBQ A;  3SI1 A;  1S7N A;  1YSJ A;  3DGV A;  3VWE A;  1TXR A;  4B12 A;  4B6Z A;  4H6U A;  4BIN A;  7CPA A;  2Q7B A;  4B13 A;  1ZO0 A;  4JJX A;  5LYL A;  1V0C A;  2I79 A;  4KOW A;  4RUH A;  4UFX A;  1IID A;  4XPD C;  5AG7 A;  5DWN A;  2PJB A;  1BOB A;  3EY5 A;  3NH8 A;  2REE A;  4R57 A;  4FD7 A;  4E2A A;  4GS4 A;  2Z3N A;  3IWW A;  4A95 A;  2RC4 A;  4TWE A;  2ZOG A;  3P2H A;  1Q7L A;  2JDC A;  3GUX A;  1CX8 A;  3IWG A;  4GXH A;  3C26 A;  2ZW5 A;  4O23 A;  5EC4 A;  3V7Z A;  2AE6 A;  5JH9 A;  2PJC A;  5H86 A;  2AFS A;  1BPM A;  1R3N A;  1S60 A;  1NSL A;  2PIY A;  3PP9 A;  4P4F A;  4FAI A;  4B10 A;  4OIW A;  4UEF A;  4PSX A;  4UWJ A;  4B5O A;  6CPA A;  3G3S A;  4CAV A;  5CNP A;  2PJ4 A;  3IU2 A;  4HKF A;  1IOI A;  2ZEG A;  4OME A;  1WWZ A;  3FED A;  2QIR A;  5AG5 A;  1LOK A;  3I3G A;  4MHP A;  1Y7R A;  3GY9 A;  3JVN A;  2CNT A;  2ZEL A;  3WR7 A;  3K2K A;  3ZJ0 A;  3DDD A;  2CTB A;  1IU8 A;  1QQ9 A;  3MN8 A;  2NSM A;  2ZPA A;  5LYF A;  4F0X A;  5KTD A;  3QNV A;  3KI9 A;  4AVC A;  4HPS A;  3KZW A;  2XEG A;  2CY2 A;  2QEC A;  2Q51 A;  2FIW A;  3FX6 A;  3JTK A;  3QAH A;  4K30 A;  4DYO A;  2BL1 A;  1YQE A;  2OZU A;  3D8P A;  2DXQ A;  3MRU A;  3B3T A;  2B3U A;  2V77 A;  4E0A A;  2PJ7 A;  3D7D A;  4NEX A;  2V8G A;  4IF5 A;  5LRJ A;  4QBJ A;  4GM5 A;  2ZEN A;  4AG7 A;  3JUW A;  4I49 A;  2CXA A;  2AFZ A;  2PJ0 A;  4R87 A;  3TO7 A;  1Z8T A;  2ABZ A;  3PBB A;  4X2T A;  4B14 A;  5J8C A;  1DTD A;  1YME A;  3B7I A;  4UWI A;  2DPT A;  1ZG7 A;  5G22 A;  3KHX A;  1LAP A;  1FT7 A;  4G1P A;  4MHD A;  4PQA A;  3GIU A;  2VZY A;  1KZF A;  3PB6 X;  3IC1 A;  3RAM A;  5EBV A;  4MHN A;  1Z8W A;  4NGM A;  4NF1 A;  1ZG8 A;  4KSA A;  1TF9 A;  1KUV A;  3VAR A;  3GKR A;  3IGR A;  2ZW6 A;  4NCZ A;  3TO9 A;  4NJR A;  4MCQ A;  2HQY A;  1M4G A;  4IK2 A;  3MGD A;  2J8N A;  2ODF A;  1ZLH A;  5F09 A;  4YFJ A;  4PK2 A;  2JBK A;  2WUU A;  2Q7S A;  3EXN A;  1EE3 P;  1UWY A;  3I9S A;  4A39 A;  1KWM A;  2IMO A;  3DR8 A;  4CGO A;  2PRB A;  4QB9 A;  2OH1 A;  2P6G A;  1FY7 A;  2JEW A;  3DLJ A;  4XPK A;  1PCA A;  2EO8 A;  1YLE A;  3TT2 A;  5HXD A;  3LD2 A;  2B4D B;  2G9D A;  3KQZ A;  3PFE A;  4UFV A;  4JLY A;  4Y49 B;  1U6M A;  1UFH A;  1ZG9 A;  3G8W A;  5JPH A;  2F7V A;  1VKC A;  1XE4 A;  2VQY A;  4LQG A;  4AG9 A;  3FIX A;  1ELL P;  1CPS A;  4JWP A;  4XPL A;  4CAW