3E0KA

Crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
146
Chain Sequence
b'AEQVRQAGIDDIGGILELIHPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFRKSKILALDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amino-acid acetyltransferase
publication title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
total genus 33
structure length 146
sequence length 148
ec nomenclature ec 2.3.1.1: Amino-acid N-acetyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3e0kA00
4E2AA 4F6AA 4MY3A 4KLWA 3JUWA 4HKFA 4NEXA 1VKCA 3EXNA 4KUBA 2B5GA 5KTAA 2VQYA 2Z11A 4UBRA 2Q4YA 3EFAA 4AG9A 1P0HA 2I00A 4KZTA 3S6KA 1IB1E 2J8MA 4MI4A 4ONUA 1U6MA 2FXFA 4R9MA 4BMHA 1MJ9A 2ZW7A 2PR1A 2B3UA 1IIDA 1VHSA 3R9GA 2JDDA 5E96A 3W6SA 2HUZA 1YLEA 5F46A 4H89A 2REEA 3RYOA 4QUSA 1KUVA 2Q0YA 4KORA 5ISVA 3IWGA 3F0AA 2B4DB 4MBUA 1KZFA 5EC4A 4L8AA 2J8RA 3TOBA 4XPLA 2OZUA 3CXQA 4R87A 2F5IA 2EUIA 2HV2A 3CXSA 3TOAA 2ZW5A 1XMTA 3FBUA 3DDDA 5F49A 4B5OA 4XPDC 3FIXA 1GHEA 2B3VA 1KUXA 1IICA 2VXKA 4E0AA 1I1DA 2BEIA 4UA3A 3SXNA 2PC1A 2FIAA 3QAHA 4XPKA 5C82A 4PK2A 1S7LA 2PSWA 2B4DA 1CJWA 1RXTA 2J8NA 1K4JA 2K5TA 4AVAA 1TIQA 2H5MA 5I0CA 2VZZA 1Y9KA 4F0YA 2R8VA 4OADA 4NSQA 4QVTA 1MJAA 3TTHA 3E0KA 3LODA 3SHPA 3P2FA 3F5BA 1NE9A 2D4PA 3ZZIA 1M44A 1PUAA 2IL4A 3D8PA 4U9YA 2EVNA 2JEVA 3GY9A 2Y0MA 2DXQA 1MJBA 1J4JA 2P6GA 2P0WA 1SQHA 4JJXA 2FIWA 3R1KA 5EBVA 4UWIA 4ZBGA 2FE7A 4JLYA 5CNPA 1YVOA 4CS0B 2OH1A 4XNHC 5FVJA 1M4DA 2WPXA 4OAEA 3WR7A 3D2MA 1IYLA 3B8GA 1Z9UA 5DWNA 2G0BA 3C26A 1IYKA 2PDOA 3BLNA 4HNXB 1P4NA 4LX9A 4K30A 3FYNA 4B5PA 5J8FA 3P2HA 1Y7RA 2ZW6A 4HNWB 3VWEA 2QECA 4M85A 3GKRA 5J8CA 4JXQA 5IB0A 3FRMA 2BL1A 3TT2A 5HMNA 4Y49C 1UFHA 2OZGA 3KKWA 3DR6A 4L89A 4PSXA 2ARHA 1Y9WA 4AB7A 4J3GA 5GCNA 5H84A 2FL4A 4FD6A 4KOSA 1YGHA 2CNSA 2X7BA 2GANA 2O28A 4U5YA 3ZJ0A 1YVKA 4M3SA 1YR0A 3TO7A 1FY7A 3GYAA 3R9EA 4RS2A 1Q2YA 5H86A 1I21A 4KOYA 5C88A 3NE7A 4CRZB 2FS5A 1RO5A 4KVOE 3EC4A 4LUAA 4OLLA 2RC4A 3CXPA 3PZJA 4NXYA 1I12A 4YFJA 2PR8A 3R96A 4YGOA 2CNMA 4DNCA 1XE4A 3S6HA 2G3AA 1LRZA 1QSNA 1OZPA 1S3ZA 4I49A 4KOVA 1WWZA 2Q04A 1QSTA 3R9FA 2VZYA 3TFYA 4FD5A 4NCZA 1Q2DA 4EVYA 4KOUA 4KLVA 2BSWA 2D4OA 2JDCA 4MJ8A 2P6FA 4XPDB 4KOWA 4U9ZA 4PSWA 2OZHA 3PGPA 4HNYB 3DSBA 3K9UA 3IGRA 4H6UA 2B58A 4KOTA 3FNCA 1V0CA 4B5PB 1NSLA 2I79A 2ZXVA 1S7FA 4RI1A 2QIRA 3G8WA 1YREA 4KOXA 2FSRA 2Q7BA 2PQ8A 5JPHA 1Q2CA 3EO4A 4H6ZA 4PV6A 1BOBA 5F47A 4AG7A 1XEBA 1M4IA 4MHDA 3S6GA 3DR8A 1KUYA 3R95A 2KCWA 3DNSA 3EY5A 4CRYB 5IX3A 2PRBA 1BO4A 2OB0A 1CM0A 1YK3A 4KUAA 4QB9A 4XNHB 3W6XA 1R57A 1Z4EA 2GE3A 3JVNA 2FCKA 2R7HA 2B4BA 2GIVA 3FXTA 4MY0A 1WK4A 5F48A 2WPWA 2R98A 2Q44A 1XF8A 2CNTA 5IV0A 3N7ZA 4KVME 4II9A 3H4QA 2R1IA 1NMTA 3BJ8A 4ORFA 5HH1A 2P6EA 4QBJA 3S6FA 2A4NA 1S7NA 4JXRA 2G3TA 2OU2A 1QSOA 3TO6A 1YX0A 3QB8A 4Y49B 1MK4A 3I9SA 4R57A 3T9YA 2FT0A 4CAVA 4AVCA 2AE6A 3BJ7A 3TE4A 1QSRA 2AJ6A 3MGDA 2Z10A 3VWDA 1B87A 3SXOA 1XIXA 1PU9A 2Q4VA 2Z0ZA 3T90A 4JWPA 3W91A 4CAXA 4AVBA 3PP9A 2REFA 2ZPAA 3TO9A 2JLMA 2VBQA 3LD2A 4PK3A 2NMTA 4IUSA 1S60A 3TCVA 2QMLA 4QC6A 4R3KA 4UWJA 1S5KA 4KVXA 5JQ4A 1Z4RA 3FB3A 4X5KA 1B6BA 4E8OA 5KTCA 1QSMA 4GS4A 2HQYA 3D3SA 4R3LA 2C27A 4CAWA 4FD7A 3V8IA 3F8KA 1S7KA 5KTDA 1N71A 3G3SA 4YRHA 2B5GB 2CY2A 3OWCA 4NF1A 4JD6A 1ON0A 2ATRA 2ZW4A 3D2PA 2BUEA 2VI7A 1M1DA 1M4GA 4FD4A 4IF5A 2VEZA 1L0CA 3I3GA 3UY5A 5DWMA
chains in the Genus database with same CATH superfamily
3ISXA 1JQGA 4E2AA 4F6AA 4B6ZA 1UWYA 4MY3A 4F0XA 3KI9A 2GLFA 1CPSA 4KLWA 1ARLA 4UF4A 1TF8A 3JUWA 4M6HA 1QQ9A 1Y0YA 4HKFA 4NEXA 1VKCA 3EXNA 4KUBA 2B5GA 5KTAA 2VQYA 2Z11A 5DS0A 4YWYA 4B11A 4UBRA 2ZOFA 2Q4YA 3EFAA 4AG9A 3KQZA 1P0HA 2I00A 4KZTA 2V8VA 2ABZA 3S6KA 1IB1E 2J8MA 1PYTB 1F57A 4MI4A 1TKFA 2JBKA 4ONUA 2BCOA 1U6MA 2FXFA 1OBRA 3TOAA 4TNUA 4R9MA 4BMHA 1MJ9A 2G9DA 2F8HA 3B3VA 3IC1A 2ZW7A 2CF4A 2PR1A 5LYDA 4C7IA 2B3UA 1IIDA 4MFJA 1VHSA 4LQ6A 3R9GA 4CYQA 2JDDA 3KGQA 5EMIA 1ZG8A 4W9YA 2ANPA 5E96A 4X2TA 3CPAA 3W6SA 2HUZA 1YLEA 3D7HA 4H89A 4CAFA 3VH9A 5F46A 2PCUA 2REEA 5D29A 1CP6A 5HXDA 4UIAA 3FECA 