3E0KA

Crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
148
structure length
146
Chain Sequence
AEQVRQAGIDDIGGILELIHPLEEQGILRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYNFRKSKILALDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amino-acid acetyltransferase
publication title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transferase
total genus 33
structure length 146
sequence length 148
ec nomenclature ec 2.3.1.1: Amino-acid N-acetyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3e0kA00
5HMNA 3D8PA 2H5MA 3EXNA 5F48A 1WWZA 2K5TA 3DDDA 3JVNA 2Q4VA 1OZPA 1MK4A 2BUEA 3DNSA 3T90A 3IWGA 2J8MA 2VZZA 4AVBA 2I79A 4X5KA 4II9A 4QB9A 3FB3A 2PQ8A 4FD5A 4B5OA 1FY7A 3S6GA 2OZGA 4OAEA 2G0BA 4Y49B 2Q7BA 1U6MA 4KOWA 1PU9A 3GKRA 5CNPA 1BOBA 1Z9UA 2PRBA 2ZXVA 3PGPA 3K9UA 4UWJA 2ZW5A 4MY0A 4KVXA 1I12A 4XPDB 2Q0YA 5ISVA 3DSBA 4XPLA 2Y0MA 4PK2A 4B5PB 4AG7A 2FIWA 3SHPA 2ZW4A 3TOAA 4L89A 3F0AA 4RI1A 3G3SA 4GS4A 4R3LA 3R95A 2P6FA 4E0AA 1Q2YA 2GIVA 4PSXA 2VI7A 5IB0A 2P6GA 3UY5A 3V8IA 4XPKA 2F5IA 2KCWA 4KOUA 4H6UA 5KTAA 1MJAA 3FBUA 2VBQA 2FS5A 3R9FA 1YK3A 3S6KA 2X7BA 1YREA 3E0KA 1B87A 3QB8A 3H4QA 2VQYA 2J8NA 1NSLA 4CRYB 2P6EA 3DR8A 4NF1A 2VXKA 2QIRA 4NXYA 1VHSA 3I3GA 2OU2A 2OB0A 2G3TA 4QBJA 5KTCA 2ZPAA 2D4OA 4CS0B 2BSWA 5F46A 1QSRA 2PSWA 5F49A 3TE4A 1TIQA 2WPXA 3LD2A 2REFA 1QSMA 2Z10A 2JDDA 2I00A 1S7LA 4JD6A 3BJ7A 3FIXA 3RYOA 4KZTA 2AJ6A 3W6SA 4CAWA 4H89A 4OADA 4HKFA 1QSTA 3PZJA 4CRZB 4F0YA 3EFAA 3EY5A 2OZHA 3GY9A 2Z0ZA 2IL4A 1R57A 1Y7RA 5F47A 2G3AA 4MBUA 2B5GB 4M85A 1Y9KA 2FCKA 1J4JA 3BJ8A 4FD4A 2R7HA 4MY3A 1Q2DA 1KZFA 2FSRA 4U5YA 1NMTA 5J8CA 3GYAA 1WK4A 3T9YA 2FE7A 4R3KA 2CNMA 2WPWA 3CXPA 3W91A 2BEIA 3FNCA 2QMLA 4F6AA 2PR8A 2B4DB 1XF8A 4AG9A 5E96A 3VWEA 2R8VA 1YVKA 2VEZA 3TO6A 3KKWA 1QSOA 2PC1A 3P2FA 3PP9A 3TO7A 2Q04A 4QVTA 2O28A 3JUWA 4JXRA 4AVAA 1LRZA 1PUAA 4JJXA 2PDOA 3C26A 5J8FA 4PK3A 5I0CA 4UBRA 4HNXB 4NCZA 4B5PA 4NSQA 1IIDA 2FIAA 4M3SA 4FD7A 4JLYA 3QAHA 2FL4A 3N7ZA 5DWNA 2OH1A 2QECA 4YGOA 4KVME 4ORFA 4UA3A 2PR1A 3VWDA 1P0HA 1M44A 1XE4A 1YVOA 2R1IA 2ATRA 3W6XA 2REEA 5C82A 1GHEA 4UWIA 5JQ4A 4LUAA 3ZJ0A 4U9ZA 2DXQA 4MHDA 1XMTA 4H6ZA 4IUSA 5JPHA 3CXQA 3NE7A 2CY2A 1S60A 3D2PA 4E8OA 1ON0A 3G8WA 4U9YA 4EVYA 2P0WA 2OZUA 1SQHA 2A4NA 4YRHA 1L0CA 1CM0A 1NE9A 4JXQA 4XNHC 1M4DA 5DWMA 1XIXA 2B58A 2D4PA 1M1DA 1KUXA 3TCVA 5GCNA 3BLNA 2HV2A 3D3SA 3F5BA 1YR0A 3EO4A 2GE3A 1RXTA 3IGRA 2ARHA 4CAVA 5EC4A 1S7KA 4PV6A 1KUVA 4K30A 1M4IA 1KUYA 3SXNA 3R9GA 1S7FA 1I1DA 4MJ8A 4ZBGA 4ONUA 3CXSA 1BO4A 4AVCA 1UFHA 4MI4A 2B5GA 5KTDA 4JWPA 3F8KA 2GANA 2RC4A 1K4JA 1MJBA 3I9SA 1RO5A 1N71A 4KUBA 2FXFA 3ZZIA 2CNTA 2B3VA 4LX9A 2BL1A 1B6BA 1Z4EA 2R98A 4R57A 2B4DA 5FVJA 4YFJA 1P4NA 2HQYA 2J8RA 1S7NA 4KOTA 5H86A 5H84A 1V0CA 4E2AA 1YLEA 1IYLA 3TFYA 4XNHB 5HH1A 3R9EA 1YGHA 4AB7A 3S6FA 4OLLA 3EC4A 2ZW6A 5IV0A 3FXTA 4HNYB 4QC6A 2CNSA 1XEBA 1IYKA 3P2HA 4QUSA 1Y9WA 1S3ZA 4FD6A 1S5KA 5C88A 3FRMA 4J3GA 3WR7A 1QSNA 3TO9A 4R9MA 2Z11A 1I21A 1M4GA 3TOBA 4DNCA 3TTHA 2FT0A 2Q4YA 2EVNA 4KOYA 4KLVA 3OWCA 2JEVA 2ZW7A 3R1KA 1IB1E 2C27A 4KOSA 1VKCA 1IICA 2Q44A 5IX3A 3FYNA 1MJ9A 2HUZA 2JDCA 2JLMA 3D2MA 1Z4RA 4PSWA 3R96A 3LODA 4KOVA 4KORA 3MGDA 4Y49C 1CJWA 2B3UA 4RS2A 4KVOE 1Q2CA 4R87A 4L8AA 4CAXA 3SXOA 2VZYA 3S6HA 4KUAA 4XPDC 4BMHA 3DR6A 4KOXA 2B4BA 3B8GA 5EBVA 4I49A 2AE6A 2NMTA 4KLWA 3TT2A 4IF5A 4HNWB 1YX0A 4NEXA 2EUIA
chains in the Genus database with same CATH superfamily
