3E18A

Crystal structure of nad-binding protein from listeria innocua
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
348
Chain Sequence
LKKYQLVIVGYGGMGSYHVTLASAADNLEVHGVFDILAEKREAAAQKGLKIYESYEAVLADEKVDAVLIATPNDSHKELAISALEAGKHVVCEKPVTMTSEDLLAIMDVAKRVNKHFMVHQNRRWDEDFLIIKEMFEQKTIGEMFHLESRVHGANGIPGDWRHLKAHGGGMVLDWGVHLLDQLLFLVDSNVKSVSANLSFALGDEVDDGFVTFITFENGITAQIEVGTTNFIKLPRWYVKGTEGTGIIHDWDLSGEIVKPTALAKTSEPTPIKAGQGLTKTMAPPSEEATNTLSLPAPAKLAPSFYNNFVDVLNNTSEPIVQNEEVYQVLKLIEAIFEAAETNRTVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oxidoreductase
publication title CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Oxidoreductase
total genus 104
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e18A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e18A01
5B4VA 3UAGA 1EFLA 1YVEI 4ALMA 3IC5A 4FFMA 3QV1A 3Q2IA 1K2WA 1Q1NA 4OMUA 1UDCA 1T4DA 1HEUA 3WIDA 4WLUA 3A28A 4UEJA 4ZA2A 1T24A 4YEDA 1QYCA 5EPOA 1PR9A 1KVQA 3I9NA 1RYDA 4BNVA 4QUKA 4DLAA 1MG0A 1YQGA 1ML3A 1Z7BA 4YAIA 3WMWA 1A7AA 3KYDB 3JQ8B 4IDBA 4OQZA 1GCUA 4XQ9A 1GADO 2GPTA 1NVMB 3VPGA 2YV2A 3TRIA 3G0OA 1DBVO 2NLOA 1TT5B 4IIVA 3LDHA 2X0RA 2GR9A 3HG7A 4HFJA 3GDGA 2B37A 1XR3A 4GGPA 3ASUA 1SO8A 3AUUA 2EP7A 1IE3A 2QZZA 1E3WB 4XR4A 2VRCA 4UEKA 1K6JA 4IY1A 5ICSA 3KTDA 4NBVA 1PZEA 3RUCA 3OA2A 4WUVA 2HJRA 4YT5A 1W73A 2Y1EA 3W6ZA 5JAQA 2EERA 3LU1A 1NR7A 3BTVA 1DLJA 5IZ4A 3E8XA 5CDTA 3HDHA 3K8ZA 3DBRB 4NBTA 3ADOA 4YCAA 5CPFA 5F1OA 4OQYA 2D0IA 2J5QA 1E1MA 3GDOA 1NNUA 1ONOA 2ZK7A 1A9ZA 1PS9A 4CM1A 5JCJD 4RDIA 1SCUA 3FI9A 3UUWA 3VVBA 1MC5A 4MOWA 1ISIA 5A1TA 3PVZA 4YA6A 2E6UX 5L40A 1VRWA 4R1SA 4CQMB 5JDCA 3JQ9A 4IXTA 1ZFNA 2BFOA 4A2CA 1I30A 1ZMTA 4JP3A 4BB6A 1SB9A 5GZ1A 4P4NA 3OA0A 3TL2A 3DHNA 1Y7TA 3EK2A 2NQTA 2Y66A 4R69A 4AJOA 4ONEA 3I4CA 5B1YA 2FZWA 3DTTA 2OORA 4RF2A 5GY7A 1OZAA 1TEHA 5TIIA 4BO4A 3G79A 3AOEA 3EC7A 3DHEA 2Y0EA 4OIMA 3KYCB 3V2UA 1WPQA 4CLEA 2B83A 2JCYA 4ITUA 1C1DB 3O38A 4ALJA 2O7QA 4YJHB 5G4KB 4UVDA 1VLLA 1C14A 3NJ4A 4QXMA 4UVHA 4YJDA 4GMGA 2YHIA 4II3A 4B4WA 4MO2A 4HUJA 3E03A 1LSOA 1NPTO 2D59A 2JKVA 4FW8A 3CMCO 1LTHR 3PIDA 3ZGYA 3GN1A 2O50A 3PFWO 3ZHYA 4DBVO 5CEFA 4ID9A 5BNIA 5IDXA 2FRDA 1XKQA 3FD8A 4ZJUA 1KVUA 3PI7A 3JTMA 4EBFA 2ZTMA 4UULA 4R4JA 2C82A 1PL7A 3RFXA 4RO0A 2PKQP 2VYVA 2ZTLA 1O0SA 1ENOA 4NBWA 4ZGWA 1PJCA 2Q1WA 3AY3A 3PQFA 4U6SA 4ZN6A 1GUFA 1BSVA 2WE8A 3KYDA 2PR2A 4OXYA 3JQ8A 4NPCA 4FC6A 5CAEA 5B37A 2QX7A 1RM4A 4BQRA 1JLLA 1NBOA 1WDKA 1JWAB 1QV7A 3PEFA 4E2YA 2VHYA 2RIRA 3ZWBA 1KVRA 5JAMA 3RC9A 4F6LA 4YQZA 1QSGA 3LC2O 1I3LA 4PLTA 1JTVA 1NQAO 1I8TA 3DOJA 4AJKA 1R15A 1IHXA 2WDZA 2BFMA 4J4BA 4OM8A 4Q3EA 5ENVA 5U1PA 1E3WA 3NGLA 4UUPA 4MP6A 3BMCB 3K5PA 4J7CA 4KP7A 2ILTA 2NNLD 5TRTA 4QFCA 1GD1O 3C8MA 3SBOA 4RV9A 4IS2A 2GZ2A 1JKIA 3LC1O 1E3LA 4MKXA 1Y8RB 1X7GA 4WKGA 2D8AA 3H3FA 3C24A 4BGEA 1P0FA 3HZZA 4RLSA 1NQOA 4J1QA 3E18A 1YDEA 4FN4A 4CMEC 5F5LA 1DIRA 4EGFA 3DBRA 1HE3A 3EHEA 3JYPA 1P1IA 2Q2WA 3D4PA 2YQ4A 2DTEA 1EBUA 1YOVB 4RPHA 1PJTA 3PZRA 3ZWOA 2JFGA 4BO1A 1PTJA 3ZHZA 1B8PA 1YONA 3IP1A 4E2XA 3O26A 1E7YA 1ZSNA 1EFKA 5JS6A 3PHIA 3GNSA 1AE1A 3DBHB 4CQMA 4QTZA 2GD1O 1CF2O 4YAJA 5B12A 1PL6A 1P44A 2HO5A 4AJ4A 2BI7A 2JHGA 3U9LA 1LUAA 4RVHA 3G1TA 1I3NA 1FK8A 4DXHA 2GZ1A 2W2KB 2FPGA 4XYBA 3OIDA 4OH1A 2EXXA 2V6GA 4PGFA 4XD2A 5DNAA 2ZJ0A 2YY7A 1O94A 3DAFA 3HN7A 4D42A 4DPMA 1F0YA 1GUYA 4FFLA 1Y5RA 3K9QO 1CERA 4R01A 4YYZA 5K9ZA 3R3SA 2ZYAA 3PHLA 3KYCA 3MCVA 4I9UA 5FFFA 5T8KC 2ZIZA 1PGJA 3EVNA 3OEYA 2AQHA 1H2BA 1C1DA 3I9JA 3QIVA 1ISJA 4YJHA 5G4KA 4NU5A 5I8ZA 2E4AA 4KDEA 2D3TA 2H63A 3KBOA 1I0ZA 3ONEA 3X2EA 1UP6A 2FSVA 4N5LA 4M1QA 3I9KA 3WGHA 1DSSG 5DT9A 3S55A 1P1FA 4NFYA 1UJMA 3R6DA 2NTJA 2GCGA 5EIOA 2AW5A 1W6UA 1ADFA 1U4OA 1B14A 5JYDA 1CWUA 1V3UA 3NYWA 1W8DA 4Z0PA 1ZIDA 2C7VA 2X9GA 2G76A 3P7MA 4HV4A 2O3UA 4E32A 4CM3A 3KSDO 3I9LA 3LF2A 1TLTA 1GU7A 4II2A 4J2OA 4N5NA 3RI3A 5A9SA 5TF4A 3G1UA 1GY8A 3RFTA 4TROA 2O48X 2VWGA 3OIGA 1KC1A 4HFRA 3HN2A 4R1TA 2XF8A 3MWDB 3TFQA 1HDYA 3K2EA 1ISHA 3AOEC 4K1LA 1LNQA 1DB3A 4OYRA 3BMQB 4FPXA 4J0FA 3RWBA 2ZB3A 2YUTA 1SZJG 3OIFA 4PG8A 4QEDA 1JWBB 1I33A 4FFNA 1PJ2A 1BRMA 2JAPA 1D7OA 3S2EA 2BGKA 3GRKA 1LDNA 3BMCA 4U0KA 2OP1A 1XA0A 3QJ5A 4UREA 5TJ9A 4BL5A 2IRWA 1E7QA 4RF5A 4FJ0A 1TT7A 2J5RA 2O4CA 3M1AA 3PDUA 2YQ5A 1C0LA 4Y6PA 3SJ7A 3DWFA 1Y8RA 4FB5A 4CMIB 3RUIA 1M75A 1PR3A 4E5PA 4R41A 2FZEA 4Z9FA 5A03A 4ZU3A 1O6ZA 3L6EA 3INTA 5A04A 5CFZA 4RQUA 3MJEA 2WYWA 1GYQA 1HZJA 3SC6A 3TSCA 3V2HA 2FR8A 1ID1A 2P4HX 3L4BC 4AJ2A 4DTIA 4EITA 1QMGA 2ZQYA 1LQTA 5BNFA 2ZJ1A 4EEXA 4YWJA 4WOJA 1O5IA 4NU6A 1PGQA 1O9BA 3DBHA 2Q99A 5DCYA 1IPFA 4EEZA 1YB5A 3IAHA 1T2DA 2ZQZA 4XDYA 4IIUA 1MFZA 4RDHA 1MV8A 4CQLB 4BO8A 3W8DA 4LSMA 3F3SA 3HADA 4QT0A 3CPSA 4CV2A 3NRCA 1JAYA 2NUAA 1CDOA 4EYEA 4TZTA 5G0VA 4DYVA 1AN9A 4YRAA 2ZB8A 4NFSA 2W98A 1NR1A 3C7DB 4GWKA 1EBFA 4ZICA 2UVDA 2W4QA 4DREA 3RKRA 1KVTA 5DCWA 1B3BA 1PWZA 1Z6ZA 4NJOA 5JYFA 1W0CA 2D5AA 5A9RA 3DC2A 3EY4A 1AGNA 4AG3A 3IDSA 2P68A 1K5HA 4FGWA 1RM0A 1EVZA 2D1YA 3L07A 4ALLA 2CF6A 3ANLA 2PGLA 4FC7A 4R68A 2YV1A 3QWIA 2CDBA 4E6PA 1UAYA 2D2IA 1UZMA 