A;  1P0H A;  2RB7 A;  1R43 A;  4NGT A;  4C2Z A;  1QMU A;  4IHM A;  3PB4 X;  4CGP A;  1F57 A;  3WC5 A;  4II9 A;  2FXF A;  3DR6 A;  2Q4Z A;  2IQ6 A;  2Z3O A;  1RO5 A;  3D7G A;  5G1Z A;  3GB0 A;  2Q0Y A;  2ZOF A;  4LUA A;  4A2Z A;  3N5F A;  4KVM E;  2PDO A;  3P2F A;  2Z10 A;  1N71 A;  3FMC A;  2PVW A;  3T9Y A;  4CGN A;  3BLN A;  1VHO A;  3H5Z A;  2PJ5 A;  5C82 A;  1PYT B;  1LAN A;  1XOV A;  2AFO A;  3N7Z A;  3W6X A;  5LYI A;  3B35 A;  3T8W A;  4FD4 A;  4NGS A;  4QVT A;  5IV0 A;  2CNS A;  3S6K A;  4JXR A;  3DNS A;  4KSF A;  2EK9 A;  2QVP A;  2RFH A;  4L89 A;  2F8H A;  2REF A;  1IYL A;  4R3K A;  2HC9 A;  1ARM A;  1JWQ A;  1S7F A;  1XIX A;  2GU2 A;  4UEE A;  5DS0 A;  3S9M A;  3FXT A;  2C6P A;  3TCV A;  1MJA A;  4C2Y A;  3CXP A;  4F9V A;  4P6Y A;  4P44 A;  5CPA A;  1HDQ A;  4MCR A;  1CP7 A;  4TNU A;  2XEJ A;  3V8I A;  1XBU A;  3HLP A;  2BEI A;  2B58 A;  3PB7 X;  4MI4 A;  1A2Z A;  4MRI A;  4P10 A;  3RYO A;  4RS2 A;  1CM0 A;  1Y0Y A;  1S7K A;  3I1U A;  3CZX A;  2P6F A;  4KOU A;  5F49 A;  4F6A A;  4WWV A;  1CPX A;  4AVB A;  2OR4 A;  4RI1 A;  5HH1 A;  1H8L A;  3IWE A;  4IAV A;  4ZY1 A;  4CAX A;  4WJB A;  2OB0 A;  2B4B A;  2O53 A;  2AFW A;  3BI1 A;  4EFD A;  2DEA A;  2PVV A;  2K5T A;  3B3C A;  2JBJ A;  2PE3 A;  3H8G A;  2FT0 A;  3TX8 A;  1VGY A;  2X7B A;  1YVO A;  4LX9 A;  3R9G A;  4KOT A;  4ZX8 A;  2KCW A;  4MFP A;  4MFL A;  5A27 A;  4NGP A;  1F2O A;  4PSW A;  3FJU A;  3LAC A;  2H5M A;  3B3W A;  3FEE A;  4Q38 A;  4CYN A;  3TTH A;  2C1C A;  3PRT A;  4C2X A;  4CAF A;  4X8I A;  1ELM P;  2D4P A;  3CDX A;  4ONW A;  4OC3 A;  3PGP A;  1M4D A;  2D4O A;  2GAN A;  4U5Y A;  1Q2D A;  3GYA A;  2O28 A;  4KLV A;  3BJ7 A;  4MFK A;  4R9M A;  4HNX B;  4YWY A;  5HMN A;  4MCS A;  4NGN A;  2I00 A;  5THW A;  4F8Z A;  5EMI A;  1YGH A;  2ZW7 A;  4KOS A;  2OZH A;  1LFW A;  4LQ6 A;  4KUA A;  3T90 A;  3BHX A;  3FVL A;  4DJL A;  4IUS A;  3NE8 A; 
#chains in the Genus database with same CATH homology
 1P4N A;  2HV2 A;  4UCP A;  4ZGY B;  5IX3 A;  4CRZ B;  1Y9K A;  2WPW A;  4MBU A;  1QSN A;  3W6S A;  1ON0 A;  1B6B A;  2ZW4 A;  2C27 A;  2Z11 A;  4KVO E;  4KUB A;  4UCM A;  4BBH A;  4JXQ A;  2VEZ A;  4OAD A;  3R9E A;  2FL4 A;  1B87 A;  5G21 A;  4CYQ A;  2QML A;  1QSR A;  3A9L A;  5F46 A;  3CXS A;  2ATR A;  4J3G A;  3K9U A;  2VI7 A;  2YNC C;  5G20 A;  2B5G