5HMNA 3WABA 1XJOA 2Z3KA 3D8PA 3IWEA 2H5MA 3EXNA 2WZNA 3FEDA 5F48A 1WWZA 4P6YA 2K5TA 3DDDA 5CBMA 2AFWA 4LQ6A 2AFUA 3RO0A 3JVNA 4UCNA 4JZ0A 2QVPA 2Q4VA 4B14A 1OZPA 1MK4A 3PBBA 5K8NA 2BUEA 1HEEA 3DNSA 4FWUA 3FJUA 5AGEA 3T90A 3IWGA 4OC4A 2V8GA 4C2YA 2J8MA 2VZZA 1Q7LA 1M4LA 1OBRA 4AVBA 2V8DA 2I79A 4X5KA 4II9A 2ZEFA 4QB9A 3LMSA 3WC5A 3FB3A 2PQ8A 3IC1A 3WT4A 4A30A 1F2PA 2YNCC 1VIXA 4FD5A 4B5OA 1FY7A 3S6GA 5A28A 2OZGA 4OAEA 2G0BA 4Y49B 2Q7BA 3S9MA 4B6ZA 2PJ4A 4UIAA 1U6MA 4KOWA 1PU9A 3GKRA 4TNUA 5CNPA 1BOBA 5I4MA 1Z9UA 4B12A 2PRBA 1YW4A 3ISZA 2ZXVA 3PGPA 3K9UA 4UWJA 4EMEA 1TKHA 2Q4ZA 3N5FA 2ZW5A 4MY0A 4LQGA 1XOVA 4KVXA 1I12A 3B3VA 4XPDB 1VHEA 3KQZA 2Q0YA 3B7IA 5ISVA 2ZEHA 1QQ9A 3DSBA 4XPLA 2EK8A 2Y0MA 4PK2A 2ZEOA 2DEAA 2AFXA 5DS0A 4B5PB 4B13A 4AG7A 2FIWA 3SHPA 3NA6A 2ZW4A 3TOAA 3BHXA 1YQEA 4L89A 2EK9A 3V38A 5JH9A 5LYLA 5D8NA 1IOIA 1LAPA 4PQAA 3F0AA 4RI1A 3G3SA 3B3SA 4O23A 4GS4A 4R3LA 3R95A 2P6FA 4E0AA 3CT9A 3PB9X 3KI9A 2OOTA 3NH4A 2C6CA 2V8VA 1LFWA 5F09A 1Q2YA 2CIJA 2GIVA 4PSXA 4C7IA 4R76A 4P45A 5K8MA 3RAMA 4BBHA 5HVGA 2VI7A 4P4IA 5IB0A 2O4HA 1IGBA 1KWMA 2P6GA 3UY5A 3KGQA 3QAYA 3V8IA 4CGLA 2NSMA 4XPKA 2F5IA 2KCWA 3KL9A 4KOUA 4H6UA 5KTAA 1MJAA 3FBUA 2C6GA 2VBQA 2EBJA 2FS5A 3R9FA 1YK3A 4NGNA 4UCPA 3S6KA 5K8OA 4OC5A 4KSAA 2X7BA 2Q43A 1YREA 3E0KA 5D29A 1B87A 3QB8A 3H4QA 2VQYA 2J8NA 4ZY0A 2POKA 1ELLP 1NSLA 4RN7A 4CRYB 1CP6A 2RFHA 4CYNA 2P6EA 3DR8A 4M6IA 3FECA 4NF1A 2VXKA 1ZO0A 3FEEA 4Q36A 5CPAA 4OKOA 2QIRA 4NXYA 1H8LA 1VHSA 2Z3PA 2PIZA 2XEFA 3IFEA 2PJ7A 3I3GA 4ZX8A 2OU2A 3SI1A 3H8GA 4OC1A 4JYWA 1IOFA 2OB0A 2G3TA 4KS9A 4NGMA 4R7MA 4QBJA 1FT7A 1DTDA 1GYTA 1BAVA 5KTCA 2ZPAA 4MFPA 2D4OA 4CS0B 2BSWA 5F46A 4PXEA 1QSRA 2PSWA 5F49A 3TE4A 1TIQA 2WPXA 3LD2A 1ARMA 1TF8A 3I1UA 3IU2A 4UIBA 2REFA 1CPXA 2ZOFA 4X8IA 3MN8A 2PJ0A 1CBXA 1QSMA 2YNDA 2Z10A 5G20A 3B3CA 2JDDA 1BLLE 2I00A 1S7LA 2WYRA 4JD6A 4FBEA 2XEGA 3BJ7A 1CPSA 1ELMP 4UEFA 1VGYA 3FIXA 3RYOA 3SJEA 3NE8A 3CZXA 4A33A 4KZTA 2AJ6A 3W6SA 1ZG9A 4CAWA 1TKJA 4H89A 4CYOA 4OADA 4HKFA 1QSTA 3PZJA 2AFMA 4CRZB 4GM5A 4F0XA 2PCUA 4F0YA 1XBUA 3EFAA 3EY5A 2PVVA 2OZHA 3GY9A 2Z0ZA 4NJQA 2PJAA 2IL4A 1R57A 5LRJA 4MMOA 2OR4A 1Y7RA 5F47A 8CPAA 1IU8A 1CX8A 2G3AA 2PJ2A 2WSAA 4MBUA 2B5GB 3JRUA 1Y9KA 4M85A 7CPAA 2FCKA 1J4JA 3BJ8A 3GIUA 4UFXA 5THWA 4FD4A 2R7HA 4MY3A 1Q2DA 1KZFA 1XFOA 2FSRA 4C2XA 4R6TA 4U5YA 1AYEA 1NMTA 4IK2A 3V7ZA 3D7GA 4OIWA 5J8CA 3GYAA 1Z8XA 1WK4A 1LANA 3T9YA 2FE7A 4R3KA 2CNMA 1Y7EA 3KHXA 3HUVA 4MRIA 2I3CA 2WPWA 3CXPA 3D4UA 4AXVA 4OC0A 3W91A 2BEIA 3FNCA 2QMLA 4PPZA 4F6AA 1JQGA 2PR8A 2B4DB 4YU9A 3HLPA 4A37A 1XF8A 4NGPA 4P4DA 1BPMA 3H5ZA 3S9NA 3VARA 4AG9A 5E96A 3VWEA 2R8VA 3KZWA 3KASA 1NSAA 1CG2A 4Z65A 1YVKA 2Z3MA 3PB4X 2VEZA 3TO6A 4MFQA 4BD9A 2EWBA 1DE4C 2CF4A 4M6HA 5BWAB 3KKWA 1PYTB 2HB6A 1QSOA 4WWVA 2PC1A 3P2FA 3PP9A 2ANPA 3TO7A 2Q04A 4OC3A 4QVTA 5G1ZA 2PVWA 2O28A 4F8ZA 2GREA 3CPXA 2ABZA 3GB0A 3JUWA 4NGTA 4JXRA 3D68A 4AVAA 2G9DA 1LRZA 5IB9A 1R43A 2WUUA 1PUAA 4JJXA 4CYQA 4ZY1A 2PDOA 3C26A 5J8FA 4PK3A 5I0CA 2V77A 3BXMA 3H8EA 4UBRA 4IHMA 4HNXB 4NCZA 4B5PA 4NSQA 4X2TA 4F9VA 1IIDA 1TXRA 2FIAA 4EWTA 4X3RA 4CAEA 4M3SA 5J1QA 4FD7A 4JLYA 3S9LA 3SI0A 3QNVA 1CP7A 3FX6A 2CTCA 3QAHA 2FL4A 4YWYA 3N7ZA 5DWNA 2OH1A 4DYOA 2QECA 4YGOA 4C2ZA 3T8WA 4KVME 3FF3A 2YNEA 2Z3LA 1IY7A 4ORFA 2Q51A 3LWUA 1F57A 4UA3A 1Y0RA 2GLFA 2PR1A 3VWDA 1P0HA 3D67A 3K2KA 1M44A 1XE4A 1YVOA 3CDXA 4NEXA 2R1IA 2DPSA 2ATRA 2IMOA 2PJ9A 2EO8A 3GLJA 4MCSA 1A2ZA 4ONWA 2PJCA 4P10A 4ZY2A 3RZAA 3W6XA 1XMBA 2REEA 4FAIA 3IU1A 1GHEA 4UWIA 5C82A 5JQ4A 2BOAA 2V8HA 4LUAA 4NGSA 1VHOA 3ZJ0A 2ODFA 1UWYA 1ZG7A 4A39A 4A32A 2Z3OA 2YNCA 4U9ZA 3IO1A 1YSJA 1ZLHA 4MHZA 2DXQA 3IIBA 4K3NA 4MHDA 1XMTA 4NGRA 4H6ZA 4IUSA 2CXAA 2XEJA 5JPHA 3CXQA 2CY2A 3NE7A 4MFKA 1S60A 3D2PA 4E8OA 1AUGA 1ON0A 5LYFA 3G8WA 4U9YA 2JBKA 1XRYA 3GUXA 3IWWA 4EVYA 1X12A 2P0WA 5HXDA 3KHZA 3SJFA 2OZUA 1YMEA 1SQHA 4P4BA 2ZELA 3FVLA 2A4NA 3DLJA 4WJBA 3D7FA 3B3TA 1YW6A 3CPAA 3KR5A 1L0CA 1CM0A 1NE9A 2PE3A 4JXQA 4XNHC 3PB6X 1M4DA 4YRHA 3VH9A 5DWMA 1XIXA 2B58A 2D4PA 1M1DA 1KUXA 2PRQA 4OMEA 3TCVA 5GCNA 3BLNA 2HV2A 4MCRA 3D3SA 3B35A 5JM6A 3FMCA 3F5BA 1YR0A 2ZEEA 4PXBA 3EO4A 1EE3P 2GE3A 4CGPA 1RXTA 5LYDA 4NFRA 2ZEDA 4UCMA 3VATA 5HVHA 5JGFA 4P4FA 3K9TA 3IGRA 3D7DA 2ARHA 4CAVA 5G21A 3PFOA 4OIDA 5AG7A 1S7KA 4PV6A 5EC4A 3KQXA 1KUVA 2RB7A 1M4IA 1KUYA 3IJ3A 4K30A 3R9GA 3RBUA 3SXNA 1S7FA 1I1DA 4MJ8A 4ZBGA 4ONUA 3SJGA 4A95A 4CGNA 3BI0A 3CXSA 4KSIA 4MFZA 4B10A 2F7VA 1BO4A 4MXUA 2GLJA 4AVCA 4ZYQA 1UFHA 2PJ3A 4MI4A 5LRGA 2B5GA 4Q7AA 5KTDA 4CGMA 4KSFA 2NYQA 1HDUA 4JWPA 1F2OA 2PIYA 1LCPA 3LACA 3F8KA 2GANA 4ZGYB 2RC4A 3PEIA 1K4JA 1MJBA 