3E0KA

Crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
146
Chain Sequence
AEQVRQAGIDDIGGILELIHPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFRKSKILALDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
molecule keywords Amino-acid acetyltransferase
total genus 33
structure length 146
sequence length 148
ec nomenclature ec 2.3.1.1: Amino-acid N-acetyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3e0kA00
1K4JA 4M3SA 5J8CA 3W91A 4H6UA 4MJ8A 4KVME 4KVXA 3FRMA 2B5GB 3D2MA 3IWGA 1BO4A 2Y0MA 2C27A 5FVJA 4HKFA 1YX0A 4IUSA 3BJ8A 3DR8A 4HNXB 4R3KA 2GE3A 3C26A 1M4DA 1L0CA 2Z0ZA 2ZW5A 4JXQA 4CS0B 3ZJ0A 2OH1A 1YVOA 2VZYA 4QBJA 3TTHA 3BJ7A 2FIWA 2K5TA 3EXNA 2OZGA 5HH1A 4UA3A 1M44A 4MI4A 3P2FA 3T9YA 3JUWA 4AB7A 4PV6A 4KZTA 3ZZIA 1XF8A 2B58A 5KTDA 3TFYA 4U5YA 3CXQA 3VWDA 2IL4A 1KUXA 1Q2CA 1M4GA 3JVNA 4AVBA 2VI7A 2Q4YA 2FL4A 2J8MA 2ZXVA 4JJXA 3P2HA 5EBVA 3FIXA 3LD2A 4R87A 3R9EA 1ON0A 1M4IA 2D4OA 4H89A 2CNTA 2OZUA 1S3ZA 4FD4A 4B5OA 4UWIA 1P0HA 3K9UA 1XE4A 3BLNA 4AG9A 1VKCA 2I79A 3EFAA 4PSXA 1NSLA 1PU9A 2R98A 2Q0YA 2B4DA 4L89A 4XNHB 2BL1A 4KOSA 3FNCA 1RXTA 4MY3A 1OZPA 1Z4EA 3H4QA 3QAHA 2REEA 2PSWA 3TE4A 1XEBA 3W6SA 4KOTA 2J8RA 5GCNA 3EY5A 4X5KA 3G3SA 3T90A 1Q2YA 4QUSA 4JWPA 4HNWB 2Q44A 1YGHA 4KOUA 1S60A 3I9SA 4OLLA 3S6FA 3G8WA 1I1DA 1Y7RA 4KVOE 3R96A 2R8VA 3IGRA 1IB1E 2X7BA 2FT0A 1LRZA 4NF1A 4CRZB 1IYLA 2FXFA 3D3SA 1YVKA 2KCWA 4I49A 1S5KA 2QMLA 4YGOA 1QSOA 2AE6A 2JLMA 4PK3A 1KZFA 2CNMA 2D4PA 2VQYA 3TO9A 1I12A 2VXKA 4RS2A 1MK4A 2HQYA 4GS4A 4KOXA 2Z10A 4KUBA 4JLYA 2NMTA 2P0WA 1S7NA 4F6AA 5KTCA 2AJ6A 1MJAA 1N71A 1M1DA 4E2AA 1Q2DA 4II9A 5IV0A 1QSNA 4MY0A 4UBRA 1CM0A 3D8PA 2RC4A 2B3VA 3SXOA 2HV2A 2OZHA 4R9MA 3WR7A 4XNHC 2ZPAA 2ZW6A 2FSRA 1YR0A 2A4NA 5E96A 4XPDB 3RYOA 2PC1A 3R95A 4Y49B 4AG7A 4R3LA 2P6GA 4ONUA 4JD6A 3FB3A 3DNSA 2ZW7A 4R57A 2JDCA 2P6EA 1QSRA 2WPXA 5F49A 2WPWA 2FS5A 4JXRA 3TO7A 3EC4A 5F48A 2H5MA 3LODA 1XMTA 4FD7A 4OAEA 4KLVA 4RI1A 2J8NA 3F5BA 4E8OA 3VWEA 1FY7A 2PRBA 1MJBA 4ORFA 4NXYA 1TIQA 2BSWA 3I3GA 1SQHA 2ATRA 3OWCA 4H6ZA 1S7KA 2Q4VA 3NE7A 4L8AA 4CAXA 2VBQA 2EVNA 1YK3A 4KUAA 2GIVA 3TOBA 1WWZA 2PQ8A 5C82A 4KOWA 1KUYA 4EVYA 2R1IA 1R57A 5DWMA 4HNYB 4CAWA 1YREA 1B6BA 4YRHA 3TCVA 3R1KA 3S6GA 3F0AA 3TOAA 2OU2A 1Z4RA 2PR1A 1J4JA 2O28A 1PUAA 2ZW4A 5J8FA 1P4NA 3W6XA 5F47A 4CRYB 3PGPA 2BUEA 3CXPA 2JEVA 3N7ZA 1CJWA 2GANA 3KKWA 3B8GA 2G3AA 4U9ZA 4QB9A 1MJ9A 2Q04A 1IYKA 1IICA 3SHPA 2FIAA 2I00A 2VEZA 3S6HA 4LUAA 1NE9A 4MBUA 1GHEA 2B4DB 5F46A 4BMHA 3D2PA 3F8KA 4YFJA 3GY9A 4QC6A 1Y9WA 1Y9KA 3DSBA 5KTAA 1UFHA 3PZJA 1NMTA 1V0CA 3V8IA 5H84A 4XPDC 4LX9A 3TT2A 2FE7A 2G0BA 4KOVA 1BOBA 2HUZA 5HMNA 4XPKA 4CAVA 1Z9UA 4IF5A 4K30A 5ISVA 2EUIA 1B87A 4FD5A 2FCKA 2B5GA 4FD6A 3UY5A 2QECA 3QB8A 3SXNA 2Z11A 4OADA 5JQ4A 2CNSA 5EC4A 1S7LA 4ZBGA 1XIXA 3R9FA 3FBUA 3GYAA 1S7FA 2VZZA 2P6FA 2PR8A 3S6KA 1U6MA 2OB0A 1I21A 1RO5A 2F5IA 2QIRA 5H86A 4MHDA 4B5PA 2BEIA 2R7HA 2B3UA 4NEXA 4PK2A 3TO6A 4AVCA 1KUVA 4B5PB 1IIDA 1VHSA 3MGDA 4AVAA 4XPLA 4E0AA 3E0KA 4NSQA 1WK4A 3GKRA 2B4BA 4Y49C 4DNCA 2ARHA 4PSWA 5IB0A 5I0CA 2PDOA 2Q7BA 3PP9A 5JPHA 5IX3A 3DR6A 4M85A 1QSTA 2G3TA 2REFA 4UWJA 3R9GA 2JDDA 4NCZA 3CXSA 3FXTA 3DDDA 2CY2A 4F0YA 5CNPA 5C88A 1QSMA 2DXQA 4KOYA 4KLWA 5DWNA 3EO4A 4U9YA 4QVTA 3FYNA 4KORA 4J3GA 1YLEA
chains in the Genus database with same CATH superfamily
1K4JA 4M3SA 5J8CA 5J8FA 1JQGA 4UFVA 3W91A 4H6UA 4MJ8A 3KQXA 4KVME 1YW6A 4KVXA 4UCNA 3FRMA 2B5GB 3D2MA 4X3RA 4DJLA 3IWGA 3LACA 4UCPA 4CGLA 1BO4A 2Y0MA 4NJRA 3KGQA 2GFQA 4UEFA 2ANPA 1HEEA 2C27A 5FVJA 4UEZA 3SI1A 4A39A 2NSMA 4MHNA 4HKFA 2Z3MA 1VGYA 1YX0A 4IUSA 3BJ8A 4UFWA 3S9NA 3DR8A 4MFPA 4HNXB 4MFZA 4Q7AA 1ZG9A 4R3KA 2I3CA 2GE3A 2J9AA 3C26A 3GLJA 1M4DA 1L0CA 1YMEA 2Z0ZA 2ZW5A 5K8OA 4ZGYB 4JXQA 1M4LA 4CS0B 3ZJ0A 2OH1A 3K2KA 1LANA 3I1UA 3PFEA 1QQ9A 1YVOA 2VZYA 3JTKA 4P4IA 5AG5A 4C68A 4QBJA 3TTHA 1R43A 3BJ7A 4PXCA 4BD9A 3SJFA 3H5ZA 3SI2A 5CBMA 2JBJA 2FIWA 4MCSA 2K5TA 3EXNA 2OZGA 2YNEA 3JRUA 5HH1A 4A32A 4UA3A 3IU2A 2EK9A 4OC1A 1M44A 4WJBA 2PJ6A 