3E19A

Crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
74
Chain Sequence
LMVVPLSEMGPGDKGIVVNILGGHNARQKLVSMGLTPGATIQVLESMGPIIISVGGVRFAIGKGLAGRVMVRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA
publication title Crystallographic Structure Determination of Iron Uptake Regulatory Protein (FeoA) by Sulfur SAD in a Monoclinic Space Group
rcsb
source organism Thermococcus thioreducens
molecule tags Transcription regulator, metal binding protein
total genus 17
structure length 74
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e19A01
1BI3A 1G3WA 2K5FA 1BI0A 4O5VA 5CVIA 1QW1A 1QVPA 1BYMA 1U8RA 1FWZA 2H3JA 2LX9A 1FX7A 3GLXA 1P92A 2K5IA 3MHXA 3HRUA 2GCXA 2QQBA 2QQ9A 2K4YA 3HRSA 1BI2A 2QQAA 1BI1A 3HRTA 4O6JA 1G3TA 3E19A 2K5LA 1G3SA 1G3YA
chains in the Genus database with same CATH superfamily
1K1ZA 1H3HA 5M9OA 2P84A 4M7DC 2P4RA 4FL6A 2RHZA 2RJFA 2A37A 2CS7A 5CKEA 3REAB 2DO3A 1YJ9Q 3F70A 4BI8B 3G7ZA 4M7AC 2BZYA 3ZEHA 2KY9A 2ZPGB 4IUPA 4BY6B 1OEBA 5LJ5g 4BI4A 2FHDA 4E7KA 3NGPA 3CCUA 4XU3A 2K2VA 3CCLT 2RK1A 2KMTA 4PJOB 4OB0B 1W70A 4E7ZA 4R56A 3C0CA 3EFOA 2YRVA 3CXCP 1Q82R 2F1LA 4OMPA 1JB0E 3G6EA 1K73R 1MUZA 2FZGB 1QVGP 4D6WA 2M1HA 1TUCA 2PVGB 3G4SA 1QW1A 2BIVA 5FLXE 1H8KA 1N9RA 4JRPA 3X20B 2DM1A 1ZA1B 1KC8U 2F2VA 3CCET 1W2BP 1WJRA 3CCMT 2O9SA 2DXBA 1TH7A 4C0DC 2EVRA 3VS5A 5IXBA 2WSCE 4RCCA 4BDZA 3SWNB 1Q7YR 2DE0X 2F2XA 3OS5A 2KSSA 1PHTA 3META 4J6XA 2FEIA 1VQ9Q 3H0FA 2ECZA 5I2SA 3BDLA 3CMAT 2E10A 2QTXA 5LJ3f 5GMKj 5LJ3e 1F1BB 2I0NA 2JXBA 2KROA 5GAMf 5GAMe 3J80E 2LQ8A 2DRMA 1WQ7A 2EAYA 1UHFA 3GBQA 4ZN1A 3VYHB 3EGXB 2CH4W 1WJQA 2FZKB 1N5ZA 1GFCA 1QLYA 3CXCS 3L2WA 1CKAA 2SEMA 3T9NA 2EGAA 4AFUC 3JV3A 4OMFB 2LDMA 2O88A 3CCLA 1A0NB 2QQRA 4ORZA 5I11A 5FU7B 1RAGB 2RPNA 1WJSA 4M77C 3LGLA 2CUBA 1MNDA 2GFUA 1Y71A 1WLPB 2GTJA 1U3OA 1SSHA 2VV5A 4C92B 2AKLA 3CCSQ 2HZYA 5L8RE 1Y96A 1KJWA 4ANJA 2EQKA 3JCMh 2KXDA 1WFWA 2O4XA 1VQ5T 3L42A 3CXCA 4Z02A 4LUDA 2P4TA 3EGDB 4UC4A 1YI2T 1VQ8Q 2NUTB 3A8HB 9ATCB 3CCMA 1Q81R 1YFNA 1X6GA 2X51A 1AT1B 4XTVA 1EIFA 1NYGA 2BUDA 3TCJA 2CGHA 3I55T 1VQKQ 2V8JA 2LCSA 2PUOB 4FYVB 2H3JA 3QIIA 2NYSA 4OP0A 5GAN5 1NM7A 1UDLA 3CMAA 2VYTA 2LCLA 3C12A 1M4ZA 4FCYA 1D0XA 1IB8A 2LVMA 5LJ5f 5LJ5e 1V1CA 2LQNA 2KRNA 2RI2A 3L2RA 1SRMA 5D6YA 5AT1B 2AHJB 4XTYA 2YUQA 1BIAA 1YITT 3MHXA 2NWMA 2SRCA 1VA7A 5GAN8 2DYIA 3EH2A 1G3TA 4IIMA 1RACB 5C0MA 2RNAA 1G8XA 3AT1B 3DB3A 3RDVA 1Y7XA 2CP5A 2XDPA 1Q82C 2KAFA 2P0PA 4EMKA 4C92E 2IVWA 1VQMQ 1WX6A 1K73C 2LX7A 1B07A 1O75A 3V7SA 3FC3A 2K6DA 3P8BB 3GOXA 3QZ9B 1MV3A 1N8RR 3NFCA 2JJ9A 1VQ5A 1AD5A 4ELYC 3RIRA 4C92D 2X3XD 2Y4YA 3LLRA 2AKKA 5FU6C 1UG1A 1YI2A 4HCCA 1T3SA 1IGUA 2CH4A 1H92A 3OY9A 2RQUA 4HVVA 3D7SB 1M30A 3QSUA 3I55A 1KQSS 3V7RA 3KFVA 4GLKA 4Y28E 2O01E 3SWNA 3E2UA 1OZ3A 5KE2A 2HD0A 3CQTA 1JO8A 1YBYA 5CCAA 2VKNA 4QQDA 3VS7A 4JDSA 4O5VA 4JPBW 4PLIA 1KHIA 1X2QA 2QTVA 4XTWA 1ZUYA 1ACMB 2BZ8A 2MF2A 2RJDA 1SRLA 2JMCA 1YITA 4ZN3A 3GIBA 1Q82U 1EFNA 3EGXA 1XJWB 3QZ5B 1K73U 3X24B 2DTOA 1M3BA 1NJIR 2B8AA 1KQSA 3PGGA 2CSQA 4JJBA 3OSSC 2DKGA 1RLPC 4OMOA 2CKKA 1GFDA 3CC2Q 2PU9B 1BCOA 5CIUA 5GAN3 2V26A 1QCFA 4IUUA 3G71T 4A4FA 3TREA 2HBPA 1TSFA 2XICA 4C92A 3CCRQ 1YJNT 1Q7YU 1VQ6Q 2DL3A 2RMOA 2RM4A 3FB9A 2OJ2A 4KT0E 5CKFA 1Q81C 1GCQC 3PE0A 3EG0A 3EGDA 1RAFB 1UGSB 3OYHA 2DTHA 4WTOB 2ZZDA 2FYKA 5CKHA 2K9GA 1RAEB 4J7FA 2R5MA 2LNHB 2GFAA 2EQMA 1JEGA 2LJ1A 1ZSZB 3VS6A 4BDYA 1SSFA 5KYWA 3C94A 3QDFA 2QGFB 2RQTA 3JCMc 1E6GA 4C92G 2GCXA 3UF4A 5DLOA 1R8OB 3HRSA 4E7IA 2COZA 4M75F 1OU8A 4QKUA 2K79A 2LC4A 3J81E 2FB7A 3RERA 4II1A 1VQNQ 3A8LB 1MMAA 3M4GA 4OB1B 1E7OA 4YTLA 5KYXA 2OTLQ 4DQ2A 2DPPB 2W10A 4F16A 1JXMA 3NTIA 2RH2A 1LOJA 3SEMA 1FMWA 4XK8E 4LDXA 2L2PA 4RTZA 2PNIA 2X35A 1I4K1 2MCNA 2DIGA 2K5FA 4J7IA 1Q81U 2HQEA 2QK0A 5GAOn 3CCVQ 1N8RC 1TXQA 3JCMX 1YJNA 1PC0A 2L89A 1VQ9T 1QQJA 1FX7A 3U23A 1JQQA 2VVKA 1JJ2S 1JRIA 2GGRA 3OW2P 2XD0A 4M75E 3EFOB 1RUWA 1G3SA 1UJYA 1SKUB 2E64A 2JUFA 2FPEA 4C8QE 1YJ9A 2VWFA 4MDWA 3M4YA 1Z9ZA 2DL8A 2MWOA 4M75D 4R0KA 2A28A 4JRKA 2CP7A 4C8QD 3VUBA 3H6ZA 3QKJA 1M1KR 2KBTA 4FSXA 4J9CA 3I56Q 3CBMA 3OMGA 1V29B 2CT4A 1JJ2A 4JUVA 2CP2A 5HK3A 4C0FA 3EG2A 2EQJA 1TU0B 1X6OA 3MO8A 5CQXA 4A4GA 4ZGJB 4FT2A 4K11A 3L2UA 1U1SA 2EFIA 4XU1A 1G5VA 1KIKA 1ZBXA 1N8RU 1WGSA 2OX7A 4J5YA 2WSFE 1WYXA 2DVEA 3ER0A 4XTXA 1VQ8T 3OW2S 5GAOq 4OMQA 2RF0A 5IHNA 2CP0A 1K0SA 4HCKA 2MOXA 2GF7A 1VQKT 1MMNA 1M2VA 4C5IA 1VQ9A 1X75C 5A0LA 1U5SA 2JM8A 4FT4A 3EFRA 3P8HA 2KQWA 3OYAA 2RI5A 1QWFA 2ZGWA 1YHQQ 2HL5C 1IRXA 1WHLA 1R77A 4N4HA 4M75A 3NMZC 1Y96B 4N0AC 1PRMC 3OW2A 2O4XB 4C8QA 4OMLA 2YUNA 3JAME 1M3CA 1SG5A 1OYXA 2LQKA 1VQ4Q 1XNIA 3MP8A 1AVZC 4X9CA 2MI6A 3PTAA 3H0IA 4L5GA 4RG2A 4M78F 4NOYA 3JCMQ 2DZCA 2O9VA 1VQMT 2JM9A 3CCSA 1UGVA 3HHTB 4PJJA 3ASKA 3MPUB 2YT6A 4Q5WA 2L3QA 4M75G 4PJOC 3UWNA 1YP5A 2NUPA 1WHMA 3MEVA 5GANj 4C8QG 2XU8A 1VQ8A 2VGNA 4KGXB 2QXFA 1T0HA 2RJEA 2H8HA 2YLCA 4PJMA 1YWPA 2RQRA 1Y07A 1IXDA 4ZGEB 