3QWHA 4P8RA 4RPJA 2F00A 4QSMA 3TL3A 2B4RO 5I9MA 1L7DA 3GVPA 1NFFA 1LI4A 2EGGA 4W9NA 5LDGA 1UXIA 2EKPA 2V6MA 3S1LA 2ZCUA 4RZHA 5DDIP 1BXGB 1D1SA 3AUTA 3X2FA 3WBBA 1T25A 1T4BA 1HDOA 4CMJA 4MVJE 4BO2A 2WD7B 2C5EA 4JX8A 2FSSA 5AXBA 2WEKA 4IMPA 4TVOA 2DTXA 1H5QA 2OUIA 2Y1CA 3U4CA 2CDAA 3CINA 1O8CA 2VOEA 3FTNA 5F1PA 3RROA 1NXQA 2CSUA 2WM3A 4D41A 1U2GA 2VRBA 3QWBA 2PGJA 1FDWA 4J9UE 4OSOA 3VKUA 3UKOA 8ADHA 4O5OA 3TFOA 1XQ1A 5KVCA 4RL6A 3UICA 1P1KA 2I66A 5L4SA 3Q9NA 3ANMA 5CEJA 2EJVA 1JA9A 3O9ZA 3BMQA 2EG9A 1TB4A 1EVJA 3CMMA 3AWDA 1YL6A 1N7GA 3OFSA 3AFMA 1C3VA 2B5VA 4F45A 1XCBA 1ONNA 1Z75A 4R1UA 1HE5A 4GL4A 3DTYA 1GZ4A 1U9JA 2I9PA 4NG5A 4YJGB 5ILGA 1ENZA 3JQBA 4O0LA 1LDEA 5IJZA 4FOOA 2Y1GA 2I3GA 2ZKLA 4FS3A 4L0QA 4I1IA 2VCYA 2DBQA 4CMIA 3I4FA 3L9XA 3KXDA 4L4XA 3K2BA 1A4IA 1O89A 2A35A 1X0XA 4A0SA 4YAKA 1UR5A 2DLDA 3ZWXA 1QLHA 3NDRA 4YPOA 4M89A 4AJEA 5F21A 1VKNA 4Z6KA 1B8VA 1YJ8A 1YQDA 4XGKA 4CV3A 3AUSA 5KTKA 4AJIA 3WGQA 4C4OA 4D3SA 1DHTA 1I24A 1ENPA 5AQ1A 4CLDA 1NFRA 3KB6A 5L95A 3GAFA 3KSZO 3DBVO 5HA5A 1ISFA 3OETA 1L7EA 2Y1DA 3RUDA 2O3SA 1A4UA 1N8KA 2HMVA 1ZUD1 1U3WA 3H5AA 3LLSA 2DKNA 4PLYA 4YJFB 3WSWA 1A71A 2PFGA 4CQLA 4OOFA 3W4IA 1DIBA 1HETA 4B7CA 1PS8A 2GN9A 1LSUA 4OJNA 4NIMA 3CE6A 3E9QA 4J16A 1M2WA 3CH6A 4B7XA 5L4LA 3JQAB 4JNKA 1YB1A 4YT8A 4LVCA 4XKJA 2EIHA 4BS9A 1T26A 4ALIA 1LDYA 1CYDA 3RCBA 2Q45A 3SVTA 1MFPA 2VQ3A 1X7HA 1IZ9A 5GMOA 1WWKA 2AQKA 3D4NA 3E5MA 3GMDA 3OJOA 1DOHA 4U7WA 2OOSA 1EUDA 1U3UA 3BHJA 4KWIA 4FJ2A 5KKCA 1Q0QA 2BLLA 2ZTVA 4BO7A 1QRRA 3HQ4O 4NHEA 4QO7A 3BMNA 3JYLA 1MC4A 2GYYA 3FBGA 4JLWA 2OXIA 5JPIA 3ASVA 1LJ8A 2ZATA 4UEOA 3KSUA 1LRKA 1KOLA 3T7EA 2OGUA 3VPFA 1BXGA 4IQGA 4B3HA 1BW9A 3GVHA 2CD9A 2GERA 1YB4A 3NV9A 4XQEA 3W1VA 2YFHA 2NU9A 2WD7A 5T73A 1LU9A 4RZIA 1XEAA 3B6ZA 2IXAA 5A3JA 5ES3A 1C0KA 3H65A 2RH4A 3PFFA 1GQQA 2JFHA 5K0ZA 1PGOA 4K6FA 1E5LA 5DF1A 4GWGA 5T6BA 2J3JA 1WAMA 1WZEA 1ZZEA 5BSFA 1N1EA 1K3TA 3OJFA 1WMAA 3VPSA 4PLFA 3PYLA 4M86A 1ZKMA 1F8GA 3P2YA 5U9CA 2HU2A 2FPIA 2IYPA 3MJTA 1NHWA 3DOOA 5EMHA 4BNFA 1KERA 5JYEA 5BT9A 3FPLA 4KUEA 4DL9A 5I8WA 3B1FA 4ROSA 1VL6A 1YGYA 2JL1A 2VHWA 2RBEA 3KZVA 3GA0A 3WQRA 3MZ0A 4BGVA 4BVAA 2ZYDA 1Q0LA 3H2SA 3M2PA 5KJFA 5LC1A 3WYCA 2O2YA 3U4HA 4NI5A 3LK7A 4ZQEA 3HFSA 2HJSA 1Y9EA 4Y98A 4ALKA 1EE2A 4EI2A 5JAZA 4W9NC 5IZCA 1IULA 3OMLA 2QZ9A 4LRTB 2BFPA 1YBMA 2DC1A 2NU6A 4TWRA 2DQ4A 3ZV4A 2I5PO 1ZO8A 1HE2A 3OHSX 1U1IA 4WCFB 1FDSA 4GLOA 4IDFA 3JV7A 4JXKA 4BHTA 3JD4A 3D1LA 2H5LA 1ONPA 2VTDA 1DLIA 2QYTA 4DPKA 3INGA 4JBHA 3DFUA 4IDCA 4CV0A 5JFOA 1XDWA 4YJFA 5IF3A 3VDRA 3FCOA 4NZ9A 4A5OA 3H3JA 4J49A 4H7PA 2IEBA 4JJGA 4NNJA 4F3YA 2GZ3A 3KYBA 1XELA 2Z1NA 4J1SA 4JBGA 5C3MA 3ZU2A 5GZ3A 3GY0A 1GZ6A 3JQAA 3MJVA 3WOHA 2XOXA 3B1JA 2A94A 2PY6A 3EDMA 4FFRA 2O2SA 3H5NA 5F3RA 9LDTA 1HSOA 1GYPA 1E0DA 4CMEA 3JQBC 4GSLA 4CR7A 4HNHA 1E7WA 3MWEB 1XHLA 4F6CA 2O4UX 4BNUA 2FR1A 1RWBA 3ZWCA 1U2DA 4BKUA 2V6FA 1DC5A 3WBFA 3PDJA 4XJTA 1E1LA 3DHYA 2Q50A 2UDPA 3QSGA 2BH9A 3VZSA 1WDMA 3ROPA 3GN2A 3BTOA 5FI5A 3UOGA 2X58A 4YTEA 3ROMA 1T2CA 1ZCJA 3ZNNA 4P38A 2VYND 1F8FA 5DN9A 3B20A 3MTJA 2I67A 2OZPA 1NVGA 4L4RA 1JDJA 5FWNA 2CF5A 1GAEO 4E2WA 3C7AA 2FY8A 3LT0A 4R3NA 2OL4A 3NT5A 4PZDA 2Y05A 5ER6A 3S8MA 1T1SA 5AXCA 3DR3A 3EUWA 3OECA 3QWAA 3V1UA 4AICA 5BR7A 3HJAA 3PYXA 1SEVA 4JN6B 5T8KA 1FDVA 1CJCA 4OGWA 2PK3A 3DZJA 3ZDFA 4ZD6A 3TZHA 3NDJA 3RUEA 2WTBA 3PLNA 1Z7EA 4E3ZA 3EGOA 3U0BA 1K6IA 1XU7A 3AY7A 4WNIA 4O63O 2A4KA 4H15A 4M8SA 1N5DA 5G4LA 1ADCA 1DXYA 2EKQA 2NVUB 5CEEA 3G17A 3H5RA 4TKMA 4Z3KA 5CDYA 4DVJA 3CIFA 1ZK0A 3WGIA 3QQPA 1R0LA 3MEQA 4U5QA 3F1LA 1PX0A 4M87A 3ETDA 3RBZA 4UVIA 1NASA 3KEQA 1X13A 5TGDA 4DGSA 1E1NA 3INRA 1SNYA 1A5ZA 5CDSA 3PHJA 6LDHA 4PZCA 1J0XO 1QP8A 4CLOB 4ND3A 4IUYA 1ZK4A 4YAGA 2VNSA 3GR6A 4CJXA 3GZNB 1FDTA 4BNWA 4WCFA 2V65A 1P3DA 3F47A 4Z0HO 3D5QA 5IDQA 5CDGA 1R37A 4EW6A 2GNAA 2AEJA 1OBFO 2CMDA 4ZQHA 1QLJA 1ARZA 1GR0A 3A06A 2IZ0A 5I7VA 3K73O 1SBYA 1J5PA 3ZU4A 4XB1A 4A73A 4CMGA 2QQ5A 2DTDA 1DDOA 2PH3A 4U0JA 3IKTA 1C0PA 5L4NA 1H94A 1LDGA 3PLRA 1U5CA 4EUFA 4J1TA 2PKRA 1PQWA 1AXEA 4PRKA 1PJLA 3SXPA 1LSJA 3PGJA 1ZK3A 1C0IA 2P9EA 2XPCA 4YBZA 5ADHA 4PN3A 4L74A 4HBGA 2Q4EA 4GH5A 3RU9A 3C3XA 3VH1A 4B8WA 1LRLA 1IL0A 3L4BA 4ND1A 2B4TO 1KIFA 4WEQA 5IZCC 3AM3A 5JDIA 4B4OA 4YB8A 1U8FO 4GI2A 3HNPA 4FIZA 5A9SB 4PIVA 3C1TA 2HRBA 2AE2A 2HLPA 4L4SA 2XXJA 1IB6A 4R16A 1Y9AA 1JVSA 3WYEA 4IM7A 4OKNA 4PLGA 1BTOA 1PJ4A 4AJNA 3S2GA 1S6YA 5L53A 4KQWA 1OMOA 3GAZA 4C7JA 2NU8A 5ER9A 3AU8A 3KETA 1OFGA 5HS4A 1GFSA 2VUUA 2WWRA 5JC8A 2VRCD 1VJ0A 5IN4A 1H2HA 4GQAA 2VHXA 2Y1FA 3UH1A 4G2NA 5EJ2A 3RFVA 2WMDA 4PLHA 1YE3A 3TZQA 1DJQA 3WTCA 5I9LA 1YL7A 4GX1A 4E0BA 1YH3A 1B8UA 4MINA 3FNGA 3ON5A 5EQDA 1DPGA 2IE0A 2YFQA 2B0JA 1U8XX 4NMHA 1WDLA 4HFMA 3OEWA 1UDAA 3FPCA 4W4TA 1VC2A 4BO0A 3GOHA 4GX0A 4R9SA 2CNBA 2NVUA 4D3DA 3SX2A 3C85A 2QRJA 4ZRMA 5TC4A 3NJ8A 3ZW9A 3VZQA 2G17A 3SLGA 7ADHA 1U3TA 1GPJA 1HL3A 2FN7A 3RD5A 1LLUA 1E3SA 4D0SA 1GV0A 5DZSA 2AEFA 2P4QA 2TMGA 4MVJM 2Q1TA 5KCZA 1MXFA 3BHIA 4CM5A 4R5HA 1V3TA 5FEUA 3ETEA 1NP3A 3HB5X 4FDAA 4B4UA 5B4UA 4CLOA 1D4FA 2ET6A 