1HDUA 2OOTA 3RYOA 4NGTA 3B3CA 1KWMA 3GUXA 3CDXA 4QUSA 1R3NA 4A95A 1KUVA 2Q0YA 4ZY2A 2V77A 4OC0A 4KORA 2PVVA 1F2OA 4P4DA 5ISVA 3IWGA 4C68A 2EWBA 3F0AA 2DPTA 3QAYA 4GXHA 2B4DB 4MBUA 1KZFA 3D66A 7CPAA 3WABA 4OIWA 5EC4A 4L8AA 3SJGA 4Z65A 4P4FA 5JGFA 5LYFA 4R6TA 2J8RA 3B35A 3TOBA 4XPLA 1XRYA 1GYTA 3IIBA 2JBJA 2PRQA 3BXMA 3PB9X 2C6CA 4M6GA 4NJQA 2HC9A 1Q7LA 2OZUA 3CXQA 1TKJA 3RAMA 1X12A 2GLJA 3IJ3A 4R87A 2F5IA 2EUIA 2HV2A 3PB6X 3CXSA 1M4LA 2ZW5A 1XMTA 3B7IA 3D7DA 1EE3P 2QJ8A 3NFZA 3FBUA 3IWEA 3DDDA 5LYIA 5F49A 4B5OA 4XPDC 1HEEA 3FIXA 1AYEA 4MRIA 1IOFA 1GHEA 4A33A 2B3VA 5F09A 3WC6A 1KUXA 1IICA 2VXKA 4PXBA 4E0AA 1I1DA 2BEIA 4UA3A 3IEHA 3SXNA 4CGMA 1VHOA 2PC1A 2FIAA 3QAHA 4B13A 4XPKA 5C82A 4PK2A 1S7LA 3KQXA 2PSWA 2B4DA 2PE3A 1CJWA 1RXTA 2J8NA 2Z3PA 1LANA 2RFHA 1K4JA 2K5TA 1CX8A 4AVAA 1TIQA 4UCMA 2H5MA 2GREA 5CPAA 5I0CA 2VZZA 1Y9KA 4OP4A 4F0YA 4ZX9A 2R8VA 2YGWA 4OADA 4NSQA 1YSJA 4QVTA 4C2YA 1MJAA 1LOKA 4Q38A 3TTHA 5G22A 3E0KA 3LODA 3BI0A 4MFQA 3SHPA 3P2FA 2WZNA 3F5BA 1NE9A 4KSAA 2D4PA 2C6GA 2ZEMA 3ZZIA 1M44A 1PUAA 2IL4A 3D8PA 1R43A 4U9YA 2HB6A 4DUKA 3NA6A 2EVNA 3SJXA 2JEVA 1TXRA 3GY9A 2Y0MA 2DXQA 1MJBA 1J4JA 2P6GA 4NGMA 4NGNA 2P0WA 1SQHA 4P4IA 4JJXA 3GLJA 2FIWA 1TKHA 3KL9A 3QNVA 3R1KA 4HPSA 4UWIA 4P4JA 5EBVA 4ZBGA 4F9VA 2FE7A 5G20A 4JLYA 3KHZA 4KS9A 5CNPA 4UFXA 1ZLHA 2EK9A 1YVOA 4C2XA 3S9NA 5K8OA 4CS0B 2OH1A 4ZY0A 5J1QA 2BO9A 4XNHC 1Z5RA 4IK2A 5FVJA 1M4DA 4H2KA 5LRGA 2WPXA 2Z3LA 1DTDA 3SI1A 4OAEA 3WR7A 3D7FA 4B12A 3D2MA 1IYLA 4ZY1A 3B8GA 1Z9UA 5DWNA 4FUUA 2G0BA 4NGQA 3C26A 1IYKA 2PDOA 3T8WA 3BLNA 1AUGA 1VIXA 4HNXB 1ELLP 1P4NA 4LX9A 4P45A 4UCPA 3KR5A 1Y0RA 4MMOA 1LAPA 4K30A 2ZEFA 3FYNA 4PXEA 4EFDA 4MHPA 4FAIA 2AFMA 4B5PA 4PPZA 5AG5A 3H8FA 4KSIA 5J8FA 4ZGYB 1NSAA 3B2YA 3P2HA 5LRJA 2RB7A 1Y7RA 2ZW6A 4HNWB 2ZEDA 4UIBA 2ZEPA 4KSFA 3VWEA 2QECA 1ZO0A 4M85A 3SJEA 1IOIA 4GM5A 3GKRA 4CGOA 4A30A 3MN8A 5J8CA 2O4HA 4JXQA 5ELYA 5IB0A 2XEGA 3B3WA 2PJ4A 4UCNA 4B14A 3FRMA 2BL1A 3TT2A 1YW6A 4A31A 4Y49C 1UFHA 2OZGA 2PJAA 3WT4A 4CPAA 4EWTA 1LFWA 3KKWA 3DR6A 4L89A 1LAMA 4PSXA 2PJ7A 2Z3NA 2ARHA 1Y9WA 3KZWA 4J3GA 2PJ3A 4AB7A 5GCNA 5H84A 4BBHA 4OC2A 3SJFA 4UEZA 2FL4A 4FD6A 4KOSA 1YGHA 1Z2LA 2CNSA 2GU2A 2Q4ZA 1XBUA 2X7BA 4TWEA 2GANA 2O28A 4PXDA 4U5YA 3ZJ0A 4FWUA 1YVKA 4M3SA 4R7MA 2AFZA 1YR0A 2WYRA 3TO7A 3PRTA 3DLJA 1FY7A 5LRKA 3GYAA 3R9EA 4RS2A 4MFKA 1Q2YA 2CTCA 5H86A 4CYPA 2PJ8A 1I21A 4KOYA 4C7HA 5C88A 5THWA 3NE7A 2POKA 2XEJA 4CRZB 2FS5A 1RO5A 1Z8XA 3V38A 5AGEA 4KVOE 3EC4A 2ZEEA 4LUAA 4OLLA 2RC4A 3CXPA 3NH5A 2YNDA 1CPXA 2J9AA 2I3CA 3PZJA 5JH9A 3PFOA 4NXYA 2PJ9A 4LQGA 4BD9A 3B3TA 5HMNA 3S9MA 2NSMA 1I12A 4YFJA 2PR8A 3V7ZA 4NFRA 6CPAA 3TC8A 3R96A 4YGOA 2CNMA 4UFVA 1LCPA 3KHXA 1XE4A 4DNCA 3D7GA 2BOAA 3S6HA 4ONWA 2G3AA 1LRZA 1QSNA 3D68A 1OZPA 4OC4A 3K2KA 5LYLA 1RTQA 1S3ZA 3KR4A 3JRUA 3HUVA 5D8NA 4I49A 5G1ZA 4KOVA 5HVGA 4OC3A 1WWZA 3BHXA 2Q04A 1QSTA 1VGYA 3FEDA 3R9FA 2VZYA 3PFEA 4CYNA 4OKOA 3D67A 4FD5A 4MHYA 3TFYA 4ZX8A 5I4MA 2PIZA 1TF9A 4NCZA 1Q2DA 3D4UA 4A94A 4EVYA 2DF5A 2EO8A 4NGSA 4KOUA 3NH8A 4KLVA 1CG2A 2BSWA 2D4OA 2JDCA 2Z3MA 2P6FA 4MJ8A 1ARMA 4XPDB 4KOWA 2DEAA 4PSWA 4U9ZA 5K8NA 2OZHA 1A2ZA 3L2NA 3PGPA 4HNYB 4OC1A 4B10A 1ZG7A 1CP7A 3DSBA 3K9UA 3IGRA 4H6UA 2B58A 1XJOA 2PIYA 2YNEA 4KOTA 4P6YA 3FNCA 1V0CA 4B5PB 3PBEA 1ELMP 1NSLA 4IHMA 3IWWA 1F2PA 4P4BA 4A2ZA 4CGLA 2I79A 3IU1A 2AFOA 2ZXVA 2EBJA 2NYQA 1S7FA 4RI1A 2QIRA 2F7VA 3JTKA 3G8WA 1YREA 3PEIA 4KOXA 3NE8A 2FSRA 1BLLE 4YU9A 2ZEGA 2CIJA 2Q7BA 2PQ8A 5AG6A 5JPHA 3LMSA 3RBUA 1Q2CA 3EO4A 4H6ZA 4PV6A 4ZYQA 5K8MA 4IAVA 1BOBA 5F47A 2PVWA 4AG7A 2PJ6A 1XEBA 4MXUA 3S9LA 1M4IA 4MFPA 4MHDA 3S6GA 4OIDA 2IQ6A 2Z3OA 3FJUA 1Z8TA 3DR8A 1XFOA 2Q43A 1KUYA 3R95A 4M6IA 4A39A 2KCWA 3DNSA 4C2ZA 3EY5A 4CRYB 5IX3A 2IMOA 3RZAA 4K3NA 4WJBA 1PCAA 2EK8A 1BO4A 2PRBA 2QYVA 2Q7SA 2PJCA 2OB0A 1BAVA 3SI2A 1CM0A 1XMBA 1YK3A 2YNCC 3GB0A 4KUAA 1R57A 1Z4EA 4QB9A 4XNHB 5AG7A 2GE3A 3JVNA 4NGRA 2FCKA 2R7HA 5BWAB 2B4BA 5G21A 1HDQA 2GIVA 3CT9A 3FXTA 1WK4A 4MY0A 4R76A 2WPWA 5F48A 4A38A 5HVHA 3N5FA 5AG4A 