2CUDA 1VQKA 2CP3A 3EHRA 4AT1B 3KBGA 1WXUA 5GJWB 3L1AA 3OYNA 1HJDA 2CYZB 4DEXA 4M78E 3V8KA 5KYYA 2BE7D 3JB9J 4PFPA 4LE9A 5FRNA 1B34A 4EMKB 4LDWA 3EGUA 2QQBA 5CK9A 1PWTA 3EHQA 2XK0A 1M8VA 4A63B 3N5BB 4M78D 1XQHA 4C0ZA 2O31A 1QKWA 1X43A 2E12A 3M56A 3JCMg 3UATA 1UGRB 2K57A 1M1KC 3TEEA 4V2SA 4J9HA 4MMLA 4Z89A 5IXFA 3QO3A 3JB9F 5GAN2 3PFSA 3CC2T 3OYKA 1Q95G 5GMKi 3OYEA 1VQMA 5GANh 2DJQA 3UPUA 2ROLA 4JJDA 7AT1B 2EWNA 2VC8A 3X26B 4PJOF 3CCRT 4PJNA 1VQ6T 4JJNK 4M7DF 3HFNA 4J9IA 1KK7A 5FU7C 2WSEE 3JB9I 4QQGA 2E3IA 4KH1B 4FW1A 5IT9E 2YHTA 2M16A 3CCQQ 2QQAA 5IAYA 4BACA 1ZUUA 1WIEA 4XU0A 2RI3A 1VQOQ 1M8MA 4M7AF 2CP6A 1SHGA 5L23A 1G3YA 4JLIA 4LUEA 3LYIA 1WI7A 2EGEA 4L59A 4EMGA 4B9XA 3M53A 4D8KA 8AT1B 1OI1A 2DILA 2WACA 5IN1A 1V76A 1QVGS 5DLQE 2D8JA 2E5QA 4RKUE 2XDDA 1WHHA 4J9EA 4BUGA 1M1KU 2RHYA 2RJCA 2F69A 4KULA 3E1SA 1C6VX 1UE9A 4HVUA 4M78A 2HEQA 4RCBA 2K3BA 3MEAA 1W2BS 5GJVB 1VQNT 2OTLT 1VYVA 2E5KA 2V1RA 1OPLA 2JTMA 4F7UF 5GANd 4JZ3A 2ENMA 3CC2A 4X9DA 1K76A 2K3XA 2JTFA 5GAN6 2VXEA 3JCMb 4OB3B 1QVGA 5FWBA 4RTXA 3OYDA 3CCVT 2F2WA 3V7CA 1J3TA 1ZA2B 3CCRA 3GPLA 4HA8A 1VQ6A 4M78G 5KYWB 2V8IA 3FRNA 1W2BA 2G3RA 4R55A 4VUBA 2L8DA 3RR6A 4NL2A 1RADB 3RUXA 3CMEQ 2KR3A 2XI9A 1PG5B 3RKXA 4A54A 4RMOA 2DERA 3X25B 2YDLA 3OSVA 3URGA 2RQWA 2LJ3A 4DA4A 2E3HA 5KYXB 2DXCA 2EYWA 4LXCA 2JMAA 4ZTJA 2ATCB 4F7UE 3JCMf 3NHNA 1JU5C 2RQVA 1YIJQ 2YLBA 2QA4Q 3JCMJ 4M77F 2A36A 2PZ1A 1XOVA 2DL7A 1BK2A 2A3LA 1N6AA 4J6YA 3JCMd 4JS4A 2RO0A 5GMKe 1PKSA 4E7LA 3UA7A 4MZPA 1VQNA 2OTLA 2JOYA 2MYSA 3RBBB 1JBMA 1VYTA 2A0FB 2XG8D 4AMCA 5KCOA 3UA6A 3SDZA 2XDBA 4M7DA 2DAQA 4TVRA 1AZGB 2M51A 3H9NA 4E6RA 3EFSA 3EG3A 1MMGA 1WHJA 3QPHA 4JRQA 3CC4Q 1WHGA 3JCMW 4M7AA 4FIBA 4WCIA 3CCVA 1RI9A 5GMKl 4GBQA 1YN8A 3A8GB 2VB6A 1I5OB 3M5AA 4A53A 4KGZB 5A0GA 2F5TX 1FMVA 1NEGA 3VS4A 3HPWA 4J9DA 4XAXB 4PLLA 2EGCA 2EJ9A 1YHQT 2COWA 2KDSA 1OX8A 1QWEA 5KE3A 1IO6A 4AG2C 3H0HA 1HSQA 4ESRA 2D6FA 3JCMP 1BU1A 1H641 3M55A 2CSIA 3CCJQ 1YWOA 2OTJQ 1Y0MA 3BY7A 4P5NA 2DL4A 2KEAA 2DXTA 1VQ4T 5FU6B 1BYMA 3I56A 4PFZA 3QUIA 2VUBA 1NPPA 2YUOA 4F7UA 1VYUA 2DETA 1M2VB 1E6HA 5KH6A 4A4EA 2A7YA 1ZSZC 2DK3A 4DOVA 1NBEB 1UECA 4QVDA 1M9SA 3CCEQ 1OULA 3CCMQ 4JLGA 5GMKm 4C5EA 3A1PA 1K9MC 2K4YA 2QDLA 4M75B 1K0XA 2D0QB 1YJ9T 4F14A 1G83A 1M5Q1 4F7UG 4C8QB 1CSKA 1G2BA 1M1FA 4C5GA 3BFMA 3OBYA 1SHFA 4HT8A 3OYFA 2HSPA 3PNWC 3E9GA 4ME7A 2RHIA 5HY6A 4MDXA 2DF6A 2BE9B 2JW4A 4M77A 1YHQA 3VRYA 4CC7A 1NEBA 2FVUA 3QWYA 1U1TA 3JB9H 2EJGA 3GNFB 1QVFP 2FPDA 1TOVA 4HCBA 3LWHA 3OBWA 3OS0A 2BKDN 4J9BA 2ZAEA 5I21A 2NUPB 1VQ4A 1MGQA 1IZ6A 4RTUA 4PNOA 4RTYA 4HT9A 3LWIA 1VQ7Q 2EBPA 4BE2A 3CC7Q 2YSQA 1D0ZA 1BI0A 1C1AA 2DEQA 4M77G 3NTHA 2ED1A 3G1JA 3P8DA 2AZVA 1QP2A 3TQ7P 2C06A 5KYYB 1UGPB 3WVDB 3M0QA 1B34B 4J6WA 2HQXA 3DKMA 1NLOC 5D6WA 4EIKA 1ZLMA 3CCQT 3M54A 5EC7A 3OS2A 2J7IA 1XTDA 2Z0WA 1VQOT 1ABQA 1JXOA 4GLMA 4F17A 2AZSA 3A8OB 1WZOA 1FWZA 4JRIA 2GTOA 1RL2A 2IPOB 1BKBA 2EYYA 1AHJB 5EG2A 3SB2A 2EQIA 2L3PA 3QYGB 5GAOp 4O6JA 2HKQB 4RTWA 3BE3A 3HSBA 2X4WA 3LGFA 4FU6A 4Y92A 2IIMA 1G3WA 2J6OA 3S3NA 1KQ2A 1WA7A 3I5SA 4M4ZA 3KXTA 1NZ9A 3MJXA 2HQHA 3HKSA 1BCMA 1VQLQ 2EW3A 2JTEA 3CCST 4DEYA 4QVCA 2XMFA 4E2FB 4HVWA 1DJ7B 4A4KA 2QAZA 3L2VA 4OMMA 4JS5A 3DLMA 3VYGA 5A2QE 2RB6A 2J06A 1TG0A 1BI3A 1QVFA 4WF2A 3CD6Q 1KD1C 3V8LA 3E9FA 3WVEB 1OZ2A 2Y90A 1AOJA 2AT1B 5I2MA 1FYNA 1PKTA 2DIQA 3INZA 2L0AA 2MPXC 2NLUA 1K8AC 1VQPQ 4Z8AA 1UTIA 2JS0A 1O9SA 4C0GA 3CCQA 3QJYA 1PSEA 1ZSGA 2KYMA 2LMJA 1VQOA 3CMET 4M78B 3FDRA 3VUZA 3SHWA 3OYJA 2QASA 1TUDA 3A8MB 4CC2A 2M02A 2VASA 3M0PA 2VGMA 4J9FA 5HCKA 3I35A 4FYYB 2PTKA 5CQYA 2H3EB 1KSWA 2E65A 1ZBJA 2ZPHB 1YIJT 2QA4T 4BB7A 4J9GA 2DL5A 2HL3A 1YCSB 3OYGA 4PK4A 3LX7A 2HMAA 2EYZA 5LJ3j 3M59A 8ATCB 2K3YA 2MIOA 5GAMj 4KH0B 5GANg 1NPRA 2C0IA 4ZTFA 4OGCA 1UJ0A 1KD1U 1D3BA 4FM4B 3QJ6A 3VS1A 2D8HA 3EG9A 3QWXX 3VS0A 4BY6C 4AFZC 3X28B 4F04B 3OYIA 2DA9A 1PRLC 2P0QA 1VOMA 3PT9A 3OYLA 4EMKC 1UB4A 2D0NA 3MEWA 2E41A 1GCQA 3G71Q 3UDCA 2RHUA 3CC4T 3HRTA 3BDUA 1HK9A 3PIOA 4CI0C 3OS1A 1I81A 1YJNQ 2NUZA 4LNPA 4PFOA 3RESA 1R0CB 4NL3A 1LJOA 3J7AF 1W1FA 4DBFA 2DXUA 3OYBA 2OAWA 3C4SA 3PMIA 2KYBA 1HYOA 2JVVA 3ME9A 2E4HA 3CMEA 4JZ4A 5A0DA 4B6MA 1KG1A 2K5LA 4QQ6A 3SWNC 5LL6S 1UFFA 3VRZA 1K9AA 3OQ5A 3CCJT 5LJ3h 2OTJT 1M2OA 3GNGA 2GQIA 1QMCA 1KFZA 6AT1B 5GAMh 1M3AA 2CZ6B 2FPFA 3LH0A 2YRDA 4M7DB 1YIJA 2QA4A 3C95A 3PVQA 2KGTA 2M0OA 4QW2A 3THKA 1D1CA 1M90R 2XKOC 3ZBDA 5LJ5j 3TVTA 2KXCA 1AWWA 2X4YA 4KRTA 4M7AB 2KI7A 1B3QA 3M0UA 3R6NA 4HCZA 2BZXA 3FJ5A 1S72Q 2FRWA 1D09B 2MWPA 3EH1A 1HD3A 1AWOA 2J6KA 4KGVB 3CPFA 3AHUA 1IHWA 3CBOA 5GAN7 1D1BA 4Z88A 3CC4A 1BIBA 3CPWP 1PCXA 3RKWA 1HXDA 4C92C 3V8JA 4MMKA 4XTZA 2A08A 1M1GA 4OVAA 1MHNA 4DBHA 4CC4B 2AK5A 1GRIA 2O2OA 4QVZA 3JCMV 1KQ1A 1D0YA 5KCHA 3DLLA 3GF5A 2CZ0B 4E7JA 4F7UB 4OB2B 1WXBA 1PSFA 3SFMA 5LJ3d 1LPLA 1AWJA 4C0DB 1WXTA 2E70A 1KHCA 5GAMd 1NYFA 2QI2A 2R58A 5HK0A 2ZCFB 3OA6A 3JB9D 3CCJA 2OTJA 1M27C 5GANf 5GANe 4PJOE 