2VZ0A 1UZLA 1PJ3A 2IYOA 3GPIA 4RPKA 3GZNA 1HLDA 3P5SA 1L1FA 3HDJA 2FR0A 4UVGA 2JHFA 1WNTA 2HUNA 2X23A 3HFGA 4WEOA 2PZJA 5DOVA 1OC2A 5C37A 3CKYA 4XYMA 3I9OA 2O3QA 3GG9A 4XCVA 3DMTA 5L51A 2J6IA 4TRJA 5A02A 3WICA 5EL0A 4WK6A 1UP4A 4I5EA 4MVJP 1M6HA 2C7GA 3EAGA 2E82A 3MOIA 3OQ6A 5KKAA 3VTFA 3W4JA 3IMFA 1E7RA 2Q2QA 2X4GA 1UXKA 2G1UA 1SB8A 1F06A 1SPXA 2A9FA 1VSUA 4BMSA 2P2SA 2PV7A 4Y8VA 1GEEA 2WYUA 4W7HA 1N9GB 2JCVA 3JD2A 4HWKA 4Q3CA 1FDUA 1WP4A 3GDFA 5ITVA 3RQSA 3RUHA 4JROA 2VYVD 4IJVA 4XEHA 1R0KA 4BO5A 4MDHA 4XR9A 4DIOA 4IQ0A 3H9GA 3QVWA 2CVOA 1M6WA 4Z9XA 3DXFA 2NVBA 2QHXA 1SOVA 3TJRA 1KY5A 4WLEA 3O4RA 3UF0A 1BVUA 3GNTA 3WX0A 2Q49A 1N92A 3WGZA 2NACA 4WCFC 2HKIA 2VNAA 2P9GA 5T5QA 1P45A 3I6QA 3KO8A 4BMVA 3I1JA 4NBUA 2P9CA 3NUGA 4PLPA 2FOIA 5DBFA 3FSRA 1F17A 5KVQA 3FWNA 1KEPA 2AA3A 2BRUA 3GLQA 3A1NA 2Z5LA 3FTPA 5DBIA 4I08A 2YYYA 2DFDA 3O03A 4TMFA 2FHSA 4WLOA 3G3EA 3GGPA 3GEMA 3VTZA 1UDBA 4JCOA 1Q2XA 1G1AA 1X0VA 2BD0A 3S2FA 3RC1A 4CM9A 3PQEA 1I36A 1XWFA 1E6EA 2SCUA 3K96A 4L73A 2EWMA 4E33A 4FD3A 1Z74A 2Y93A 1PQUA 3KOUA 2FPPA 3F46A 3HDYA 3D0OA 3VH2A 3VDQA 1BXZA 4D79A 1ZSYA 4W6ZA 5IN5A 2ZCVA 4ZVVA 1R0SA 3NGXA 4J1NA 4RCVA 3RBXA 1LA2A 5DOZA 5JDIC 1NAHA 5I7EA 3JQFC 1HDGO 3QWFA 4R51A 1GZ3A 3KRTA 4G81A 4AL4A 1Y81A 3JQCA 4CQMD 2HK9A 4MIYA 3ITKA 4BKPA 2YDXA 4XGIA 4BMNA 4L8VA 5T64A 4L9RA 4BNNA 4ZQGA 1Z73A 3LQFA 4P4GA 1QR6A 4PRLA 5KJEA 3PK0A 5F1KA 5JCXA 3UN1A 5A9TA 1EK5A 3DFZA 1VSVA 5IXSA 4CR6A 1HLPA 4J90A 3QVSA 4CMCA 3WGGA 3ZZNA 1UAGA 3RUFA 1RJWA 2HMUA 1OAAA 2Q22A 4I5FA 4D45A 2NADA 3U09A 5JSFA 1E3IA 2AG5A 1P1JA 3C1AA 3DZHA 3ZV3A 2EHDA 1DIGA 4OSPA 5G0WA 4QX6A 1NWHA 2C59A 1F14A 2OFPA 2OO5A 2OBNA 4AFNA 2EV9A 4CMKA 5JE8A 3C1OA 1P9LA 3BMNB 1VL0A 2H9IA 4TKLA 5I7SA 1CQJA 3PIIA 3PHGA 1IUKA 4RLHA 4Y6RA 4E5NA 2VUTA 1MGOA 4BV9A 5KIAA 2R2GA 1U3VA 2RCYA 4J4HA 4XYEA 3ZV5A 4MVJA 2FWMX 3VKVA 4IZHA 4OKIA 1N9GA 2W8ZA 1PZFA 4BNIA 1BW9B 3IUSA 3UXYA 3VAZA 2NSDA 4ND4A 1ZW1A 4XQGA 4EUEA 3CTMA 3WLEA 3VC7A 4ZRNA 1PGNA 4JQCA 3ITDA 1WZIA 2Q3EA 4RVDA 1NWCA 3Q0EA 4UUMA 5L9AA 2YV3A 1PJQA 1VJ1A 1W4ZA 2OMEA 2RHCA 3F5SA 5KJ1A 4ZHSA 3IJRA 4NK4A 5EN4A 1MB4A 4R9RA 3DL2A 4R5MA 4BOYA 3A4VA 4Y9DA 2DVMA 5A4DA 2POQX 4RPGA 2F1KA 3BIOA 4I5GA 4BGUA 1HDZA 2O23A 5B4TA 5JY1A 2DM6A 5CG2A 2GN6A 4XDZA 2IZZA 4A03A 3ZU3A 3KV3O 1YWGO 2RAFA 3DMTC 3EZYA 3QHAA 1KY4A 3FRJA 1JVBA 4CMBA 4CUKA 1FF9A 1LEHA 3ZWWA 2EGHA 3OQBA 4Y67A 3FNHA 4BO9A 3CEAA 5L7TA 2BMAA 4ND2A 5A05A 5COAA 3QRWA 5TJHA 1X7DA 1KYQA 3TQHA 2CFCA 3ICPA 4S1VA 3TOXA 2YHUA 2X0IA 1MA0A 4KUGA 3H9UA 4WJZA 2GUGA 1IY8A 3H7AA 4OL9A 4MKZA 4XRGA 4WASA 3U62A 4RVFA 2R00C 3RBVA 4UVEA 2G0TA 3QVTA 4TVBA 3RC2A 4QECA 4D46A 5L7WA 4E5YA 4PZEA 1LC3A 3E6AA 5L3ZA 1KS9A 5KWEA 5IAAA 1VE9A 4XJSA 4IBOA 4N54A 4Z3DA 3WGTA 2YJZA 2HK8A 3F1KA 4A26A 5IXYA 3S2IA 3ZHXA 3DQPA 4RQTA 5M6DA 2BFAA 1X14A 3L0DA 2PZKA 5MGBA 3DAPA 4XX0A 2QYSA 4FOSA 2QG4A 1GDHA 4WPGA 3EVTA 3HE3A 1V6AA 4Z0TA 2NVWA 1LLDA 4CLRB 2DT5A 4GX2A 4IPTA 4PLVA 5TLSA 3Q2KA 3ONFA 1PQPA 1GQYA 1YRLA 2OP0A 1X15A 1HKUA 2LDBA 2DUWA 1J49A 1BMDA 2JAHA 3DONA 3GPDG 4XWYA 2GASA 4BNGA 3L4SO 1U5AA 2C2YA 3G49A 5H82A 3DZFA 3TDKA 1XIVA 4AJJA 4JBIA 5KOIA 3P19A 3GVCA 3K31A 3GVIA 3N7UA 3LVFO 2W90A 4NR0A 3GGOA 3WSVA 2W2LA 3C7CB 1D3AA 4BNKA 1ZK1A 3LT1A 1YO6A 4FGSA 1VPDA 4ILKA 4GVLA 1ENYA 1DC3A 1K89A 1XG5A 1G6KA 3RJ5A 3WYBA 2E49A 5G0TA 3V1TC 2CDCA 1N7HA 3ENKA 3JQGB 4N18A 4CLHA 4J2HA 3RUAA 1PSDA 4EJ6A 2Y99A 5U4QA 5I7FA 3RSHA 5JLAA 3TN7A 1V35A 5IFLA 4GKVA 1RYEA 4IJKA 3AFNA 4EUHA 4E5MA 3KVOA 3OQ1A 4FQ8A 3SLKA 4BGIA 3WJAA 4EDFA 1B26A 3ZHBA 3GFBA 4CM4A 3ZI0A 3FHLA 2ZTUA 2Y0DA 4MJLA 4RVUA 1PZHA 3GF4A 3FNEA 1ZJZA 4KQXA 1GUZA 4B3IA 3E1KA 1RM3A 1GL3A 3PWSA 3EW7A 3IJPA 3R1IA 4NFHA 2HK7A 4INAA 4DIFA 4A27A 4M49A 5ENDA 3OSUA 3ZWVA 2WYVA 2Y68A 1EMDA 3BYZA 3T4XA 3IKVA 1ZK2A 3MTGA 1Q7GA 2AMFA 1EUZA 1ZBQA 5KJCA 1ORRA 3VPXA 4U8GA 4PFJA 3WNQA 3I23A 3TZKA 2C2XA 1A9YA 1V8BA 2DFVA 4NH4A 4DC1A 4H3VA 3NTQA 3CUKA 1CETA 3OP4A 4W99A 2X6TA 3LT4A 5LDHA 2AG8A 3W8FA 3LC7O 1DHRA 1NAIA 1WXDA 1IHYA 2HMWA 2PZMA 4J3FA 2BGLA 1D1TA 2Q1SA 3BMOB 4HY3A 4BUCA 4AJHA 4CM8B 1M76A 4BNYA 4B8ZA 3ZU5A 4L75A 1HRDA 3PPIA 1EUCA 5COQA 1DRWA 3V2GA 4LCEA 3PHHA 4J6FA 5A3VA 2NU7A 2AEMA 5JO9A 1B0AA 1YQXA 3PWKA 2O3RA 5JCJA 3TOZA 4E31A 5EINA 1ULUA 4YT4A 1E6WA 3GG2A 4Q39A 3N74A 2Z1MA 1MLDA 4IMRA 3TPCA 1IZ0A 1HTBA 3ZWNA 4W82A 3AI3A 1HYEA 4N7RA 4EJ0A 1BHSA 1AXGA 1ZEJA 2Q46A 5THKA 4HNGA 5AOVA 5AXAA 4CLRA 4XB2A 4NJMB 4DA9A 1PWXA 1PJSA 4BNJA 1H0KA 2J3IA 3A9WA 2H1SA 2PLAA 3RJ9A 4LGVA 1J6UA 1XSEA 3WFIA 1R16A 1QYDA 2VT2A 3BHMA 4XA8A 3VH3A 4K26A 1YBAA 4PVDA 1P31A 1EQUA 2HMTA 3GK3A 2VZ9A 3I5MA 3R3JA 1WMBA 2PKQO 1I5RA 2PWZA 3FR8A 1ZXBA 2P5YA 4BKOA 3DB2A 3RVDA 5HM8A 1HDRA 1KEVA 1OC4A 2C07A 2TMDA 4LISA 5KVVA 3JQGA 3GQVA 1LQUA 1YS4A 3T4EA 4E13A 5EERA 5CPBA 2BF7A 4CUJA 2PNFA 3CZRA 4CM7A 3R0IA 4HADA 1RPNA 2PGDA 5DCUA 1NPDA 4YXFA 3STHA 2QRLA 3Q11A 4URFA 3WLFA 3ADPA 3VZRA 3AW9A 2B4QA 3SEFA 3LLVA 5ICMA 2VN8A 2AQIA 4LSWA 3SC4A 3MJCA 4BNZA 3H4VA 2VT3A 1A7KA 1PEDA 3F4BA 5TS3A 4MP3A 4JK3A 4P22A 3E5RA 4BNTA 1NX6A 4IXWA 3UCFA 1H6BA 4JJFA 3P2OA 