3P2FA 4MI4A 5LRGA 4Z65A 3T9YA 3JUWA 1VHEA 4PXEA 2AFWA 3DLJA 2WZNA 2Z3OA 3SI0A 1XJOA 4AB7A 4CAEA 4PV6A 1YSJA 3FH4A 1YQEA 2NYQA 2YNDA 4KZTA 4MFJA 4A2ZA 3ZZIA 5K8MA 2ZENA 4KSAA 3VARA 3RO0A 3BI0A 4CYOA 1XF8A 1IY7A 2CXAA 2O53A 4LQGA 2PJ8A 4P6YA 1TKJA 5AG7A 3L2NA 1XMBA 2B58A 4R7MA 4CPAA 5KTDA 3TFYA 3D4UA 4MFQA 4NGNA 4YU9A 1VHOA 3CXQA 4U5YA 5K8PA 3VWDA 2IL4A 1KUXA 1Q2CA 1LAMA 2GLFA 1Y7EA 4CYQA 1LAPA 4P10A 1F2PA 1M4GA 2HB6A 3NH8A 3JVNA 2V8HA 3PB4X 4AVBA 5I4MA 1CP7A 2VI7A 1ARMA 3CPAA 5AG4A 2Q4YA 2FL4A 3WABA 2J8MA 4CGOA 4MFLA 2ZEEA 1CPSA 4ONWA 4TWEA 2ZEDA 2ZXVA 4H2KA 4JJXA 3WT4A 4MFKA 3P2HA 3IFEA 5EBVA 3FIXA 3LD2A 4R87A 4EMEA 3R9EA 1ON0A 1UWYA 1M4IA 2IQ6A 2D4OA 1F2OA 4H89A 4F8ZA 1IOFA 3B35A 3T8WA 4X2TA 2CNTA 2OZUA 1S3ZA 4FD4A 3B2YA 4B5OA 4EFDA 4UWIA 3NE8A 1A2ZA 1P0HA 3H8FA 3K9UA 1XE4A 3BLNA 2BOAA 4PPZA 5G21A 1VKCA 3SJXA 4AG9A 2I79A 1TKFA 3EFAA 4MHYA 4NGPA 2AFXA 4PSXA 3FEEA 4PQAA 2XEGA 1NSLA 1YW4A 1PU9A 2R98A 1LCPA 2HC9A 3CPXA 2Q0YA 2B4DA 4L89A 3PBBA 4XNHB 2BL1A 4KOSA 3FNCA 2PIYA 1RXTA 5HVGA 4MY3A 1OZPA 1Z4EA 2Z3LA 1JWQA 3H4QA 3K9TA 4OIDA 3QAHA 2REEA 3A9LA 3NH4A 2PSWA 3TE4A 1XEBA 3W6SA 4KOTA 2J8RA 2XEIA 4UCMA 2AFOA 5GCNA 4C7HA 3EY5A 1ELMP 1IGBA 4X5KA 3G3SA 2ZEOA 3T90A 3D7FA 4A94A 1Q2YA 4IAVA 4QUSA 4TNUA 3LMSA 4OC3A 4JWPA 4HNWB 2Q44A 1YGHA 4KOUA 2O4HA 4B10A 1FNOA 1DE4C 5A28A 4OKOA 1BAVA 3PFOA 2Z3NA 1S60A 3I9SA 2PJBA 3TX8A 4OLLA 4ZX8A 3G8WA 3S6FA 2AFSA 3FECA 1I1DA 3S9LA 1Y7RA 4CGMA 4KVOE 4GXHA 2V8GA 5LRKA 3R96A 4CAFA 2R8VA 3IGRA 2WSAA 2JEWA 1IB1E 2X7BA 5J1QA 4MCQA 3TC8A 3HUVA 3FX6A 2FT0A 4MCPA 1LRZA 4NF1A 4CRZB 1OBRA 1IYLA 2FXFA 4MCRA 3D3SA 2PRQA 1YVKA 3KL9A 2KCWA 5JM6A 3KZWA 2C1CA 4I49A 3SJEA 1S5KA 2QMLA 4YGOA 4ZY2A 4C2ZA 1QSOA 3ISZA 2AE6A 1HDUA 3IO1A 2JLMA 3KQZA 4PK3A 5HXDA 4DUKA 1X10A 4UIAA 4IK2A 1KZFA 2CNMA 2D4PA 2C6CA 2QVPA 3B3SA 2AFMA 2VQYA 3KHXA 1Y0YA 4X8IA 3TO9A 3BXMA 1I12A 2VXKA 4RS2A 1MK4A 4P4FA 4UFXA 1CBXA 2HQYA 3MN8A 5EMIA 4GS4A 4KOXA 2DPSA 2Z10A 4KUBA 3FJUA 5G20A 4JLYA 2NMTA 5G22A 3FF3A 2AFZA 2P0WA 1S7NA 3GIUA 4F6AA 5KTCA 2AJ6A 3IIBA 2IMOA 1MJAA 1N71A 1M1DA 4E2AA 1Q2DA 2YNCC 3CT9A 4RUHA 4II9A 3KHZA 5ELYA 5IV0A 3PB6X 1QSNA 4MY0A 4UBRA 1CM0A 3RBUA 3D8PA 4JZ0A 2RC4A 2B3VA 2Q51A 2C6PA 3SXOA 2GLJA 3RZAA 2Q7SA 1XFOA 5LYDA 2HV2A 2OZHA 2PVWA 1CP6A 3FEDA 4R9MA 5DS0A 1F57A 2ZEHA 4PXBA 1TXRA 3WR7A 4XNHC 2ZPAA 4ZY0A 2ZW6A 1H8LA 1Z8TA 4IHMA 2FSRA 4B14A 1ZG7A 1QMUA 4OC5A 4B6ZA 1YR0A 2A4NA 5E96A 4XPDB 3V38A 3RYOA 1PYTB 2PC1A 3R95A 3QAYA 4Y49B 4AG7A 4R3LA 2P6GA 2POKA 2XEJA 1KWMA 3FVLA 4ONUA 4JD6A 3FB3A 3DNSA 4DYOA 2ZW7A 4NFRA 2JDCA 3KR5A 4R57A 2P6EA 1QSRA 4CGNA 1CG2A 4R8FA 2C6GA 2WPXA 5F49A 2WPWA 2CIJA 2FS5A 1BLLE 1R3NA 4JXRA 2PE3A 3ISXA 3D7DA 3TO7A 3EC4A 5F48A 4UEEA 2H5MA 3LODA 4C2XA 5JH9A 1XMTA 3H8EA 4M6GA 4FD7A 4G1PA 4UF4A 4OAEA 4KLVA 4F9UA 4RI1A 2J8NA 3PEIA 3F5BA 1AMPA 5G1ZA 3VH9A 4B11A 4E8OA 1AUGA 1ZLIA 3VWEA 4BBHA 1FY7A 4MHPA 2PRBA 1MJBA 2PIZA 3GUXA 4ORFA 4NXYA 4OC0A 2OOTA 1TIQA 2BSWA 2PJ7A 2XEFA 3D7HA 4EWTA 3I3GA 1SQHA 4MMOA 4C7IA 2ATRA 3OWCA 4H6ZA 3RAMA 4ZYQA 1IOIA 3GB0A 2EO8A 1S7KA 2Q4VA 3NE7A 4CYNA 4ZI6A 4L8AA 3IU1A 5HVFA 3BI1A 3D68A 4CAXA 1NSAA 2VBQA 2EVNA 1YK3A 4P45A 5LYFA 4KUAA 2GIVA 3TOBA 5IB9A 3NH5A 1WWZA 2PQ8A 5C82A 3SJGA 2ZEMA 4KOWA 1Z8LA 1KUYA 2QJ8A 3QNVA 4EVYA 2R1IA 1GYTA 1R57A 5DWMA 4HNYB 4CAWA 5K8NA 2ODFA 2CTCA 2F8HA 1YREA 2DEAA 1B6BA 4CGPA 2PJ2A 4YRHA 3N5FA 1Z8XA 3TCVA 4KS9A 3R1KA 3S6GA 4B12A 3PB7X 3F0AA 3TOAA 2OU2A 3NA6A 3WC5A 1LOKA 1Z4RA 2PR1A 1J4JA 2O28A 5AGEA 1PUAA 2ZW4A 3BHXA 5LYIA 1P4NA 3VATA 5F47A 5LRJA 3W6XA 4CRYB 3PGPA 4Q36A 2BUEA 3CXPA 4A30A 2JEVA 4K3NA 3N7ZA 4GM5A 2PJ5A 3CDXA 1CJWA 3PB9X 2RFHA 2GANA 3KKWA 5BWAB 3B8GA 3B3VA 2G3AA 4U9ZA 4QB9A 4YWYA 2ZOFA 2PCUA 3CZXA 1MJ9A 2AFUA 2Q04A 4FWUA 1IYKA 1IICA 2V8DA 5THWA 1BPMA 2FIAA 2I00A 4P44A 4Q38A 3SHPA 2VEZA 4M6IA 4A31A 3S6HA 4F0XA 3PRTA 4LUAA 2WUUA 2JBKA 1Y0RA 3B3WA 3D67A 1NE9A 1ZO0A 4OC4A 4MBUA 1GHEA 4OIWA 2B4DB 2ZELA 5F46A 4BMHA 4B13A 4AXVA 3D2PA 2PJCA 3F8KA 3KR4A 3GY9A 4YFJA 4QC6A 1Y9WA 1Y9KA 3DSBA 4A33A 