2R98A 8CPAA 3B3SA 1FT7A 4UEEA 5A27A 2Q44A 3PB7X 4MCRA 2ZENA 2XEFA 1XF8A 2CNTA 4AXVA 5IV0A 3N7ZA 4RN7A 4KVME 4II9A 3H4QA 2R1IA 1NMTA 3BJ8A 4ORFA 2XEIA 1JWQA 1YW4A 5HH1A 1FNOA 2P6EA 4NGPA 4UEFA 2AFXA 4CGPA 4MCSA 4QBJA 3S6FA 3LACA 2A4NA 2PJ5A 2AFWA 5K8PA 1S7NA 4JXRA 2G3TA 1ZLIA 2OU2A 2Q51A 1QSOA 4P4EA 1YX0A 3TO6A 3H8EA 3QB8A 2V8HA 2VL1A 2DPSA 4Y49B 1MK4A 3I9SA 3SI0A 2ZOGA 1CBXA 2WSAA 4R57A 5HVFA 3T9YA 4OMEA 2FT0A 3FX6A 4CAVA 4AVCA 2AE6A 3BJ7A 3TE4A 3RNZA 1QSRA 2AJ6A 3MGDA 2Z10A 3VWDA 1B87A 4CYOA 4X8IA 1ZG9A 4ZI6A 4F8ZA 4R8FA 3SXOA 3WC7A 1PU9A 1XIXA 2Q4VA 2Z0ZA 4CAEA 3T90A 3VARA 4CGNA 3FF3A 4JWPA 3W91A 2IJZA 1YMEA 4CAXA 5A28A 4AVBA 3PP9A 1H8LA 3KASA 2REFA 2YNCA 4JZ0A 4MHNA 1QMUA 2ZPAA 4X3RA 4DJLA 3TO9A 2PJ1A 1VHEA 4A32A 5CBMA 4UFWA 2JLMA 2VBQA 3LD2A 4PK3A 2V8GA 1YQEA 2NMTA 3HLPA 4IUSA 3IFEA 3I1UA 2GFQA 1S60A 3PB8X 3TCVA 5JM6A 2QMLA 3CPXA 1YLOA 2Z3KA 4QC6A 4R3KA 4UWJA 4MCQA 1S5KA 4KVXA 5JQ4A 3TX8A 1Z4RA 4MHZA 3FB3A 4X5KA 1B6BA 3BI1A 4E8OA 1DE4C 5KTCA 1QSMA 1IGBA 4GS4A 2AFSA 3VATA 2HQYA 3FMCA 4RUHA 4EMEA 3CZXA 1AMPA 3D3SA 2PJBA 4O23A 4A37A 4R3LA 4Q7AA 3FH4A 3A9LA 2C27A 2ZEOA 4OC5A 1BPMA 1Z8LA 4FBEA 4MFLA 1IY7A 4MCPA 4CAWA 4FD7A 2QVPA 3V8IA 4BINA 3F8KA 1BPNA 1S7KA 5KTDA 2V8DA 1N71A 2OR4A 3LWUA 4G1PA 4PQAA 2PJ2A 4P10A 3WC5A 3G3SA 2CTBA 2WUUA 3IO1A 3MRUA 4YRHA 3PBBA 2AFUA 2PJ0A 3H5ZA 2B5GB 4DYOA 2CY2A 3DGVA 3W6XA 3OWCA 3RO0A 4NF1A 3NH4A 2C1CA 3FVLA 4JD6A 5IB9A 2FVGA 1ON0A 2ATRA 2ZW4A 2ZELA 4JYWA 2C6PA 3D2PA 2JEWA 4P44A 1Z8WA 2BUEA 1IU8A 2ZEHA 1X10A 2VI7A 1M1DA 1M4GA 4FD4A 4WWVA 2CXAA 4IF5A 3PB4X 2VEZA 4NJRA 3IU2A 1L0CA 4MFZA 1XOVA 3I3GA 4Q36A 3ISZA 4F9UA 4PXCA 3UY5A 3FEEA 5DWMA 3GIUA 3K9TA 1Y7EA 3H8GA 2ODFA 2O53A
chains in the Genus database with same CATH topology
4E2AA 4F6AA 4MY3A 4F0XA 4KLWA 3JUWA 4HKFA 4NEXA 1VKCA 3EXNA 4KUBA 2B5GA 5KTAA 2VQYA 2Z11A 4B11A 4UBRA 2Q4YA 3EFAA 4AG9A 1P0HA 2I00A 4KZTA 3S6KA 1IB1E 2J8MA 4MI4A 4ONUA 1U6MA 2FXFA 4R9MA 4BMHA 1MJ9A 2ZW7A 2PR1A 4C7IA 2B3UA 1IIDA 4MFJA 1VHSA 3R9GA 4CYQA 2JDDA 5E96A 3W6SA 2HUZA 1YLEA 4CAFA 4H89A 5F46A 2REEA 3RYOA 4A95A 4QUSA 1KUVA 2Q0YA 4KORA 5ISVA 3IWGA 4C68A 3F0AA 2DPTA 2B4DB 4MBUA 1KZFA 5EC4A 4L8AA 2J8RA 3TOBA 4XPLA 2OZUA 3CXQA 4R87A 2F5IA 2EUIA 2HV2A 3CXSA 3TOAA 2ZW5A 1XMTA 3FBUA 3IWEA 3DDDA 5F49A 4B5OA 4XPDC 3FIXA 4A33A 1GHEA 2B3VA 1KUXA 1IICA 2VXKA 4E0AA 1I1DA 2BEIA 4UA3A 3SXNA 4CGMA 2PC1A 2FIAA 3QAHA 4B13A 4XPKA 5C82A 4PK2A 1S7LA 2PSWA 2B4DA 2Z3PA 1CJWA 1RXTA 2J8NA 1K4JA 2K5TA 4AVAA 1TIQA 4UCMA 2H5MA 5I0CA 2VZZA 1Y9KA 4F0YA 2R8VA 2YGWA 4OADA 4NSQA 4QVTA 4C2YA 1MJAA 4Q38A 3TTHA 5G22A 3E0KA 3LODA 4MFQA 3SHPA 3P2FA 3F5BA 4KSAA 1NE9A 2D4PA 3ZZIA 1M44A 1PUAA 2IL4A 3D8PA 4U9YA 2EVNA 2JEVA 3GY9A 2Y0MA 2DXQA 1MJBA 1J4JA 2P6GA 2P0WA 1SQHA 4JJXA 2FIWA 3R1KA 5EBVA 4UWIA 4ZBGA 2FE7A 5G20A 4JLYA 4KS9A 5CNPA 4UFXA 4C2XA 1YVOA 4CS0B 2OH1A 4XNHC 5FVJA 1M4DA 2WPXA 2Z3LA 4OAEA 3WR7A 4B12A 3D2MA 1IYLA 3B8GA 1Z9UA 5DWNA 2G0BA 3C26A 1IYKA 2PDOA 3BLNA 4HNXB 1P4NA 4LX9A 4UCPA 4K30A 3FYNA 4B5PA 5J8FA 4ZGYB 3P2HA 1Y7RA 2ZW6A 4HNWB 4KSFA 3VWEA 2QECA 1ZO0A 4M85A 3GKRA 4CGOA 4A30A 5J8CA 4JXQA 5IB0A 4UCNA 4B14A 3FRMA 2BL1A 3TT2A 5HMNA 4A31A 4Y49C 1UFHA 2OZGA 3KKWA 3DR6A 4L89A 4PSXA 2Z3NA 2ARHA 1Y9WA 4AB7A 4J3GA 5GCNA 5H84A 4BBHA 2FL4A 4FD6A 4KOSA 1YGHA 2CNSA 2X7BA 2GANA 2O28A 4U5YA 3ZJ0A 1YVKA 4M3SA 1YR0A 3TO7A 1FY7A 3GYAA 3R9EA 4RS2A 4MFKA 1Q2YA 5H86A 4CYPA 4C7HA 1I21A 4KOYA 5C88A 3NE7A 4CRZB 2FS5A 1RO5A 5AGEA 4KVOE 3EC4A 4LUAA 4OLLA 2RC4A 3CXPA 2YNDA 3PZJA 4NXYA 1I12A 4YFJA 2PR8A 3R96A 4YGOA 2CNMA 4UFVA 4DNCA 1XE4A 3S6HA 2G3AA 1LRZA 1QSNA 1OZPA 1S3ZA 4I49A 5G1ZA 4KOVA 1WWZA 2Q04A 1QSTA 3R9FA 2VZYA 4CYNA 3TFYA 4FD5A 4NCZA 1Q2DA 4EVYA 4KOUA 4KLVA 2BSWA 2D4OA 2JDCA 2Z3MA 2P6FA 4MJ8A 4XPDB 4KOWA 4U9ZA 4PSWA 2OZHA 4B10A 3PGPA 4HNYB 3DSBA 3K9UA 3IGRA 4H6UA 2B58A 2YNEA 4KOTA 3FNCA 1V0CA 4B5PB 1NSLA 4A2ZA 4CGLA 2I79A 3IU1A 2ZXVA 1S7FA 4RI1A 2QIRA 3JTKA 3G8WA 1YREA 4KOXA 2FSRA 2Q7BA 2PQ8A 5AG6A 5JPHA 1Q2CA 3EO4A 4H6ZA 4PV6A 1BOBA 5F47A 4AG7A 1XEBA 1M4IA 