1EE9A 1HYHA 3PXXA 4IZIA 1P33A 2G82A 2A92A 2GN4A 3H9QA 3GEDA 4TRNA 3ZWMA 3TWOA 1ISMA 1HZZA 2PH5A 4UAGA 2FP4A 1CRWG 3D3EA 3PRJA 4GSKA 3KHUA 2NTVA 1UXGA 4GVXA 1MG5A 4GAEA 4NK5A 3WXBA 3TF5A 5GZ6A 1I3KA 3OJLA 2VWHA 4OXNA 4M55A 5CHEA 3VPHA 3ROQA 4BQPA 4YDRA 2O7SA 2X5KO 3NX4A 3Q9UA 3WR5A 3Q1LA 3WMXA 3BZUA 1SOWA 3BMOA 1J4AA 3M1LA 3H6KA 1LBEA 1T1RA 5JBIA 4HXYA 4CM8A 3PTZA 1YKFA 4XYGA 1PJBA 3I3OA 2AE1A 4CMHA 1UZNA 7MDHA 2VUSA 2AXQA 3B70A 4I5DA 4L76A 5C7LO 4DC0A 4O1MA 3D4OA 4PVCA 4GPD1 3L6OO 3AY6A 1GCOA 3UFXA 2X0JA 1JU9A 3QVOA 1A72A 1JW9B 3JQEA 1ZMOA 1EVYA 2V7PA 1CQIA 4UUNA 3NEPX 4RVSA 4WCDA 4CL8A 1P1RA 3EMKA 5BQFA 3PYMA 4I8XA 1LXCA 5CP8A 3B1KA 1Y6JA 2OBYA 1JN0A 1E92A 1QG6A 2IZ1A 5K6AC 3MJ4A 4NJMA 4RF4A 1I2BA 1I2ZA 3GMSA 3VOSA 4DIBA 2DPHA 3IL2A 4Q3AA 4K9DA 3FWZA 3JQAD 3D7LA 1GPDG 1ZVMA 2QRKA 1Y5MA 4ALNA 3MJSA 4RJTA 2Y67A 3EYWA 1Y8QB 4YR9A 1YDWA 4HFNA 4BNHA 2J8ZA 3DZGA 5KJ6A 2X7HA 4J9VA 5C5IA 2XXBA 5HS6A 3QA9A 4MVJF 5JXWA 2EP5A 5JW6A 4BIIA 2BKAA 4JP2A 1B15A 2X86A 2PD3A 1GYRA 2GO1A 3PQDA 5H81A 4CM6A 3NT2A 5HTOA 3JQFA 4RORA 2C54A 1I10A 2HCTA 3WB9A 5BNTA 3DOCA 4KUHA 3ZNOA 4R54A 3HB4X 3W4KA 4CL3A 1C1XB 1O95A 1XGKA 5LCXA 4IS3A 3QVXA 2D4AA 3VZPA 2Q4BA 4YVFA 3UGKA 4E4YA 2BELA 1NVTA 2Q2VA 3LZ6A 3UW3A 5IDYA 1G0OA 4XZ3A 2UUPA 3AOGA 1T2AA 5HBRA 3ENNA 5H83A 4GGOA 1B3RA 4MP8A 1QKIA 4MKRA 2E48A 5F5NA 4EJMA 1P77A 4BO3A 3FN4A 3IUPA 1G0NA 1QYVA 3U5TA 2AHRA 3V1YA 3A14A 3GUCA 3WQQA 4E5KA 1TT5A 5BSEA 5AYVA 3OH8A 3H9JA 2H6EA 2B69A 3AM5A 3LF1A 5JO0A 3TZ6A 1LLQA 3GZ4A 4D7AA 1UXHA 4IJUA 1Z82A 3K92A 2JJYA 4PG5A 5THQA 2JFFA 3OJ0A 2JCXA 3W6UA 3NKLA 3U49A 5KVSA 1KC3A 2DBVO 1EQ2A 1U7TA 3K6JA 4KZPA 1UXJA 2PD6A 3CSDA 5A06A 2IEDA 1IYZA 1AUPA 1ZJYA 3UCXA 4F46A 4GBJA 1LX6A 4YRBA 3QW2A 2VWPA 3UHAA 4LCJA 1R66A 1KVSA 3ROKA 2RH8A 1PGPA 3NTOA 1KEUA 5JYAA 2GN8A 9LDBA 3ANNA 3COSA 3OM9A 4LK3A 5T57A 3RKUA 2UYYA 3HSKA 3LT2A 4W7IA 5ITWA 2BGMA 3DZKA 1NM5A 2IDZA 1UP7A 3PJEA 5G0UA 3RU7A 3I83A 1E6UA 1UUFA 1Z45A 2I76A 3NT4A 4NBRA 1NYTA 4RGBA 1DRUA 2VOJA 2X8LA 5L45A 4B4VA 3N58A 3GNQA 3JSAA 4MIEA 4YT2A 1H6CA 3D64A 1TVEA 1Y8QA 2R00A 1YJQA 5JY6A 4RVGA 2VHZA 2C5AA 1VI2A 5C7IO 5JMPA 2BHLA 1PU2A 5L7YA 3WGYA 3ONDA 2CVQA 4Q3BA 1SAYA 3PJDA 2BI8A 3PJFA 4HKTA 4PG7A 3M6IA 3ABIA 4TSKA 4PG4A 4KTVE 1BDMA 4Y6SA 4GMFA 4D43A 4K28A 1EK6A 4IQ8A 2YDYA 2EW8A 2X22A 1ULSA 4DUPA 3FF4A 4LW8A 2X0NA 5IDWA 1EZ4A 4HX5A 1C1XA 3I52A 3V8BA 1XU9A 3GC6A 2J3HA 2I99A 5JDCC 2HDHA 3JQ9C 1WW8A 4FJ1A 3KUXA 1RM5A 1E7SA 4DMLA 3KEOA 1Q7BA 3WQSB 2JD0A 5A5FA 1DFGA 3JYOA 4E12A 1E77A 2GF2A 4QO8A 4IJWA 4TRMA 5G0SA 4RF3A 4FFPA 3ZWPA 3QY9A 3RC7A 1U4SA 4A7PA 4BO6A 5JNLA 3TNLA 4D3FA 2P5UA 3Q6IA 3SJUA 4OAQA 1DIHA 2NWQA 4FFOA 4I9HA 3ZNQA 1DRVA 3I6IA 3BXXA 1BXKA 4DMMA 4OOEA 1CEQA 2GLXA 3D5TA 1MP0A 4J0EA 4TRRA 5DBGA 2DU8A 3QP9A 3H2ZA 4PLZA 3E9MA 2DUUA 1ZNQO 2HMSA 3M2TA 1I3MA 1NQTA 1HYGA 2IODA 3V5NA 1U7HA 1EVIA 2LDXA 4U6QA 1YXMA 4E21A 3U4IA 4OO3A 4YAEA 1P74A 4IINA 1LLCA 3GRPA 1GTMA 4ESOA 4LMRA 4J4TA 1LRJA 1V9LA 4IDAA 4LMPA 4S3MA 5ILOA 1ADBA 3QE3A 4WE3A 2HQ1A 5FYDA 3ZW8A 4ZQFA 4B79A 1DAPA 1FXSA 1I2CA 4KTTE 5EQFA 3ZWAA 4BKQA 1H6DA 1N2SA 2HRZA 3HHPA 3K30A 1QV6A 6ADHA 2G5CA 1YOVA 4G65A 4KWHA 4G5HA 3H9EO 4J7UA 2DBZA 2RHRA 2NTNA 3DMYA 4FBGA 3E9NA 1M67A 4RPLA 1B7GO 4D44A 5TT0A 3ZV6A 5AVOA 1MUUA 4TQGA 1HXHA 1BG6A 5I9NA 2C20A 3VH4A 1XQ6A 3WS7A 1ZXLA 5KNLA 1LDMA 5HRUA 4R3WA 2W2KA 3PWZA 4WLVA 2X9NA 3ZCXA 2UV8A 2EW2A 3UCEA 3ZH2A 1QXSA 3JQDA 1EDZA 2PA3A 1E3JA 2PD4A 3KLMX 3H8VA 3AM4A 2Y1OA 4B7UA 3DO5A 3GHHA 2OHXA 3GFGA 3GT0A 2X9VA 1LSSA 3ZWYA 1ZH8A 4KDFA 3WGOA 3IIEA 3GH3A 1NHGA 3AU9A 4CM4B 5TSDA 3WJ7A 3AUAA 1H6AA 2XAAA 4I9NA 3HUDA 1BDBA 3F5QA 2X5OA 1DAOA 4FCCA 2NM0A 1H9AA 4N5MA 4DPLA 1H9BA 3D3WB 3NAQA 3AI1A 1R6DA 3L9WA 4GX5A 2I65A 4D0RA 4XIJA 2CY0A 3JQ7B 4NDNE 2Q1UA 1IOLA 1HT0A 3W8EA 2VTEA 2ZYGA 3DBLB 3OJEA 3BTUA 3LSYA 1A27A 3NDIA 4MVJH 4BNLA 1YBVA 1IPEA 1PL8A 2YZ7A 4DQXA 1VKOA 2B36A 1ISGA 4FR5A 2UAGA 3OICA 4O6VA 4UUOA 3OF2A 5C7OO 3WFJA 3L77A 4CM9D 3U3XA 1V0JA 3L6DA 1R12A 1SEPA 3WIEA 2WE7A 2HSDA 1VL8A 1T2FA 3FNFA 1VJTA 4XGNA 3AK4A 2VZ8A 1UH5A 2NQ8A 2QIOA 3UVEA 1QYXA 4YQYA 3RIHA 1F12A 4GLLA 1WLYA 5J9GA 1NTOA 3O8QB 1I32A 1KBZA 4M54A 3KLPX 3DZIA 5TT1A 5HWSA 2O3TA 4X54A 3RASA 4LRSB 4A10A 4XIYA 4DQUA 3ULKA 2ZB7A 4DWVA 1FJHA 4WLFA 3WG9A 3E48A 4DYDA 4NQZA 2GDZA 4LVUA 1P1HA 3GGGA 1TXGA 1Y1PA 5TX7A 3PZBA 4Q9NA 5FI3A 1DO8A 3HDQA 1BWSA 1CIVA 2FMUA 3JQ6A 3RAJA 5CDUA 1ADGA 1H93A 4HP8A 4P4LA 1DEHA 4PLCA 1NQ5A 4WLNA 4MPDA 3TZCA 4DLLA 4DQVA 1V3VA 2GSDA 1HDXA 3VVCA 2C29D 2CUKA 4WGGA 1K6XA 3IS3A 3LYLA 4CODB 3GVXA 3Q3CA 2P91A 3OBBA 1E7MA 1R4MB 2I3AA 2DBRA 2PZLA 8LDHA 4Q3DA 1XYGA 1E1KA 4WNCA 4DRYA 2UUOA 4R1NA 1YL5A 1R4NB 4OXKA 1P0CA 4MVJG 4AVYA 3WNVA 2E37A 3IOYA 2DPGA 1JAXA 1GQ2A 1HDCA 1QORA 2V6BA 4J7XA 4OHUA 1RKXA 3F6YA 1BVRA 4BNMA 3F9IA 4J43A 3CXRA 4BB5A 5TNXA 2D5CA 3U4DA 3ST7A 3JD0A 2VHVA 3PGXA 3I9MA 1PZGA 1T2EA 1U28A 1EDOA 3KM0A 3ZNPA 3ETGA 4BV8A 2B35A 4MVJD 1JKFA 5G2OA 3BA1A 4IGEA 3FBTA 3PP8A 3JYQA 1FMCA 3CZMA 2IXBA 3JD1A 1S7CA 1DFHA 5COBA 4B3JA 2VWQA 1X1TA 1MXHA 4DBZA 3IQDB 3AJRA 4E2ZA 2NV6A 1N1GA 5BSHA 