2EWBA 6CPAA 5KTAA 1HDQA 1UFHA 3WC6A 2PJ1A 3PZJA 4KSFA 1Q7LA 1NMTA 1V0CA 3B3TA 3V8IA 4P4EA 5H84A 4XPDC 4OP4A 4LX9A 3TT2A 2FE7A 2G0BA 2ZEFA 1BOBA 3HLPA 4KOVA 2Z3PA 2HUZA 3H8GA 3S9MA 1YLOA 2Q43A 4XPKA 1Z9UA 4MHZA 3V7ZA 2YNCA 4IF5A 4P4JA 4K30A 4A95A 4CAVA 2EUIA 5ISVA 1B87A 2BO9A 4FD5A 4CYPA 2FCKA 2B5GA 4FD6A 3UY5A 3PBEA 2QECA 3QB8A 4NGMA 3SXNA 2PJ3A 3WC7A 4BINA 1CX8A 2Z11A 1IU8A 1ZG8A 2ZOGA 4OADA 5JQ4A 2WYRA 1BPNA 4NJQA 2CNSA 5EC4A 4NGRA 1S7LA 5HVHA 4W9YA 3RNZA 4HPSA 4ZBGA 1XIXA 3R9FA 5CPAA 2CF4A 1EE3P 3KI9A 3FBUA 1XRYA 2OR4A 4LQ6A 4P4BA 2PJ9A 3NFZA 3GYAA 1DTDA 4UIBA 1S7FA 2VZZA 2P6FA 1TF9A 2PR8A 2QYVA 3S6KA 2FVGA 1U6MA 2ZEPA 2OB0A 1I21A 2GU2A 1RO5A 4MRIA 1ARLA 4M6HA 3D7GA 4FAIA 2Q4ZA 3FMCA 4FUUA 4NGTA 2DF5A 1TKHA 3D66A 3IEHA 2YGWA 2F5IA 4ZY1A 2QIRA 4NGQA 5H86A 4KORA 4MHDA 4R76A 4B5PA 2BEIA 3LWUA 5JGFA 2R7HA 2PJ4A 1ELLP 2B3UA 1Z2LA 4NEXA 4P4DA 4PK2A 5A27A 3TO6A 4AVCA 1CPXA 1KUVA 2DPTA 4B5PB 5AG6A 1IIDA 2VL1A 7CPAA 4FBEA 4A37A 1VHSA 3MGDA 4AVAA 2PVVA 5LYLA 4XPLA 2Z3KA 3DGVA 4E0AA 2IJZA 1XOVA 3E0KA 1WK4A 3GKRA 3IWWA 4NSQA 2B4BA 1Z8WA 3MRUA 4A38A 5F09A 4R6TA 4OMEA 4O23A 5HMNA 4Y49C 4RN7A 3B7IA 4DNCA 3B3CA 5D8NA 1ZLHA 1AYEA 2EBJA 2ARHA 3IWEA 4PSWA 4ZX9A 4NGSA 5IB0A 8CPAA 4KSIA 1LFWA 4OC2A 5I0CA 2PDOA 2Q7BA 3PP9A 5JPHA 4PXDA 2BCOA 5IX3A 2V8VA 4MXUA 1FT7A 3DR6A 4M85A 4WWVA 2V77A 1RTQA 2ABZA 2G3TA 2EK8A 1QSTA 2REFA 4JYWA 2GREA 4UWJA 5D29A 3R9GA 4C2YA 3IC1A 2JDDA 1PCAA 4NCZA 3CXSA 4F9VA 1Z5RA 3FXTA 3DDDA 2CY2A 1XBUA 4F0YA 3IJ3A 5CNPA 2PJAA 5C88A 1QSMA 2RB7A 3KASA 2F7VA 1TF8A 1X12A 2DXQA 4KOYA 4KLWA 1VIXA 2PJ0A 2G9DA 5DWNA 3PB8X 3EO4A 4U9YA 4QVTA 3FYNA 2CTBA 4J3GA 1YLEA 2ZEGA
chains in the Genus database with same CATH topology
1K4JA 4M3SA 5J8CA 4UFVA 3W91A 4H6UA 4MJ8A 4KVME 4KVXA 4UCNA 3FRMA 2B5GB 3D2MA 3IWGA 4UCPA 4CGLA 1BO4A 2Y0MA 2C27A 5FVJA 4HKFA 2Z3MA 1YX0A 4IUSA 3BJ8A 4UFWA 3DR8A 4MFPA 4HNXB 4MFZA 4R3KA 2GE3A 3C26A 1M4DA 1L0CA 2Z0ZA 2ZW5A 4ZGYB 4JXQA 4CS0B 3ZJ0A 2OH1A 5AG5A 1YVOA 2VZYA 3JTKA 4C68A 4QBJA 3TTHA 3BJ7A 3H5ZA 2FIWA 4A32A 2K5TA 3EXNA 2OZGA 2YNEA 5HH1A 4UA3A 3IU2A 1M44A 4MI4A 3P2FA 3T9YA 3JUWA 2Z3OA 4AB7A 4CAEA 4PV6A 4MFJA 2YNDA 4A2ZA 4KZTA 3ZZIA 4KSAA 4CYOA 1XF8A 2CXAA 5AG7A 2B58A 5KTDA 3TFYA 4MFQA 4U5YA 3CXQA 3VWDA 2IL4A 1KUXA 1Q2CA 4CYQA 1M4GA 3JVNA 4AVBA 2VI7A 5AG4A 2Q4YA 2FL4A 2J8MA 4CGOA 4MFLA 2ZXVA 4JJXA 4MFKA 3P2HA 5EBVA 3FIXA 3LD2A 4R87A 3R9EA 1ON0A 1M4IA 2D4OA 4H89A 2CNTA 2OZUA 1S3ZA 4FD4A 4B5OA 4UWIA 1P0HA 3K9UA 5G21A 1XE4A 3BLNA 4AG9A 1VKCA 2I79A 3EFAA 4PSXA 1NSLA 1PU9A 2R98A 2Q0YA 2B4DA 4L89A 4XNHB 2BL1A 4KOSA 3FNCA 1RXTA 4MY3A 1OZPA 1Z4EA 2Z3LA 3H4QA 3QAHA 2REEA 3A9LA 2PSWA 3TE4A 1XEBA 3W6SA 4KOTA 2J8RA 4UCMA 5GCNA 4C7HA 3EY5A 4X5KA 3G3SA 3T90A 1Q2YA 4QUSA 4JWPA 4HNWB 2Q44A 1YGHA 4KOUA 4B10A 5A28A 2Z3NA 1S60A 3I9SA 4OLLA 3S6FA 3G8WA 1I1DA 1Y7RA 4CGMA 4KVOE 3R96A 4CAFA 2R8VA 3IGRA 2WSAA 1IB1E 2X7BA 2FT0A 1LRZA 4NF1A 4CRZB 1IYLA 2FXFA 3D3SA 1YVKA 2KCWA 4I49A 1S5KA 2QMLA 4YGOA 4C2ZA 1QSOA 2AE6A 2JLMA 4PK3A 1KZFA 2CNMA 2D4PA 2VQYA 3TO9A 1I12A 2VXKA 4RS2A 1MK4A 4UFXA 2HQYA 4GS4A 4KOXA 2DPSA 2Z10A 4KUBA 5G20A 4JLYA 2NMTA 5G22A 2P0WA 1S7NA 4F6AA 5KTCA 2AJ6A 1MJAA 1N71A 1M1DA 4E2AA 1Q2DA 2YNCC 4II9A 5IV0A 1QSNA 4MY0A 4UBRA 1CM0A 3D8PA 2RC4A 2B3VA 3SXOA 2HV2A 2OZHA 4R9MA 3WR7A 4XNHC 2ZPAA 2ZW6A 2FSRA 4B14A 1YR0A 2A4NA 5E96A 4XPDB 3RYOA 2PC1A 3R95A 4Y49B 4AG7A 4R3LA 2P6GA 4ONUA 4JD6A 3FB3A 3DNSA 2ZW7A 4R57A 2JDCA 2P6EA 1QSRA 4CGNA 2WPXA 5F49A 2WPWA 2FS5A 4JXRA 3TO7A 3EC4A 5F48A 2H5MA 3LODA 4C2XA 1XMTA 4FD7A 4OAEA 4KLVA 4RI1A 2J8NA 3F5BA 5G1ZA 4B11A 4E8OA 3VWEA 4BBHA 1FY7A 2PRBA 1MJBA 4ORFA 4NXYA 1TIQA 2BSWA 3I3GA 1SQHA 4C7IA 2ATRA 3OWCA 4H6ZA 4CYNA 1S7KA 2Q4VA 3NE7A 4L8AA 3IU1A 4CAXA 2VBQA 2EVNA 1YK3A 4KUAA 2GIVA 3TOBA 1WWZA 2PQ8A 5C82A 4KOWA 1KUYA 4EVYA 2R1IA 1R57A 5DWMA 4HNYB 4CAWA 1YREA 1B6BA 4CGPA 4YRHA 3TCVA 4KS9A 3R1KA 3S6GA 4B12A 3F0AA 3TOAA 2OU2A 1Z4RA 2PR1A 1J4JA 2O28A 5AGEA 1PUAA 2ZW4A 5J8FA 1P4NA 3W6XA 5F47A 4CRYB 3PGPA 4Q36A 2BUEA 3CXPA 4A30A 2JEVA 