4MFPA 4MHDA 3S6GA 2Z3OA 3DR8A 1KUYA 3R95A 2KCWA 3DNSA 4C2ZA 3EY5A 4CRYB 5IX3A 2PRBA 1BO4A 2OB0A 1CM0A 1YK3A 2YNCC 4KUAA 4QB9A 4XNHB 1R57A 1Z4EA 5AG7A 5AG5A 3W6XA 2GE3A 3JVNA 2FCKA 2R7HA 5BWAB 2B4BA 5G21A 2GIVA 3FXTA 4MY0A 1WK4A 5F48A 2WPWA 5AG4A 2R98A 5A27A 2Q44A 1XF8A 2CNTA 5IV0A 3N7ZA 4KVME 4II9A 3H4QA 2R1IA 1NMTA 3BJ8A 4ORFA 5HH1A 2P6EA 4CGPA 4QBJA 3S6FA 2A4NA 1S7NA 4JXRA 2G3TA 2OU2A 1QSOA 3TO6A 1YX0A 3QB8A 2DPSA 4Y49B 1MK4A 3I9SA 2WSAA 4R57A 3T9YA 2FT0A 4CAVA 4AVCA 2AE6A 3BJ7A 3TE4A 1QSRA 2AJ6A 3MGDA 2Z10A 3VWDA 1B87A 4CYOA 3SXOA 4CAEA 1XIXA 1PU9A 2Q4VA 2Z0ZA 3T90A 4CGNA 4JWPA 3W91A 4CAXA 5A28A 4AVBA 3PP9A 2REFA 2YNCA 2ZPAA 3TO9A 4A32A 4UFWA 2JLMA 2VBQA 3LD2A 4PK3A 2NMTA 4IUSA 1S60A 3TCVA 2QMLA 2Z3KA 4QC6A 4R3KA 4UWJA 1S5KA 4KVXA 5JQ4A 1Z4RA 3FB3A 4X5KA 1B6BA 4E8OA 5KTCA 1QSMA 4GS4A 2HQYA 3D3SA 4R3LA 3A9LA 2C27A 4MFLA 4CAWA 4FD7A 3V8IA 3F8KA 1S7KA 5KTDA 1N71A 3G3SA 2WUUA 4YRHA 3H5ZA 2B5GB 2CY2A 3OWCA 4NF1A 4JD6A 1ON0A 2ATRA 2ZW4A 3D2PA 2BUEA 2VI7A 1M1DA 1M4GA 4FD4A 2CXAA 4IF5A 2VEZA 3IU2A 1L0CA 4MFZA 3I3GA 4Q36A 3UY5A 5DWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2A A;  4F6A A;  4MY3 A;  4KLW A;  3JUW A;  4HKF A;  4NEX A;  1VKC A;  3EXN A;  4KUB A;  2B5G A;  5KTA A;  2VQY A;  2Z11 A;  4UBR A;  2Q4Y A;  3EFA A;  4AG9 A;  1P0H A;  2I00 A;  4KZT A;  3S6K A;  1IB1 E;  2J8M A;  4MI4 A;  4ONU A;  1U6M A;  2FXF A;  4R9M A;  4BMH A;  1MJ9 A;  2ZW7 A;  2PR1 A;  2B3U A;  1IID A;  1VHS A;  3R9G A;  2JDD A;  5E96 A;  3W6S A;  2HUZ A;  1YLE A;  5F46 A;  4H89 A;  2REE A;  3RYO A;  4QUS A;  1KUV A;  2Q0Y A;  4KOR A;  5ISV A;  3IWG A;  3F0A A;  2B4D B;  4MBU A;  1KZF A;  5EC4 A;  4L8A A;  2J8R A;  3TOB A;  4XPL A;  2OZU A;  3CXQ A;  4R87 A;  2F5I A;  2EUI A;  2HV2 A;  3CXS A;  3TOA A;  2ZW5 A;  1XMT A;  3FBU A;  3DDD A;  5F49 A;  4B5O A;  4XPD C;  3FIX A;  1GHE A;  2B3V A;  1KUX A;  1IIC A;  2VXK A;  4E0A A;  1I1D A;  2BEI A;  4UA3 A;  3SXN A;  2PC1 A;  2FIA A;  3QAH A;  4XPK A;  5C82 A;  4PK2 A;  1S7L A;  2PSW A;  2B4D A;  1CJW A;  1RXT A;  2J8N A;  1K4J A;  2K5T A;  4AVA A;  1TIQ A;  2H5M A;  5I0C A;  2VZZ A;  1Y9K A;  4F0Y A;  2R8V A;  4OAD A;  4NSQ A;  4QVT A;  1MJA A;  3TTH A;  3E0K A;  3LOD A;  3SHP A;  3P2F A;  3F5B A;  1NE9 A;  2D4P A;  3ZZI A;  1M44 A;  1PUA A;  2IL4 A;  3D8P A;  4U9Y A;  2EVN A;  2JEV A;  3GY9 A;  2Y0M A;  2DXQ A;  1MJB A;  1J4J A;  2P6G A;  2P0W A;  1SQH A;  4JJX A;  2FIW A;  3R1K A;  5EBV A;  4UWI A;  4ZBG A;  2FE7 A;  4JLY A;  5CNP A;  1YVO A;  4CS0 B;  2OH1 A;  4XNH C;  5FVJ A;  1M4D A;  2WPX A;  4OAE A;  3WR7 A;  3D2M A;  1IYL A;  3B8G A;  1Z9U A;  5DWN A;  2G0B A;  3C26 A;  1IYK A;  2PDO A;  3BLN A;  4HNX B;  1P4N A;  4LX9 A;  4K30 A;  3FYN A;  4B5P A;  5J8F A;  3P2H A;  1Y7R A;  2ZW6 A;  4HNW B;  3VWE A;  2QEC A;  4M85 A;  3GKR A;  5J8C A;  4JXQ A;  5IB0 A;  3FRM A;  2BL1 A;  3TT2 A;  5HMN A;  4Y49 C;  1UFH A;  2OZG A;  3KKW A;  3DR6 A;  4L89 A;  4PSX A;  2ARH A;  1Y9W A;  4AB7 A;  4J3G A;  5GCN A;  5H84 A;  2FL4 A;  4FD6 A;  4KOS A;  1YGH A;  2CNS A;  2X7B A;  2GAN A;  2O28 A;  4U5Y A;  3ZJ0 A;  1YVK A;  4M3S A;  1YR0 A;  3TO7 A;  1FY7 A;  3GYA A;  3R9E A;  4RS2 A;  1Q2Y A;  5H86 A;  1I21 A;  4KOY A;  5C88 A;  3NE7 A;  4CRZ B;  2FS5 A;  1RO5 A;  4KVO E;  3EC4 A;  4LUA A;  4OLL A;  2RC4 A;  3CXP A;  3PZJ A;  4NXY A;  1I12 A;  4YFJ A;  2PR8 A;  3R96 A;  4YGO A;  2CNM A;  4DNC A;  1XE4 A;  3S6H A;  2G3A A;  1LRZ A;  1QSN A;  1OZP A;  1S3Z A;  4I49 A;  4KOV A;  1WWZ A;  2Q04 A;  1QST A;  3R9F A;  2VZY A;  3TFY A;  4FD5 A;  4NCZ A;  1Q2D A;  4EVY A;  4KOU A;  4KLV A;  2BSW A;  2D4O A;  2JDC A;  4MJ8 A;  2P6F A;  4XPD B;  4KOW A;  4U9Z A;  4PSW A;  2OZH A;  3PGP A;  4HNY B;  3DSB A;  3K9U A;  3IGR A;  4H6U A;  2B58 A;  4KOT A;  3FNC A;  1V0C A;  4B5P B;  1NSL A;  2I79 A;  2ZXV A;  1S7F A;  4RI1 A;  2QIR A;  3G8W A;  1YRE A;  4KOX A;  2FSR A;  2Q7B A;  2PQ8 A;  5JPH A;  1Q2C A;  3EO4 A;  4H6Z A;  4PV6 A;  1BOB A;  5F47 A;  4AG7 A;  1XEB A;  1M4I A;  