3BTSA 2ZB4A 5FF9A 4JJIA 1KETA 2R6JA 3DDNA 2B5WA 2EJWA 4QFDA 5T67A 4Q3NA 3EZLA 4JIGA 2O3JA 1WVGA 1ZEMA 2EF1A 4AJPA 1HF3A 5EESA 4ZQBA 1NPYA 4XQCA 4C7KA 2C0CA 4JGBA 3D3WA 3ICCA 4H16A 1GV1A 3WTBA 1DC4A 5K6AA 2VYNA 4XYLA 3AI2A 1DFIA 2HAEA 3JQ7A 2AQ8A 4K6CA 4FSHA 1I01A 1AHIA 1KEWA 4GKBA 1DC6A 1B2LA 3DBLA 2YW9A 5BSGA 4CLXA 5A5EA 5MDHA 1QYWA 4YACA 5JC1A 4PG6A 5TQVA 1SC6A 1VM6A 4XRRA 4LN1A 5AXDA 3WWZA 4BNXA 3WDSA 3NTRA 5JAIA 5CG1A 1LC0A 1AHHA 1X1EA 4TZKA 5DULA 2X5JO 4MIOA 1K0UA 3MOGA 1Q0HA 1JKJA 1NFQA 3GHYA 1LDBA 4IDGA 1JQBA 2GGSA 3O8QA 1ZSVA 1DIAA 1BGVA 4KMSA 3T7CA 4EZBA 5IG2A 1XLTA 2CVZA 4CUZA 3HWRA 1EEHA 2DAPA 2PTGA 2Z95A 3ORFA 4PCVA 3FR7A 2EEZA 2JD1A 3DEYX 5JMWA 4YJGA 2EKLA 4CR8A 3E82A 3DZBA 2CZCA 4IGFA 4IDEA 4Z9YA 1TA4A 2I6TA 1OOEA 4CV1A 3F4LA 2QW8A 3QLJA 1GEGA 1PS0A 4WOKA 2GRAA 4E30A 4O59O 4J91A 2JD2A 2J3KA 3BAZA 3VHRA 4KOAA 1B16A 2J5KA 2Y0CA 1HWYA 2X1HA 3ZN2A 4ND5A 1R4MA 4AJLA 1M66A 1HSZA 2WJPA 5J23A 3IP3A 3PJGA 4AJ1A 2W2LD 1D8AA 1DJNA 1R4NA 3GUYA 4IDDA 3JCZA 4WECA 2WD8A 4MVJI 1SMKA 1PIWA 3JYNA 4DLBA 1MX3A 1OI7A 1Q7CA 3WWYA 3DAGA 5DP1A 3JD3A 4PLWA 4CPDA 4CMAA 1E3EA 2YHIB 4YRDA 1E5QA 4BKRA 2WSBA 3GEGA 4QQRA 1TI7A 5DP2A 1HE4A
chains in the Genus database with same CATH superfamily
1XDZA 2IHYA 3Q98A 3CWCA 5JJ5A 1KK0A 2P9QA 3QV1A 1SK8A 4PF1A 3PFIA 1XT6A 4OMUA 2Q8QA 2QGFA 1L4UA 2HZBA 5HZGA 4WLUA 4AP6A 4UEJA 1N2ZA 3NH6A 4ZA2A 1T24A 5EPOA 2WZQA 1A69A 1PR9A 2KSQA 3ECSA 4N9WA 1PZXA 1XNGA 4EPWA 3AHGA 3WO0A 4JJ8A 3VYVA 1YQGA 1ML3A 1PHRA 4AS1A 2W6IA 1W49A 1U80A 5DTIA 1OIWA 1KZGB 4E1BA 4JUDX 4D9KA 5LL6P 3M6UA 3AIKA 1CIPA 1N2JA 2WJVA 4DLPA 5IP5A 1YR3A 3H04A 4OP1A 5MFZA 1JLLB 5JQGF 4MTLA 3MJFA 3IESA 4C7VA 4TYMA 1V1JA 2BCGY 1V39A 2C4HA 2CWDA 1DBVO 4YPFA 3UTCA 2GSWA 3LYAA 4JT8A 5IMSA 3GLVA 1YI1A 5CMLA 2GEDA 1XR3A 2EJCA 4UDOA 3HP4A 1QIMA 3B5IA 2QMEA 3NTLA 3Q7IA 4FZJA 2FWJA 4XM2A 3T1YB 1B4DA 1SO8A 5BN5B 2EP7A 3PJRA 2B8EA 3CRZA 5IF9A 2XE8A 3Q7RA 4ARBA 4XR4A 1SXQA 2W6OA 4IJMA 3EP9B 1E9BA 1T8YA 4ITVA 2FKNA 2UYGA 2HXGA 2QV0A 4IY1A 4KIUA 4X6XA 3KTDA 1H0HA 3NCTA 1M34E 3NNNA 3PS9A 4K03A 3OA2A 4XOUA 3VZCA 2HJRA 1E94E 2ZVQX 1ZUWA 3DKPA 3HN6A 3ZI4A 3CEMA 4C4TA 4EMSA 4Y1RB 2RG7A 1W73A 2FMFA 2Y1EA 3GUZA 1XN1A 1NKTA 3DO8A 4QYIA 3EQ9A 2ZYVX 4MARA 2ECQA 2GS9A 2V5UA 2XF2A 3WADA 1EVQA 2HJ9A 3CF0A 1PFUA 3OX2A 2J5BA 3HKCA 1W44A 3K8ZA 5CDTA 2EX1A 2ZAOA 2HX1A 3ADOA 3F3MA 3CEHA 4WNYA 3VOAA 5CPFA 4JXXA 2J5QA 4P2BA 1TMGE 2A1TS 1EIZA 2AOUB 1ONOA 2O5VA 2ZK7A 3L5OA 4G84A 4X1YB 4UU0A 3UPDA 4R31A 4DM4A 3DD1A 3M0EA 1BJTA 1W5EA 4QATA 4O4JB 3KUKA 4KQ2A 4DA7A 3C39A 3UUWA 4BWFB 5DNWA 2R7AA 5A1TA 1ISIA 3G0CA 1J8MF 3PVZA 3TRDA 2XNCA 3AKEA 4R9UC 4MRSA 4F96A 2B94A 3N1UA 1QPBA 2IHZA 3CUUA 4CQMB 5JDCA 2FMXA 2CNWD 3C4JA 3OY2A 1VZ2A 2HV8A 3O82A 4NCHA 1DEAA 5CVCA 1TQ2A 2YICA 3DHNA 1T34A 2ZSFA 4AYXA 1EK2A 2RFLA 3A27A 1JENB 1TF2A 2IF2A 4L08A 4HVAA 1R2QA 5B1YA 4D97A 1ZKDA 1SH7A 4PBRA 3VYRB 4X3PA 1TTHA 4PX2A 5GY7A 2NYUA 2B8WA 3VNVA 2PYDA 4YRPA 4C4SA 4BU1A 3DHEA 2Y0EA 3S7TA 3EF3A 2QRGA 3V2UA 4WZBA 2J9ZB 4AQYB 1YZVA 3PXEA 1GSIA 1WHTA 5C4GB 4ARSA 3MFQA 4ALJA 1RJDA 4YJHB 5ALWA 2PMFA 1DKPA 3E22A 4G1CA 3WGKA 4YJDA 3GPLA 3LXMA 2BR5A 2I2CA 2AFHB 3KQTA 4HGYA 4BVLA 4DJ5X 4B4WA 2X9QA 3REGA 4GXTA 4UZFA 4A8PA 4HQNA 1F6BA 4G89A 3E03A 4HUJA 4XARA 2ERCA 3OF5A 1NPTO 1KAQA 1FNMA 2CXXA 3GFTA 1QCDA 5DN6D 4H1HA 1IBKB 2O57A 1J25A 3PIDA 3V7FA 3ZGYA 4BMOB 4MUNA 1EEXB 1CX9B 2YUIA 1DADA 1KVUA 3PI7A 3OLWA 4IIXA 1KE2A 4DWOA 4EJFA 2ZTMA 2I7VA 3R7LA 1JR3A 4R4JA 1F51E 1WU7A 3MWEA 1KXZA 1GGMA 3WNZA 1W5TA 4PYQA 5EWMB 5EKDA 4OXIA 2XWQA 7AT1A 4U6SA 3FVRA 3PQFA 2CNKA 1BSVA 1QE3A 4HDRA 2OMKA 2FQ1A 3KYDA 4G5XA 2PR2A 3C3EA 3JQ8A 3H1GA 1N36B 4B6GA 1CZUA 2GZHA 1QNFA 2P2ZA 2J33A 1Z17A 1RM4A 4CG0A 4BPBA 5EIHA 5HRCA 3UV6A 2HWKA 1NBOA 2BISA 4DKXA 3SOZA 1F1JA 2VHYA 2RIRA 4RMHA 2QP9X 3FUVA 4KN5A 3RC9A 1DI0A 3T9BA 3R4VA 4YQZA 1FLAA 2XBLA 3FOFC 2A4MA 2WF7A 5EZYF 3DR5A 2IUFA 3PFNA 4AJKA 1I8TA 1W2WB 3BFKA 3IBYA 4KYUA 4A6EA 2YIMA 3W79A 4OM8A 3ZDYB 3OEEA 5HQ3B 1B1CA 1RJ9B 3NWOA 4L78A 4BMYA 4NLLA 5EEGA 3A1WA 3ESCA 5KOYA 4KP7A 3WDLA 5CCXA 2ILTA 3AHDA 3H5VA 2XVYA 4P1ZA 2HDWA 2YC4C 2SHKA 1IY1A 2HPVA 2RGBA 4L9AA 4NCIA 4RV9A 5FJIA 2F8MA 1L4MA 5TS2A 1SUPA 4JI8B 4MKXA 1YA6A 3L41A 3EA0A 4NNOA 2R3SA 2FU5C 1HTWA 1JR4A 3DXYA 1P0FA 4RZXA 4RK5A 1NQOA 3BHNA 2M1XA 3F8WA 4LYYA 5J5CA 2WLSA 4NL4H 4FCTA 3O7MA 3VHLB 1V16A 3BGVA 2IYSA 3M6AA 3OSZA 3NRJA 4OQFA 4H1WA 1GVNB 1UDWA 5HF5A 1VHWA 1L5RA 1EBUA 3FY4A 3IQZA 1Q21A 1PR4A 3PZRA 4RPHA 5K3FB 3ZWOA 3JWJA 4E07A 3BIFA 3H4TA 4BO1A 1L4BA 3ZWQA 3L1VA 2IS2A 1KOJA 3IP1A 1Y1KE 2J45A 1EFKA 2BF4A 4EF4A 5JS6A 3GNSA 2I62A 1RQRA 2DHRA 3LWNA 3CUYA 5KZMB 5HF9A 3PNLA 3VR1A 1CF2O 1N0WA 1VHTA 4AMVA 1ACMA 5FOWA 4DCUA 1JJVA 4JFAA 2JHGA 2WHXA 3C3KA 3U9LA 4WINA 1FP4B 4AJ4A 2Z6VA 1VIYA 2FPRA 1PWEA 4RJJA 3U56A 2W2KB 4XYBA 4HVLA 3OIDA 2NUAB 3GO4A 4ZK2A 2EXXA 1ZPDA 1ESNA 4YAFA 3QV2A 1N5OX 1WDWB 1O94A 3RSQA 3KX2A 3QYFA 2CMHA 2HBZA 4AY4A 4XM0A 3IBFA 1Y5RA 3HYLA 2YYSA 2R7NA 4YYZA 1A5SB 1T0UA 2FFHA 5K9ZA 2ZYAA 3PHLA 3MBOA 1KMHA 4ZCRA 3R6LA 5T8KC 2P0EA 1ZHFA 4OQDA 1UANA 3VVLA 