3N7ZA 1CJWA 5BWAB 2GANA 3KKWA 3B8GA 2G3AA 4U9ZA 4QB9A 1MJ9A 2Q04A 1IYKA 1IICA 3SHPA 2FIAA 2I00A 4Q38A 4A31A 4F0XA 2VEZA 3S6HA 4LUAA 2WUUA 1NE9A 1ZO0A 4MBUA 1GHEA 2B4DB 5F46A 4BMHA 4B13A 3D2PA 3F8KA 4YFJA 3GY9A 4QC6A 1Y9WA 1Y9KA 3DSBA 4A33A 5KTAA 1UFHA 3PZJA 4KSFA 1NMTA 1V0CA 3V8IA 5H84A 4XPDC 4LX9A 3TT2A 2FE7A 2G0BA 4KOVA 1BOBA 2Z3PA 2HUZA 5HMNA 4XPKA 4CAVA 1Z9UA 2YNCA 4IF5A 4K30A 4A95A 5ISVA 2EUIA 1B87A 4FD5A 4CYPA 2FCKA 2B5GA 4FD6A 3UY5A 2QECA 3QB8A 3SXNA 2Z11A 4OADA 5JQ4A 2CNSA 5EC4A 1S7LA 4ZBGA 1XIXA 3R9FA 3FBUA 3GYAA 1S7FA 2VZZA 2P6FA 2PR8A 3S6KA 1U6MA 2OB0A 1I21A 1RO5A 2YGWA 2F5IA 2QIRA 5H86A 4MHDA 4B5PA 2BEIA 2R7HA 2B3UA 4NEXA 4PK2A 5A27A 3TO6A 4AVCA 1KUVA 2DPTA 4B5PB 5AG6A 1IIDA 1VHSA 3MGDA 4AVAA 4XPLA 2Z3KA 4E0AA 3E0KA 4NSQA 1WK4A 3GKRA 2B4BA 4Y49C 4DNCA 2ARHA 3IWEA 4PSWA 5IB0A 5I0CA 2PDOA 2Q7BA 3PP9A 5JPHA 5IX3A 3DR6A 4M85A 1QSTA 2G3TA 2REFA 4C2YA 4UWJA 3R9GA 2JDDA 4NCZA 3CXSA 3FXTA 3DDDA 2CY2A 4F0YA 5CNPA 5C88A 1QSMA 2DXQA 4KOYA 4KLWA 5DWNA 3EO4A 4U9YA 4QVTA 3FYNA 4KORA 4J3GA 1YLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  4M3S A;  5J8C A;  3W91 A;  4H6U A;  4MJ8 A;  4KVM E;  4KVX A;  3FRM A;  2B5G B;  3D2M A;  3IWG A;  1BO4 A;  2Y0M A;  2C27 A;  5FVJ A;  4HKF A;  1YX0 A;  4IUS A;  3BJ8 A;  3DR8 A;  4HNX B;  4R3K A;  2GE3 A;  3C26 A;  1M4D A;  1L0C A;  2Z0Z A;  2ZW5 A;  4JXQ A;  4CS0 B;  3ZJ0 A;  2OH1 A;  1YVO A;  2VZY A;  4QBJ A;  3TTH A;  3BJ7 A;  2FIW A;  2K5T A;  3EXN A;  2OZG A;  5HH1 A;  4UA3 A;  1M44 A;  4MI4 A;  3P2F A;  3T9Y A;  3JUW A;  4AB7 A;  4PV6 A;  4KZT A;  3ZZI A;  1XF8 A;  2B58 A;  5KTD A;  3TFY A;  4U5Y A;  3CXQ A;  3VWD A;  2IL4 A;  1KUX A;  1Q2C A;  1M4G A;  3JVN A;  4AVB A;  2VI7 A;  2Q4Y A;  2FL4 A;  2J8M A;  2ZXV A;  4JJX A;  3P2H A;  5EBV A;  3FIX A;  3LD2 A;  4R87 A;  3R9E A;  1ON0 A;  1M4I A;  2D4O A;  4H89 A;  2CNT A;  2OZU A;  1S3Z A;  4FD4 A;  4B5O A;  4UWI A;  1P0H A;  3K9U A;  1XE4 A;  3BLN A;  4AG9 A;  1VKC A;  2I79 A;  3EFA A;  4PSX A;  1NSL A;  1PU9 A;  2R98 A;  2Q0Y A;  2B4D A;  4L89 A;  4XNH B;  2BL1 A;  4KOS A;  3FNC A;  1RXT A;  4MY3 A;  1OZP A;  1Z4E A;  3H4Q A;  3QAH A;  2REE A;  2PSW A;  3TE4 A;  1XEB A;  3W6S A;  4KOT A;  2J8R A;  5GCN A;  3EY5 A;  4X5K A;  3G3S A;  3T90 A;  1Q2Y A;  4QUS A;  4JWP A;  4HNW B;  2Q44 A;  1YGH A;  4KOU A;  1S60 A;  3I9S A;  4OLL A;  3S6F A;  3G8W A;  1I1D A;  1Y7R A;  4KVO E;  3R96 A;  2R8V A;  3IGR A;  1IB1 E;  2X7B A;  2FT0 A;  1LRZ A;  4NF1 A;  4CRZ B;  1IYL A;  2FXF A;  3D3S A;  1YVK A;  2KCW A;  4I49 A;  1S5K A;  2QML A;  4YGO A;  1QSO A;  2AE6 A;  2JLM A;  4PK3 A;  1KZF A;  2CNM A;  2D4P A;  2VQY A;  3TO9 A;  1I12 A;  2VXK A;  4RS2 A;  1MK4 A;  2HQY A;  4GS4 A;  4KOX A;  2Z10 A;  4KUB A;  4JLY A;  2NMT A;  2P0W A;  1S7N A;  4F6A A;  5KTC A;  2AJ6 A;  1MJA A;  1N71 A;  1M1D A;  4E2A A;  1Q2D A;  4II9 A;  5IV0 A;  1QSN A;  4MY0 A;  4UBR A;  1CM0 A;  3D8P A;  2RC4 A;  2B3V A;  3SXO A;  2HV2 A;  2OZH A;  4R9M A;  3WR7 A;  4XNH C;  2ZPA A;  2ZW6 A;  2FSR A;  1YR0 A;  2A4N A;  5E96 A;  4XPD B;  3RYO A;  2PC1 A;  3R95 A;  4Y49 B;  4AG7 A;  4R3L A;  2P6G A;  4ONU A;  4JD6 A;  3FB3 A;  3DNS A;  2ZW7 A;  4R57 A;  2JDC A;  2P6E A;  1QSR A;  2WPX A;  5F49 A;  2WPW A;  2FS5 A;  4JXR A;  3TO7 A;  3EC4 A;  5F48 A;  2H5M A;  3LOD A;  1XMT A;  4FD7 A;  4OAE A;  4KLV A;  4RI1 A;  2J8N A;  3F5B A;  4E8O A;  3VWE A;  1FY7 A;  2PRB A;  1MJB A;  4ORF A;  4NXY A;  1TIQ A;  2BSW A;  3I3G A;  1SQH A;  2ATR A;  3OWC A;  4H6Z A;  1S7K A;  2Q4V A;  3NE7 A;  4L8A A;  4CAX A;  2VBQ A;  2EVN A;  1YK3 A;  4KUA A;  2GIV A;  3TOB A;  1WWZ A;  2PQ8 A;  5C82 A;  4KOW A;  1KUY A;  4EVY A;  2R1I A;  1R57 A;  5DWM A;  4HNY B;  4CAW A;  1YRE A;  1B6B A;  4YRH A;  3TCV A;  3R1K A;  3S6G A;  3F0A A;  3TOA A;  2OU2 A;  1Z4R A;  2PR1 A;  1J4J A;  2O28 A;  1PUA A;  2ZW4 A;  5J8F A;  1P4N A;  3W6X A;  5F47 A;  4CRY B;  3PGP A;  2BUE A;  3CXP A;  2JEV A;  3N7Z A;  1CJW A;  2GAN A;  3KKW A;  3B8G A;  2G3A A;  4U9Z