5LJ5h 1ZUKA 4M7DE 1NE8A 3R6OA 1UUEA 2HSEB 1GL5A 2HBWA 2EYXA 1PNJA 4GY5A 2D1XA 2X4JA 1EZZB 2DBMA 4M7AE 1VQ7T 2GNCA 4PJOD 2C0TA 5KYUA 2J6FA 4M7DD 1YJWQ 2ESWA 1K9MR 3CC7T 2QEXQ 1I5LA 2OAUA 2LQWA 2LX9A 2W0ZA 1FMKA 4ATOA 5IHKA 3OYCA 1NLPC 4PL6A 4EDUA 4D8DA 3CPWS 2M0YA 3PVLA 2LJ0A 4M7AD 3O8VA 1LCKA 2QDYB 1Y57A 3VS2A 1X2KA 3NTKA 3CCEA 5GMKh 4M77B 5J3BA 4ELZC 3HP9A 2KT8A 4HKEA 4E7HA 2LT4A 1RAHB 4OF1A 4C92F 3FIFA 2EPDA 4X1VA 2HCKA 2K5IA 1AEYA 1Z9QA 4JJCA 3EG1A 1VIFA 4A4HA 5HKCA 4N0AA 1U06A 5I22A 4IIOA 2DD4A 3CCUQ 2V1QA 1AZEA 3JCMe 2DX1A 3M57A 2KT1A 2LRQA 2X9HA 1KQSP 4OGEA 4L6V5 3CPWA 3I56T 5LJ5d 2E6ZA 4Y91A 3G6EQ 3HTRA 4LN2A 4LD9K 4KBMB 2DRKA 2KNBB 1YNZA 3CEYA 1N9SA 1VQLT 2FG0A 2PVOB 2XIDA 3G4SQ 2JT4A 2LZ6B 1OX9A 3FLGA 4N4GA 2LP5A 4FYWB 2ROTA 1H3ZA 5AYFA 1X01A 4PJOA 1MV0B 3LW5E 1M90C 4HXJA 1IHVA 1ZHIA 4XU2A 3M9QA 1GXIE 1VQ7A 2R57A 3CD6T 1Q86R 2FL7A 1EX4A 3CC7A 2ED0A 3OMCA 3MKDA 1CKBA 2PUKB 3JB9G 1LNXA 3HL8A 4M77E 2YXYA 3VU3C 2DYBA 2MK5A 2EQUA 2KVQG 1R0BG 2FO0A 1PD0A 1VQPT 1IREB 4KUIA 3EAEA 4ZGDB 1OU9A 4LDUA 2L3SA 1Q7YC 1I0CA 4PJOG 1X6BA 4M77D 4M7DG 1BI1A 5FWCA 1BB9A 2K2MA 3MP1A 3RMQA 3TSZA 1OOTA 2L3RA 2V8KA 1UHCA 3I5RA 4KUDK 3CCLQ 2ZPIB 3VS3A 3H8ZA 1IGQA 3A98A 3O5ZA 4M7AG 4J8OA 4CRIA 5CR2A 2EKOA 3GP8A 1FXXA 3BW1A 4M75C 1MNEA 1X27A 1ARKA 2DVJA 4IKFA 1GCPA 1I8FA 1KD1R 1M90U 1QCOA 4X34A 3H41A 4C8QC 3M58A 1VQLA 4J83A 3PMTA 3L2ZA 4RUGA 3MEUA 4FW2A 1RAAB 3QG1A 3WXMB 1U8RA 2K7AA 2ZPEB 4PJLA 2ZPFB 3QDRB 1GBQA 1OQKA 3HFOA 2QYZA 1RAIB 3OYYA 3OYMA 1K8AR 3MCAB 3CD6A 5IH2A 1ZQ1A 2IG0A 3Q1JA 5GAN4 5CO7A 2FZCB 2RN8A 2CZ1B 4QT7A 1I07A 3FEOA 4FSSA 1D1AA 1PM3A 1WHKA 2FRYA 2JS2A 4MZMA 3RKYA 3CMAQ 2CREA 5GAOr 2X4XA 1RABB 2LT1A 1OPKA 5FRMA 4DOWA 4BI3A 4E7SA 4E47A 1VQPA 5J39A 2E1HA 1S1NA 2HNIA 2NUTA 5FW9A 4ZNXA 3IQLA 1JJ2P 1D3BB 2HAXA 1TUGB 3EG9B 2C0OA 3ZFJA 3LH5A 2JNGA 2JZ2A 3HRUA 2RA2A 4IUTA 1LVKA 4AG1C 1ZX6A 2B86A 2DLPA 4C8QF 1YCYA 3VV0A 3NPFA 2HKNA 5DM7R 2L5QA 2EYQA 4EMHA 1K9MU 2KRMA 1VQ5Q 2YWWA 5J26A 1S72T 4PKCC 2ZPBB 1KC8R 3M0TA 2AIRB 2ABLA 1MMDA 1RLQC 3A5ZB 1C0MA 4MZTA 1YI2Q 1WNLA 2PVDB 1QCNA 1TS9A 2E6NA 1T0JA 1W6XA 1Q86C 4LD6A 3G71A 3RMSA 4IUQA 5FROA 3I55Q 1SF9A 5CVIA 2QGGA 2I2LA 2GBQA 3M0RA 4IURA 2DMOA 1P92A 4AFQC 3QHSA 1ABOA 2KE9A 1QVFS 1RI0A 1I1JA 2XHCA 1N27A 3E19A 3VKIA 2F5KA 5CKDA 2D9TA 2DTIA 3S6WA 2LTOA 2MMPA 3FJPA 5C6SA 3L2QA 1SEMA 1WPYA 1YITQ 2OI3A 2EKHA 3QYHB 4B9WA 2GQVA 2DEUA 5DY9A 1TWBA 2LNVA 3GLXA 3VJPA 5CKBA 1K4US 2COYA 2G6FX 2CZ7B 4XQ3A 5KYNA 1SPKA 3OB9A 1BBZA 2PQWA 1VUBA 5D6XA 3RNJA 1WQWA 3SD4A 1GBRA 3JSCA 4M78C 3DB4A 4BD3A 2DNUA 4DBRA 5GAOl 2YRCA 1YJWT 2VXFA 3REBB 3I9QA 2DBKA 2QEXT 5CAIA 1B7TA 1Q86U 1NJIC 2LCCA 2QQ9A 4BE0A 1S72A 1BI2A 2YUPA 3S3MA 4FYXB 3KUFA 4AFSC 1QKXA 2JN0A 2KK4A 2QG9B 3QXEB 2R5AA 3TU4K 2DFUA 4LDVA 1UGQB 3M0SA 3MP6A 2EIFA 2QQSA 2EJFA 2Y4XA 2KRSA 4C5HA 4EPCA 3ULRB 5LJ3g 2DZ9A 2X3WD 1AWXA 4N4IA 3CCUT 5GAMg 4OMNA 1VIEA 4DBQA 1QVPA 5KYUB 2MAMA 4NS5A 2DD5A 1TTHB 3TSWA 3QBYA 3G6ET 2P0KA 1NG2A 2CDTA 3UT1A 3CBPA 4RG8A 1UEBA 1W4SA 4RTVA 5ECAA 2CT3A 1QP3A 3G4ST 1ZSZA 5GAOm 5IHIA 2RHXA 5D7UA 3JRZA 1NJIU 4CC3A 1WDXA 2J05A 3ZL7C 1T3LA 4IUVA 4BE1A 4LDYA 4RTTA 3PIPA 2RK2A 1PD1A 1YJWA 2BTTA 2DJZA 1K8AU 2QEXA 3S3OA 2M9UA 1X69A 2RD1A 2HDAA 4XTUA 1OV3A 1KC8C
chains in the Genus database with same CATH topology
4C8QE 1YJ9A 4M7DD 4MDWA 5M9OA 4M7DC 3CC7T 2DXTA 3M4YA 1VQ4T 4FL6A 2RHZA 5FU6B 1BYMA 2RJFA 1I5LA 2OAUA 3I56A 2CS7A 3QUIA 2LX9A 2MWOA 4M75D 4ATOA 3OYCA 2VUBA 1NPPA 5CKEA 4F7UA 4PL6A 2DO3A 4EDUA 3CPWS 3F70A 4BI8B 3O8VA 4M7AD 2QDYB 4JRKA 3G7ZA 4C8QD 4M7AC 3VUBA 3H6ZA 3QKJA 3NTKA 4FSXA 3CCEA 3ZEHA 5GMKh 4M77B 2KY9A 2ZPGB 3CBMA 3OMGA 3HP9A 4IUPA 2A7YA 1V29B 5J3BA 4A4EA 2DK3A 4BY6B 1JJ2A 4HKEA 5LJ5g 4E7HA 4BI4A 2FHDA 4E7KA 4JUVA 4DOVA 2LT4A 3CCUA 4XU3A 4OF1A 5HK3A 4C92F 2K2VA 3FIFA 4C0FA 3CCLT 2RK1A 2EQJA 2KMTA 4PJOB 4QVDA 1M9SA 4PJOD 4OB0B 1X6OA 4JLGA 3MO8A 4R56A 2K5IA 5GMKm 5CQXA 2YRVA 1VIFA 4FT2A 4A4HA 4A4GA 4C5EA 4N0AA 4ZGJB 5HKCA 1U1SA 3L2UA 2K4YA 1K9MC 2EFIA 2DD4A 4XU1A 4M75B 2D0QB 1JB0E 3G6EA 1G5VA 1ZBXA 1YJ9T 1WGSA 1N8RU 3JCMe 3M57A 4J5YA 2WSFE 1M5Q1 2LRQA 2DVEA 4OGEA 3ER0A 4L6V5 4XTXA 2M1HA 4C8QB 4D6WA 1M1FA 4C5GA 3I56T 3BFMA 3CPWA 1VQ8T 2PVGB 3G4SA 5GAOq 3OBYA 1QW1A 3OW2S 5LJ5d 4HT8A 2E6ZA 3OYFA 2BIVA 3PNWC 4Y91A 3E9GA 4ME7A 5FLXE 2GF7A 2RHIA 4LD9K 1N9RA 4JRPA 3X20B 4KBMB 3CEYA 1VQKT 5HY6A 4MDXA 1KC8U 1N9SA 4C5IA 1VQLT 3CCET 1VQ9A 1WJRA 3CCMT 2PVOB 4M77A 2XIDA 1YHQA 2DXBA 1X75C 1TH7A 2FVUA 4C0DC 5A0LA 3FLGA 1U1TA 4N4GA 2WSCE 3JB9H 1H3ZA 4RCCA 4BDZA 2EJGA 3SWNB 3GNFB 1X01A 5AYFA 4PJOA 4HCBA 3LW5E 4FT4A 3OS5A 3EFRA 1M90C 2KSSA 3LWHA 1ZHIA 3META 3P8HA 2KQWA 3M9QA 4J6XA 4XU2A 3OBWA 1VQ7A 4F7UG 2RI5A 3OS0A 3OYAA 2ZGWA 5I2SA 1GXIE 2BKDN 3BDLA 3CMAT 2E10A 2QTXA 2R57A 3CD6T 5LJ3f 5GMKj 5LJ3e 2FL7A 4N4HA 5I21A 3CC7A 3OMCA 4M75A 1VQ4A 1MGQA 1IZ6A 5GAMe 5GAMf 4PNOA 1Y96B 3J80E 4N0AC 2LQ8A 3LWIA 4HT9A 3OW2A 1WQ7A 2O4XB 4C8QA 