A;  1XF8 A;  2G3T A;  1IB1 E;  4CS0 B;  2Y0M A;  3R1K A;  4A33 A;  2G0B A;  3R9F A;  1NMT A;  2PC1 A;  3TOA A;  5ISV A;  1PU9 A;  4YRH A;  4KZT A;  4YGO A;  4MY3 A;  4C7I A;  4UFW A;  2Q4V A;  2Z3L A;  5FVJ A;  3B8G A;  1RXT A;  5AGE A;  2Q44 A;  3QB8 A;  2FE7 A;  4JD6 A;  1SQH A;  2VXK A;  3BJ8 A;  3S6H A;  2JEV A;  2OZG A;  3TE4 A;  4CYO A;  3D2P A;  1M4I A;  2NMT A;  1Z9U A;  2PR8 A;  2PR1 A;  5AG6 A;  3FB3 A;  4U9Z A;  4PK3 A;  4XNH B;  4EVY A;  1J4J A;  2Z0Z A;  2VZZ A;  4KOY A;  4H89 A;  1YRE A;  4MFZ A;  3TFY A;  5F48 A;  3SHP A;  4QC6 A;  4A31 A;  5J8F A;  3FYN A;  2G3A A;  4AVA A;  1OZP A;  1M1D A;  4B11 A;  4A32 A;  2JDD A;  4UA3 A;  3F8K A;  1YK3 A;  2WSA A;  4OAE A;  4ONU A;  5KTC A;  3PZJ A;  4FD5 A;  4F0Y A;  1TIQ A;  5H84 A;  1YX0 A;  4U9Y A;  3ZZI A;  1LRZ A;  4FD6 A;  1MJ9 A;  1S7L A;  4KVX A;  5E96 A;  2PSW A;  1Y9W A;  2R1I A;  4DNC A;  2EVN A;  1BO4 A;  4BMH A;  3SXO A;  3TO6 A;  5C88 A;  1Z4R A;  4E8O A;  3FBU A;  2B4D A;  2OU2 A;  4AB7 A;  3LOD A;  1Q2Y A;  4XPD B;  3VWD A;  5KTA A;  1S5K A;  4UCN A;  1YR0 A;  4Q36 A;  2PQ8 A;  4KOX A;  2GE3 A;  1R57 A;  1WK4 A;  3SXN A;  4KOR A;  3OWC A;  2Q04 A;  5GCN A;  2B5G B;  3D3S A;  4CAE A;  2FS5 A;  3S6G A;  1KUY A;  2BSW A;  4PV6 A;  4X5K A;  3EO4 A;  4H6Z A;  3IU1 A;  2YGW A;  2FIA A;  3CXQ A;  4C7H A;  5BWA B;  3EC4 A;  2ZXV A;  4HNW B;  1NE9 A;  2A4N A;  4XNH C;  2FCK A;  5DWM A;  4KLW A;  4M85 A;  2R8V A;  1QST A;  2J8M A;  3R95 A;  1XMT A;  1YVK A;  2IL4 A;  2JLM A;  3FNC A;  5JQ4 A;  1QSM A;  1MJB A;  1K4J A;  1I21 A;  2P6E A;  4CGL A;  2Z3M A;  4ZBG A;  2YND A;  3F0A A;  4KS9 A;  2B3V A;  3KKW A;  2ARH A;  4KOV A;  2J8R A;  1XEB A;  2EUI A;  2FSR A;  1PUA A;  3TOB A;  1CJW A;  1KUX A;  2GIV A;  3NE7 A;  3D2M A;  5A28 A;  1Q2C A;  4OLL A;  2DPS A;  2Q4Y A;  4B5P B;  1VHS A;  3EFA A;  4MFQ A;  3E0K A;  3H4Q A;  4HNY B;  3DSB A;  1QSO A;  1I12 A;  1Z4E A;  4CGM A;  1MK4 A;  4MY0 A;  1IIC A;  2YNC A;  2AJ6 A;  1M44 A;  4L8A A;  4M3S A;  2CNM A;  4MFJ A;  2YNE A;  5I0C A;  5IB0 A;  1IYK A;  2BUE A;  4QUS A;  4C68 A;  2R7H A;  2R98 A;  1I1D A;  3W91 A;  2Z3P A;  1L0C A;  2F5I A;  5AG4 A;  3S6F A;  1GHE A;  4NSQ A;  4A30 A;  3FRM A;  4NXY A;  4CRY B;  4ORF A;  3R96 A;  4R3L A;  4UBR A;  2HUZ A;  5F47 A;  2P0W A;  4Y49 C;  3UY5 A;  4B5P A;  2Z3K