A;  4QB9 A;  1MJ9 A;  2Q04 A;  1IYK A;  1IIC A;  3SHP A;  2FIA A;  2I00 A;  2VEZ A;  3S6H A;  4LUA A;  1NE9 A;  4MBU A;  1GHE A;  2B4D B;  5F46 A;  4BMH A;  3D2P A;  3F8K A;  4YFJ A;  3GY9 A;  4QC6 A;  1Y9W A;  1Y9K A;  3DSB A;  5KTA A;  1UFH A;  3PZJ A;  1NMT A;  1V0C A;  3V8I A;  5H84 A;  4XPD C;  4LX9 A;  3TT2 A;  2FE7 A;  2G0B A;  4KOV A;  1BOB A;  2HUZ A;  5HMN A;  4XPK A;  4CAV A;  1Z9U A;  4IF5 A;  4K30 A;  5ISV A;  2EUI A;  1B87 A;  4FD5 A;  2FCK A;  2B5G A;  4FD6 A;  3UY5 A;  2QEC A;  3QB8 A;  3SXN A;  2Z11 A;  4OAD A;  5JQ4 A;  2CNS A;  5EC4 A;  1S7L A;  4ZBG A;  1XIX A;  3R9F A;  3FBU A;  3GYA A;  1S7F A;  2VZZ A;  2P6F A;  2PR8 A;  3S6K A;  1U6M A;  2OB0 A;  1I21 A;  1RO5 A;  2F5I A;  2QIR A;  5H86 A;  4MHD A;  4B5P A;  2BEI A;  2R7H A;  2B3U A;  4NEX A;  4PK2 A;  3TO6 A;  4AVC A;  1KUV A;  4B5P B;  1IID A;  1VHS A;  3MGD A;  4AVA A;  4XPL A;  4E0A A;  3E0K A;  4NSQ A;  1WK4 A;  3GKR A;  2B4B A;  4Y49 C;  4DNC A;  2ARH A;  4PSW A;  5IB0 A;  5I0C A;  2PDO A;  2Q7B A;  3PP9 A;  5JPH A;  5IX3 A;  3DR6 A;  4M85 A;  1QST A;  2G3T A;  2REF A;  4UWJ A;  3R9G A;  2JDD A;  4NCZ A;  3CXS A;  3FXT A;  3DDD A;  2CY2 A;  4F0Y A;  5CNP A;  5C88 A;  1QSM A;  2DXQ A;  4KOY A;  4KLW A;  5DWN A;  3EO4 A;  4U9Y A;  4QVT A;  3FYN A;  4KOR A;  4J3G A;  1YLE A; 
#chains in the Genus database with same CATH topology
 1K4J A;  4M3S A;  5J8C A;  5J8F A;  1JQG A;  4UFV A;  3W91 A;  4H6U A;  4MJ8 A;  3KQX A;  4KVM E;  1YW6 A;  4KVX A;  4UCN A;  3FRM A;  2B5G B;  3D2M A;  4X3R A;  4DJL A;  3IWG A;  3LAC A;  4UCP A;  4CGL A;  1BO4 A;  2Y0M A;  4NJR A;  3KGQ A;  2GFQ A;  4UEF A;  2ANP A;  1HEE A;  2C27 A;  5FVJ A;  4UEZ A;  3SI1 A;  4A39 A;  2NSM A;  4MHN A;  4HKF A;  2Z3M A;  1VGY A;  1YX0 A;  4IUS A;  3BJ8 A;  4UFW A;  3S9N A;  3DR8 A;  4MFP A;  4HNX B;  4MFZ A;  4Q7A A;  1ZG9 A;  4R3K A;  2I3C A;  2GE3 A;  2J9A A;  3C26 A;  3GLJ A;  1M4D A;  1L0C A;  1YME A;  2Z0Z A;  2ZW5 A;  5K8O A;  4ZGY B;  4JXQ A;  1M4L A;  4CS0 B;  3ZJ0 A;  2OH1 A;  3K2K A;  1LAN A;  3I1U A;  3PFE A;  1QQ9 A;  1YVO A;  2VZY A;  3JTK A;  4P4I A;  5AG5 A;  4C68 A;  4QBJ A;  3TTH A;  1R43 A;  3BJ7 A;  4PXC A;  4BD9 A;  3SJF A;  3H5Z A;  3SI2 A;  5CBM A;  2JBJ A;  2FIW A;  4MCS A;  2K5T A;  3EXN A;  2OZG A;  2YNE A;  3JRU A;  5HH1 A;  4A32 A;  4UA3 A;  3IU2 A;  2EK9 A;  4OC1 A;  1M44 A;  4WJB A;  2PJ6 A;  3P2F A;  4MI4 A;  5LRG A;  4Z65 A;  3T9Y A;  3JUW A;  1VHE A;  4PXE A;  2AFW A;  3DLJ A;  2WZN A;  2Z3O A;  3SI0 A;  1XJO A;  4AB7 A;  4CAE A;  4PV6 A;  1YSJ A;  3FH4 A;  1YQE A;  2NYQ A;  2YND A;  4KZT A;  4MFJ A;  4A2Z A;  3ZZI A;  5K8M A;  2ZEN A;  4KSA A;  3VAR A;  3RO0 A;  3BI0 A;  4CYO A;  1XF8 A;  1IY7 A;  2CXA A;  2O53 A;  4LQG A;  2PJ8 A;  4P6Y A;  1TKJ A;  5AG7 A;  3L2N A;  1XMB A;  2B58 A;  4R7M A;  4CPA A;  5KTD A;  3TFY A;  3D4U A;  4MFQ A;  4NGN A;  4YU9 A;  1VHO A;  3CXQ A;  4U5Y A;  5K8P A;  3VWD A;  2IL4 A;  1KUX A;  1Q2C A;  1LAM A;  2GLF A;  1Y7E A;  4CYQ A;  1LAP A;  4P10 A;  1F2P A;  1M4G A;  2HB6 A;  3NH8 A;  3JVN A;  2V8H A;  3PB4 X;  4AVB A;  5I4M A;  1CP7 A;  2VI7 A;  1ARM A;  3CPA A;  5AG4 A;  2Q4Y A;  2FL4 A;  3WAB A;  2J8M A;  4CGO A;  4MFL A;  2ZEE A;  1CPS A;  4ONW A;  4TWE A;  2ZED A;  2ZXV A;  4H2K A;  4JJX A;  3WT4 A;  4MFK A;  3P2H A;  3IFE A;  5EBV A;  3FIX A;  3LD2 A;  4R87 A;  4EME A;  3R9E A;  1ON0 A;  1UWY A;  1M4I A;  2IQ6 A;  2D4O A;  1F2O A;  4H89 A;  4F8Z A;  1IOF A;  3B35 A;  3T8W A;  4X2T A;  2CNT A;  2OZU A;  1S3Z A;  4FD4 A;  3B2Y A;  4B5O A;  4EFD A;  4UWI A;  3NE8 A;  1A2Z A;  1P0H A;  3H8F A;  3K9U A;  1XE4 A;  3BLN A;  2BOA A;  4PPZ A;  5G21 A;  1VKC A;  3SJX A;  4AG9 A;  2I79 A;  1TKF A;  3EFA A;  4MHY A;  4NGP A;  2AFX A;  4PSX A;  3FEE A;  4PQA A;  2XEG A;  1NSL A;  1YW4 A;  1PU9 A;  2R98 A;  1LCP A;  2HC9 A;  3CPX A;  2Q0Y A;  2B4D A;  4L89 A;  3PBB A;  4XNH B;  2BL1 A;  4KOS A;  3FNC A;  2PIY A;  1RXT A;  5HVG A;  4MY3 A;  1OZP A;  1Z4E A;  2Z3L A;  1JWQ A;  