2PUKB 3JB9G 2EAYA 3JAME 1LNXA 3HL8A 4ZN1A 5KH6A 1OYXA 4BE2A 4M77E 2LQKA 3VYHB 3VU3C 1WJQA 1XNIA 2EQUA 2KVQG 3MP8A 1BI0A 4X9CA 3CXCS 2DEQA 2MI6A 3PTAA 3L2WA 4M77G 1VQPT 4L5GA 3T9NA 4RG2A 3NTHA 1IREB 4KUIA 3EAEA 4M78F 4NOYA 3JCMQ 2DZCA 4ZGDB 3P8DA 4LDUA 1QP2A 1Q7YC 1VQMT 4OMFB 2LDMA 3CCLA 2C06A 4PJOG 2QQRA 1UGPB 5FU7B 3WVDB 4M77D 4M7DG 1BI1A 3CCSA 1WJSA 1B34B 4J6WA 2HQXA 3HHTB 3MP1A 4M77C 3RMQA 3LGLA 3DKMA 5D6WA 3ASKA 2L3RA 3CCQT 2V8KA 3M54A 3OS2A 2GFUA 4KUDK 4Q5WA 1XTDA 1Y71A 4M75G 1VQOT 2ZPIB 4PJOC 3H8ZA 3UWNA 3A8OB 2VV5A 4C92B 4M7AG 1FWZA 4J8OA 5L8RE 3MEVA 4CRIA 5GANj 4C8QG 4JRIA 1Y96A 2XU8A 1VQ8A 5CR2A 2VGNA 2EKOA 2EQKA 1RL2A 2QXFA 2RJEA 3JCMh 3GP8A 1FXXA 1BKBA 2YLCA 2O4XA 3BW1A 1VQ5T 4M75C 1AHJB 5EG2A 3SB2A 3L42A 4IKFA 1Y07A 3QYGB 1I8FA 5GAOp 3CXCA 4Z02A 4O6JA 4ZGEB 1M90U 1VQKA 2P4TA 4X34A 4UC4A 4C8QC 3M58A 1VQLA 3KBGA 4J83A 1YI2T 2X4WA 3PMTA 3HSBA 3A8HB 3CCMA 3L2ZA 3LGFA 4FU6A 3L1AA 3MEUA 3OYNA 1G3WA 3S3NA 4XTVA 1KQ2A 1EIFA 2BUDA 2CYZB 3QG1A 3WXMB 1U8RA 3TCJA 2CGHA 2ZPEB 2ZPFB 3QDRB 4M78E 3I55T 3KXTA 2V8JA 3V8KA 3JB9J 1NZ9A 2PUOB 2H3JA 3HFOA 3QIIA 3HKSA 4OP0A 5GAN5 3OYYA 5FRNA 1B34A 4EMKB 4LDWA 3OYMA 3CCST 4QVCA 3CMAA 2VYTA 2LCLA 2QQBA 3MCAB 3CD6A 1ZQ1A 1M4ZA 3C12A 2IG0A 3Q1JA 5CK9A 5GAN4 5CO7A 2LVMA 5LJ5f 2CZ1B 5LJ5e 1DJ7B 4A4KA 2XK0A 1M8VA 3L2VA 4JS5A 2RI2A 3DLMA 3VYGA 5A2QE 2RB6A 3FEOA 3N5BB 3L2RA 4M78D 1BI3A 1XQHA 3G71T 4MZMA 3RKYA 4WF2A 4C0ZA 2E12A 3CC2A 1QVFA 3M56A 3JCMg 5D6YA 2X4XA 5GAOr 1KD1C 1UGRB 2K57A 2LT1A 1M1KC 3V8LA 2AHJB 3TEEA 5FRMA 3E9FA 4DOWA 4V2SA 4XTYA 4MMLA 1BIAA 3WVEB 4BI3A 4E47A 1YITT 3QO3A 1OZ2A 3MHXA 5J39A 1VQPA 3JB9F 5GAN2 2E1HA 3PFSA 2HNIA 2Y90A 3CC2T 3OYKA 5GAN8 5I2MA 5GMKi 1G3TA 3OYEA 1VQMA 2DIQA 3INZA 5GANh 5C0MA 3UPUA 2NLUA 3DB3A 1K8AC 1D3BB 2HAXA 1O9SA 4C0GA 3CCQA 1Y7XA 2EWNA 2XDPA 3QJYA 1PSEA 2KAFA 2P0PA 2VC8A 3X26B 1Q82C 4EMKA 3ZFJA 4C92E 4PJOF 3CCRT 1VQOA 2IVWA 3CMET 4JJNK 4M78B 2JNGA 3FDRA 3VUZA 3HFNA 1K73C 1VQ6T 3OYJA 4M7DF 1O75A 3V7SA 3FC3A 5FU7C 2WSEE 3JB9I 2JZ2A 3A8MB 4QQGA 3HRUA 2RA2A 2VGMA 3P8BB 4IUTA 3QZ9B 3GOXA 5IT9E 2YHTA 2M16A 2QQAA 5IAYA 4BACA 3NFCA 1VQ5A 4XU0A 2RI3A 5CQYA 4ELYC 4M7AF 3RIRA 4C92D 2Y4YA 1G3YA 4JLIA 4C8QF 1YCYA 3LLRA 3LYIA 2E65A 2ZPHB 5FU6C 3VV0A 2QA4T 1YIJT 4BB7A 5DM7R 1YI2A 4HCCA 2L5QA 2EYQA 4EMHA 1K9MU 4L59A 4EMGA 4B9XA 3M53A 3OY9A 3OYGA 5J26A 1S72T 3LX7A 5LJ3j 3M59A 4PKCC 1OI1A 2ZPBB 2WACA 5IN1A 2K3YA 3QSUA 5GAMj 3I55A 5DLQE 1QVGS 1KQSS 3V7RA 4MZTA 3A5ZB 1NPRA 4GLKA 5GANg 2E5QA 4ZTFA 4OGCA 4Y28E 1WNLA 2PVDB 2O01E 4RKUE 3SWNA 2E6NA 1D3BA 2XDDA 4FM4B 1KD1U 3QJ6A 4BUGA 1M1KU 2RHYA 4BY6C 1OZ3A 2RJCA 5KE2A 2F69A 4KULA 4LD6A 3G71A 1Q86C 2HD0A 3E1SA 3RMSA 3X28B 4IUQA 4M78A 5FROA 1YBYA 5CCAA 4QQDA 3OYIA 2P0QA 4JDSA 4O5VA 4RCBA 3PT9A 5CVIA 3OYLA 3MEAA 1W2BS 4PLIA 1KHIA 2I2LA 4EMKC 1VQNT 1UB4A 4XTWA 2OTLT 4IURA 3MEWA 2E41A 1P92A 3UDCA 3QHSA 2MF2A 2RJDA 1QVFS 2RHUA 3CC4T 1RI0A 3HRTA 1YITA 4ZN3A 2JTMA 2XHCA 3BDUA 1N27A 3E19A 4F7UF 5GANd 1Q82U 3GIBA 1HK9A 3PIOA 4CI0C 3VKIA 3QZ5B 2F5KA 5CKDA 4X9DA 1I81A 3OS1A 2D9TA 2DTIA 2K3XA 2JTFA 3S6WA 5GAN6 2LTOA 1K73U 2MMPA 3X24B 2DTOA 3FJPA 5C6SA 2VXEA 3RESA 4NL3A 3JCMb 4OB3B 2B8AA 1LJOA 3PGGA 1QVGA 1KQSA 3J7AF 3OSSC 3L2QA 1WPYA 2DKGA 3QYHB 2CKKA 2DXUA 4B9WA 3OYBA 2GQVA 3C4SA 3OYDA 3PMIA 2PU9B 5DY9A 3CCVT 3V7CA 2LNVA 3GLXA 5CIUA 3CCRA 3GPLA 5GAN3 2JVVA 3ME9A 4HA8A 3CMEA 3VJPA 4M78G 5CKBA 1VQ6A 2CZ7B 2V8IA 4XQ3A 4IUUA 5A0DA 3FRNA 3OB9A 4A4FA 2G3RA 3TREA 2K5LA 2PQWA 4QQ6A 4R55A 3SWNC 5LL6S 1W2BA 1KG1A 2HBPA 1VUBA 4VUBA 2L8DA 5D6XA 3OQ5A 1WQWA 2XICA 5LJ3h 3CCJT 3GNGA 4NL2A 4C92A 2OTJT 3RUXA 3SD4A 3JSCA 1YJNT 1Q7YU 4M78C 3DB4A 2XI9A 5GAMh 3RKXA 4A54A 4RMOA 2CZ6B 3X25B 2RM4A 4BD3A 5GAOl 3OSVA 1YJWT 2VXFA 3LH0A 3URGA 4M7DB 3FB9A 4ELZC 2QA4A 3C95A 2QEXT 4DA4A 1YIJA 5CAIA 4KT0E 5CKFA 2M0OA 4QW2A 1Q81C 1Q86U 1NJIC 2DXCA 2LCCA 1UGSB 2QQ9A 4BE0A 1S72A 1BI2A 4ZTJA 3OYHA 2XKOC 4F7UE 3ZBDA 5LJ5j 2DTHA 3JCMf 3S3MA 3KUFA 2ZZDA 2FYKA 2X4YA 5CKHA 4M7AB 2YLBA 3JCMJ 2JN0A 2KK4A 3QXEB 4J7FA 2R5AA 4M77F 2R5MA 3TU4K 2GFAA 1XOVA 4HCZA 2EQMA 4LDVA 2A3LA 1UGQB 3MP6A 1N6AA 2EIFA 4J6YA 3JCMd 4JS4A 4BDYA 2RO0A 1SSFA 5GMKe 2QQSA 2MWPA 3C94A 4E7LA 2EJFA 2Y4XA 3JCMc 4C92G 4MZPA 2GCXA 3CPFA 4C5HA 1VQNA 3AHUA 5DLOA 1R8OB 3HRSA 2JOYA 4EPCA 4E7IA 2OTLA 4M75F 5LJ3g 1JBMA 2DZ9A 3CBOA 5GAN7 4N4IA 3CCUT 2XG8D 5GAMg 3CC4A 1BIBA 2LC4A 3J81E 5KCOA 2FB7A 3RERA 1VIEA 3RKWA 3SDZA 4II1A 1HXDA 4C92C 2XDBA 4M7DA 3V8JA 3A8LB 4MMKA 4XTZA 3M4GA 2DAQA 1QVPA 4OB1B 1M1GA 4TVRA 4YTLA 4DQ2A 2MAMA 2DPPB 4NS5A 4OVAA 1MHNA 2DD5A 3EFSA 3QPHA 3NTIA 4JRQA 3QBYA 2RH2A 3G6ET 2P0KA 4QVZA 3JCMV 1LOJA 1KQ1A 3UT1A 5KCHA 3JCMW 4XK8E 3CBPA 4LDXA 3DLLA 4M7AA 4FIBA 4RG8A 3GF5A 3CCVA 1UEBA 2CZ0B 5GAMd 4E7JA 4F7UB 5GMKl 1W4SA 4OB2B 2X35A 1PSFA 3SFMA 3A8GB 5LJ3d 1I4K1 1QP3A 3G4ST 4C0DB 5GAOm 2DIGA 2RHXA 2E70A 1KHCA 2K5FA 3JRZA 3M5AA 2QI2A 2R58A 4J7IA 5HK0A 4A53A 1Q81U 1NJIU 2HQEA 2ZCFB 5A0GA 2F5TX 3OA6A 3JB9D 5GAOn 1N8RC 3CCJA 2OTJA 5GANf 5GANe 4PJOE 3JCMX 5LJ5h 3HPWA 4XAXB 1YJNA 4M7DE 2L89A 4PLLA 1NE8A 4IUVA 4BE1A 1FX7A 2EJ9A 4LDYA 1VQ9T 3PIPA 1YHQT 2KDSA 3R6OA 2RK2A 5KE3A 1JJ2S 1JRIA 1YJWA 2DJZA 1K8AU 2QEXA 4GY5A 2M9UA 4M75E 3S3OA 2D6FA 2XD0A 3JCMP 2RD1A 1H641 3M55A 1G3SA 2X4JA 2E64A 2JUFA 3BY7A 4XTUA 4M7AE 1VQ7T 1KC8C 4P5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI3 A;  1G3W A;  2K5F A;  1BI0 A;  4O5V A;  5CVI A;  1QW1 A;  1QVP A;  1BYM A;  1U8R A;  1FWZ A;  2H3J A;  2LX9 A;  1FX7 A;  3GLX A;  1P92 A;  2K5I A;  3MHX A;  3HRU A;  2GCX A;  2QQB A;  2QQ9 A;  2K4Y A;  3HRS A;  1BI2 A;  2QQA A;  1BI1 A;  3HRT A;  4O6J A;  1G3T A;  3E19 A;  2K5L A;  1G3S A;  1G3Y A; 