3V4RA 5KOJB 3ZTYA 1INLA 5IS2A 4FMCB 5GJWC 2BMEA 4LJRA 1OQAA 1OBCA 4GP7A 4PY2A 5G4KA 3TAUA 1Z07A 2HT6A 3DKIA 4K6MA 1OXTA 1EWVA 1KEKA 1QAQA 3G0HA 2H63A 2JGMA 2CVPA 3EVEA 2F3SA 3GUVA 1I0ZA 1M0WA 3TAHA 1M6EX 1UP6A 2MSKA 4IILA 1L2TA 4N5LA 4JKIA 3WGHA 4BB9A 4Q4HB 3IEXA 3RFFA 3B48A 1AK1A 4XEUA 5LXTF 3S55A 3FNBA 5CITA 3AJ9A 1YNSA 3R6DA 2NTJA 3IQHX 3CLTC 1DC7A 4K8RB 2QN8A 3ANXA 4LZOA 2WD9A 1M8JA 1UL1X 3NYWA 1OZHA 4KQ9A 2BBTA 4GPEA 2PZ8A 4MKHA 4Z0PA 1Z8FA 1ZIDA 2C7VA 2F48A 2G76A 4WBNB 2AHOA 4HV4A 1K2VN 4E32A 5FHRA 3TINA 1CJMA 2HQRA 3I9LA 3LF2A 1EFVA 1G5PA 2G5GX 3N0VA 2B1RA 1BWPA 4C3VA 3NBKA 3OE7A 1OYWA 4QLOA 4Q1FA 2F4NA 4WFQA 5AR1A 5GV7A 3G1UA 3O9MA 5TF4A 3RFTA 1CZKA 3LQ1A 2QR5A 1DPFA 1T9DA 2J3EA 1N75A 3AFHA 3OKCA 4HFRA 2WHRA 3JYHA 2R96A 1N2OA 4L5CA 4Q1DA 2AG6A 3L04A 1TPZA 1XPOA 1ISHA 3AOEC 4PANA 2FEKA 4U3JA 4K1LA 1N78A 4PYLA 1M8KA 4QDOA 1NN0A 4I5IA 5IUKC 3ZYCA 1O6CA 1UBSB 1AMNA 3RWBA 4X8MA 1AKQA 4H17A 3PNPA 1GPNA 1ZJJA 2RARA 3U3ZA 5ARCA 2JAPA 2ZUWA 1AUVA 5KYXB 1YTUA 1N2BA 1U7XA 4EH1A 4UREA 5EPEA 3SHOA 3SWWA 4HDNA 1X80A 1VB5A 2IRWA 1IUPA 2VTKA 1R9GA 2O4CA 2J5RA 3FSJX 2W58A 2YQ5A 3QG5A 2RC6A 2MSWA 4Y6PA 5D8DA 3SJ7A 5A4FS 4P92A 1GNTA 1PR3A 4YAWA 4R41A 3UMGA 4E5PA 4QGSA 3CN9A 4QUIA 1IVSA 1XAGA 3IGFA 5LPNA 3AR5A 2FX5A 2CCJA 3HB0A 2AJLI 4LNAA 1TFRA 3B2QA 4RQUA 2IBMA 1GYQA 1UM9A 3WMGA 2J9YB 3P9KA 2FR8A 4GPAA 1ID1A 1QU2A 3ZIUA 5HMLA 4CT5A 4X66B 4ZOLB 3I6ZA 4WXPA 4EITA 1QMGA 1VCIA 2ZQYA 4MWOA 5HE8A 2VQEB 4AMUA 1X94A 1RRKA 1ZVJA 3CNNA 4KQGA 2ZJ1A 3IE1A 4WOJA 2JBAB 3GFPA 4YASA 1ABBA 4B76A 1WZ2A 1PGQA 3D31A 2E55A 5DCYA 3H5LA 1Q57A 1YFKA 2ZQZA 2NMVA 4NMXB 4MW4A 3Q6NA 4XDYA 5DHPA 5IM5A 4QAQA 5MHTA 2Y0PA 3SFZA 1OV6A 3EIUA 1NI3A 3TNFA 3HADA 4JKYA 1I4LD 1MQAA 4MWDA 1F4VA 3CPSA 3COZA 5DNUA 2Z56A 1MB2A 5CLIA 1QMIA 5H0IA 3BBPA 4DMCA 3I34X 2VTBA 5G0VA 2ZAYA 4MX8A 1PNOA 3OI7A 3PFFA 3T5PA 4G1BA 1NULA 1TJNA 1E58A 3RYFB 1BDJA 1KVTA 1ZGHA 4NJOA 2XQJA 5A4JA 2D5AA 2ODAA 5A9RA 2HB6A 3EY4A 3NLLA 5I7OA 1EUDB 3FJYA 2GK7A 1P5FA 1MGPA 4EG4A 2OZVA 3E61A 4L8YA 2FQXA 4B48A 3S28A 1TO2E 1EVZA 2R8YA 4ZT6A 3QLUC 2RHGB 3ANLA 3CJTA 4MRNA 4R68A 2XMPA 2WB2A 2J48A 2CDBA 4PHCA 1I14A 3PENA 3S2SA 3SHWA 3SQDA 2VKQA 3IT3A 4PZLA 2E4YA 4LECA 1UKZA 1SUSA 4HMOA 2B4RO 4QSMA 1L7DA 4RPJA 4W1QA 3RS9A 3BFJA 1TZJA 4LYGA 2V6MA 2FHPA 3ER9A 2ZCUA 5JXHA 1H8ED 3O4IA 4RA9A 5IM4A 1WUYA 4Y2QA 4TTSA 2P9FA 3X2FA 1IRIA 1YRHA 2HBQA 1N6IA 3S44A 1KQOA 1G7CA 1K4MA 4BO2A 2Q5HA 1O96B 2XEXA 2DT8A 3VUFA 3MXTA 1B0ZA 4Q01A 2MU1A 3U7QA 2ETXA 1QAOA 2QM7A 3QOFA 3E7PA 3UH0A 2OB2A 3CINA 2IZ5A 3K72B 4BN5A 1AK9A 1JIQA 1TE2A 2IE8A 2XJ9A 3BCSA 4RIIA 3W78A 1A8QA 2I29A 3E4DA 3K0AB 4EECA 4D41A 5BWBA 5HE9A 2O8CA 2QMYA 3BWEA 4BQFA 3SVLA 1GNSA 2I4OA 4BX2A 1CFZA 1YJCA 8ADHA 1XVVA 2GD6A 2GPBA 4C22A 5EZYA 5KVCA 2NV0A 4PAOA 3SX0A 2FN4A 3UICA 3F98A 2XGJA 5L4SA 5EE3A 3GLSA 1N5MA 4IIDA 4TXHA 3ZH9B 2QRVB 4DV4B 3D6NB 2EG9A 1PV2A 4EWLA 1TOAA 3EHDA 1BVYF 1BCSA 3PDWA 4IR7A 1GU1A 3AWDA 1U0OC 4IWNA 1VKRA 4ZPJA 6REQA 1CE8B 4HGNA 1C3VA 1EP3B 4LGMA 4KXQA 1Z75A 4R1UA 4MGZR 4KWTA 2Y1WA 2YOGA 5J40A 3ZGZA 1U9JA 2I9PA 2JVJA 4OY3A 4O0LA 2ZSHA 4FCVA 3TS1A 1CZOA 5IJZA 2RC5A 2X3FA 1ZJ6A 3AP1A 3A9TA 3F6PA 3HLKA 4FS3A 1U63A 3OE5A 1J9EA 2VCYA 2RD2A 1JSXA 3R0VA 2HV9A 1WHSB 3L9XA 3KXDA 3L0BA 1A4IA 4KODA 1TQ8A 2A35A 1Z08A 2NU6B 4KR9A 1WV1A 1M2OB 2GT1A 1UR5A 3A3OA 1P9NA 5EMNA 1G6HA 4F9GA 1AKUA 1GQRA 1G5FA 2BKLA 4M89A 1THTA 2X5XA 4WT7A 3GAAA 1D1PA 1Z2AA 1YQDA 4EPYA 1KSJA 2XBUA 3UK1A 1EQAA 4CV3A 2G8NA 4HH0A 3OD1A 1LPBB 5EMLA 2ZIFA 1GM5A 1I24A 1ENPA 2IEAA 4CLDA 3Q3GE 1AA6A 1CDZA 3SF0A 4JC4A 1POXA 2TS1A 3QITA 2E2WA 4EMBA 3HWWA 4PM4A 1KFEB 4X62B 1TLLA 2XT6A 3GARA 3H1TA 3KJNA 2DYKA 1L7EA 3OETA 3RUDA 3LLSA 3TMKA 3UOAB 1T3SA 1ZUD1 1U3WA 4H0FA 2DKNA 1EXDA 4ZOEA 5HILA 1DKNA 4CQLA 4WY8A 4LCBA 1HETA 1P19A 3ACCA 3MGBA 3N2LA 1S4MA 1NV9A 4QDUA 2OQRA 3E9QA 3C98A 1E9FA 1SCDA 2N9UA 4YT8A 1FRNA 1KMNA 3EJ6A 4XKJA 1E1RD 4DXDA 4G56A 1T26A 4M99A 1X9GA 1CYDA 3RCBA 2VO1A 3QHQA 2Q3MA 1WEHA 3D2BA 4B34A 1IZ9A 1MCZA 4DMKA 1J1IA 1WWKA 1W85B 3I9FA 3KVYA 5C0OE 3RS5A 3OJOA 3U4GA 4ACBA 4CKCA 2FLVA 1UK7A 1XVLA 4ZODA 1OX6A 2CFOA 4L0CA 4F21A 5ERYA 4G1UC 1XXHA 1Y3BE 1ZMRA 3UJ7A 1QRRA 3HQ4O 4NHEA 2XWJI 4QGHA 1XDDA 1IHPA 2J7PA 3ITNA 3L8DA 3G2MA 4QO7A 3WKEA 1AV7A 1FUYB 1W9HA 2OESA 3IQGX 5EUMA 2BEWA 5E4JA 5H4GA 4XAQA 5JOQA 1NMZA 3OLXA 3FBGA 2OXIA 4EKEA 4O4HF 1YZLA 3NIBA 3TUXA 2SKCA 3OCWA 3IUQA 1LRKA 1MPTA 2V7QD 2OGUA 3T7EA 4X91A 5EHIA 3R3XA 4DADA 2GERA 2GKOA 1EPUA 3DZDA 3W1VA 4OFWA 4YJKA 4U00A 5K0EA 2FVXA 1I7DA 3HCDA 2H5EA 5FT9A 3Q7SA 1LU9A 4D5EA 1XEAA 1VE6A 4I4IA 2P41A 3AXSA 3AP3A 3QTBA 4OTZA 2XH8A 5D86A 1DOZA 4R0NA 5ES3A 1C0KA 3E7FA 1XKLA 1ZS9A 2KB0A 3H65A 4Q9AA 4YP1A 1K97A 3HJCA 1T8TA 3PUVA 1X19A 1UPFA 2JFHA 3CZ5A 1PGOA 2A88A 1E5LA 2Y27A 1EZZA 3E2IA 4K6FA 3M9XA 4LKOA 5DF1A 2Q1YA 5L6MB 1WZEA 3EEOA 3AZOA 4WQMA 3OJFA 1WMAA 2R6ZA 4Q6WA 1FU7A 4O2BF 5EI5A 4M86A 1ZKMA 3P2YA 1XN4A 4L5YA 2BE9A 1YACA 2C99A 4JI3B 5CLJA 3GLGE 1KERA 5BT9A 4DL9A 1XQ9A 3AERA 3EDQA 3QUTA 1ANKA 3WA6A 3O3MB 1YE8A 5ETJA 2OO5C 4GW3A 3KZVA 4NS4A 1QTQA 4ZCQA 2VBCA 