3H4Q A;  3K9T A;  4OID A;  3QAH A;  2REE A;  3A9L A;  3NH4 A;  2PSW A;  3TE4 A;  1XEB A;  3W6S A;  4KOT A;  2J8R A;  2XEI A;  4UCM A;  2AFO A;  5GCN A;  4C7H A;  3EY5 A;  1ELM P;  1IGB A;  4X5K A;  3G3S A;  2ZEO A;  3T90 A;  3D7F A;  4A94 A;  1Q2Y A;  4IAV A;  4QUS A;  4TNU A;  3LMS A;  4OC3 A;  4JWP A;  4HNW B;  2Q44 A;  1YGH A;  4KOU A;  2O4H A;  4B10 A;  1FNO A;  1DE4 C;  5A28 A;  4OKO A;  1BAV A;  3PFO A;  2Z3N A;  1S60 A;  3I9S A;  2PJB A;  3TX8 A;  4OLL A;  4ZX8 A;  3G8W A;  3S6F A;  2AFS A;  3FEC A;  1I1D A;  3S9L A;  1Y7R A;  4CGM A;  4KVO E;  4GXH A;  2V8G A;  5LRK A;  3R96 A;  4CAF A;  2R8V A;  3IGR A;  2WSA A;  2JEW A;  1IB1 E;  2X7B A;  5J1Q A;  4MCQ A;  3TC8 A;  3HUV A;  3FX6 A;  2FT0 A;  4MCP A;  1LRZ A;  4NF1 A;  4CRZ B;  1OBR A;  1IYL A;  2FXF A;  4MCR A;  3D3S A;  2PRQ A;  1YVK A;  3KL9 A;  2KCW A;  5JM6 A;  3KZW A;  2C1C A;  4I49 A;  3SJE A;  1S5K A;  2QML A;  4YGO A;  4ZY2 A;  4C2Z A;  1QSO A;  3ISZ A;  2AE6 A;  1HDU A;  3IO1 A;  2JLM A;  3KQZ A;  4PK3 A;  5HXD A;  4DUK A;  1X10 A;  4UIA A;  4IK2 A;  1KZF A;  2CNM A;  2D4P A;  2C6C A;  2QVP A;  3B3S A;  2AFM A;  2VQY A;  3KHX A;  1Y0Y A;  4X8I A;  3TO9 A;  3BXM A;  1I12 A;  2VXK A;  4RS2 A;  1MK4 A;  4P4F A;  4UFX A;  1CBX A;  2HQY A;  3MN8 A;  5EMI A;  4GS4 A;  4KOX A;  2DPS A;  2Z10 A;  4KUB A;  3FJU A;  5G20 A;  4JLY A;  2NMT A;  5G22 A;  3FF3 A;  2AFZ A;  2P0W A;  1S7N A;  3GIU A;  4F6A A;  5KTC A;  2AJ6 A;  3IIB A;  2IMO A;  1MJA A;  1N71 A;  1M1D A;  4E2A A;  1Q2D A;  2YNC C;  3CT9 A;  4RUH A;  4II9 A;  3KHZ A;  5ELY A;  5IV0 A;  3PB6 X;  1QSN A;  4MY0 A;  4UBR A;  1CM0 A;  3RBU A;  3D8P A;  4JZ0 A;  2RC4 A;  2B3V A;  2Q51 A;  2C6P A;  3SXO A;  2GLJ A;  3RZA A;  2Q7S A;  1XFO A;  5LYD A;  2HV2 A;  2OZH A;  2PVW A;  1CP6 A;  3FED A;  4R9M A;  5DS0 A;  1F57 A;  2ZEH A;  4PXB A;  1TXR A;  3WR7 A;  4XNH C;  2ZPA A;  4ZY0 A;  2ZW6 A;  1H8L A;  1Z8T A;  4IHM A;  2FSR A;  4B14 A;  1ZG7 A;  1QMU A;  4OC5 A;  4B6Z A;  1YR0 A;  2A4N A;  5E96 A;  4XPD B;  3V38 A;  3RYO A;  1PYT B;  2PC1 A;  3R95 A;  3QAY A;  4Y49 B;  4AG7 A;  4R3L A;  2P6G A;  2POK A;  2XEJ A;  1KWM A;  3FVL A;  4ONU A;  4JD6 A;  3FB3 A;  3DNS A;  4DYO A;  2ZW7 A;  4NFR A;  2JDC A;  3KR5 A;  4R57 A;  2P6E A;  1QSR A;  4CGN A;  1CG2 A;  4R8F A;  2C6G A;  2WPX A;  5F49 A;  2WPW A;  2CIJ A;  2FS5 A;  1BLL E;  1R3N A;  4JXR A;  2PE3 A;  3ISX A;  3D7D A;  3TO7 A;  3EC4 A;  5F48 A;  4UEE A;  2H5M A;  3LOD A;  4C2X A;  5JH9 A;  1XMT A;  3H8E A;  4M6G A;  4FD7 A;  4G1P A;  4UF4 A;  4OAE A;  4KLV A;  4F9U A;  4RI1 A;  2J8N A;  3PEI A;  3F5B A;  1AMP A;  5G1Z A;  3VH9 A;  4B11 A;  4E8O A;  1AUG A;  1ZLI A;  3VWE A;  4BBH A;  1FY7 A;  4MHP A;  2PRB A;  1MJB A;  2PIZ A;  3GUX A;  4ORF A;  4NXY A;  4OC0 A;  2OOT A;  1TIQ A;  2BSW A;  2PJ7 A;  2XEF A;  3D7H A;  4EWT A;  3I3G A;  1SQH A;  4MMO A;  4C7I A;  2ATR A;  3OWC A;  4H6Z A;  3RAM A;  4ZYQ A;  1IOI A;  3GB0 A;  2EO8 A;  1S7K A;  2Q4V A;  3NE7 A;  4CYN A;  4ZI6 A;  4L8A A;  3IU1 A;  5HVF A;  3BI1 A;  3D68 A;  4CAX A;  1NSA A;  2VBQ A;  2EVN A;  1YK3 A;  4P45 A;  5LYF A;  4KUA A;  2GIV A;  3TOB A;  5IB9 A;  3NH5 A;  1WWZ A;  2PQ8 A;  5C82 A;  3SJG A;  2ZEM A;  4KOW A;  1Z8L A;  1KUY A;  2QJ8 A;  3QNV A;  4EVY A;  2R1I A;  1GYT A;  1R57 A;  5DWM A;  4HNY B;  4CAW A;  5K8N A;  2ODF A;  2CTC A;  2F8H A;  1YRE A;  2DEA A;  1B6B A;  4CGP A;  2PJ2 A;  4YRH A;  3N5F A;  1Z8X A;  3TCV A;  4KS9 A;  3R1K A;  3S6G A;  4B12 A;  3PB7 X;  3F0A A;  3TOA A;  2OU2 A;  3NA6 A;  3WC5 A;  1LOK A;  1Z4R A;  2PR1 A;  1J4J A;  2O28 A;  5AGE A;  1PUA A;  2ZW4 A;  3BHX A;  5LYI A;  1P4N A;  3VAT A;  5F47 A;  5LRJ A;  3W6X A;  4CRY B;  3PGP A;  4Q36 A;  2BUE A;  3CXP A;  4A30 A;  2JEV A;  4K3N A;  3N7Z A;  4GM5 A;  2PJ5 A;  3CDX A;  1CJW A;  3PB9 X;  2RFH A;  2GAN A;  3KKW A;  5BWA B;  3B8G A;  3B3V A;  2G3A A;  4U9Z A;  4QB9 A;  4YWY A;  2ZOF A;  2PCU A;  3CZX A;  1MJ9 A;  2AFU A;  2Q04 A;  4FWU A;  1IYK A;  1IIC A;  2V8D