#chains in the Genus database with same CATH topology
 1K1Z A;  1H3H A;  5M9O A;  2P84 A;  4M7D C;  2P4R A;  4FL6 A;  2RHZ A;  2RJF A;  2A37 A;  2CS7 A;  5CKE A;  3REA B;  2DO3 A;  1YJ9 Q;  3F70 A;  4BI8 B;  3G7Z A;  4M7A C;  2BZY A;  3ZEH A;  2KY9 A;  2ZPG B;  4IUP A;  4BY6 B;  1OEB A;  5LJ5 g;  4BI4 A;  2FHD A;  4E7K A;  3NGP A;  3CCU A;  4XU3 A;  2K2V A;  3CCL T;  2RK1 A;  2KMT A;  4PJO B;  4OB0 B;  1W70 A;  4E7Z A;  4R56 A;  3C0C A;  3EFO A;  2YRV A;  3CXC P;  1Q82 R;  2F1L A;  4OMP A;  1JB0 E;  3G6E A;  1K73 R;  1MUZ A;  2FZG B;  1QVG P;  4D6W A;  2M1H A;  1TUC A;  2PVG B;  3G4S A;  1QW1 A;  2BIV A;  5FLX E;  1H8K A;  1N9R A;  4JRP A;  3X20 B;  2DM1 A;  1ZA1 B;  1KC8 U;  2F2V A;  3CCE T;  1W2B P;  1WJR A;  3CCM T;  2O9S A;  2DXB A;  1TH7 A;  4C0D C;  2EVR A;  3VS5 A;  5IXB A;  2WSC E;  4RCC A;  4BDZ A;  3SWN B;  1Q7Y R;  2DE0 X;  2F2X A;  3OS5 A;  2KSS A;  1PHT A;  3MET A;  4J6X A;  2FEI A;  1VQ9 Q;  3H0F A;  2ECZ A;  5I2S A;  3BDL A;  3CMA T;  2E10 A;  2QTX A;  5LJ3 f;  5GMK j;  5LJ3 e;  1F1B B;  2I0N A;  2JXB A;  2KRO A;  5GAM f;  5GAM e;  3J80 E;  2LQ8 A;  2DRM A;  1WQ7 A;  2EAY A;  1UHF A;  3GBQ A;  4ZN1 A;  3VYH B;  3EGX B;  2CH4 W;  1WJQ A;  2FZK B;  1N5Z A;  1GFC A;  1QLY A;  3CXC S;  3L2W A;  1CKA A;  2SEM A;  3T9N A;  2EGA A;  4AFU C;  3JV3 A;  4OMF B;  2LDM A;  2O88 A;  3CCL A;  1A0N B;  2QQR A;  4ORZ A;  5I11 A;  5FU7 B;  1RAG B;  2RPN A;  1WJS A;  4M77 C;  3LGL A;  2CUB A;  1MND A;  2GFU A;  1Y71 A;  1WLP B;  2GTJ A;  1U3O A;  1SSH A;  2VV5 A;  4C92 B;  2AKL A;  3CCS Q;  2HZY A;  5L8R E;  1Y96 A;  1KJW A;  4ANJ A;  2EQK A;  3JCM h;  2KXD A;  1WFW A;  2O4X A;  1VQ5 T;  3L42 A;  3CXC A;  4Z02 A;  4LUD A;  2P4T A;  3EGD B;  4UC4 A;  1YI2 T;  1VQ8 Q;  2NUT B;  3A8H B;  9ATC B;  3CCM A;  1Q81 R;  1YFN A;  1X6G A;  2X51 A;  1AT1 B;  4XTV A;  1EIF A;  1NYG A;  2BUD A;  3TCJ A;  2CGH A;  3I55 T;  1VQK Q;  2V8J A;  2LCS A;  2PUO B;  4FYV B;  2H3J A;  3QII A;  2NYS A;  4OP0 A;  5GAN 5;  1NM7 A;  1UDL A;  3CMA A;  2VYT A;  2LCL A;  3C12 A;  1M4Z A;  4FCY A;  1D0X A;  1IB8 A;  2LVM A;  5LJ5 f;  5LJ5 e;  1V1C A;  2LQN A;  2KRN A;  2RI2 A;  3L2R A;  1SRM A;  5D6Y A;  5AT1 B;  2AHJ B;  4XTY A;  2YUQ A;  1BIA A;  1YIT T;  3MHX A;  2NWM A;  2SRC A;  1VA7 A;  5GAN 8;  2DYI A;  3EH2 A;  1G3T A;  4IIM A;  1RAC B;  5C0M A;  2RNA A;  1G8X A;  3AT1 B;  3DB3 A;  3RDV A;  1Y7X A;  2CP5 A;  2XDP A;  1Q82 C;  2KAF A;  2P0P A;  4EMK A;  4C92 E;  2IVW A;  1VQM Q;  1WX6 A;  1K73 C;  2LX7 A;  1B07 A;  1O75 A;  3V7S A;  3FC3 A;  2K6D A;  3P8B B;  3GOX A;  3QZ9 B;  1MV3 A;  1N8R R;  3NFC A;  2JJ9 A;  1VQ5 A;  1AD5 A;  4ELY C;  3RIR A;  4C92 D;  2X3X D;  2Y4Y A;  3LLR A;  2AKK A;  5FU6 C;  1UG1 A;  1YI2 A;  4HCC A;  1T3S A;  1IGU A;  2CH4 A;  1H92 A;  3OY9 A;  2RQU A;  4HVV A;  3D7S B;  1M30 A;  3QSU A;  3I55 A;  1KQS S;  3V7R A;  3KFV A;  4GLK A;  4Y28 E;  2O01 E;  3SWN A;  3E2U A;  1OZ3 A;  5KE2 A;  2HD0 A;  3CQT A;  1JO8 A;  1YBY A;  5CCA A;  2VKN A;  4QQD A;  3VS7 A;  4JDS A;  4O5V A;  4JPB W;  4PLI A;  1KHI A;  1X2Q A;  2QTV A;  4XTW A;  1ZUY A;  1ACM B;  2BZ8 A;  2MF2 A;  2RJD A;  1SRL A;  2JMC A;  1YIT A;  4ZN3 A;  3GIB A;  1Q82 U;  1EFN A;  3EGX A;  1XJW B;  3QZ5 B;  1K73 U;  3X24 B;  2DTO A;  1M3B A;  1NJI R;  2B8A A;  1KQS A;  3PGG A;  2CSQ A;  4JJB A;  3OSS C;  2DKG A;  1RLP C;  4OMO A;  2CKK A;  1GFD A;  3CC2 Q;  2PU9 B;  1BCO A;  5CIU A;  5GAN 3;  2V26 A;  1QCF A;  4IUU A;  3G71 T;  4A4F A;  3TRE A;  2HBP A;  1TSF A;  2XIC A;  4C92 A;  3CCR Q;  1YJN T;  1Q7Y U;  1VQ6 Q;  2DL3 A;  2RMO A;  2RM4 A;  3FB9 A;  2OJ2 A;  4KT0 E;  5CKF A;  1Q81 C;  1GCQ C;  3PE0 A;  3EG0 A;  3EGD A;  1RAF B;  1UGS B;  3OYH A;  2DTH A;  4WTO B;  2ZZD A;  2FYK A;  5CKH A;  2K9G A;  1RAE B;  4J7F A;  2R5M A;  2LNH B;  2GFA A;  2EQM A;  1JEG A;  2LJ1 A;  1ZSZ B;  3VS6 A;  4BDY A;  1SSF A;  5KYW A;  3C94 A;  3QDF A;  2QGF B;  2RQT A;  3JCM c;  1E6G A;  4C92 G;  2GCX A;  3UF4 A;  5DLO A;  1R8O B;  3HRS A;  4E7I A;  2COZ A;  4M75 F;  1OU8 A;  4QKU A;  2K79 A;  2LC4 A;  3J81 E;  2FB7 A;  3RER A;  4II1 A;  1VQN Q;  3A8L B;  1MMA A;  3M4G A;  4OB1 B;  1E7O A;  4YTL A;  5KYX A;  2OTL Q;  