4MYDA 5K7SA 3MHPA 1FRFS 1J7JA 2C1EA 2O2YA 2VTVA 3NH9A 4QQFA 1NR5A 3KWLA 3OZGA 4ZXFA 4ZQEA 5E3JA 4F4HA 1NNEA 5HUQA 2HJSA 4X8LA 1EE2A 5K0CA 2W7TA 5TB5A 1ZOIA 2OCLA 4UM5A 2IV3A 5B3AA 3AF0A 2BFPA 1ZNXA 2YIDA 2ZP1A 2DQ4A 2I5PO 4N47A 1ZO8A 1HE2A 2EZ9A 2QUIA 1EZ1A 4UXIA 3VR4D 4BZXA 1Z6AA 4DG5A 3L0SA 1G20B 4W7SA 4WK0B 1RD4A 3QVUA 3EVZA 2JG3A 4BHTA 4HYQA 5JBQA 1Z4KA 1DLIA 5K99A 4FFBB 3FW1A 2ZAMA 1OWOA 2H1IA 4FHEA 3ISJA 2CNOA 1E4OA 2QU7A 4N3NA 2Q4TA 3EY9A 1D0VA 1XDWA 2XNDA 2XYVA 4MKFA 3B3AA 1USKA 4CV0A 3THWA 4MRVA 4YCJA 1FQKA 4EF6A 1XCLA 1MOZA 3H3JA 1OZGA 4KN9S 2IEBA 1YDHA 3N76A 4R8VA 5HFNA 1GRCA 3DBIA 3WLOA 3VTKA 3UJDA 4F8EA 3ADKA 1TYAE 1NOIA 3JY6A 1NDQA 3VISA 3AKZA 1W1UA 1GZ6A 3JQAA 3NYIA 3B1JA 1A3CA 5LBIA 2PY6A 4QHYA 2D62A 1JH8A 1Q1GA 2H08A 3EDMA 2WIBA 2GK6A 1VGRA 3AF5A 1C3OA 1NW5A 4FFRA 2AMYA 3RRYA 5AW2A 1GYPA 2BKXA 5CM9C 2Z98A 4CMEA 2X2FA 3TLCA 3GP5A 1NBMD 4PCLA 1OH5A 2OFXA 4N5HX 4F6CA 4B3TB 3JWPA 1UFKA 5AT1A 5JUWA 2FR1A 3PG5A 4EPVA 1RWBA 3E9EA 4RA6A 3EIQA 4JZYA 5EHZA 1JAIA 2GCOA 1SQ6A 2KYRA 3J81k 2G1PA 3WBFA 3D3KA 1FLVA 1HQDA 3A25A 4V0ME 2GJ4A 2UDPA 2XE6A 2BH9A 2I87A 5HXAA 2XHZA 1XP5A 1WDMA 2QW1A 2PANA 3D2CA 3GN2A 3M6XA 1LQ2A 3T3DA 2HJVA 3DULA 2X19A 3BULA 2X58A 4GZLA 5DGIA 5LZ8A 3ROMA 1Q7RA 1H2XA 2VYND 1F8FA 2AR0A 1JEQB 2BZ0A 3SY8A 1E0SA 3VSBA 1JDJA 2JFZA 2CF5A 3BXFA 1V96A 4E2WA 4JI5B 1V48A 3BIJA 1JYFA 1YKSA 2HH9A 4EBBA 3B6KA 3A6JA 4LBVA 1KZ9A 3TQCA 3LX8A 5K8TA 3DR3A 4BN4A 3NS7A 3EUWA 2IK8A 4OQQA 1B00A 4C3UA 3HJAA 1ZD3A 1CVRA 1ZIPA 1V4NA 3LOPA 4OU4A 4H31A 1AGPA 1SG6A 3EWNA 2QD1A 4MGYR 3R8FA 2BEUA 4YJ2F 4J16C 3TSAA 3PGMA 3BSWA 4CTOA 4Z53A 3NDJA 2IY9A 2Q7XA 3FFWA 1T6BY 4XUEA 3D59A 3V7YA 5FBLB 1I0IA 3TCXB 4E3ZA 1Q0TA 5JJKA 1JHQA 4O63O 3RS0A 4BN0A 3GLFA 2W6CX 3NNSA 1DXYA 1Y4UA 1WB9A 1PD0A 4WH0A 4JDUA 5L3QA 3T7JA 3G17A 4TKMA 1YRBA 2WJAA 2KW5A 5CDYA 1VYVA 3PXDA 3CIFA 1ZK0A 1TQHA 2H3HA 4NOJA 5A5GA 3GDHA 2CB9A 4RKRA 1J42A 2XNSA 3ETDA 1KZHA 3QENA 1HBJA 3C3AA 3HV0A 2CCKA 5CVTA 3MMNA 2SBTA 3T3NA 3K4PA 2XZPA 3IVMA 4PAWA 2ZVJA 1A5ZA 4HN2A 4LA4A 2QX8A 1EK1A 4FTWA 5KSWB 1WP9A 4ZO8A 2R48A 3ONVA 4D4LA 5AVWA 4HS4A 3IIIA 3O1JC 3IKLA 1P60A 3QFHA 1ST2A 1UBJS 4S04A 3S8YA 3ACBA 3GR6A 5AO9A 5L3SA 2XUDA 1CD5A 2ATVA 5AM2A 1FDTA 3NAZA 3U6BA 1O4WA 2EP8A 2PZBA 1R37A 4X8HA 5T3YA 3RJZA 1P2FA 2GNAA 4N3CA 2AEJA 4HGOA 4QJ3A 3ZD8A 4JR0A 5KHOC 3OZFA 2IZ0A 4EFKA 2F55A 4KWEA 3IAUA 1PG2A 2FFRA 1U04A 5ALFA 4CMGA 2QQ5A 3FHCB 3R5TA 1EHCA 1CRPA 4MW2A 3V1NA 3QPVA 2DTDA 2H2IA 4R1LA 4YJ3B 2GETA 3T5CA 1W8IA 1EYZA 4FYXA 4U0JA 3IKTA 4BVEA 5CW2A 3GNLA 3IILA 2QMUA 1RI3A 2XUKA 3MTDA 1LGYA 3TW8A 1NVUQ 3QLEA 4KLAA 4BYMA 1WCIA 2VDJA 3LA8A 2GF0A 5HEKA 1Q74A 3ZE2B 1W2GA 1AXEA 2WB4A 1PJLA 3PEEA 4G5QA 3QI2A 3AONB 1ZK3A 2P9EA 3OCVA 5K8IA 4PN3A 1DO2A 4JASB 1E5TA 2YVAA 1KZ1A 2DWCA 3VR2D 2Q4EA 4ESHA 1BD4A 4GH5A 5A6SA 2YMMA 3FKJA 2BGGA 2XMDA 1HFKA 4C06A 4WZBE 4E4RA 1H23A 3MTQA 4TTPA 1K27A 4X71A 5J1TB 4NCAA 2VUHB 1ISSA 1ML4A 4I14A 4L9WA 4ZCLA 5BUQA 1U8FO 4LFCB 4WOCA 1QIEA 3R7DA 1E8MA 5KYWB 4PIVA 2NP7A 2JPDA 5KWJA 2E7ZA 1HPLA 3LS2A 1MKYA 2LIVA 4O4HA 1Y9AA 4MUGA 4IM7A 1DUSA 4OKNA 5TY0A 1IJFA 3CLHA 4OQEA 1IY9A 1K7FB 4XM1A 2LVBA 1S0UA 3QF4B 1MIHA 3FLEA 1S6YA 3GROA 3K1JA 4KQWA 5ALSA 3RLFA 2P7IA 1BJRE 3OURA 4EB0A 3VVMA 5ER9A 5ALQA 4B45A 5TXGA 5SY6A 3KETA 1E2PA 2B25A 4EFNA 2AK3A 5IAOA 1VJ0A 1JR3E 2B4YA 2VHXA 5IN4A 2FMKA 3CS3A 4G2NA 5EJ2A 3UH1A 1MABB 1MJFA 3BDVA 1N33B 1ZOOA 4H08A 4PLHA 5I9LA 2IHUA 3PDCA 4RSRA 1YL7A 3I6YA 4GX1A 4JB3A 5JD3A 3TQIA 4A15A 3FNGA 1U0BB 2QVBA 2IE0A 4JI7B 1E1CA 1RXSA 2VS1A 1CF9A 1OLXB 3HU2A 1WSWA 3I2IA 1QIDA 2IYAA 2ZANA 4NMHA 4P36A 3O1LA 3O8BA 2FPPB 5I8PA 5TF0A 2A58A 1Q0PA 3W8NA 1Y34E 1PR0A 5AVYA 1UK8A 5G41A 1SCNE 2AMVA 3TSYA 3GFSA 1NU6A 4W4TA 5IBPA 1SVUA 2O0JA 4UHDA 3L7OA 5JZBA 1IEQA 4YAUA 1Y3CE 1COWA 3A6DA 2NVUA 4RSHA 4MUAA 3T1HB 3K70C 2FG7C 1T4GA 5EAIA 1GCAA 1HOXA 2PJRA 1GZUA 1NUQA 1QX4A 1ZC4A 1ES9A 1Y0BA 3P2KA 3G23A 2CL0X 1GGFA 4HLQB 3DTVD 3TLKA 3RD5A 3QKSA 5IJWA 2D7JA 3K16A 4KQFA 1I4EB 4LY0A 4D0SA 5KTNA 1Y1QA 3KYJB 1UJ5A 5LYJB 2VXOA 4YC7A 4BCCA 4AKIA 1G8YA 2CE2X 1VA4A 5IPFA 4MVJM 5KCZA 1YF3A 4LYFA 4CM5A 1T3LA 5TQ2B 3UWKA 2I2DA 1V3TA 1ZI6A 4YCDA 5BQ5A 3N8IA 1ZONA 5FEUA 2XCTB 1NP3A 2NUBA 5B4UA 5LA6F 4IJ6A 2ET6A 2OCDA 3MTEA 4N0PA 1UJNA 3R9XA 4MXDA 1BH2A 3OLZA 5F9MA 4YWHA 1YQ9A 3SQOA 5DCLA 2QRPA 4ZT7A 1HLDA 2VXCA 1PFYA 2IQ5A 2FXVA 3IP6A 4Z86A 2FSUA 1QO0D 4U8HA 4UFOA 5MN6A 2NO0A 1OJ7A 3IVXA 4US2R 3HFGA 3EPKA 4NP6A 1U0JA 4UTOA 1YHYA 1Z0SA 4WEOA 5J9FA 1JTFA 5CXQA 2FMTA 5IANA 3QLVC 2XA9A 5DFAA 3FYTA 3VPBA 4D4JA 2R6GA 5HJEA 1FFYA 4IIGA 1CW2B 2O3QA 4TSFA 3COWA 3DMTA 4XCVA 5CCDA 2J6IA 2ATEA 2WKSA 3GFFA 4YRJA 4Y9TA 1KQPA 4WK6A 2H1WA 5EL0A 3TRKA 1UP4A 4URWR 4I5EA 4O2AF 4MVJP 4R40A 1M6HA 2E5LB 1GO2A 3TBFA 2VHUA 2FLWA 2I6XA 1P7CA 2B78A 3HFJA 3HU5A 4B3BA 2F3UA 1W5SA 3VTFA 3FJOA 1YZNA 2DJ5A 3EJWA 3VV3A 4R2KA 4HK4A 5K4HA 4HGZA 2GM5A 2C1ZA 3KJFA 4BQQA 4KRGA 5A3RA 5F3DA 2A9FA 1RJFA 2MT9A 2R1TB 4TTVA 4BMSA 1QO7A 1GEEA 2WYUA 4W7HA 1P7YA 1R4ZA 4JZKA 4PCUA 1WP4A 3GDFA 1TUBB 3THOA 3OQVA 3HY6A 3RQSA 5ITVA 5KEIA 1YDGA 3BXEA 