A;  5THW A;  1BPM A;  2FIA A;  2I00 A;  4P44 A;  4Q38 A;  3SHP A;  2VEZ A;  4M6I A;  4A31 A;  3S6H A;  4F0X A;  3PRT A;  4LUA A;  2WUU A;  2JBK A;  1Y0R A;  3B3W A;  3D67 A;  1NE9 A;  1ZO0 A;  4OC4 A;  4MBU A;  1GHE A;  4OIW A;  2B4D B;  2ZEL A;  5F46 A;  4BMH A;  4B13 A;  4AXV A;  3D2P A;  2PJC A;  3F8K A;  3KR4 A;  3GY9 A;  4YFJ A;  4QC6 A;  1Y9W A;  1Y9K A;  3DSB A;  4A33 A;  2EWB A;  6CPA A;  5KTA A;  1HDQ A;  1UFH A;  3WC6 A;  2PJ1 A;  3PZJ A;  4KSF A;  1Q7L A;  1NMT A;  1V0C A;  3B3T A;  3V8I A;  4P4E A;  5H84 A;  4XPD C;  4OP4 A;  4LX9 A;  3TT2 A;  2FE7 A;  2G0B A;  2ZEF A;  1BOB A;  3HLP A;  4KOV A;  2Z3P A;  2HUZ A;  3H8G A;  3S9M A;  1YLO A;  2Q43 A;  4XPK A;  1Z9U A;  4MHZ A;  3V7Z A;  2YNC A;  4IF5 A;  4P4J A;  4K30 A;  4A95 A;  4CAV A;  2EUI A;  5ISV A;  1B87 A;  2BO9 A;  4FD5 A;  4CYP A;  2FCK A;  2B5G A;  4FD6 A;  3UY5 A;  3PBE A;  2QEC A;  3QB8 A;  4NGM A;  3SXN A;  2PJ3 A;  3WC7 A;  4BIN A;  1CX8 A;  2Z11 A;  1IU8 A;  1ZG8 A;  2ZOG A;  4OAD A;  5JQ4 A;  2WYR A;  1BPN A;  4NJQ A;  2CNS A;  5EC4 A;  4NGR A;  1S7L A;  5HVH A;  4W9Y A;  3RNZ A;  4HPS A;  4ZBG A;  1XIX A;  3R9F A;  5CPA A;  2CF4 A;  1EE3 P;  3KI9 A;  3FBU A;  1XRY A;  2OR4 A;  4LQ6 A;  4P4B A;  2PJ9 A;  3NFZ A;  3GYA A;  1DTD A;  4UIB A;  1S7F A;  2VZZ A;  2P6F A;  1TF9 A;  2PR8 A;  2QYV A;  3S6K A;  2FVG A;  1U6M A;  2ZEP A;  2OB0 A;  1I21 A;  2GU2 A;  1RO5 A;  4MRI A;  1ARL A;  4M6H A;  3D7G A;  4FAI A;  2Q4Z A;  3FMC A;  4FUU A;  4NGT A;  2DF5 A;  1TKH A;  3D66 A;  3IEH A;  2YGW A;  2F5I A;  4ZY1 A;  2QIR A;  4NGQ A;  5H86 A;  4KOR A;  4MHD A;  4R76 A;  4B5P A;  2BEI A;  3LWU A;  5JGF A;  2R7H A;  2PJ4 A;  1ELL P;  2B3U A;  1Z2L A;  4NEX A;  4P4D A;  4PK2 A;  5A27 A;  3TO6 A;  4AVC A;  1CPX A;  1KUV A;  2DPT A;  4B5P B;  5AG6 A;  1IID A;  2VL1 A;  7CPA A;  4FBE A;  4A37 A;  1VHS A;  3MGD A;  4AVA A;  2PVV A;  5LYL A;  4XPL A;  2Z3K A;  3DGV A;  4E0A A;  2IJZ A;  1XOV A;  3E0K A;  1WK4 A;  3GKR A;  3IWW A;  4NSQ A;  2B4B A;  1Z8W A;  3MRU A;  4A38 A;  5F09 A;  4R6T A;  4OME A;  4O23 A;  5HMN A;  4Y49 C;  4RN7 A;  3B7I A;  4DNC A;  3B3C A;  5D8N A;  1ZLH A;  1AYE A;  2EBJ A;  2ARH A;  3IWE A;  4PSW A;  4ZX9 A;  4NGS A;  5IB0 A;  8CPA A;  4KSI A;  1LFW A;  4OC2 A;  5I0C A;  2PDO A;  2Q7B A;  3PP9 A;  5JPH A;  4PXD A;  2BCO A;  5IX3 A;  2V8V A;  4MXU A;  1FT7 A;  3DR6 A;  4M85 A;  4WWV A;  2V77 A;  1RTQ A;  2ABZ A;  2G3T A;  2EK8 A;  1QST A;  2REF A;  4JYW A;  2GRE A;  4UWJ A;  5D29 A;  3R9G A;  4C2Y A;  3IC1 A;  2JDD A;  1PCA A;  4NCZ A;  3CXS A;  4F9V A;  1Z5R A;  3FXT A;  3DDD A;  2CY2 A;  1XBU A;  4F0Y A;  3IJ3 A;  5CNP A;  2PJA A;  5C88 A;  1QSM A;  2RB7 A;  3KAS A;  2F7V A;  1TF8 A;  1X12 A;  2DXQ A;  4KOY A;  4KLW A;  1VIX A;  2PJ0 A;  2G9D A;  5DWN A;  3PB8 X;  3EO4 A;  4U9Y A;  4QVT A;  3FYN A;  2CTB A;  4J3G A;  1YLE A;  2ZEG A; 
#chains in the Genus database with same CATH homology
 1K4J A;  4M3S A;  5J8C A;  4UFV A;  3W91 A;  4H6U A;  4MJ8 A;  4KVM E;  4KVX A;  4UCN A;  3FRM A;  2B5G B;  3D2M A;  3IWG A;  4UCP A;  4CGL A;  1BO4 A;  2Y0M A;  2C27 A;  5FVJ A;  4HKF A;  2Z3M A;  1YX0 A;  4IUS A;  3BJ8 A;  4UFW A;  3DR8 A;  4MFP A;  4HNX B;  4MFZ A;  4R3K A;  2GE3 A;  3C26 A;  1M4D A;  1L0C A;  2Z0Z A;  2ZW5 A;  4ZGY B;  4JXQ A;  4CS0 B;  3ZJ0 A;  2OH1 A;  5AG5 A;  1YVO A;  2VZY A;  3JTK A;  4C68 A;  4QBJ A;  3TTH A;  3BJ7 A;  3H5Z A;  2FIW A;  4A32 A;  2K5T A;  3EXN A;  2OZG A;  2YNE A;  5HH1 A;  4UA3 A;  3IU2 A;  1M44 A;  4MI4 A;  3P2F A;  3T9Y A;  3JUW A;  2Z3O A;  4AB7 A;  4CAE A;  4PV6 A;  4MFJ A;  2YND A;  4A2Z A;  4KZT A;  3ZZI A;  4KSA A;  4CYO A;  1XF8 A;  2CXA A;  5AG7 A;  2B58 A;  5KTD A;  3TFY A;  4MFQ A;  4U5Y A;  3CXQ A;  3VWD A;  2IL4 A;  1KUX A;  1Q2C A;  4CYQ A;  1M4G A;  3JVN A;  4AVB A;  2VI7 A;  5AG4 A;  2Q4Y A;  2FL4 A;  2J8M A;  4CGO A;  4MFL A;  2ZXV A;  4JJX A;  4MFK A;  3P2H A;  5EBV A;  3FIX A;  3LD2 A;  4R87 A;  3R9E A;  1ON0 A;  1M4I A;  2D4O A;  4H89 A;  