3I9SA 1RO5A 1N71A 4KUBA 1PCAA 2FXFA 3IEHA 2HC9A 4OP4A 3ZZIA 1YLOA 4CAFA 5A27A 3BI1A 2CNTA 2GU2A 2B3VA 1X10A 4LX9A 2BL1A 1B6BA 1Z4EA 2R98A 4R57A 3FH4A 2PJ5A 4ZI6A 2PJ8A 3NFZA 2B4DA 4FUUA 2PJBA 5FVJA 4YFJA 2ZEPA 4PXDA 2BCOA 5HVFA 1P4NA 2HQYA 2YGWA 4A94A 2J8RA 3PB7X 4UEEA 1S7NA 4KOTA 5H86A 2PJ1A 2C6PA 5H84A 4P4EA 2QJ8A 1V0CA 3NH5A 4F9UA 1Y0YA 4E2AA 1YLEA 2Z3NA 1IYLA 4CYPA 4EFDA 2DPTA 3TFYA 4HPSA 4XNHB 2Q7SA 2CTBA 1FNOA 5HH1A 5AG5A 5EMIA 1BPNA 1YGHA 3R9EA 4AB7A 3B2YA 3S6FA 3SJXA 4A2ZA 3L2NA 4OLLA 4TWEA 2AFSA 6CPAA 1Z8TA 3EC4A 4GXHA 4MCQA 2ZW6A 4ZX9A 5IV0A 3FXTA 4HNYB 3KR4A 4QC6A 4B11A 4A31A 3ISXA 2CNSA 1XEBA 3PRTA 1IYKA 4PXCA 5K8PA 3PFEA 3P2HA 2IQ6A 4QUSA 4A38A 4P44A 1ZLIA 1Y9WA 3WC7A 1S3ZA 1JWQA 3JTKA 4FD6A 1S5KA 5C88A 5G22A 2XEIA 4R8FA 3FRMA 1ARLA 4J3GA 4BINA 3WR7A 1QSNA 3TO9A 3D7HA 4R9MA 2AFOA 4NJRA 4DJLA 2Z11A 1I21A 2J9AA 1Z5RA 1M4GA 3TOBA 4OC2A 2JEWA 4MCPA 4DNCA 1LOKA 3TTHA 2FT0A 4M6GA 3B3WA 3MRUA 2Q4YA 2EVNA 4KOYA 3TX8A 5AG6A 4KLVA 1ZG8A 2GFQA 2VL1A 2IJZA 4UFVA 2C1CA 3OWCA 3A9LA 2JEVA 2ZW7A 2QYVA 3R1KA 1IB1E 2C27A 4KOSA 3TC8A 1VKCA 4UFWA 1IICA 2PJ6A 2Q44A 5LRKA 4MHNA 5IX3A 3FYNA 1LAMA 3SI2A 1Z8LA 1MJ9A 2HUZA 2JDCA 2JLMA 3D2MA 3PBEA 1Z4RA 2ZEMA 4PSWA 4MFLA 3H8FA 3R96A 3LODA 4KOVA 1AMPA 4KORA 1Z8WA 3MGDA 4H2KA 4MFJA 4Y49C 1CJWA 2B3UA 4RS2A 3NH8A 2O53A 1QMUA 3D66A 4KVOE 1Q2CA 4R87A 4C68A 2F8HA 4L8AA 4CAXA 3SXOA 2VZYA 4MHYA 4UF4A 5LYIA 2AFZA 1TF9A 5ELYA 3S6HA 1HDQA 2ZEGA 2ZENA 4KUAA 5AG4A 4NGQA 4CPAA 4XPDC 4BMHA 3DR6A 3RNZA 4KOXA 4MHPA 4C7HA 4W9YA 2B4BA 3B8GA 4RUHA 4Q38A 4G1PA 2JBJA 1R3NA 1TKFA 5EBVA 4IAVA 4CGOA 2ZOGA 4I49A 2AE6A 2FVGA 2NMTA 4KLWA 4UEZA 3TT2A 2BO9A 1RTQA 4IF5A 4HNWB 3WC6A 4P4JA 3PB8X 1YX0A 4DUKA 1Z2LA 3DGVA 2EUIA 2DF5A
chains in the Genus database with same CATH topology
5HMNA 2Z3KA 3D8PA 3IWEA 2H5MA 3EXNA 5F48A 1WWZA 2K5TA 3DDDA 3JVNA 4UCNA 4B14A 2Q4VA 1OZPA 1MK4A 2BUEA 3DNSA 5AGEA 3T90A 3IWGA 4C2YA 2J8MA 2VZZA 4AVBA 2I79A 4X5KA 4II9A 4QB9A 3FB3A 2PQ8A 4A30A 2YNCC 4FD5A 4B5OA 1FY7A 3S6GA 5A28A 2OZGA 4OAEA 2G0BA 4Y49B 2Q7BA 1U6MA 4KOWA 1PU9A 3GKRA 5CNPA 1BOBA 1Z9UA 4B12A 2PRBA 2ZXVA 3PGPA 3K9UA 4UWJA 2ZW5A 4MY0A 4KVXA 1I12A 4XPDB 2Q0YA 5ISVA 3DSBA 4XPLA 2Y0MA 4PK2A 4B5PB 4B13A 4AG7A 2FIWA 3SHPA 2ZW4A 3TOAA 4L89A 3F0AA 4RI1A 3G3SA 4GS4A 4R3LA 3R95A 2P6FA 4E0AA 1Q2YA 4C7IA 2GIVA 4PSXA 4BBHA 2VI7A 5IB0A 2P6GA 3UY5A 3V8IA 4CGLA 4XPKA 2F5IA 2KCWA 4KOUA 4H6UA 5KTAA 1MJAA 3FBUA 2VBQA 2FS5A 3R9FA 1YK3A 4UCPA 3S6KA 4KSAA 2X7BA 1YREA 3E0KA 1B87A 3QB8A 3H4QA 2VQYA 2J8NA 1NSLA 4CRYB 4CYNA 2P6EA 3DR8A 4NF1A 4Q36A 2VXKA 1ZO0A 2QIRA 4NXYA 1VHSA 2Z3PA 3I3GA 2OU2A 2OB0A 2G3TA 4KS9A 4QBJA 5KTCA 2ZPAA 4MFPA 2D4OA 4CS0B 2BSWA 5F46A 1QSRA 2PSWA 5F49A 3TE4A 1TIQA 2WPXA 3LD2A 3IU2A 2REFA 1QSMA 2YNDA 2Z10A 5G20A 2JDDA 2I00A 1S7LA 4JD6A 3BJ7A 3FIXA 3RYOA 4A33A 4KZTA 2AJ6A 3W6SA 4CAWA 4H89A 4CYOA 4OADA 4HKFA 1QSTA 3PZJA 4CRZB 4F0XA 4F0YA 3EFAA 3EY5A 2OZHA 3GY9A 2Z0ZA 2IL4A 1R57A 1Y7RA 5F47A 2G3AA 4MBUA 2WSAA 2B5GB 1Y9KA 4M85A 2FCKA 1J4JA 3BJ8A 4UFXA 4FD4A 2R7HA 4MY3A 1Q2DA 1KZFA 2FSRA 4C2XA 4U5YA 1NMTA 5J8CA 3GYAA 1WK4A 3T9YA 2FE7A 4R3KA 2CNMA 2WPWA 3CXPA 3W91A 2BEIA 3FNCA 2QMLA 4F6AA 2PR8A 2B4DB 1XF8A 3H5ZA 4AG9A 5E96A 3VWEA 2R8VA 1YVKA 2Z3MA 2VEZA 3TO6A 4MFQA 5BWAB 3KKWA 1QSOA 2PC1A 3P2FA 3PP9A 3TO7A 2Q04A 4QVTA 5G1ZA 2O28A 3JUWA 4JXRA 4AVAA 1LRZA 2WUUA 1PUAA 4JJXA 4CYQA 2PDOA 3C26A 5J8FA 4PK3A 5I0CA 4UBRA 4HNXB 4NCZA 4B5PA 4NSQA 1IIDA 2FIAA 4CAEA 4M3SA 4FD7A 4JLYA 3QAHA 2FL4A 3N7ZA 5DWNA 2OH1A 2QECA 4YGOA 4C2ZA 4KVME 2YNEA 2Z3LA 4ORFA 4UA3A 2PR1A 3VWDA 1P0HA 1M44A 1XE4A 1YVOA 2R1IA 2DPSA 2ATRA 3W6XA 2REEA 3IU1A 1GHEA 4UWIA 5C82A 5JQ4A 4LUAA 3ZJ0A 4A32A 2Z3OA 2YNCA 4U9ZA 2DXQA 4MHDA 1XMTA 4H6ZA 4IUSA 2CXAA 5JPHA 3CXQA 3NE7A 2CY2A 4MFKA 1S60A 3D2PA 4E8OA 1ON0A 3G8WA 4U9YA 4EVYA 2P0WA 2OZUA 1SQHA 2A4NA 4YRHA 1L0CA 1CM0A 1NE9A 4JXQA 4XNHC 1M4DA 5DWMA 1XIXA 2B58A 2D4PA 1M1DA 1KUXA 3TCVA 5GCNA 3BLNA 2HV2A 3D3SA 3F5BA 1YR0A 4CGPA 3EO4A 2GE3A 1RXTA 4UCMA 3IGRA 2ARHA 4CAVA 5G21A 5AG7A 5EC4A 1S7KA 