4DQ2 A;  2DPP B;  2W10 A;  4F16 A;  1JXM A;  3NTI A;  2RH2 A;  1LOJ A;  3SEM A;  1FMW A;  4XK8 E;  4LDX A;  2L2P A;  4RTZ A;  2PNI A;  2X35 A;  1I4K 1;  2MCN A;  2DIG A;  2K5F A;  4J7I A;  1Q81 U;  2HQE A;  2QK0 A;  5GAO n;  3CCV Q;  1N8R C;  1TXQ A;  3JCM X;  1YJN A;  1PC0 A;  2L89 A;  1VQ9 T;  1QQJ A;  1FX7 A;  3U23 A;  1JQQ A;  2VVK A;  1JJ2 S;  1JRI A;  2GGR A;  3OW2 P;  2XD0 A;  4M75 E;  3EFO B;  1RUW A;  1G3S A;  1UJY A;  1SKU B;  2E64 A;  2JUF A;  2FPE A;  4C8Q E;  1YJ9 A;  2VWF A;  4MDW A;  3M4Y A;  1Z9Z A;  2DL8 A;  2MWO A;  4M75 D;  4R0K A;  2A28 A;  4JRK A;  2CP7 A;  4C8Q D;  3VUB A;  3H6Z A;  3QKJ A;  1M1K R;  2KBT A;  4FSX A;  4J9C A;  3I56 Q;  3CBM A;  3OMG A;  1V29 B;  2CT4 A;  1JJ2 A;  4JUV A;  2CP2 A;  5HK3 A;  4C0F A;  3EG2 A;  2EQJ A;  1TU0 B;  1X6O A;  3MO8 A;  5CQX A;  4A4G A;  4ZGJ B;  4FT2 A;  4K11 A;  3L2U A;  1U1S A;  2EFI A;  4XU1 A;  1G5V A;  1KIK A;  1ZBX A;  1N8R U;  1WGS A;  2OX7 A;  4J5Y A;  2WSF E;  1WYX A;  2DVE A;  3ER0 A;  4XTX A;  1VQ8 T;  3OW2 S;  5GAO q;  4OMQ A;  2RF0 A;  5IHN A;  2CP0 A;  1K0S A;  4HCK A;  2MOX A;  2GF7 A;  1VQK T;  1MMN A;  1M2V A;  4C5I A;  1VQ9 A;  1X75 C;  5A0L A;  1U5S A;  2JM8 A;  4FT4 A;  3EFR A;  3P8H A;  2KQW A;  3OYA A;  2RI5 A;  1QWF A;  2ZGW A;  1YHQ Q;  2HL5 C;  1IRX A;  1WHL A;  1R77 A;  4N4H A;  4M75 A;  3NMZ C;  1Y96 B;  4N0A C;  1PRM C;  3OW2 A;  2O4X B;  4C8Q A;  4OML A;  2YUN A;  3JAM E;  1M3C A;  1SG5 A;  1OYX A;  2LQK A;  1VQ4 Q;  1XNI A;  3MP8 A;  1AVZ C;  4X9C A;  2MI6 A;  3PTA A;  3H0I A;  4L5G A;  4RG2 A;  4M78 F;  4NOY A;  3JCM Q;  2DZC A;  2O9V A;  1VQM T;  2JM9 A;  3CCS A;  1UGV A;  3HHT B;  4PJJ A;  3ASK A;  3MPU B;  2YT6 A;  4Q5W A;  2L3Q A;  4M75 G;  4PJO C;  3UWN A;  1YP5 A;  2NUP A;  1WHM A;  3MEV A;  5GAN j;  4C8Q G;  2XU8 A;  1VQ8 A;  2VGN A;  4KGX B;  2QXF A;  1T0H A;  2RJE A;  2H8H A;  2YLC A;  4PJM A;  1YWP A;  2RQR A;  1Y07 A;  1IXD A;  4ZGE B;  2CUD A;  1VQK A;  2CP3 A;  3EHR A;  4AT1 B;  3KBG A;  1WXU A;  5GJW B;  3L1A A;  3OYN A;  1HJD A;  2CYZ B;  4DEX A;  4M78 E;  3V8K A;  5KYY A;  2BE7 D;  3JB9 J;  4PFP A;  4LE9 A;  5FRN A;  1B34 A;  4EMK B;  4LDW A;  3EGU A;  2QQB A;  5CK9 A;  1PWT A;  3EHQ A;  2XK0 A;  1M8V A;  4A63 B;  3N5B B;  4M78 D;  1XQH A;  4C0Z A;  2O31 A;  1QKW A;  1X43 A;  2E12 A;  3M56 A;  3JCM g;  3UAT A;  1UGR B;  2K57 A;  1M1K C;  3TEE A;  4V2S A;  4J9H A;  4MML A;  4Z89 A;  5IXF A;  3QO3 A;  3JB9 F;  5GAN 2;  3PFS A;  3CC2 T;  3OYK A;  1Q95 G;  5GMK i;  3OYE A;  1VQM A;  5GAN h;  2DJQ A;  3UPU A;  2ROL A;  4JJD A;  7AT1 B;  2EWN A;  2VC8 A;  3X26 B;  4PJO F;  3CCR T;  4PJN A;  1VQ6 T;  4JJN K;  4M7D F;  3HFN A;  4J9I A;  1KK7 A;  5FU7 C;  2WSE E;  3JB9 I;  4QQG A;  2E3I A;  4KH1 B;  4FW1 A;  5IT9 E;  2YHT A;  2M16 A;  3CCQ Q;  2QQA A;  5IAY A;  4BAC A;  1ZUU A;  1WIE A;  4XU0 A;  2RI3 A;  1VQO Q;  1M8M A;  4M7A F;  2CP6 A;  1SHG A;  5L23 A;  1G3Y A;  4JLI A;  4LUE A;  3LYI A;  1WI7 A;  2EGE A;  4L59 A;  4EMG A;  4B9X A;  3M53 A;  4D8K A;  8AT1 B;  1OI1 A;  2DIL A;  2WAC A;  5IN1 A;  1V76 A;  1QVG S;  5DLQ E;  2D8J A;  2E5Q A;  4RKU E;  2XDD A;  1WHH A;  4J9E A;  4BUG A;  1M1K U;  2RHY A;  2RJC A;  2F69 A;  4KUL A;  3E1S A;  1C6V X;  1UE9 A;  4HVU A;  4M78 A;  2HEQ A;  4RCB A;  2K3B A;  3MEA A;  1W2B S;  5GJV B;  1VQN T;  2OTL T;  1VYV A;  2E5K A;  2V1R A;  1OPL A;  2JTM A;  4F7U F;  5GAN d;  4JZ3 A;  2ENM A;  3CC2 A;  4X9D A;  1K76 A;  2K3X A;  2JTF A;  5GAN 6;  2VXE A;  3JCM b;  4OB3 B;  1QVG A;  5FWB A;  4RTX A;  3OYD A;  3CCV T;  2F2W A;  3V7C A;  1J3T A;  1ZA2 B;  3CCR A;  3GPL A;  4HA8 A;  1VQ6 A;  4M78 G;  5KYW B;  2V8I A;  3FRN A;  1W2B A;  2G3R A;  4R55 A;  4VUB A;  2L8D A;  3RR6 A;  4NL2 A;  1RAD B;  3RUX A;  3CME Q;  2KR3 A;  2XI9 A;  1PG5 B;  3RKX A;  4A54 A;  4RMO A;  2DER A;  3X25 B;  2YDL A;  3OSV A;  3URG A;  2RQW A;  2LJ3 A;  4DA4 A;  2E3H A;  5KYX B;  2DXC A;  2EYW A;  4LXC A;  2JMA A;  4ZTJ A;  2ATC B;  4F7U E;  3JCM f;  3NHN A;  1JU5 C;  2RQV A;  1YIJ Q;  2YLB A;  2QA4 Q;  3JCM J;  4M77 F;  2A36 A;  2PZ1 A;  1XOV A;  2DL7 A;  1BK2 A;  2A3L A;  1N6A A;  4J6Y A;  3JCM d;  4JS4 A;  2RO0 A;  5GMK e;  1PKS A;  4E7L A;  3UA7 A;  4MZP A;  1VQN A;  2OTL A;  2JOY A;  2MYS A;  3RBB B;  1JBM A;  1VYT A;  2A0F B;  2XG8 D;  4AMC A;  5KCO A;  3UA6 A;  3SDZ A;  2XDB A;  4M7D A;  2DAQ A;  4TVR A;  1AZG B;  2M51 A;  3H9N A;  4E6R A;  3EFS A;  3EG3 A;  1MMG A;  1WHJ A;  3QPH A;  4JRQ A;  3CC4 Q;  1WHG A;  3JCM W;  4M7A A;  4FIB A;  4WCI A;  3CCV A;  1RI9 A;  5GMK l;  4GBQ A;  1YN8 A;  3A8G B;  2VB6 A;  1I5O B;  3M5A A;  4A53 A;  4KGZ B;  5A0G A;  2F5T X;  1FMV A;  1NEG A;  3VS4 A;  3HPW A;  4J9D A;  4XAX B;  4PLL A;  2EGC A;  2EJ9 A;  1YHQ T;  2COW A;  2KDS A;  1OX8 A;  1QWE A;  5KE3 A;  1IO6 A;  4AG2 C;  3H0H A;  1HSQ A;  4ESR A;  2D6F A;  3JCM P;  1BU1 A;  1H64 1;  3M55 A;  2CSI A;  3CCJ Q;  1YWO A;  