3E0OA

Crystal structure of msrb
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
142
structure length
142
Chain Sequence
b'MMAYNKEEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDTSHGMIRTEVRSRTADSHLGHVFNDGPGPNGLRYCINSAALRFVPKHKLKEEGYESYLHLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide methionine sulfoxide reductase msrB
publication title Structural and Kinetic Analysis of an MsrA-MsrB Fusion Protein from Streptococcus pneumoniae
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 40
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.8.4.12: Peptide-methionine (R)-S-oxide reductase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01641 SelR SelR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.20 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Peptide methionine sulfoxide reductase. 3e0oA00
5AMHA 4CI1B 4TZ4C 4CI3B 3HCJA 3HCHA 2KV1A 3WX1A 4V2YA 2K8DA 3CEZA 3HCIA 4CI2B 4TZUA 3WX2A 4V31A 4V30A 3CXKA 4V2ZA 4TZCA 2KZNA 3HCGA 1L1DA 3E0MA 3E0OA 3MAOA
chains in the Genus database with same CATH superfamily
5AMHA 1H6QA 4CI1B 4TZ4C 1TXJA 4CI3B 3HCJA 4A2XA 2QFDA 4A2VA 3HCHA 3EBMA 3P3KA 3ZD6A 5F98A 2YKGA 3OG8A 2KV1A 2LVLA 3WX1A 3EQTA 5F9HA 2FU5A 4V2YA 2RQBA 3GA3A 2K8DA 3CEZA 2RMJA 3HCIA 3LRRA 4CI2B 3LRNA 4TZUA 1HXRA 2QFBA 4V31A 3WX2A 2HR9A 4V30A 1FWQA 3CXKA 1YZ1A 2KWBA 4V2ZA 3ZD7A 3DJMA 4TZCA 2KZNA 3HCGA 2LOYA 1L1DA 3E0MA 3FACA 2W4RA 3NCUA 2RQAA 3E0OA 3MAOA 4BPBA 5F9FA 4AY2A 1H7YA 5E3HA
chains in the Genus database with same CATH topology
5AMHA 4CI1B 4TZ4C 4CI3B 3HCJA 3HCHA 2KV1A 3WX1A 4V2YA 2K8DA 3CEZA 3HCIA 4CI2B 4TZUA 3WX2A 4V31A 4V30A 3CXKA 4V2ZA 4TZCA 2KZNA 3HCGA 1L1DA 3E0MA 3E0OA 3MAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AMH A;  4CI1 B;  4TZ4 C;  4CI3 B;  3HCJ A;  3HCH A;  2KV1 A;  3WX1 A;  4V2Y A;  2K8D A;  3CEZ A;  3HCI A;  4CI2 B;  4TZU A;  3WX2 A;  4V31 A;  4V30 A;  3CXK A;  4V2Z A;  4TZC A;  2KZN A;  3HCG A;  1L1D A;  3E0M A;  3E0O A;  3MAO A; 
#chains in the Genus database with same CATH topology
 5AMH A;  1H6Q A;  4CI1 B;  4TZ4 C;  1TXJ A;  4CI3 B;  3HCJ A;  4A2X A;  2QFD A;  4A2V A;  3HCH A;  3EBM A;  3P3K A;  3ZD6 A;  5F98 A;  2YKG A;  3OG8 A;  2KV1 A;  2LVL A;  3WX1 A;  3EQT A;  5F9H A;  2FU5 A;  4V2Y A;  2RQB A;  3GA3 A;  2K8D A;  3CEZ A;  2RMJ A;  3HCI A;  3LRR A;  4CI2 B;  3LRN A;  4TZU A;  1HXR A;  2QFB A;  4V31 A;  3WX2 A;  2HR9 A;  4V30 A;  1FWQ A;  3CXK A;  1YZ1 A;  2KWB A;  4V2Z A;  3ZD7 A;  3DJM A;  4TZC A;  2KZN A;  3HCG A;  2LOY A;  1L1D A;  3E0M A;  3FAC A;  2W4R A;  3NCU A;  2RQA A;  3E0O A;  3MAO A;  4BPB A;  5F9F A;  4AY2 A;  1H7Y A;  5E3H A; 
#chains in the Genus database with same CATH homology
 5AMH A;  4CI1 B;  4TZ4 C;  4CI3 B;  3HCJ A;  3HCH A;  2KV1 A;  3WX1 A;  4V2Y A;  2K8D A;  3CEZ A;  3HCI A;  4CI2 B;  4TZU A;  3WX2 A;  4V31 A;  4V30 A;  3CXK A;  4V2Z A;  4TZC A;  2KZN A;  3HCG A;  1L1D A;  3E0M A;  3E0O A;  3MAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...