4MHD A;  3S6G A;  3DR8 A;  1KUY A;  3R95 A;  2KCW A;  3DNS A;  3EY5 A;  4CRY B;  5IX3 A;  2PRB A;  1BO4 A;  2OB0 A;  1CM0 A;  1YK3 A;  4KUA A;  4QB9 A;  4XNH B;  3W6X A;  1R57 A;  1Z4E A;  2GE3 A;  3JVN A;  2FCK A;  2R7H A;  2B4B A;  2GIV A;  3FXT A;  4MY0 A;  1WK4 A;  5F48 A;  2WPW A;  2R98 A;  2Q44 A;  1XF8 A;  2CNT A;  5IV0 A;  3N7Z A;  4KVM E;  4II9 A;  3H4Q A;  2R1I A;  1NMT A;  3BJ8 A;  4ORF A;  5HH1 A;  2P6E A;  4QBJ A;  3S6F A;  2A4N A;  1S7N A;  4JXR A;  2G3T A;  2OU2 A;  1QSO A;  3TO6 A;  1YX0 A;  3QB8 A;  4Y49 B;  1MK4 A;  3I9S A;  4R57 A;  3T9Y A;  2FT0 A;  4CAV A;  4AVC A;  2AE6 A;  3BJ7 A;  3TE4 A;  1QSR A;  2AJ6 A;  3MGD A;  2Z10 A;  3VWD A;  1B87 A;  3SXO A;  1XIX A;  1PU9 A;  2Q4V A;  2Z0Z A;  3T90 A;  4JWP A;  3W91 A;  4CAX A;  4AVB A;  3PP9 A;  2REF A;  2ZPA A;  3TO9 A;  2JLM A;  2VBQ A;  3LD2 A;  4PK3 A;  2NMT A;  4IUS A;  1S60 A;  3TCV A;  2QML A;  4QC6 A;  4R3K A;  4UWJ A;  1S5K A;  4KVX A;  5JQ4 A;  1Z4R A;  3FB3 A;  4X5K A;  1B6B A;  4E8O A;  5KTC A;  1QSM A;  4GS4 A;  2HQY A;  3D3S A;  4R3L A;  2C27 A;  4CAW A;  4FD7 A;  3V8I A;  3F8K A;  1S7K A;  5KTD A;  1N71 A;  3G3S A;  4YRH A;  2B5G B;  2CY2 A;  3OWC A;  4NF1 A;  4JD6 A;  1ON0 A;  2ATR A;  2ZW4 A;  3D2P A;  2BUE A;  2VI7 A;  1M1D A;  1M4G A;  4FD4 A;  4IF5 A;  2VEZ A;  1L0C A;  3I3G A;  3UY5 A;  5DWM A; 
#chains in the Genus database with same CATH topology
 3ISX A;  1JQG A;  4E2A A;  4F6A A;  4B6Z A;  1UWY A;  4MY3 A;  4F0X A;  3KI9 A;  2GLF A;  1CPS A;  4KLW A;  1ARL A;  4UF4 A;  1TF8 A;  3JUW A;  4M6H A;  1QQ9 A;  1Y0Y A;  4HKF A;  4NEX A;  1VKC A;  3EXN A;  4KUB A;  2B5G A;  5KTA A;  2VQY A;  2Z11 A;  5DS0 A;  4YWY A;  4B11 A;  4UBR A;  2ZOF A;  2Q4Y A;  3EFA A;  4AG9 A;  3KQZ A;  1P0H A;  2I00 A;  4KZT A;  2V8V A;  2ABZ A;  3S6K A;  1IB1 E;  2J8M A;  1PYT B;  1F57 A;  4MI4 A;  1TKF A;  2JBK A;  4ONU A;  2BCO A;  1U6M A;  2FXF A;  1OBR A;  3TOA A;  4TNU A;  4R9M A;  4BMH A;  1MJ9 A;  2G9D A;  2F8H A;  3B3V A;  3IC1 A;  2ZW7 A;  2CF4 A;  2PR1 A;  5LYD A;  4C7I A;  2B3U A;  1IID A;  4MFJ A;  1VHS A;  4LQ6 A;  3R9G A;  4CYQ A;  2JDD A;  3KGQ A;  5EMI A;  1ZG8 A;  4W9Y A;  2ANP A;  5E96 A;  4X2T A;  3CPA A;  3W6S A;  2HUZ A;  1YLE A;  3D7H A;  4H89 A;  4CAF A;  3VH9 A;  5F46 A;  2PCU A;  2REE A;  5D29 A;  1CP6 A;  5HXD A;  4UIA A;  3FEC A;  1HDU A;  2OOT A;  3RYO A;  4NGT A;  3B3C A;  1KWM A;  3GUX A;  3CDX A;  4QUS A;  1R3N A;  4A95 A;  1KUV A;  2Q0Y A;  4ZY2 A;  2V77 A;  4OC0 A;  4KOR A;  2PVV A;  1F2O A;  4P4D A;  5ISV A;  3IWG A;  4C68 A;  2EWB A;  3F0A A;  2DPT A;  3QAY A;  4GXH A;  2B4D B;  4MBU A;  1KZF A;  3D66 A;  7CPA A;  3WAB A;  4OIW A;  5EC4 A;  4L8A A;  3SJG A;  4Z65 A;  4P4F A;  5JGF A;  5LYF A;  4R6T A;  2J8R A;  3B35 A;  3TOB A;  4XPL A;  1XRY A;  1GYT A;  3IIB A;  2JBJ A;  2PRQ A;  3BXM A;  3PB9 X;  2C6C A;  4M6G A;  4NJQ A;  2HC9 A;  1Q7L A;  2OZU A;  3CXQ A;  1TKJ A;  3RAM A;  1X12 A;  2GLJ A;  3IJ3 A;  4R87 A;  2F5I A;  2EUI A;  2HV2 A;  3PB6 X;  3CXS A;  1M4L A;  2ZW5 A;  1XMT A;  3B7I A;  3D7D A;  1EE3 P;  2QJ8 A;  3NFZ A;  3FBU A;  3IWE A;  3DDD A;  5LYI A;  5F49 A;  4B5O A;  4XPD C;  1HEE A;  3FIX A;  1AYE A;  4MRI A;  1IOF A;  1GHE A;  4A33 A;  2B3V A;  5F09 A;  3WC6 A;  1KUX A;  1IIC A;  2VXK A;  4PXB A;  4E0A A;  1I1D A;  2BEI A;  4UA3 A;  3IEH A;  3SXN A;  4CGM A;  1VHO A;  2PC1 A;  2FIA A;  3QAH A;  4B13 A;  4XPK A;  5C82 A;  4PK2 A;  1S7L A;  3KQX A;  2PSW A;  2B4D A;  2PE3 A;  1CJW A;  1RXT A;  2J8N A;  2Z3P A;  1LAN A;  2RFH A;  1K4J A;  2K5T A;  1CX8 A;  4AVA A;  1TIQ A;  4UCM A;  2H5M A;  2GRE A;  5CPA A;  5I0C A;  2VZZ A;  1Y9K A;  4OP4 A;  4F0Y A;  4ZX9 A;  2R8V A;  2YGW A;  4OAD A;  4NSQ A;  1YSJ A;  4QVT A;  4C2Y A;  1MJA A;  1LOK A;  4Q38 A;  3TTH A;  5G22 A;  3E0K A;  3LOD A;  3BI0 A;  4MFQ A;  3SHP A;  3P2F A;  2WZN A;  3F5B A;  1NE9 A;  4KSA A;  2D4P A;  2C6G A;  2ZEM A;  3ZZI A;  1M44 A;  1PUA A;  2IL4 A;  3D8P A;  1R43 A;  4U9Y A;  2HB6 A;  4DUK A;  3NA6 