4PV6A 1KUVA 4K30A 1M4IA 1KUYA 3SXNA 3R9GA 1S7FA 1I1DA 4MJ8A 4ZBGA 4ONUA 4A95A 4CGNA 3CXSA 4MFZA 4B10A 1BO4A 4AVCA 1UFHA 4MI4A 2B5GA 5KTDA 4CGMA 4KSFA 4JWPA 3F8KA 2GANA 4ZGYB 2RC4A 1K4JA 1MJBA 3I9SA 1RO5A 1N71A 4KUBA 2FXFA 3ZZIA 4CAFA 5A27A 2CNTA 2B3VA 4LX9A 2BL1A 1B6BA 1Z4EA 2R98A 4R57A 2B4DA 5FVJA 4YFJA 1P4NA 2HQYA 2YGWA 2J8RA 1S7NA 4KOTA 5H86A 5H84A 1V0CA 4E2AA 1YLEA 2Z3NA 1IYLA 4CYPA 2DPTA 3TFYA 4XNHB 5HH1A 5AG5A 3R9EA 1YGHA 4AB7A 3S6FA 4A2ZA 4OLLA 3EC4A 2ZW6A 5IV0A 3FXTA 4HNYB 4QC6A 4B11A 4A31A 2CNSA 1XEBA 1IYKA 3P2HA 4QUSA 1Y9WA 1S3ZA 4FD6A 3JTKA 1S5KA 5C88A 5G22A 3FRMA 4J3GA 3WR7A 1QSNA 3TO9A 4R9MA 2Z11A 1I21A 1M4GA 3TOBA 4DNCA 3TTHA 2FT0A 2Q4YA 2EVNA 4KOYA 5AG6A 4KLVA 4UFVA 3OWCA 3A9LA 2JEVA 2ZW7A 3R1KA 1IB1E 2C27A 4KOSA 1VKCA 4UFWA 1IICA 2Q44A 5IX3A 3FYNA 1MJ9A 2HUZA 2JDCA 2JLMA 3D2MA 1Z4RA 4PSWA 4MFLA 3R96A 3LODA 4KOVA 4KORA 3MGDA 4MFJA 4Y49C 1CJWA 2B3UA 4RS2A 4KVOE 1Q2CA 4R87A 4C68A 4L8AA 4CAXA 3SXOA 2VZYA 3S6HA 4KUAA 5AG4A 4XPDC 4BMHA 3DR6A 4KOXA 4C7HA 2B4BA 3B8GA 4Q38A 5EBVA 4CGOA 4I49A 2AE6A 2NMTA 4KLWA 3TT2A 4IF5A 4HNWB 1YX0A 4NEXA 2EUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HMN A;  3D8P A;  2H5M A;  3EXN A;  5F48 A;  1WWZ A;  2K5T A;  3DDD A;  3JVN A;  2Q4V A;  1OZP A;  1MK4 A;  2BUE A;  3DNS A;  3T90 A;  3IWG A;  2J8M A;  2VZZ A;  4AVB A;  2I79 A;  4X5K A;  4II9 A;  4QB9 A;  3FB3 A;  2PQ8 A;  4FD5 A;  4B5O A;  1FY7 A;  3S6G A;  2OZG A;  4OAE A;  2G0B A;  4Y49 B;  2Q7B A;  1U6M A;  4KOW A;  1PU9 A;  3GKR A;  5CNP A;  1BOB A;  1Z9U A;  2PRB A;  2ZXV A;  3PGP A;  3K9U A;  4UWJ A;  2ZW5 A;  4MY0 A;  4KVX A;  1I12 A;  4XPD B;  2Q0Y A;  5ISV A;  3DSB A;  4XPL A;  2Y0M A;  4PK2 A;  4B5P B;  4AG7 A;  2FIW A;  3SHP A;  2ZW4 A;  3TOA A;  4L89 A;  3F0A A;  4RI1 A;  3G3S A;  4GS4 A;  4R3L A;  3R95 A;  2P6F A;  4E0A A;  1Q2Y A;  2GIV A;  4PSX A;  2VI7 A;  5IB0 A;  2P6G A;  3UY5 A;  3V8I A;  4XPK A;  2F5I A;  2KCW A;  4KOU A;  4H6U A;  5KTA A;  1MJA A;  3FBU A;  2VBQ A;  2FS5 A;  3R9F A;  1YK3 A;  3S6K A;  2X7B A;  1YRE A;  3E0K A;  1B87 A;  3QB8 A;  3H4Q A;  2VQY A;  2J8N A;  1NSL A;  4CRY B;  2P6E A;  3DR8 A;  4NF1 A;  2VXK A;  2QIR A;  4NXY A;  1VHS A;  3I3G A;  2OU2 A;  2OB0 A;  2G3T A;  4QBJ A;  5KTC A;  2ZPA A;  2D4O A;  4CS0 B;  2BSW A;  5F46 A;  1QSR A;  2PSW A;  5F49 A;  3TE4 A;  1TIQ A;  2WPX A;  3LD2 A;  2REF A;  1QSM A;  2Z10 A;  2JDD A;  2I00 A;  1S7L A;  4JD6 A;  3BJ7 A;  3FIX A;  3RYO A;  4KZT A;  2AJ6 A;  3W6S A;  4CAW A;  4H89 A;  4OAD A;  4HKF A;  1QST A;  3PZJ A;  4CRZ B;  4F0Y A;  3EFA A;  3EY5 A;  2OZH A;  3GY9 A;  2Z0Z A;  2IL4 A;  1R57 A;  1Y7R A;  5F47 A;  2G3A A;  4MBU A;  2B5G B;  4M85 A;  1Y9K A;  2FCK A;  1J4J A;  3BJ8 A;  4FD4 A;  2R7H A;  4MY3 A;  1Q2D A;  1KZF A;  2FSR A;  4U5Y A;  1NMT A;  5J8C A;  3GYA A;  1WK4 A;  3T9Y A;  2FE7 A;  4R3K A;  2CNM A;  2WPW A;  3CXP A;  3W91 A;  2BEI A;  3FNC A;  2QML A;  4F6A A;  2PR8 A;  2B4D B;  1XF8 A;  4AG9 A;  5E96 A;  3VWE A;  2R8V A;  1YVK A;  2VEZ A;  3TO6 A;  3KKW A;  1QSO A;  2PC1 A;  3P2F A;  3PP9 A;  3TO7 A;  2Q04 A;  4QVT A;  2O28 A;  3JUW A;  4JXR A;  4AVA A;  1LRZ A;  1PUA A;  4JJX A;  2PDO A;  3C26 A;  5J8F A;  4PK3 A;  5I0C A;  4UBR A;  4HNX B;  4NCZ A;  4B5P A;  4NSQ A;  1IID A;  2FIA A;  4M3S A;  4FD7 A;  4JLY A;  3QAH A;  2FL4 A;  3N7Z A;  5DWN A;  2OH1 A;  2QEC A;  4YGO A;  4KVM E;  4ORF A;  4UA3 A;  2PR1 A;  3VWD A;  1P0H A;  1M44 A;  1XE4 A;  1YVO A;  2R1I A;  2ATR A;  3W6X A;  2REE A;  5C82 A;  1GHE A;  4UWI A;  5JQ4 A;  4LUA A;  3ZJ0 A;  4U9Z A;  2DXQ A;  4MHD A;  1XMT A;  4H6Z A;  4IUS A;  5JPH A;  3CXQ A;  3NE7 A;  2CY2 A;  1S60 A;  3D2P A;  4E8O A;  1ON0 A;  3G8W A;  4U9Y A;  4EVY A;  2P0W A;  2OZU A;  1SQH A;  2A4N A;  4YRH A;  1L0C A;  1CM0 A;  1NE9 A;  4JXQ A;  4XNH C;  1M4D A;  5DWM A;  1XIX A;  2B58 A;  2D4P A;  1M1D A;  1KUX A;  3TCV A;  5GCN A;  3BLN A;  2HV2 A;  3D3S A;  3F5B A;  1YR0 A;  3EO4 A;  2GE3 A;  1RXT A;  3IGR A;  2ARH A;  4CAV A;  5EC4 A;  1S7K A;  4PV6 A;  