A;  3F5B A;  4MJ8 A;  2WPX A;  1S3Z A;  2VBQ A;  1S7N A;  3VWE A;  4B12 A;  4H6U A;  2Q7B A;  4B13 A;  1ZO0 A;  4JJX A;  1V0C A;  2I79 A;  4KOW A;  4UFX A;  1IID A;  4XPD C;  5AG7 A;  5DWN A;  1BOB A;  3EY5 A;  2REE A;  4R57 A;  4FD7 A;  4E2A A;  4GS4 A;  2Z3N A;  4A95 A;  2RC4 A;  3P2H A;  2JDC A;  3IWG A;  3C26 A;  2ZW5 A;  5EC4 A;  2AE6 A;  5H86 A;  1S60 A;  1NSL A;  3PP9 A;  4B10 A;  4UWJ A;  4B5O A;  4PSX A;  3G3S A;  4CAV A;  5CNP A;  3IU2 A;  4HKF A;  1WWZ A;  2QIR A;  5AG5 A;  3I3G A;  1Y7R A;  3GY9 A;  3JVN A;  2CNT A;  3WR7 A;  3ZJ0 A;  3DDD A;  2ZPA A;  4F0X A;  5KTD A;  4AVC A;  2CY2 A;  2QEC A;  2FIW A;  3JTK A;  3QAH A;  4K30 A;  2BL1 A;  2OZU A;  3D8P A;  2DXQ A;  4E0A A;  2B3U A;  4NEX A;  4IF5 A;  4QBJ A;  4AG7 A;  3JUW A;  4I49 A;  2CXA A;  4R87 A;  3TO7 A;  4B14 A;  5J8C A;  4UWI A;  2DPT A;  5G22 A;  4MHD A;  2VZY A;  1KZF A;  5EBV A;  4NF1 A;  4KSA A;  1KUV A;  3GKR A;  3IGR A;  2ZW6 A;  4NCZ A;  3TO9 A;  2HQY A;  1M4G A;  3MGD A;  2J8N A;  4YFJ A;  4PK2 A;  2WUU A;  3EXN A;  3I9S A;  3DR8 A;  4CGO A;  2PRB A;  4QB9 A;  2OH1 A;  2P6G A;  1FY7 A;  4XPK A;  1YLE A;  3TT2 A;  3LD2 A;  2B4D B;  4UFV A;  4JLY A;  4Y49 B;  1U6M A;  1UFH A;  3G8W A;  5JPH A;  1VKC A;  1XE4 A;  2VQY A;  4AG9 A;  3FIX A;  4JWP A;  4XPL A;  4CAW A;  1P0H A;  4C2Z A;  4CGP A;  4II9 A;  2FXF A;  3DR6 A;  2Z3O A;  5G1Z A;  1RO5 A;  2Q0Y A;  4LUA A;  4A2Z A;  4KVM E;  2PDO A;  3P2F A;  2Z10 A;  1N71 A;  3T9Y A;  4CGN A;  3BLN A;  3H5Z A;  5C82 A;  3N7Z A;  3W6X A;  4FD4 A;  4QVT A;  5IV0 A;  2CNS A;  3S6K A;  4JXR A;  3DNS A;  4KSF A;  4L89 A;  2REF A;  1IYL A;  4R3K A;  1S7F A;  1XIX A;  3FXT A;  3TCV A;  1MJA A;  4C2Y A;  3CXP A;  3V8I A;  3RYO A;  2BEI A;  2B58 A;  4MI4 A;  4CYP A;  4RS2 A;  1CM0 A;  5F49 A;  1S7K A;  4KOU A;  4F6A A;  2P6F A;  4AVB A;  4RI1 A;  5HH1 A;  3IWE A;  4CAX A;  2OB0 A;  2B4B A;  2K5T A;  2FT0 A;  2X7B A;  1YVO A;  4LX9 A;  3R9G A;  4KOT A;  2KCW A;  4MFP A;  4MFL A;  5A27 A;  4PSW A;  2H5M A;  4Q38 A;  4CYN A;  3TTH A;  4C2X A;  4CAF A;  2D4P A;  3PGP A;  1M4D A;  2D4O A;  2GAN A;  4U5Y A;  1Q2D A;  3GYA A;  2O28 A;  4KLV A;  3BJ7 A;  4MFK A;  4R9M A;  4HNX B;  5HMN A;  2I00 A;  1YGH A;  2ZW7 A;  4KOS A;  2OZH A;  4KUA A;  3T90 A;  4IUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...