A;  2EVN A;  3SJX A;  2JEV A;  1TXR A;  3GY9 A;  2Y0M A;  2DXQ A;  1MJB A;  1J4J A;  2P6G A;  4NGM A;  4NGN A;  2P0W A;  1SQH A;  4P4I A;  4JJX A;  3GLJ A;  2FIW A;  1TKH A;  3KL9 A;  3QNV A;  3R1K A;  4HPS A;  4UWI A;  4P4J A;  5EBV A;  4ZBG A;  4F9V A;  2FE7 A;  5G20 A;  4JLY A;  3KHZ A;  4KS9 A;  5CNP A;  4UFX A;  1ZLH A;  2EK9 A;  1YVO A;  4C2X A;  3S9N A;  5K8O A;  4CS0 B;  2OH1 A;  4ZY0 A;  5J1Q A;  2BO9 A;  4XNH C;  1Z5R A;  4IK2 A;  5FVJ A;  1M4D A;  4H2K A;  5LRG A;  2WPX A;  2Z3L A;  1DTD A;  3SI1 A;  4OAE A;  3WR7 A;  3D7F A;  4B12 A;  3D2M A;  1IYL A;  4ZY1 A;  3B8G A;  1Z9U A;  5DWN A;  4FUU A;  2G0B A;  4NGQ A;  3C26 A;  1IYK A;  2PDO A;  3T8W A;  3BLN A;  1AUG A;  1VIX A;  4HNX B;  1ELL P;  1P4N A;  4LX9 A;  4P45 A;  4UCP A;  3KR5 A;  1Y0R A;  4MMO A;  1LAP A;  4K30 A;  2ZEF A;  3FYN A;  4PXE A;  4EFD A;  4MHP A;  4FAI A;  2AFM A;  4B5P A;  4PPZ A;  5AG5 A;  3H8F A;  4KSI A;  5J8F A;  4ZGY B;  1NSA A;  3B2Y A;  3P2H A;  5LRJ A;  2RB7 A;  1Y7R A;  2ZW6 A;  4HNW B;  2ZED A;  4UIB A;  2ZEP A;  4KSF A;  3VWE A;  2QEC A;  1ZO0 A;  4M85 A;  3SJE A;  1IOI A;  4GM5 A;  3GKR A;  4CGO A;  4A30 A;  3MN8 A;  5J8C A;  2O4H A;  4JXQ A;  5ELY A;  5IB0 A;  2XEG A;  3B3W A;  2PJ4 A;  4UCN A;  4B14 A;  3FRM A;  2BL1 A;  3TT2 A;  1YW6 A;  4A31 A;  4Y49 C;  1UFH A;  2OZG A;  2PJA A;  3WT4 A;  4CPA A;  4EWT A;  1LFW A;  3KKW A;  3DR6 A;  4L89 A;  1LAM A;  4PSX A;  2PJ7 A;  2Z3N A;  2ARH A;  1Y9W A;  3KZW A;  4J3G A;  2PJ3 A;  4AB7 A;  5GCN A;  5H84 A;  4BBH A;  4OC2 A;  3SJF A;  4UEZ A;  2FL4 A;  4FD6 A;  4KOS A;  1YGH A;  1Z2L A;  2CNS A;  2GU2 A;  2Q4Z A;  1XBU A;  2X7B A;  4TWE A;  2GAN A;  2O28 A;  4PXD A;  4U5Y A;  3ZJ0 A;  4FWU A;  1YVK A;  4M3S A;  4R7M A;  2AFZ A;  1YR0 A;  2WYR A;  3TO7 A;  3PRT A;  3DLJ A;  1FY7 A;  5LRK A;  3GYA A;  3R9E A;  4RS2 A;  4MFK A;  1Q2Y A;  2CTC A;  5H86 A;  4CYP A;  2PJ8 A;  1I21 A;  4KOY A;  4C7H A;  5C88 A;  5THW A;  3NE7 A;  2POK A;  2XEJ A;  4CRZ B;  2FS5 A;  1RO5 A;  1Z8X A;  3V38 A;  5AGE A;  4KVO E;  3EC4 A;  2ZEE A;  4LUA A;  4OLL A;  2RC4 A;  3CXP A;  3NH5 A;  2YND A;  1CPX A;  2J9A A;  2I3C A;  3PZJ A;  5JH9 A;  3PFO A;  4NXY A;  2PJ9 A;  4LQG A;  4BD9 A;  3B3T A;  5HMN A;  3S9M A;  2NSM A;  1I12 A;  4YFJ A;  2PR8 A;  3V7Z A;  4NFR A;  6CPA A;  3TC8 A;  3R96 A;  4YGO A;  2CNM A;  4UFV A;  1LCP A;  3KHX A;  1XE4 A;  4DNC A;  3D7G A;  2BOA A;  3S6H A;  4ONW A;  2G3A A;  1LRZ A;  1QSN A;  3D68 A;  1OZP A;  4OC4 A;  3K2K A;  5LYL A;  1RTQ A;  1S3Z A;  3KR4 A;  3JRU A;  3HUV A;  5D8N A;  4I49 A;  5G1Z A;  4KOV A;  5HVG A;  4OC3 A;  1WWZ A;  3BHX A;  2Q04 A;  1QST A;  1VGY A;  3FED A;  3R9F A;  2VZY A;  3PFE A;  4CYN A;  4OKO A;  3D67 A;  4FD5 A;  4MHY A;  3TFY A;  4ZX8 A;  5I4M A;  2PIZ A;  1TF9 A;  4NCZ A;  1Q2D A;  3D4U A;  4A94 A;  4EVY A;  2DF5 A;  2EO8 A;  4NGS A;  4KOU A;  3NH8 A;  4KLV A;  1CG2 A;  2BSW A;  2D4O A;  2JDC A;  2Z3M A;  2P6F A;  4MJ8 A;  1ARM A;  4XPD B;  4KOW A;  2DEA A;  4PSW A;  4U9Z A;  5K8N A;  2OZH A;  1A2Z A;  3L2N A;  3PGP A;  4HNY B;  4OC1 A;  4B10 A;  1ZG7 A;  1CP7 A;  3DSB A;  3K9U A;  3IGR A;  4H6U A;  2B58 A;  1XJO A;  2PIY A;  2YNE A;  4KOT A;  4P6Y A;  3FNC A;  1V0C A;  4B5P B;  3PBE A;  1ELM P;  1NSL A;  4IHM A;  3IWW A;  1F2P A;  4P4B A;  4A2Z A;  4CGL A;  2I79 A;  3IU1 A;  2AFO A;  2ZXV A;  2EBJ A;  2NYQ A;  1S7F A;  4RI1 A;  2QIR A;  2F7V A;  3JTK A;  3G8W A;  1YRE A;  3PEI A;  4KOX A;  3NE8 A;  2FSR A;  1BLL E;  4YU9 A;  2ZEG A;  2CIJ A;  2Q7B A;  2PQ8 A;  5AG6 A;  5JPH A;  3LMS A;  3RBU A;  1Q2C A;  3EO4 A;  4H6Z A;  4PV6 A;  4ZYQ A;  5K8M A;  4IAV A;  1BOB A;  5F47 A;  2PVW A;  4AG7 A;  2PJ6 A;  1XEB A;  4MXU A;  3S9L A;  1M4I A;  4MFP A;  4MHD A;  3S6G A;  4OID A;  2IQ6 A;  2Z3O A;  3FJU A;  1Z8T A;  3DR8 A;  1XFO A;  2Q43 A;  1KUY A;  3R95 A;  4M6I A;  4A39 A;  2KCW A;  3DNS A;  4C2Z A;  3EY5 A;  4CRY B;  5IX3 A;  2IMO A;  3RZA A;  4K3N A;  4WJB A;  1PCA A;  2EK8 A;  1BO4 A;  2PRB A;  2QYV A;  