1KUV A;  4K30 A;  1M4I A;  1KUY A;  3SXN A;  3R9G A;  1S7F A;  1I1D A;  4MJ8 A;  4ZBG A;  4ONU A;  3CXS A;  1BO4 A;  4AVC A;  1UFH A;  4MI4 A;  2B5G A;  5KTD A;  4JWP A;  3F8K A;  2GAN A;  2RC4 A;  1K4J A;  1MJB A;  3I9S A;  1RO5 A;  1N71 A;  4KUB A;  2FXF A;  3ZZI A;  2CNT A;  2B3V A;  4LX9 A;  2BL1 A;  1B6B A;  1Z4E A;  2R98 A;  4R57 A;  2B4D A;  5FVJ A;  4YFJ A;  1P4N A;  2HQY A;  2J8R A;  1S7N A;  4KOT A;  5H86 A;  5H84 A;  1V0C A;  4E2A A;  1YLE A;  1IYL A;  3TFY A;  4XNH B;  5HH1 A;  3R9E A;  1YGH A;  4AB7 A;  3S6F A;  4OLL A;  3EC4 A;  2ZW6 A;  5IV0 A;  3FXT A;  4HNY B;  4QC6 A;  2CNS A;  1XEB A;  1IYK A;  3P2H A;  4QUS A;  1Y9W A;  1S3Z A;  4FD6 A;  1S5K A;  5C88 A;  3FRM A;  4J3G A;  3WR7 A;  1QSN A;  3TO9 A;  4R9M A;  2Z11 A;  1I21 A;  1M4G A;  3TOB A;  4DNC A;  3TTH A;  2FT0 A;  2Q4Y A;  2EVN A;  4KOY A;  4KLV A;  3OWC A;  2JEV A;  2ZW7 A;  3R1K A;  1IB1 E;  2C27 A;  4KOS A;  1VKC A;  1IIC A;  2Q44 A;  5IX3 A;  3FYN A;  1MJ9 A;  2HUZ A;  2JDC A;  2JLM A;  3D2M A;  1Z4R A;  4PSW A;  3R96 A;  3LOD A;  4KOV A;  4KOR A;  3MGD A;  4Y49 C;  1CJW A;  2B3U A;  4RS2 A;  4KVO E;  1Q2C A;  4R87 A;  4L8A A;  4CAX A;  3SXO A;  2VZY A;  3S6H A;  4KUA A;  4XPD C;  4BMH A;  3DR6 A;  4KOX A;  2B4B A;  3B8G A;  5EBV A;  4I49 A;  2AE6 A;  2NMT A;  4KLW A;  3TT2 A;  4IF5 A;  4HNW B;  1YX0 A;  4NEX A;  2EUI A; 
#chains in the Genus database with same CATH topology
 5HMN A;  3WAB A;  1XJO A;  2Z3K A;  3D8P A;  3IWE A;  2H5M A;  3EXN A;  2WZN A;  3FED A;  5F48 A;  1WWZ A;  4P6Y A;  2K5T A;  3DDD A;  5CBM A;  2AFW A;  4LQ6 A;  2AFU A;  3RO0 A;  3JVN A;  4UCN A;  4JZ0 A;  2QVP A;  2Q4V A;  4B14 A;  1OZP A;  1MK4 A;  3PBB A;  5K8N A;  2BUE A;  1HEE A;  3DNS A;  4FWU A;  3FJU A;  5AGE A;  3T90 A;  3IWG A;  4OC4 A;  2V8G A;  4C2Y A;  2J8M A;  2VZZ A;  1Q7L A;  1M4L A;  1OBR A;  4AVB A;  2V8D A;  2I79 A;  4X5K A;  4II9 A;  2ZEF A;  4QB9 A;  3LMS A;  3WC5 A;  3FB3 A;  2PQ8 A;  3IC1 A;  3WT4 A;  4A30 A;  1F2P A;  2YNC C;  1VIX A;  4FD5 A;  4B5O A;  1FY7 A;  3S6G A;  5A28 A;  2OZG A;  4OAE A;  2G0B A;  4Y49 B;  2Q7B A;  3S9M A;  4B6Z A;  2PJ4 A;  4UIA A;  1U6M A;  4KOW A;  1PU9 A;  3GKR A;  4TNU A;  5CNP A;  1BOB A;  5I4M A;  1Z9U A;  4B12 A;  2PRB A;  1YW4 A;  3ISZ A;  2ZXV A;  3PGP A;  3K9U A;  4UWJ A;  4EME A;  1TKH A;  2Q4Z A;  3N5F A;  2ZW5 A;  4MY0 A;  4LQG A;  1XOV A;  4KVX A;  1I12 A;  3B3V A;  4XPD B;  1VHE A;  3KQZ A;  2Q0Y A;  3B7I A;  5ISV A;  2ZEH A;  1QQ9 A;  3DSB A;  4XPL A;  2EK8 A;  2Y0M A;  4PK2 A;  2ZEO A;  2DEA A;  2AFX A;  5DS0 A;  4B5P B;  4B13 A;  4AG7 A;  2FIW A;  3SHP A;  3NA6 A;  2ZW4 A;  3TOA A;  3BHX A;  1YQE A;  4L89 A;  2EK9 A;  3V38 A;  5JH9 A;  5LYL A;  5D8N A;  1IOI A;  1LAP A;  4PQA A;  3F0A A;  4RI1 A;  3G3S A;  3B3S A;  4O23 A;  4GS4 A;  4R3L A;  3R95 A;  2P6F A;  4E0A A;  3CT9 A;  3PB9 X;  3KI9 A;  2OOT A;  3NH4 A;  2C6C A;  2V8V A;  1LFW A;  5F09 A;  1Q2Y A;  2CIJ A;  2GIV A;  4PSX A;  4C7I A;  4R76 A;  4P45 A;  5K8M A;  3RAM A;  4BBH A;  5HVG A;  2VI7 A;  4P4I A;  5IB0 A;  2O4H A;  1IGB A;  1KWM A;  2P6G A;  3UY5 A;  3KGQ A;  3QAY A;  3V8I A;  4CGL A;  2NSM A;  4XPK A;  2F5I A;  2KCW A;  3KL9 A;  4KOU A;  4H6U A;  5KTA A;  1MJA A;  3FBU A;  2C6G A;  2VBQ A;  2EBJ A;  2FS5 A;  3R9F A;  1YK3 A;  4NGN A;  4UCP A;  3S6K A;  5K8O A;  4OC5 A;  4KSA A;  2X7B A;  2Q43 A;  1YRE A;  3E0K A;  5D29 A;  1B87 A;  3QB8 A;  3H4Q A;  2VQY A;  2J8N A;  4ZY0 A;  2POK A;  1ELL P;  1NSL A;  4RN7 A;  4CRY B;  1CP6 A;  2RFH A;  4CYN A;  2P6E A;  3DR8 A;  4M6I A;  3FEC A;  4NF1 A;  2VXK A;  1ZO0 A;  3FEE A;  4Q36 A;  5CPA A;  4OKO A;  2QIR A;  4NXY A;  1H8L A;  1VHS A;  2Z3P A;  2PIZ A;  2XEF A;  3IFE A;  2PJ7 A;  3I3G A;  4ZX8 A;  2OU2 A;  3SI1 A;  3H8G A;  4OC1 A;  4JYW A;  1IOF A;  2OB0 A;  2G3T A;  4KS9 A;  4NGM A;  4R7M A;  4QBJ A;  1FT7 A;  1DTD A;  1GYT A;  1BAV A;  5KTC A;  2ZPA A;  4MFP A;  2D4O A;  4CS0 B;  2BSW A;  5F46 A;  4PXE A;  1QSR A;  2PSW A;  5F49 A;  3TE4 A;  1TIQ A;  