4M98A 4JROA 5K8VA 2VYVD 1R0KA 4EAAA 4DIOA 2H92A 4PPNA 1M6WA 2VAWA 1Z9BA 4Z9XA 3DJFA 3DXFA 3TJRA 1KY5A 3OZXA 3LQYA 2DFNA 1SD1A 2XUOA 3DL0A 1QR2A 1YZTA 2DH6A 4IEIA 2Q49A 1U7OA 1Y5LA 3PDIB 3N5CA 4D5GA 5B1IA 2NACA 4EJSA 1Q83A 1DKRA 4KSYA 5I51A 4WCFC 2QUJA 3LPCA 3EASA 3HRKA 2I4NA 2J32A 5ALEA 1KDVA 2QLFA 2C0QA 1R0XA 2HIHA 2WSSA 1GZVA 2X41A 3I1JA 2IOYA 1YK1A 1FP7A 2QV7A 3FUWA 3NUGA 3FROA 2FOIA 3O31A 4NICA 4PWYA 4V0LA 1FFXA 3HCOA 4TLAA 1GT91 5BW5A 2Z5LA 3I2GA 4I08A 3GJRA 3RHTA 2YYYA 4GXQA 4NZOA 3A1SA 1J07A 3K9NA 3O03A 4TMFA 3SS7X 2CV2A 2NXCA 3AR2A 3TTUA 1QHFA 3IUYA 1GWNA 3I76A 2M2IA 3VTZA 2MSEB 2FWRA 4YJ2A 1G1AA 3FGZA 4G6ZA 2BD0A 3UV3A 4F91B 3DYBA 4GOXA 3PQEA 8ATCA 1T5BA 1FNBA 3B78A 1XWFA 1PL0A 1RE1A 2SCUA 3K96A 1OPXA 1FYEA 2AJDA 4J1TC 1LFAA 5ERGB 1ZI9A 3IOEA 1PAUA 4DM7A 4EY7A 1TF7A 2QSYA 1AB5A 4FD3A 5BYAA 3LPLA 2Y93A 4XQ0A 2XWSA 1SVWA 1MQ8B 1XTUA 1K92A 1PG5A 2GTHA 2HWWA 2NZ2A 3LP6A 5D7NA 5BQPA 2ARKA 4DR5B 3VH2A 2FG6C 1QUFA 2H7VA 4E5DA 4OJQA 4F85A 1BXZA 1DTWA 2RGEA 4D79A 3KEFA 3P5BA 2ZJZA 2GA9A 4J1NA 4RCVA 1ZQ9A 4KRXA 1LA2A 3PQVA 4UU8A 4XD7A 3IWBB 3X1WA 1ZCAA 3QVKA 1GAQA 3QWFA 4R51A 5B1HA 5EIFA 3KRTA 4CQMD 2HK9A 5AKHA 3DS8A 3TXXA 1O95C 4K9SA 4JENA 1THGA 2BM8A 2C42A 4D0GA 3ENZA 5HUHA 1Z73A 3WWDA 3ZXYA 4NMWA 4MA5A 2AG1A 1QAMA 1D0IA 3DP9A 4MR9B 3NFYA 4QGAA 1FIUA 4MQMA 1EK5A 4UMEA 3R7AA 3TTTA 3BXGA 3NZEA 2FN8A 4LC1A 3A6FA 3QVSA 4DLXA 4CMCA 4J3NA 2A5DA 2BM9A 3FDXA 3KTFA 3TLAA 5DM70 3C8DA 2PX2A 2HMUA 2IOHA 1OAAA 3AL2A 3O73A 4HNAB 2Q22A 5LSAA 4D45A 1HI9A 2NADA 2H4ZA 4IEFB 1CUEA 2AG5A 5K1ZA 2WUFA 3B6MA 5TGTA 1JQDA 4GRAA 4MGHA 3WLLA 3DZHA 2EZ4A 4PZZA 3GJZA 4U2DA 1RMTA 4QODA 3M3HA 2RHMA 3KXIA 2C59A 3ETJA 4CCYA 1H2ZA 2HCFA 1E2IA 4M0UA 5FWXB 3BREA 4LRYA 1UT8A 4UUAA 3DQZA 3LFUA 4AFNA 4EG6A 4EUKA 2EV9A 5CBKA 1WMEA 4BE9A 4CRWB 3WA7A 1P4AA 2QTTA 1OCEA 2NTEA 3C1OA 3L5KA 3ZX5A 1X1QA 2H9IA 4I50A 3MUNA 1N9KA 4LJYA 4PTLA 2ZRDA 3CKKA 4TKLA 4MQFA 4ARUA 3PHGA 1ZR4A 3F8TA 3O3NB 3N2EA 4BXOB 5KIAA 5FBZA 2CNLA 2LCIA 2RCYA 1T15A 4XYEA 5AWFC 3VKVA 2V4ZA 3P0HA 3EXFB 2PWBA 3PXUA 4MS3A 2Z9DA 2I78A 1XRRA 4OKIA 4BCBA 1M6VB 1PZFA 2W8ZA 3EQ8A 3UO8B 4OB6A 4EUSA 1P4JA 2QZJA 3Q8LA 1MORA 5EIWA 3D1VA 5F52A 3UMFA 1ZW1A 2NU9B 2P2NA 3PXAA 3CTMA 1W4BA 3A9CA 2G0AA 4EUEA 1IFXA 3EGXB 4EOGA 4HDCA 3DAOA 4YLGA 4A6PA 2CYBA 2X14A 4P82A 2NQ2C 3FOAA 4CHGA 4Z7QB 1I94B 2Q3EA 3P9CA 4Z4IA 4UUMA 5L9AA 3WHLA 3OT5A 1PJQA 2OMEA 5ABPA 2FI1A 2HDOA 2CLFB 3F5SA 1NIJA 3IJRA 5KJ1A 1MB4A 3QKRB 1DV1A 4HXFB 3DL2A 1M3SA 4P83A 4R9RA 5FYQA 4B5LA 2PRIA 4KQCA 1M10A 4Y9DA 2D06A 2WJIA 4MZDA 4YO7A 5BQOA 4RNCA 1HDZA 1DXQA 1VIMA 2W11A 4I1RA 2ZT7A 4Z1MD 1FQOA 2NZUG 1USIA 3FOCA 3ZD7A 4LHSA 1BOFA 2DFTA 2PT5A 1CXZA 3QVLA 4FKMA 4PTYA 4B3SB 5JD5A 1HQKA 2VYQA 5J4YA 4B3CA 1V26A 1FFGA 3M3PA 3CEAA 2I71A 3DLTA 4LNUA 4ATNA 2XQKA 4C1NA 3KEGA 5DISB 2REQA 1KYQA 1X7WA 2NSHA 4NWIA 3N2GB 2CFCA 3ICPA 3TQHA 4MWGA 1EB9A 3V8MA 5AVTA 3ETNA 4P08A 2CLCX 4WJZA 3H9UA 3PHCA 4HTAA 4ZEXA 1YZHA 4TOIA 3UZUA 4AO6A 4MKZA 4XRGA 2G1JA 4WASA 3SSNA 3MQFA 4TV8F 1W35A 1YR8A 2HZ7A 3U62A 3UAOA 3VDNB 3RBVA 5BR8B 3SQWA 3QVTA 1MRSA 5AW0A 4TVBA 4KGZA 2BDEA 4E5YA 1V7QA 4K9NA 4RZ3A 1KS9A 1B41A 5LYYA 4F9EA 2GBGA 3SX4A 3FKSD 5EIAA 3JR7A 2R4QA 4XJSA 2WBLC 3WGTA 1DQNA 1VJRA 4KR7A 3V33A 4A26A 2PXAA 3RYIA 3RREA 3VR3D 5BYKA 1D6MA 4BBPA 4MAAA 4Z9AA 3DQPA 3ZHXA 4WKCA 3FLBA 2ZT8A 3E9ZA 3ZCTA 5F9FA 2JFUA 4XX0A 2R62A 1MVNA 1PK7A 3PCXA 2QG4A 2RI1A 5HCIA 3KWFA 3ORYA 1V6AA 1EH5A 3W7BA 2H52A 3EGIA 3DF7A 3DYVA 3H9BA 3QVMA 4KAAA 2PQ2A 5CJJA 1EM8A 1XTQA 3K6RA 4YRQA 2Q2OA 1TF5A 2V7VA 4HQRA 4IPTA 4P3OA 1CDDA 5B55A 2OP0A 1X15A 3C5VA 2BSXA 2B8NA 3ILSA 2BRUC 2CYAA 3GPDG 3CF4A 2GASA 3OO1A 2JH8A 3CVVA 1U5AA 3HVRA 5LJLA 4ZVNA 3V8QA 2P0YA 2IXTA 2F3PA 3EVGA 2C9MA 4UDXX 1FSGA 3W3AA 4C0JA 4CEIB 1C9YA 4X00A 4F2DA 3GVCA 3K31A 3GVIA 3WSVA 1N5KA 2W90A 3GGOA 1Z8HA 2W2LA 4KC0A 3C7CB 4J0CA 1YO6A 2LV8A 4ILKA 4P33A 4JSYA 2CJPA 3BXHA 1ORVA 4O2AA 3K70B 1MENA 1LPNA 2XMZA 1K89A 3RJ5A 1RKUA 3TJMA 2A86A 2FEOA 2P8JA 1YUBA 2Y9MB 2F1JA 3C4QA 4GIBA 4HZUA 4E1AA 2D74A 2VJYA 1EFTA 3H1FA 2LRHA 4LRXA 1CS0B 3FIUA 1JYEA 1UBMS 2PVPA 4I1SA 5EVCA 2H8GA 1EDBA 3EZ6A 3IKJA 4N01A 2J08A 2NO6A 1T43A 5D6OA 5B7PA 2VSYA 3K4HA 2FPKA 2CL6X 3VOBA 2NYAA 4IJKA 3RU3A 4EUHA 3SLKA 4AKTA 1C3LA 4EDFA 1DT3A 2OBBA 3BB3A 3FGNA 4IP0A 3ZHBA 2DLNA 4F2GA 2APJA 4C7OB 1M9NA 2V6IA 3EARA 3LUDA 5FTNA 4D4KA 1M34B 3CUWA 4UDNA 521PA 1ORDA 4KWCA 2XKBA 3FZYA 1CIJA 3QVJA 5AKGA 1Z47A 4FILA 4F0JA 1Q0RA 1TYBE 4NAUA 4NFHA 1GL3A 1XXHE 2PS0A 3ELUA 4NONA 1UKVY 5EEHA 1PFKA 4WDRA 2ILVA 3B6IA 1B2RA 3QNMA 3CX7A 2JGLA 1IWOA 3FCSB 4A27A 4DIFA 4DJDC 3H8JA 4NYJQ 4CIDA 5KDDA 2IXFA 2P1RA 1EMDA 1E0KA 2ZPAA 3B6JA 1E4EA 1ZUNB 2X0DA 3T4XA 1ACLA 3IKVA 3M4ZA 1FBNA 1NUAA 2ALJA 4DR2B 1LS1A 1QGYA 1XMPA 2K2WA 1BS2A 2AMFA 2LTAA 1EUZA 1F4LA 1V7ZA 3DTNA 4O4IB 5CNIA 5BVGB 5KJCA 3ESAA 3V4FA 1Z5WA 4PFJA 2JATA 3LKZA 3NWEA 4M9ZA 5BSTA 6Q21A 3WWOA 3UUFA 4G86A 1Z2NX 4GLFA 3UA3A 3BXOA 1SXIA 4H3VA 1EVLA 3NTQA 4M8LA 1F48A 1DAIA 3TVTA 2PMDA 1V4VA 3AXTA 1VBFA 4OLJA 5EXSA 4WKBA 3O0DA 2IH5A 2MHCA 4GC5A 5LDDC 5LDHA 3EAQA 3LC7O 1DHRA