2Q7S A;  2PJC A;  2OB0 A;  1BAV A;  3SI2 A;  1CM0 A;  1XMB A;  1YK3 A;  2YNC C;  3GB0 A;  4KUA A;  1R57 A;  1Z4E A;  4QB9 A;  4XNH B;  5AG7 A;  2GE3 A;  3JVN A;  4NGR A;  2FCK A;  2R7H A;  5BWA B;  2B4B A;  5G21 A;  1HDQ A;  2GIV A;  3CT9 A;  3FXT A;  1WK4 A;  4MY0 A;  4R76 A;  2WPW A;  5F48 A;  4A38 A;  5HVH A;  3N5F A;  5AG4 A;  2R98 A;  8CPA A;  3B3S A;  1FT7 A;  4UEE A;  5A27 A;  2Q44 A;  3PB7 X;  4MCR A;  2ZEN A;  2XEF A;  1XF8 A;  2CNT A;  4AXV A;  5IV0 A;  3N7Z A;  4RN7 A;  4KVM E;  4II9 A;  3H4Q A;  2R1I A;  1NMT A;  3BJ8 A;  4ORF A;  2XEI A;  1JWQ A;  1YW4 A;  5HH1 A;  1FNO A;  2P6E A;  4NGP A;  4UEF A;  2AFX A;  4CGP A;  4MCS A;  4QBJ A;  3S6F A;  3LAC A;  2A4N A;  2PJ5 A;  2AFW A;  5K8P A;  1S7N A;  4JXR A;  2G3T A;  1ZLI A;  2OU2 A;  2Q51 A;  1QSO A;  4P4E A;  1YX0 A;  3TO6 A;  3H8E A;  3QB8 A;  2V8H A;  2VL1 A;  2DPS A;  4Y49 B;  1MK4 A;  3I9S A;  3SI0 A;  2ZOG A;  1CBX A;  2WSA A;  4R57 A;  5HVF A;  3T9Y A;  4OME A;  2FT0 A;  3FX6 A;  4CAV A;  4AVC A;  2AE6 A;  3BJ7 A;  3TE4 A;  3RNZ A;  1QSR A;  2AJ6 A;  3MGD A;  2Z10 A;  3VWD A;  1B87 A;  4CYO A;  4X8I A;  1ZG9 A;  4ZI6 A;  4F8Z A;  4R8F A;  3SXO A;  3WC7 A;  1PU9 A;  1XIX A;  2Q4V A;  2Z0Z A;  4CAE A;  3T90 A;  3VAR A;  4CGN A;  3FF3 A;  4JWP A;  3W91 A;  2IJZ A;  1YME A;  4CAX A;  5A28 A;  4AVB A;  3PP9 A;  1H8L A;  3KAS A;  2REF A;  2YNC A;  4JZ0 A;  4MHN A;  1QMU A;  2ZPA A;  4X3R A;  4DJL A;  3TO9 A;  2PJ1 A;  1VHE A;  4A32 A;  5CBM A;  4UFW A;  2JLM A;  2VBQ A;  3LD2 A;  4PK3 A;  2V8G A;  1YQE A;  2NMT A;  3HLP A;  4IUS A;  3IFE A;  3I1U A;  2GFQ A;  1S60 A;  3PB8 X;  3TCV A;  5JM6 A;  2QML A;  3CPX A;  1YLO A;  2Z3K A;  4QC6 A;  4R3K A;  4UWJ A;  4MCQ A;  1S5K A;  4KVX A;  5JQ4 A;  3TX8 A;  1Z4R A;  4MHZ A;  3FB3 A;  4X5K A;  1B6B A;  3BI1 A;  4E8O A;  1DE4 C;  5KTC A;  1QSM A;  1IGB A;  4GS4 A;  2AFS A;  3VAT A;  2HQY A;  3FMC A;  4RUH A;  4EME A;  3CZX A;  1AMP A;  3D3S A;  2PJB A;  4O23 A;  4A37 A;  4R3L A;  4Q7A A;  3FH4 A;  3A9L A;  2C27 A;  2ZEO A;  4OC5 A;  1BPM A;  1Z8L A;  4FBE A;  4MFL A;  1IY7 A;  4MCP A;  4CAW A;  4FD7 A;  2QVP A;  3V8I A;  4BIN A;  3F8K A;  1BPN A;  1S7K A;  5KTD A;  2V8D A;  1N71 A;  2OR4 A;  3LWU A;  4G1P A;  4PQA A;  2PJ2 A;  4P10 A;  3WC5 A;  3G3S A;  2CTB A;  2WUU A;  3IO1 A;  3MRU A;  4YRH A;  3PBB A;  2AFU A;  2PJ0 A;  3H5Z A;  2B5G B;  4DYO A;  2CY2 A;  3DGV A;  3W6X A;  3OWC A;  3RO0 A;  4NF1 A;  3NH4 A;  2C1C A;  3FVL A;  4JD6 A;  5IB9 A;  2FVG A;  1ON0 A;  2ATR A;  2ZW4 A;  2ZEL A;  4JYW A;  2C6P A;  3D2P A;  2JEW A;  4P44 A;  1Z8W A;  2BUE A;  1IU8 A;  2ZEH A;  1X10 A;  2VI7 A;  1M1D A;  1M4G A;  4FD4 A;  4WWV A;  2CXA A;  4IF5 A;  3PB4 X;  2VEZ A;  4NJR A;  3IU2 A;  1L0C A;  4MFZ A;  1XOV A;  3I3G A;  4Q36 A;  3ISZ A;  4F9U A;  4PXC A;  3UY5 A;  3FEE A;  5DWM A;  3GIU A;  3K9T A;  1Y7E A;  3H8G A;  2ODF A;  2O53 A; 
#chains in the Genus database with same CATH homology
 4E2A A;  4F6A A;  4MY3 A;  4F0X A;  4KLW A;  3JUW A;  4HKF A;  4NEX A;  1VKC A;  3EXN A;  4KUB A;  2B5G A;  5KTA A;  2VQY A;  2Z11 A;  4B11 A;  4UBR A;  2Q4Y A;  3EFA A;  4AG9 A;  1P0H A;  2I00 A;  4KZT A;  3S6K A;  1IB1 E;  2J8M A;  4MI4 A;  4ONU A;  1U6M A;  2FXF A;  4R9M A;  4BMH A;  1MJ9 A;  2ZW7 A;  2PR1 A;  4C7I A;  2B3U A;  1IID A;  4MFJ A;  1VHS A;  3R9G A;  4CYQ A;  2JDD A;  5E96 A;  3W6S A;  2HUZ A;  1YLE A;  4CAF A;  4H89 A;  5F46 A;  2REE A;  3RYO A;  4A95 A;  4QUS A;  1KUV A;  2Q0Y A;  4KOR A;  5ISV A;  3IWG A;  4C68 A;  3F0A A;  2DPT A;  2B4D B;  4MBU A;  1KZF A;  5EC4 A;  4L8A A;  2J8R A;  3TOB A;  4XPL A;  2OZU A;  3CXQ A;  4R87 A;  2F5I A;  2EUI A;  2HV2 A;  3CXS A;  3TOA A;  2ZW5 A;  1XMT A;  3FBU A;  3IWE A;  3DDD A;  5F49 A;  4B5O A;  4XPD C;  3FIX A;  4A33 A;  1GHE A;  2B3V A;  1KUX A;  1IIC A;  2VXK A;  4E0A A;  1I1D A;  2BEI A;  4UA3 A;  3SXN A;  4CGM A;  2PC1 A;  2FIA A;  3QAH A;  4B13 A;  4XPK A;  5C82 A;  4PK2 A;  1S7L A;  2PSW A;  2B4D A;  2Z3P A;  1CJW A;  1RXT A;  