2WPX A;  3LD2 A;  1ARM A;  1TF8 A;  3I1U A;  3IU2 A;  4UIB A;  2REF A;  1CPX A;  2ZOF A;  4X8I A;  3MN8 A;  2PJ0 A;  1CBX A;  1QSM A;  2YND A;  2Z10 A;  5G20 A;  3B3C A;  2JDD A;  1BLL E;  2I00 A;  1S7L A;  2WYR A;  4JD6 A;  4FBE A;  2XEG A;  3BJ7 A;  1CPS A;  1ELM P;  4UEF A;  1VGY A;  3FIX A;  3RYO A;  3SJE A;  3NE8 A;  3CZX A;  4A33 A;  4KZT A;  2AJ6 A;  3W6S A;  1ZG9 A;  4CAW A;  1TKJ A;  4H89 A;  4CYO A;  4OAD A;  4HKF A;  1QST A;  3PZJ A;  2AFM A;  4CRZ B;  4GM5 A;  4F0X A;  2PCU A;  4F0Y A;  1XBU A;  3EFA A;  3EY5 A;  2PVV A;  2OZH A;  3GY9 A;  2Z0Z A;  4NJQ A;  2PJA A;  2IL4 A;  1R57 A;  5LRJ A;  4MMO A;  2OR4 A;  1Y7R A;  5F47 A;  8CPA A;  1IU8 A;  1CX8 A;  2G3A A;  2PJ2 A;  2WSA A;  4MBU A;  2B5G B;  3JRU A;  1Y9K A;  4M85 A;  7CPA A;  2FCK A;  1J4J A;  3BJ8 A;  3GIU A;  4UFX A;  5THW A;  4FD4 A;  2R7H A;  4MY3 A;  1Q2D A;  1KZF A;  1XFO A;  2FSR A;  4C2X A;  4R6T A;  4U5Y A;  1AYE A;  1NMT A;  4IK2 A;  3V7Z A;  3D7G A;  4OIW A;  5J8C A;  3GYA A;  1Z8X A;  1WK4 A;  1LAN A;  3T9Y A;  2FE7 A;  4R3K A;  2CNM A;  1Y7E A;  3KHX A;  3HUV A;  4MRI A;  2I3C A;  2WPW A;  3CXP A;  3D4U A;  4AXV A;  4OC0 A;  3W91 A;  2BEI A;  3FNC A;  2QML A;  4PPZ A;  4F6A A;  1JQG A;  2PR8 A;  2B4D B;  4YU9 A;  3HLP A;  4A37 A;  1XF8 A;  4NGP A;  4P4D A;  1BPM A;  3H5Z A;  3S9N A;  3VAR A;  4AG9 A;  5E96 A;  3VWE A;  2R8V A;  3KZW A;  3KAS A;  1NSA A;  1CG2 A;  4Z65 A;  1YVK A;  2Z3M A;  3PB4 X;  2VEZ A;  3TO6 A;  4MFQ A;  4BD9 A;  2EWB A;  1DE4 C;  2CF4 A;  4M6H A;  5BWA B;  3KKW A;  1PYT B;  2HB6 A;  1QSO A;  4WWV A;  2PC1 A;  3P2F A;  3PP9 A;  2ANP A;  3TO7 A;  2Q04 A;  4OC3 A;  4QVT A;  5G1Z A;  2PVW A;  2O28 A;  4F8Z A;  2GRE A;  3CPX A;  2ABZ A;  3GB0 A;  3JUW A;  4NGT A;  4JXR A;  3D68 A;  4AVA A;  2G9D A;  1LRZ A;  5IB9 A;  1R43 A;  2WUU A;  1PUA A;  4JJX A;  4CYQ A;  4ZY1 A;  2PDO A;  3C26 A;  5J8F A;  4PK3 A;  5I0C A;  2V77 A;  3BXM A;  3H8E A;  4UBR A;  4IHM A;  4HNX B;  4NCZ A;  4B5P A;  4NSQ A;  4X2T A;  4F9V A;  1IID A;  1TXR A;  2FIA A;  4EWT A;  4X3R A;  4CAE A;  4M3S A;  5J1Q A;  4FD7 A;  4JLY A;  3S9L A;  3SI0 A;  3QNV A;  1CP7 A;  3FX6 A;  2CTC A;  3QAH A;  2FL4 A;  4YWY A;  3N7Z A;  5DWN A;  2OH1 A;  4DYO A;  2QEC A;  4YGO A;  4C2Z A;  3T8W A;  4KVM E;  3FF3 A;  2YNE A;  2Z3L A;  1IY7 A;  4ORF A;  2Q51 A;  3LWU A;  1F57 A;  4UA3 A;  1Y0R A;  2GLF A;  2PR1 A;  3VWD A;  1P0H A;  3D67 A;  3K2K A;  1M44 A;  1XE4 A;  1YVO A;  3CDX A;  4NEX A;  2R1I A;  2DPS A;  2ATR A;  2IMO A;  2PJ9 A;  2EO8 A;  3GLJ A;  4MCS A;  1A2Z A;  4ONW A;  2PJC A;  4P10 A;  4ZY2 A;  3RZA A;  3W6X A;  1XMB A;  2REE A;  4FAI A;  3IU1 A;  1GHE A;  4UWI A;  5C82 A;  5JQ4 A;  2BOA A;  2V8H A;  4LUA A;  4NGS A;  1VHO A;  3ZJ0 A;  2ODF A;  1UWY A;  1ZG7 A;  4A39 A;  4A32 A;  2Z3O A;  2YNC A;  4U9Z A;  3IO1 A;  1YSJ A;  1ZLH A;  4MHZ A;  2DXQ A;  3IIB A;  4K3N A;  4MHD A;  1XMT A;  4NGR A;  4H6Z A;  4IUS A;  2CXA A;  2XEJ A;  5JPH A;  3CXQ A;  2CY2 A;  3NE7 A;  4MFK A;  1S60 A;  3D2P A;  4E8O A;  1AUG A;  1ON0 A;  5LYF A;  3G8W A;  4U9Y A;  2JBK A;  1XRY A;  3GUX A;  3IWW A;  4EVY A;  1X12 A;  2P0W A;  5HXD A;  3KHZ A;  3SJF A;  2OZU A;  1YME A;  1SQH A;  4P4B A;  2ZEL A;  3FVL A;  2A4N A;  3DLJ A;  4WJB A;  3D7F A;  3B3T A;  1YW6 A;  3CPA A;  3KR5 A;  1L0C A;  1CM0 A;  1NE9 A;  2PE3 A;  4JXQ A;  4XNH C;  3PB6 X;  1M4D A;  4YRH A;  3VH9 A;  5DWM A;  1XIX A;  2B58 A;  2D4P A;  1M1D A;  1KUX A;  2PRQ A;  4OME A;  3TCV A;  5GCN A;  3BLN A;  2HV2 A;  4MCR A;  3D3S A;  3B35 A;  5JM6 A;  3FMC A;  3F5B A;  1YR0 A;  2ZEE A;  4PXB A;  3EO4 A;  1EE3 P;  2GE3 A;  4CGP A;  1RXT A;  5LYD A;  4NFR A;  2ZED A;  4UCM A;  3VAT A;  5HVH A;  5JGF A;  4P4F A;  3K9T A;  3IGR A;  3D7D A;  2ARH A;  4CAV A;  5G21 A;  3PFO A;  4OID A;  5AG7 A;  1S7K A;  4PV6 A;  5EC4 A;  3KQX A;  1KUV A;  2RB7 A;  1M4I A;  1KUY A;  3IJ3 A;  4K30 A;  3R9G A;  3RBU A;  3SXN A;  1S7F A;  1I1D A;  4MJ8 A;  4ZBG A;  4ONU A;  3SJG A;  4A95 A;  4CGN A;  3BI0 