2CNT A;  2OZU A;  1S3Z A;  4FD4 A;  4B5O A;  4UWI A;  1P0H A;  3K9U A;  5G21 A;  1XE4 A;  3BLN A;  4AG9 A;  1VKC A;  2I79 A;  3EFA A;  4PSX A;  1NSL A;  1PU9 A;  2R98 A;  2Q0Y A;  2B4D A;  4L89 A;  4XNH B;  2BL1 A;  4KOS A;  3FNC A;  1RXT A;  4MY3 A;  1OZP A;  1Z4E A;  2Z3L A;  3H4Q A;  3QAH A;  2REE A;  3A9L A;  2PSW A;  3TE4 A;  1XEB A;  3W6S A;  4KOT A;  2J8R A;  4UCM A;  5GCN A;  4C7H A;  3EY5 A;  4X5K A;  3G3S A;  3T90 A;  1Q2Y A;  4QUS A;  4JWP A;  4HNW B;  2Q44 A;  1YGH A;  4KOU A;  4B10 A;  5A28 A;  2Z3N A;  1S60 A;  3I9S A;  4OLL A;  3S6F A;  3G8W A;  1I1D A;  1Y7R A;  4CGM A;  4KVO E;  3R96 A;  4CAF A;  2R8V A;  3IGR A;  2WSA A;  1IB1 E;  2X7B A;  2FT0 A;  1LRZ A;  4NF1 A;  4CRZ B;  1IYL A;  2FXF A;  3D3S A;  1YVK A;  2KCW A;  4I49 A;  1S5K A;  2QML A;  4YGO A;  4C2Z A;  1QSO A;  2AE6 A;  2JLM A;  4PK3 A;  1KZF A;  2CNM A;  2D4P A;  2VQY A;  3TO9 A;  1I12 A;  2VXK A;  4RS2 A;  1MK4 A;  4UFX A;  2HQY A;  4GS4 A;  4KOX A;  2DPS A;  2Z10 A;  4KUB A;  5G20 A;  4JLY A;  2NMT A;  5G22 A;  2P0W A;  1S7N A;  4F6A A;  5KTC A;  2AJ6 A;  1MJA A;  1N71 A;  1M1D A;  4E2A A;  1Q2D A;  2YNC C;  4II9 A;  5IV0 A;  1QSN A;  4MY0 A;  4UBR A;  1CM0 A;  3D8P A;  2RC4 A;  2B3V A;  3SXO A;  2HV2 A;  2OZH A;  4R9M A;  3WR7 A;  4XNH C;  2ZPA A;  2ZW6 A;  2FSR A;  4B14 A;  1YR0 A;  2A4N A;  5E96 A;  4XPD B;  3RYO A;  2PC1 A;  3R95 A;  4Y49 B;  4AG7 A;  4R3L A;  2P6G A;  4ONU A;  4JD6 A;  3FB3 A;  3DNS A;  2ZW7 A;  4R57 A;  2JDC A;  2P6E A;  1QSR A;  4CGN A;  2WPX A;  5F49 A;  2WPW A;  2FS5 A;  4JXR A;  3TO7 A;  3EC4 A;  5F48 A;  2H5M A;  3LOD A;  4C2X A;  1XMT A;  4FD7 A;  4OAE A;  4KLV A;  4RI1 A;  2J8N A;  3F5B A;  5G1Z A;  4B11 A;  4E8O A;  3VWE A;  4BBH A;  1FY7 A;  2PRB A;  1MJB A;  4ORF A;  4NXY A;  1TIQ A;  2BSW A;  3I3G A;  1SQH A;  4C7I A;  2ATR A;  3OWC A;  4H6Z A;  4CYN A;  1S7K A;  2Q4V A;  3NE7 A;  4L8A A;  3IU1 A;  4CAX A;  2VBQ A;  2EVN A;  1YK3 A;  4KUA A;  2GIV A;  3TOB A;  1WWZ A;  2PQ8 A;  5C82 A;  4KOW A;  1KUY A;  4EVY A;  2R1I A;  1R57 A;  5DWM A;  4HNY B;  4CAW A;  1YRE A;  1B6B A;  4CGP A;  4YRH A;  3TCV A;  4KS9 A;  3R1K A;  3S6G A;  4B12 A;  3F0A A;  3TOA A;  2OU2 A;  1Z4R A;  2PR1 A;  1J4J A;  2O28 A;  5AGE A;  1PUA A;  2ZW4 A;  5J8F A;  1P4N A;  3W6X A;  5F47 A;  4CRY B;  3PGP A;  4Q36 A;  2BUE A;  3CXP A;  4A30 A;  2JEV A;  3N7Z A;  1CJW A;  5BWA B;  2GAN A;  3KKW A;  3B8G A;  2G3A A;  4U9Z A;  4QB9 A;  1MJ9 A;  2Q04 A;  1IYK A;  1IIC A;  3SHP A;  2FIA A;  2I00 A;  4Q38 A;  4A31 A;  4F0X A;  2VEZ A;  3S6H A;  4LUA A;  2WUU A;  1NE9 A;  1ZO0 A;  4MBU A;  1GHE A;  2B4D B;  5F46 A;  4BMH A;  4B13 A;  3D2P A;  3F8K A;  4YFJ A;  3GY9 A;  4QC6 A;  1Y9W A;  1Y9K A;  3DSB A;  4A33 A;  5KTA A;  1UFH A;  3PZJ A;  4KSF A;  1NMT A;  1V0C A;  3V8I A;  5H84 A;  4XPD C;  4LX9 A;  3TT2 A;  2FE7 A;  2G0B A;  4KOV A;  1BOB A;  2Z3P A;  2HUZ A;  5HMN A;  4XPK A;  4CAV A;  1Z9U A;  2YNC A;  4IF5 A;  4K30 A;  4A95 A;  5ISV A;  2EUI A;  1B87 A;  4FD5 A;  4CYP A;  2FCK A;  2B5G A;  4FD6 A;  3UY5 A;  2QEC A;  3QB8 A;  3SXN A;  2Z11 A;  4OAD A;  5JQ4 A;  2CNS A;  5EC4 A;  1S7L A;  4ZBG A;  1XIX A;  3R9F A;  3FBU A;  3GYA A;  1S7F A;  2VZZ A;  2P6F A;  2PR8 A;  3S6K A;  1U6M A;  2OB0 A;  1I21 A;  1RO5 A;  2YGW A;  2F5I A;  2QIR A;  5H86 A;  4MHD A;  4B5P A;  2BEI A;  2R7H A;  2B3U A;  4NEX A;  4PK2 A;  5A27 A;  3TO6 A;  4AVC A;  1KUV A;  2DPT A;  4B5P B;  5AG6 A;  1IID A;  1VHS A;  3MGD A;  4AVA A;  4XPL A;  2Z3K A;  4E0A A;  3E0K A;  4NSQ A;  1WK4 A;  3GKR A;  2B4B A;  4Y49 C;  4DNC A;  2ARH A;  3IWE A;  4PSW A;  5IB0 A;  5I0C A;  2PDO A;  2Q7B A;  3PP9 A;  5JPH A;  5IX3 A;  3DR6 A;  4M85 A;  1QST A;  2G3T A;  2REF A;  4C2Y A;  4UWJ A;  3R9G A;  2JDD A;  4NCZ A;  3CXS A;  3FXT A;  3DDD A;  2CY2 A;  4F0Y A;  5CNP A;  5C88 A;  1QSM A;  2DXQ A;  4KOY A;  4KLW A;  5DWN A;  3EO4 A;  4U9Y A;  4QVT A;  3FYN A;  4KOR A;  4J3G A;  1YLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...