2J8N A;  1K4J A;  2K5T A;  4AVA A;  1TIQ A;  4UCM A;  2H5M A;  5I0C A;  2VZZ A;  1Y9K A;  4F0Y A;  2R8V A;  2YGW A;  4OAD A;  4NSQ A;  4QVT A;  4C2Y A;  1MJA A;  4Q38 A;  3TTH A;  5G22 A;  3E0K A;  3LOD A;  4MFQ A;  3SHP A;  3P2F A;  3F5B A;  4KSA A;  1NE9 A;  2D4P A;  3ZZI A;  1M44 A;  1PUA A;  2IL4 A;  3D8P A;  4U9Y A;  2EVN A;  2JEV A;  3GY9 A;  2Y0M A;  2DXQ A;  1MJB A;  1J4J A;  2P6G A;  2P0W A;  1SQH A;  4JJX A;  2FIW A;  3R1K A;  5EBV A;  4UWI A;  4ZBG A;  2FE7 A;  5G20 A;  4JLY A;  4KS9 A;  5CNP A;  4UFX A;  4C2X A;  1YVO A;  4CS0 B;  2OH1 A;  4XNH C;  5FVJ A;  1M4D A;  2WPX A;  2Z3L A;  4OAE A;  3WR7 A;  4B12 A;  3D2M A;  1IYL A;  3B8G A;  1Z9U A;  5DWN A;  2G0B A;  3C26 A;  1IYK A;  2PDO A;  3BLN A;  4HNX B;  1P4N A;  4LX9 A;  4UCP A;  4K30 A;  3FYN A;  4B5P A;  5J8F A;  4ZGY B;  3P2H A;  1Y7R A;  2ZW6 A;  4HNW B;  4KSF A;  3VWE A;  2QEC A;  1ZO0 A;  4M85 A;  3GKR A;  4CGO A;  4A30 A;  5J8C A;  4JXQ A;  5IB0 A;  4UCN A;  4B14 A;  3FRM A;  2BL1 A;  3TT2 A;  5HMN A;  4A31 A;  4Y49 C;  1UFH A;  2OZG A;  3KKW A;  3DR6 A;  4L89 A;  4PSX A;  2Z3N A;  2ARH A;  1Y9W A;  4AB7 A;  4J3G A;  5GCN A;  5H84 A;  4BBH A;  2FL4 A;  4FD6 A;  4KOS A;  1YGH A;  2CNS A;  2X7B A;  2GAN A;  2O28 A;  4U5Y A;  3ZJ0 A;  1YVK A;  4M3S A;  1YR0 A;  3TO7 A;  1FY7 A;  3GYA A;  3R9E A;  4RS2 A;  4MFK A;  1Q2Y A;  5H86 A;  4CYP A;  4C7H A;  1I21 A;  4KOY A;  5C88 A;  3NE7 A;  4CRZ B;  2FS5 A;  1RO5 A;  5AGE A;  4KVO E;  3EC4 A;  4LUA A;  4OLL A;  2RC4 A;  3CXP A;  2YND A;  3PZJ A;  4NXY A;  1I12 A;  4YFJ A;  2PR8 A;  3R96 A;  4YGO A;  2CNM A;  4UFV A;  4DNC A;  1XE4 A;  3S6H A;  2G3A A;  1LRZ A;  1QSN A;  1OZP A;  1S3Z A;  4I49 A;  5G1Z A;  4KOV A;  1WWZ A;  2Q04 A;  1QST A;  3R9F A;  2VZY A;  4CYN A;  3TFY A;  4FD5 A;  4NCZ A;  1Q2D A;  4EVY A;  4KOU A;  4KLV A;  2BSW A;  2D4O A;  2JDC A;  2Z3M A;  2P6F A;  4MJ8 A;  4XPD B;  4KOW A;  4U9Z A;  4PSW A;  2OZH A;  4B10 A;  3PGP A;  4HNY B;  3DSB A;  3K9U A;  3IGR A;  4H6U A;  2B58 A;  2YNE A;  4KOT A;  3FNC A;  1V0C A;  4B5P B;  1NSL A;  4A2Z A;  4CGL A;  2I79 A;  3IU1 A;  2ZXV A;  1S7F A;  4RI1 A;  2QIR A;  3JTK A;  3G8W A;  1YRE A;  4KOX A;  2FSR A;  2Q7B A;  2PQ8 A;  5AG6 A;  5JPH A;  1Q2C A;  3EO4 A;  4H6Z A;  4PV6 A;  1BOB A;  5F47 A;  4AG7 A;  1XEB A;  1M4I A;  4MFP A;  4MHD A;  3S6G A;  2Z3O A;  3DR8 A;  1KUY A;  3R95 A;  2KCW A;  3DNS A;  4C2Z A;  3EY5 A;  4CRY B;  5IX3 A;  2PRB A;  1BO4 A;  2OB0 A;  1CM0 A;  1YK3 A;  2YNC C;  4KUA A;  4QB9 A;  4XNH B;  1R57 A;  1Z4E A;  5AG7 A;  5AG5 A;  3W6X A;  2GE3 A;  3JVN A;  2FCK A;  2R7H A;  5BWA B;  2B4B A;  5G21 A;  2GIV A;  3FXT A;  4MY0 A;  1WK4 A;  5F48 A;  2WPW A;  5AG4 A;  2R98 A;  5A27 A;  2Q44 A;  1XF8 A;  2CNT A;  5IV0 A;  3N7Z A;  4KVM E;  4II9 A;  3H4Q A;  2R1I A;  1NMT A;  3BJ8 A;  4ORF A;  5HH1 A;  2P6E A;  4CGP A;  4QBJ A;  3S6F A;  2A4N A;  1S7N A;  4JXR A;  2G3T A;  2OU2 A;  1QSO A;  3TO6 A;  1YX0 A;  3QB8 A;  2DPS A;  4Y49 B;  1MK4 A;  3I9S A;  2WSA A;  4R57 A;  3T9Y A;  2FT0 A;  4CAV A;  4AVC A;  2AE6 A;  3BJ7 A;  3TE4 A;  1QSR A;  2AJ6 A;  3MGD A;  2Z10 A;  3VWD A;  1B87 A;  4CYO A;  3SXO A;  4CAE A;  1XIX A;  1PU9 A;  2Q4V A;  2Z0Z A;  3T90 A;  4CGN A;  4JWP A;  3W91 A;  4CAX A;  5A28 A;  4AVB A;  3PP9 A;  2REF A;  2YNC A;  2ZPA A;  3TO9 A;  4A32 A;  4UFW A;  2JLM A;  2VBQ A;  3LD2 A;  4PK3 A;  2NMT A;  4IUS A;  1S60 A;  3TCV A;  2QML A;  2Z3K A;  4QC6 A;  4R3K A;  4UWJ A;  1S5K A;  4KVX A;  5JQ4 A;  1Z4R A;  3FB3 A;  4X5K A;  1B6B A;  4E8O A;  5KTC A;  1QSM A;  4GS4 A;  2HQY A;  3D3S A;  4R3L A;  3A9L A;  2C27 A;  4MFL A;  4CAW A;  4FD7 A;  3V8I A;  3F8K A;  1S7K A;  5KTD A;  1N71 A;  3G3S A;  2WUU A;  4YRH A;  3H5Z A;  2B5G B;  2CY2 A;  3OWC A;  4NF1 A;  4JD6 A;  1ON0 A;  2ATR A;  2ZW4 A;  3D2P A;  2BUE A;  2VI7 A;  1M1D A;  1M4G A;  4FD4 A;  2CXA A;  4IF5 A;  2VEZ A;  3IU2 A;  1L0C A;  4MFZ A;  3I3G A;  4Q36 A;  3UY5 A;  5DWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...