A;  3CXS A;  4KSI A;  4MFZ A;  4B10 A;  2F7V A;  1BO4 A;  4MXU A;  2GLJ A;  4AVC A;  4ZYQ A;  1UFH A;  2PJ3 A;  4MI4 A;  5LRG A;  2B5G A;  4Q7A A;  5KTD A;  4CGM A;  4KSF A;  2NYQ A;  1HDU A;  4JWP A;  1F2O A;  2PIY A;  1LCP A;  3LAC A;  3F8K A;  2GAN A;  4ZGY B;  2RC4 A;  3PEI A;  1K4J A;  1MJB A;  3I9S A;  1RO5 A;  1N71 A;  4KUB A;  1PCA A;  2FXF A;  3IEH A;  2HC9 A;  4OP4 A;  3ZZI A;  1YLO A;  4CAF A;  5A27 A;  3BI1 A;  2CNT A;  2GU2 A;  2B3V A;  1X10 A;  4LX9 A;  2BL1 A;  1B6B A;  1Z4E A;  2R98 A;  4R57 A;  3FH4 A;  2PJ5 A;  4ZI6 A;  2PJ8 A;  3NFZ A;  2B4D A;  4FUU A;  2PJB A;  5FVJ A;  4YFJ A;  2ZEP A;  4PXD A;  2BCO A;  5HVF A;  1P4N A;  2HQY A;  2YGW A;  4A94 A;  2J8R A;  3PB7 X;  4UEE A;  1S7N A;  4KOT A;  5H86 A;  2PJ1 A;  2C6P A;  5H84 A;  4P4E A;  2QJ8 A;  1V0C A;  3NH5 A;  4F9U A;  1Y0Y A;  4E2A A;  1YLE A;  2Z3N A;  1IYL A;  4CYP A;  4EFD A;  2DPT A;  3TFY A;  4HPS A;  4XNH B;  2Q7S A;  2CTB A;  1FNO A;  5HH1 A;  5AG5 A;  5EMI A;  1BPN A;  1YGH A;  3R9E A;  4AB7 A;  3B2Y A;  3S6F A;  3SJX A;  4A2Z A;  3L2N A;  4OLL A;  4TWE A;  2AFS A;  6CPA A;  1Z8T A;  3EC4 A;  4GXH A;  4MCQ A;  2ZW6 A;  4ZX9 A;  5IV0 A;  3FXT A;  4HNY B;  3KR4 A;  4QC6 A;  4B11 A;  4A31 A;  3ISX A;  2CNS A;  1XEB A;  3PRT A;  1IYK A;  4PXC A;  5K8P A;  3PFE A;  3P2H A;  2IQ6 A;  4QUS A;  4A38 A;  4P44 A;  1ZLI A;  1Y9W A;  3WC7 A;  1S3Z A;  1JWQ A;  3JTK A;  4FD6 A;  1S5K A;  5C88 A;  5G22 A;  2XEI A;  4R8F A;  3FRM A;  1ARL A;  4J3G A;  4BIN A;  3WR7 A;  1QSN A;  3TO9 A;  3D7H A;  4R9M A;  2AFO A;  4NJR A;  4DJL A;  2Z11 A;  1I21 A;  2J9A A;  1Z5R A;  1M4G A;  3TOB A;  4OC2 A;  2JEW A;  4MCP A;  4DNC A;  1LOK A;  3TTH A;  2FT0 A;  4M6G A;  3B3W A;  3MRU A;  2Q4Y A;  2EVN A;  4KOY A;  3TX8 A;  5AG6 A;  4KLV A;  1ZG8 A;  2GFQ A;  2VL1 A;  2IJZ A;  4UFV A;  2C1C A;  3OWC A;  3A9L A;  2JEV A;  2ZW7 A;  2QYV A;  3R1K A;  1IB1 E;  2C27 A;  4KOS A;  3TC8 A;  1VKC A;  4UFW A;  1IIC A;  2PJ6 A;  2Q44 A;  5LRK A;  4MHN A;  5IX3 A;  3FYN A;  1LAM A;  3SI2 A;  1Z8L A;  1MJ9 A;  2HUZ A;  2JDC A;  2JLM A;  3D2M A;  3PBE A;  1Z4R A;  2ZEM A;  4PSW A;  4MFL A;  3H8F A;  3R96 A;  3LOD A;  4KOV A;  1AMP A;  4KOR A;  1Z8W A;  3MGD A;  4H2K A;  4MFJ A;  4Y49 C;  1CJW A;  2B3U A;  4RS2 A;  3NH8 A;  2O53 A;  1QMU A;  3D66 A;  4KVO E;  1Q2C A;  4R87 A;  4C68 A;  2F8H A;  4L8A A;  4CAX A;  3SXO A;  2VZY A;  4MHY A;  4UF4 A;  5LYI A;  2AFZ A;  1TF9 A;  5ELY A;  3S6H A;  1HDQ A;  2ZEG A;  2ZEN A;  4KUA A;  5AG4 A;  4NGQ A;  4CPA A;  4XPD C;  4BMH A;  3DR6 A;  3RNZ A;  4KOX A;  4MHP A;  4C7H A;  4W9Y A;  2B4B A;  3B8G A;  4RUH A;  4Q38 A;  4G1P A;  2JBJ A;  1R3N A;  1TKF A;  5EBV A;  4IAV A;  4CGO A;  2ZOG A;  4I49 A;  2AE6 A;  2FVG A;  2NMT A;  4KLW A;  4UEZ A;  3TT2 A;  2BO9 A;  1RTQ A;  4IF5 A;  4HNW B;  3WC6 A;  4P4J A;  3PB8 X;  1YX0 A;  4DUK A;  1Z2L A;  3DGV A;  2EUI A;  2DF5 A; 
#chains in the Genus database with same CATH homology
 5HMN A;  2Z3K A;  3D8P A;  3IWE A;  2H5M A;  3EXN A;  5F48 A;  1WWZ A;  2K5T A;  3DDD A;  3JVN A;  4UCN A;  4B14 A;  2Q4V A;  1OZP A;  1MK4 A;  2BUE A;  3DNS A;  5AGE A;  3T90 A;  3IWG A;  4C2Y A;  2J8M A;  2VZZ A;  4AVB A;  2I79 A;  4X5K A;  4II9 A;  4QB9 A;  3FB3 A;  2PQ8 A;  4A30 A;  2YNC C;  4FD5 A;  4B5O A;  1FY7 A;  3S6G A;  5A28 A;  2OZG A;  4OAE A;  2G0B A;  4Y49 B;  2Q7B A;  1U6M A;  4KOW A;  1PU9 A;  3GKR A;  5CNP A;  1BOB A;  1Z9U A;  4B12 A;  2PRB A;  2ZXV A;  3PGP A;  3K9U A;  4UWJ A;  2ZW5 A;  4MY0 A;  4KVX A;  1I12 A;  4XPD B;  2Q0Y A;  5ISV A;  3DSB A;  4XPL A;  2Y0M A;  4PK2 A;  4B5P B;  4B13 A;  4AG7 A;  2FIW A;  3SHP A;  2ZW4 A;  3TOA A;  4L89 A;  3F0A A;  4RI1 A;  3G3S A;  4GS4 A;  4R3L A;  3R95 A;  2P6F A;  4E0A A;  1Q2Y A;  4C7I A;  2GIV A;  4PSX A;  4BBH A;  2VI7 A;  5IB0 A;  2P6G A;  3UY5 A;  3V8I A;  4CGL A;  4XPK A;  2F5I A;  2KCW A;  4KOU A;  4H6U A;  5KTA A;  1MJA A;  3FBU A;  2VBQ A;  2FS5 A;  3R9F A;  1YK3 A;  4UCP A;  3S6K A;  4KSA A;  2X7B A;  1YRE A;  3E0K