2OTJ Q;  1Y0M A;  3BY7 A;  4P5N A;  2DL4 A;  2KEA A;  2DXT A;  1VQ4 T;  5FU6 B;  1BYM A;  3I56 A;  4PFZ A;  3QUI A;  2VUB A;  1NPP A;  2YUO A;  4F7U A;  1VYU A;  2DET A;  1M2V B;  1E6H A;  5KH6 A;  4A4E A;  2A7Y A;  1ZSZ C;  2DK3 A;  4DOV A;  1NBE B;  1UEC A;  4QVD A;  1M9S A;  3CCE Q;  1OUL A;  3CCM Q;  4JLG A;  5GMK m;  4C5E A;  3A1P A;  1K9M C;  2K4Y A;  2QDL A;  4M75 B;  1K0X A;  2D0Q B;  1YJ9 T;  4F14 A;  1G83 A;  1M5Q 1;  4F7U G;  4C8Q B;  1CSK A;  1G2B A;  1M1F A;  4C5G A;  3BFM A;  3OBY A;  1SHF A;  4HT8 A;  3OYF A;  2HSP A;  3PNW C;  3E9G A;  4ME7 A;  2RHI A;  5HY6 A;  4MDX A;  2DF6 A;  2BE9 B;  2JW4 A;  4M77 A;  1YHQ A;  3VRY A;  4CC7 A;  1NEB A;  2FVU A;  3QWY A;  1U1T A;  3JB9 H;  2EJG A;  3GNF B;  1QVF P;  2FPD A;  1TOV A;  4HCB A;  3LWH A;  3OBW A;  3OS0 A;  2BKD N;  4J9B A;  2ZAE A;  5I21 A;  2NUP B;  1VQ4 A;  1MGQ A;  1IZ6 A;  4RTU A;  4PNO A;  4RTY A;  4HT9 A;  3LWI A;  1VQ7 Q;  2EBP A;  4BE2 A;  3CC7 Q;  2YSQ A;  1D0Z A;  1BI0 A;  1C1A A;  2DEQ A;  4M77 G;  3NTH A;  2ED1 A;  3G1J A;  3P8D A;  2AZV A;  1QP2 A;  3TQ7 P;  2C06 A;  5KYY B;  1UGP B;  3WVD B;  3M0Q A;  1B34 B;  4J6W A;  2HQX A;  3DKM A;  1NLO C;  5D6W A;  4EIK A;  1ZLM A;  3CCQ T;  3M54 A;  5EC7 A;  3OS2 A;  2J7I A;  1XTD A;  2Z0W A;  1VQO T;  1ABQ A;  1JXO A;  4GLM A;  4F17 A;  2AZS A;  3A8O B;  1WZO A;  1FWZ A;  4JRI A;  2GTO A;  1RL2 A;  2IPO B;  1BKB A;  2EYY A;  1AHJ B;  5EG2 A;  3SB2 A;  2EQI A;  2L3P A;  3QYG B;  5GAO p;  4O6J A;  2HKQ B;  4RTW A;  3BE3 A;  3HSB A;  2X4W A;  3LGF A;  4FU6 A;  4Y92 A;  2IIM A;  1G3W A;  2J6O A;  3S3N A;  1KQ2 A;  1WA7 A;  3I5S A;  4M4Z A;  3KXT A;  1NZ9 A;  3MJX A;  2HQH A;  3HKS A;  1BCM A;  1VQL Q;  2EW3 A;  2JTE A;  3CCS T;  4DEY A;  4QVC A;  2XMF A;  4E2F B;  4HVW A;  1DJ7 B;  4A4K A;  2QAZ A;  3L2V A;  4OMM A;  4JS5 A;  3DLM A;  3VYG A;  5A2Q E;  2RB6 A;  2J06 A;  1TG0 A;  1BI3 A;  1QVF A;  4WF2 A;  3CD6 Q;  1KD1 C;  3V8L A;  3E9F A;  3WVE B;  1OZ2 A;  2Y90 A;  1AOJ A;  2AT1 B;  5I2M A;  1FYN A;  1PKT A;  2DIQ A;  3INZ A;  2L0A A;  2MPX C;  2NLU A;  1K8A C;  1VQP Q;  4Z8A A;  1UTI A;  2JS0 A;  1O9S A;  4C0G A;  3CCQ A;  3QJY A;  1PSE A;  1ZSG A;  2KYM A;  2LMJ A;  1VQO A;  3CME T;  4M78 B;  3FDR A;  3VUZ A;  3SHW A;  3OYJ A;  2QAS A;  1TUD A;  3A8M B;  4CC2 A;  2M02 A;  2VAS A;  3M0P A;  2VGM A;  4J9F A;  5HCK A;  3I35 A;  4FYY B;  2PTK A;  5CQY A;  2H3E B;  1KSW A;  2E65 A;  1ZBJ A;  2ZPH B;  1YIJ T;  2QA4 T;  4BB7 A;  4J9G A;  2DL5 A;  2HL3 A;  1YCS B;  3OYG A;  4PK4 A;  3LX7 A;  2HMA A;  2EYZ A;  5LJ3 j;  3M59 A;  8ATC B;  2K3Y A;  2MIO A;  5GAM j;  4KH0 B;  5GAN g;  1NPR A;  2C0I A;  4ZTF A;  4OGC A;  1UJ0 A;  1KD1 U;  1D3B A;  4FM4 B;  3QJ6 A;  3VS1 A;  2D8H A;  3EG9 A;  3QWX X;  3VS0 A;  4BY6 C;  4AFZ C;  3X28 B;  4F04 B;  3OYI A;  2DA9 A;  1PRL C;  2P0Q A;  1VOM A;  3PT9 A;  3OYL A;  4EMK C;  1UB4 A;  2D0N A;  3MEW A;  2E41 A;  1GCQ A;  3G71 Q;  3UDC A;  2RHU A;  3CC4 T;  3HRT A;  3BDU A;  1HK9 A;  3PIO A;  4CI0 C;  3OS1 A;  1I81 A;  1YJN Q;  2NUZ A;  4LNP A;  4PFO A;  3RES A;  1R0C B;  4NL3 A;  1LJO A;  3J7A F;  1W1F A;  4DBF A;  2DXU A;  3OYB A;  2OAW A;  3C4S A;  3PMI A;  2KYB A;  1HYO A;  2JVV A;  3ME9 A;  2E4H A;  3CME A;  4JZ4 A;  5A0D A;  4B6M A;  1KG1 A;  2K5L A;  4QQ6 A;  3SWN C;  5LL6 S;  1UFF A;  3VRZ A;  1K9A A;  3OQ5 A;  3CCJ T;  5LJ3 h;  2OTJ T;  1M2O A;  3GNG A;  2GQI A;  1QMC A;  1KFZ A;  6AT1 B;  5GAM h;  1M3A A;  2CZ6 B;  2FPF A;  3LH0 A;  2YRD A;  4M7D B;  1YIJ A;  2QA4 A;  3C95 A;  3PVQ A;  2KGT A;  2M0O A;  4QW2 A;  3THK A;  1D1C A;  1M90 R;  2XKO C;  3ZBD A;  5LJ5 j;  3TVT A;  2KXC A;  1AWW A;  2X4Y A;  4KRT A;  4M7A B;  2KI7 A;  1B3Q A;  3M0U A;  3R6N A;  4HCZ A;  2BZX A;  3FJ5 A;  1S72 Q;  2FRW A;  1D09 B;  2MWP A;  3EH1 A;  1HD3 A;  1AWO A;  2J6K A;  4KGV B;  3CPF A;  3AHU A;  1IHW A;  3CBO A;  5GAN 7;  1D1B A;  4Z88 A;  3CC4 A;  1BIB A;  3CPW P;  1PCX A;  3RKW A;  1HXD A;  4C92 C;  3V8J A;  4MMK A;  4XTZ A;  2A08 A;  1M1G A;  4OVA A;  1MHN A;  4DBH A;  4CC4 B;  2AK5 A;  1GRI A;  2O2O A;  4QVZ A;  3JCM V;  1KQ1 A;  1D0Y A;  5KCH A;  3DLL A;  3GF5 A;  2CZ0 B;  4E7J A;  4F7U B;  4OB2 B;  1WXB A;  1PSF A;  3SFM A;  5LJ3 d;  1LPL A;  1AWJ A;  4C0D B;  1WXT A;  2E70 A;  1KHC A;  5GAM d;  1NYF A;  2QI2 A;  2R58 A;  5HK0 A;  2ZCF B;  3OA6 A;  3JB9 D;  3CCJ A;  2OTJ A;  1M27 C;  5GAN f;  5GAN e;  4PJO E;  5LJ5 h;  1ZUK A;  4M7D E;  1NE8 A;  3R6O A;  1UUE A;  2HSE B;  1GL5 A;  2HBW A;  2EYX A;  1PNJ A;  4GY5 A;  2D1X A;  2X4J A;  1EZZ B;  2DBM A;  4M7A E;  1VQ7 T;  2GNC A;  4PJO D;  2C0T A;  5KYU A;  2J6F A;  4M7D D;  1YJW Q;  2ESW A;  1K9M R;  3CC7 T;  2QEX Q;  1I5L A;  2OAU A;  2LQW A;  2LX9 A;  2W0Z A;  1FMK A;  4ATO A;  5IHK A;  3OYC A;  1NLP C;  4PL6 A;  4EDU A;  4D8D A;  3CPW S;  2M0Y A;  3PVL A;  2LJ0 A;  4M7A D;  3O8V A;  1LCK A;  2QDY B;  1Y57 A;  3VS2 A;  1X2K A;  