A;  1B87 A;  3QB8 A;  3H4Q A;  2VQY A;  2J8N A;  1NSL A;  4CRY B;  4CYN A;  2P6E A;  3DR8 A;  4NF1 A;  4Q36 A;  2VXK A;  1ZO0 A;  2QIR A;  4NXY A;  1VHS A;  2Z3P A;  3I3G A;  2OU2 A;  2OB0 A;  2G3T A;  4KS9 A;  4QBJ A;  5KTC A;  2ZPA A;  4MFP A;  2D4O A;  4CS0 B;  2BSW A;  5F46 A;  1QSR A;  2PSW A;  5F49 A;  3TE4 A;  1TIQ A;  2WPX A;  3LD2 A;  3IU2 A;  2REF A;  1QSM A;  2YND A;  2Z10 A;  5G20 A;  2JDD A;  2I00 A;  1S7L A;  4JD6 A;  3BJ7 A;  3FIX A;  3RYO A;  4A33 A;  4KZT A;  2AJ6 A;  3W6S A;  4CAW A;  4H89 A;  4CYO A;  4OAD A;  4HKF A;  1QST A;  3PZJ A;  4CRZ B;  4F0X A;  4F0Y A;  3EFA A;  3EY5 A;  2OZH A;  3GY9 A;  2Z0Z A;  2IL4 A;  1R57 A;  1Y7R A;  5F47 A;  2G3A A;  4MBU A;  2WSA A;  2B5G B;  1Y9K A;  4M85 A;  2FCK A;  1J4J A;  3BJ8 A;  4UFX A;  4FD4 A;  2R7H A;  4MY3 A;  1Q2D A;  1KZF A;  2FSR A;  4C2X A;  4U5Y A;  1NMT A;  5J8C A;  3GYA A;  1WK4 A;  3T9Y A;  2FE7 A;  4R3K A;  2CNM A;  2WPW A;  3CXP A;  3W91 A;  2BEI A;  3FNC A;  2QML A;  4F6A A;  2PR8 A;  2B4D B;  1XF8 A;  3H5Z A;  4AG9 A;  5E96 A;  3VWE A;  2R8V A;  1YVK A;  2Z3M A;  2VEZ A;  3TO6 A;  4MFQ A;  5BWA B;  3KKW A;  1QSO A;  2PC1 A;  3P2F A;  3PP9 A;  3TO7 A;  2Q04 A;  4QVT A;  5G1Z A;  2O28 A;  3JUW A;  4JXR A;  4AVA A;  1LRZ A;  2WUU A;  1PUA A;  4JJX A;  4CYQ A;  2PDO A;  3C26 A;  5J8F A;  4PK3 A;  5I0C A;  4UBR A;  4HNX B;  4NCZ A;  4B5P A;  4NSQ A;  1IID A;  2FIA A;  4CAE A;  4M3S A;  4FD7 A;  4JLY A;  3QAH A;  2FL4 A;  3N7Z A;  5DWN A;  2OH1 A;  2QEC A;  4YGO A;  4C2Z A;  4KVM E;  2YNE A;  2Z3L A;  4ORF A;  4UA3 A;  2PR1 A;  3VWD A;  1P0H A;  1M44 A;  1XE4 A;  1YVO A;  2R1I A;  2DPS A;  2ATR A;  3W6X A;  2REE A;  3IU1 A;  1GHE A;  4UWI A;  5C82 A;  5JQ4 A;  4LUA A;  3ZJ0 A;  4A32 A;  2Z3O A;  2YNC A;  4U9Z A;  2DXQ A;  4MHD A;  1XMT A;  4H6Z A;  4IUS A;  2CXA A;  5JPH A;  3CXQ A;  3NE7 A;  2CY2 A;  4MFK A;  1S60 A;  3D2P A;  4E8O A;  1ON0 A;  3G8W A;  4U9Y A;  4EVY A;  2P0W A;  2OZU A;  1SQH A;  2A4N A;  4YRH A;  1L0C A;  1CM0 A;  1NE9 A;  4JXQ A;  4XNH C;  1M4D A;  5DWM A;  1XIX A;  2B58 A;  2D4P A;  1M1D A;  1KUX A;  3TCV A;  5GCN A;  3BLN A;  2HV2 A;  3D3S A;  3F5B A;  1YR0 A;  4CGP A;  3EO4 A;  2GE3 A;  1RXT A;  4UCM A;  3IGR A;  2ARH A;  4CAV A;  5G21 A;  5AG7 A;  5EC4 A;  1S7K A;  4PV6 A;  1KUV A;  4K30 A;  1M4I A;  1KUY A;  3SXN A;  3R9G A;  1S7F A;  1I1D A;  4MJ8 A;  4ZBG A;  4ONU A;  4A95 A;  4CGN A;  3CXS A;  4MFZ A;  4B10 A;  1BO4 A;  4AVC A;  1UFH A;  4MI4 A;  2B5G A;  5KTD A;  4CGM A;  4KSF A;  4JWP A;  3F8K A;  2GAN A;  4ZGY B;  2RC4 A;  1K4J A;  1MJB A;  3I9S A;  1RO5 A;  1N71 A;  4KUB A;  2FXF A;  3ZZI A;  4CAF A;  5A27 A;  2CNT A;  2B3V A;  4LX9 A;  2BL1 A;  1B6B A;  1Z4E A;  2R98 A;  4R57 A;  2B4D A;  5FVJ A;  4YFJ A;  1P4N A;  2HQY A;  2YGW A;  2J8R A;  1S7N A;  4KOT A;  5H86 A;  5H84 A;  1V0C A;  4E2A A;  1YLE A;  2Z3N A;  1IYL A;  4CYP A;  2DPT A;  3TFY A;  4XNH B;  5HH1 A;  5AG5 A;  3R9E A;  1YGH A;  4AB7 A;  3S6F A;  4A2Z A;  4OLL A;  3EC4 A;  2ZW6 A;  5IV0 A;  3FXT A;  4HNY B;  4QC6 A;  4B11 A;  4A31 A;  2CNS A;  1XEB A;  1IYK A;  3P2H A;  4QUS A;  1Y9W A;  1S3Z A;  4FD6 A;  3JTK A;  1S5K A;  5C88 A;  5G22 A;  3FRM A;  4J3G A;  3WR7 A;  1QSN A;  3TO9 A;  4R9M A;  2Z11 A;  1I21 A;  1M4G A;  3TOB A;  4DNC A;  3TTH A;  2FT0 A;  2Q4Y A;  2EVN A;  4KOY A;  5AG6 A;  4KLV A;  4UFV A;  3OWC A;  3A9L A;  2JEV A;  2ZW7 A;  3R1K A;  1IB1 E;  2C27 A;  4KOS A;  1VKC A;  4UFW A;  1IIC A;  2Q44 A;  5IX3 A;  3FYN A;  1MJ9 A;  2HUZ A;  2JDC A;  2JLM A;  3D2M A;  1Z4R A;  4PSW A;  4MFL A;  3R96 A;  3LOD A;  4KOV A;  4KOR A;  3MGD A;  4MFJ A;  4Y49 C;  1CJW A;  2B3U A;  4RS2 A;  4KVO E;  1Q2C A;  4R87 A;  4C68 A;  4L8A A;  4CAX A;  3SXO A;  2VZY A;  3S6H A;  4KUA A;  5AG4 A;  4XPD C;  4BMH A;  3DR6 A;  4KOX A;  4C7H A;  2B4B A;  3B8G A;  4Q38 A;  5EBV A;  4CGO A;  4I49 A;  2AE6 A;  2NMT A;  4KLW A;  3TT2 A;  4IF5 A;  4HNW B;  1YX0 A;  4NEX A;  2EUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...