3NTK A;  3CCE A;  5GMK h;  4M77 B;  5J3B A;  4ELZ C;  3HP9 A;  2KT8 A;  4HKE A;  4E7H A;  2LT4 A;  1RAH B;  4OF1 A;  4C92 F;  3FIF A;  2EPD A;  4X1V A;  2HCK A;  2K5I A;  1AEY A;  1Z9Q A;  4JJC A;  3EG1 A;  1VIF A;  4A4H A;  5HKC A;  4N0A A;  1U06 A;  5I22 A;  4IIO A;  2DD4 A;  3CCU Q;  2V1Q A;  1AZE A;  3JCM e;  2DX1 A;  3M57 A;  2KT1 A;  2LRQ A;  2X9H A;  1KQS P;  4OGE A;  4L6V 5;  3CPW A;  3I56 T;  5LJ5 d;  2E6Z A;  4Y91 A;  3G6E Q;  3HTR A;  4LN2 A;  4LD9 K;  4KBM B;  2DRK A;  2KNB B;  1YNZ A;  3CEY A;  1N9S A;  1VQL T;  2FG0 A;  2PVO B;  2XID A;  3G4S Q;  2JT4 A;  2LZ6 B;  1OX9 A;  3FLG A;  4N4G A;  2LP5 A;  4FYW B;  2ROT A;  1H3Z A;  5AYF A;  1X01 A;  4PJO A;  1MV0 B;  3LW5 E;  1M90 C;  4HXJ A;  1IHV A;  1ZHI A;  4XU2 A;  3M9Q A;  1GXI E;  1VQ7 A;  2R57 A;  3CD6 T;  1Q86 R;  2FL7 A;  1EX4 A;  3CC7 A;  2ED0 A;  3OMC A;  3MKD A;  1CKB A;  2PUK B;  3JB9 G;  1LNX A;  3HL8 A;  4M77 E;  2YXY A;  3VU3 C;  2DYB A;  2MK5 A;  2EQU A;  2KVQ G;  1R0B G;  2FO0 A;  1PD0 A;  1VQP T;  1IRE B;  4KUI A;  3EAE A;  4ZGD B;  1OU9 A;  4LDU A;  2L3S A;  1Q7Y C;  1I0C A;  4PJO G;  1X6B A;  4M77 D;  4M7D G;  1BI1 A;  5FWC A;  1BB9 A;  2K2M A;  3MP1 A;  3RMQ A;  3TSZ A;  1OOT A;  2L3R A;  2V8K A;  1UHC A;  3I5R A;  4KUD K;  3CCL Q;  2ZPI B;  3VS3 A;  3H8Z A;  1IGQ A;  3A98 A;  3O5Z A;  4M7A G;  4J8O A;  4CRI A;  5CR2 A;  2EKO A;  3GP8 A;  1FXX A;  3BW1 A;  4M75 C;  1MNE A;  1X27 A;  1ARK A;  2DVJ A;  4IKF A;  1GCP A;  1I8F A;  1KD1 R;  1M90 U;  1QCO A;  4X34 A;  3H41 A;  4C8Q C;  3M58 A;  1VQL A;  4J83 A;  3PMT A;  3L2Z A;  4RUG A;  3MEU A;  4FW2 A;  1RAA B;  3QG1 A;  3WXM B;  1U8R A;  2K7A A;  2ZPE B;  4PJL A;  2ZPF B;  3QDR B;  1GBQ A;  1OQK A;  3HFO A;  2QYZ A;  1RAI B;  3OYY A;  3OYM A;  1K8A R;  3MCA B;  3CD6 A;  5IH2 A;  1ZQ1 A;  2IG0 A;  3Q1J A;  5GAN 4;  5CO7 A;  2FZC B;  2RN8 A;  2CZ1 B;  4QT7 A;  1I07 A;  3FEO A;  4FSS A;  1D1A A;  1PM3 A;  1WHK A;  2FRY A;  2JS2 A;  4MZM A;  3RKY A;  3CMA Q;  2CRE A;  5GAO r;  2X4X A;  1RAB B;  2LT1 A;  1OPK A;  5FRM A;  4DOW A;  4BI3 A;  4E7S A;  4E47 A;  1VQP A;  5J39 A;  2E1H A;  1S1N A;  2HNI A;  2NUT A;  5FW9 A;  4ZNX A;  3IQL A;  1JJ2 P;  1D3B B;  2HAX A;  1TUG B;  3EG9 B;  2C0O A;  3ZFJ A;  3LH5 A;  2JNG A;  2JZ2 A;  3HRU A;  2RA2 A;  4IUT A;  1LVK A;  4AG1 C;  1ZX6 A;  2B86 A;  2DLP A;  4C8Q F;  1YCY A;  3VV0 A;  3NPF A;  2HKN A;  5DM7 R;  2L5Q A;  2EYQ A;  4EMH A;  1K9M U;  2KRM A;  1VQ5 Q;  2YWW A;  5J26 A;  1S72 T;  4PKC C;  2ZPB B;  1KC8 R;  3M0T A;  2AIR B;  2ABL A;  1MMD A;  1RLQ C;  3A5Z B;  1C0M A;  4MZT A;  1YI2 Q;  1WNL A;  2PVD B;  1QCN A;  1TS9 A;  2E6N A;  1T0J A;  1W6X A;  1Q86 C;  4LD6 A;  3G71 A;  3RMS A;  4IUQ A;  5FRO A;  3I55 Q;  1SF9 A;  5CVI A;  2QGG A;  2I2L A;  2GBQ A;  3M0R A;  4IUR A;  2DMO A;  1P92 A;  4AFQ C;  3QHS A;  1ABO A;  2KE9 A;  1QVF S;  1RI0 A;  1I1J A;  2XHC A;  1N27 A;  3E19 A;  3VKI A;  2F5K A;  5CKD A;  2D9T A;  2DTI A;  3S6W A;  2LTO A;  2MMP A;  3FJP A;  5C6S A;  3L2Q A;  1SEM A;  1WPY A;  1YIT Q;  2OI3 A;  2EKH A;  3QYH B;  4B9W A;  2GQV A;  2DEU A;  5DY9 A;  1TWB A;  2LNV A;  3GLX A;  3VJP A;  5CKB A;  1K4U S;  2COY A;  2G6F X;  2CZ7 B;  4XQ3 A;  5KYN A;  1SPK A;  3OB9 A;  1BBZ A;  2PQW A;  1VUB A;  5D6X A;  3RNJ A;  1WQW A;  3SD4 A;  1GBR A;  3JSC A;  4M78 C;  3DB4 A;  4BD3 A;  2DNU A;  4DBR A;  5GAO l;  2YRC A;  1YJW T;  2VXF A;  3REB B;  3I9Q A;  2DBK A;  2QEX T;  5CAI A;  1B7T A;  1Q86 U;  1NJI C;  2LCC A;  2QQ9 A;  4BE0 A;  1S72 A;  1BI2 A;  2YUP A;  3S3M A;  4FYX B;  3KUF A;  4AFS C;  1QKX A;  2JN0 A;  2KK4 A;  2QG9 B;  3QXE B;  2R5A A;  3TU4 K;  2DFU A;  4LDV A;  1UGQ B;  3M0S A;  3MP6 A;  2EIF A;  2QQS A;  2EJF A;  2Y4X A;  2KRS A;  4C5H A;  4EPC A;  3ULR B;  5LJ3 g;  2DZ9 A;  2X3W D;  1AWX A;  4N4I A;  3CCU T;  5GAM g;  4OMN A;  1VIE A;  4DBQ A;  1QVP A;  5KYU B;  2MAM A;  4NS5 A;  2DD5 A;  1TTH B;  3TSW A;  3QBY A;  3G6E T;  2P0K A;  1NG2 A;  2CDT A;  3UT1 A;  3CBP A;  4RG8 A;  1UEB A;  1W4S A;  4RTV A;  5ECA A;  2CT3 A;  1QP3 A;  3G4S T;  1ZSZ A;  5GAO m;  5IHI A;  2RHX A;  5D7U A;  3JRZ A;  1NJI U;  4CC3 A;  1WDX A;  2J05 A;  3ZL7 C;  1T3L A;  4IUV A;  4BE1 A;  4LDY A;  4RTT A;  3PIP A;  2RK2 A;  1PD1 A;  1YJW A;  2BTT A;  2DJZ A;  1K8A U;  2QEX A;  3S3O A;  2M9U A;  1X69 A;  2RD1 A;  2HDA A;  4XTU A;  1OV3 A;  1KC8 C; 
#chains in the Genus database with same CATH homology
 4C8Q E;  1YJ9 A;  4M7D D;  4MDW A;  5M9O A;  4M7D C;  3CC7 T;  2DXT A;  3M4Y A;  1VQ4 T;  4FL6 A;  2RHZ A;  5FU6 B;  1BYM A;  2RJF A;  1I5L A;  2OAU A;  3I56 A;  2CS7 A;  3QUI A;  2LX9 A;  2MWO A;  4M75 D;  4ATO A;  3OYC A;  2VUB A;  1NPP A;  5CKE A;  4F7U A;  4PL6 A;  2DO3 A;  4EDU A;  3CPW S;  3F70 A;  4BI8 B;  3O8V A;  4M7A D;  2QDY B;  4JRK A;  3G7Z A;  4C8Q D;  4M7A C;  3VUB A;  3H6Z A;  3QKJ A;  3NTK A;  4FSX A;  3CCE A;  3ZEH A;  5GMK h;  4M77 B;  2KY9 A;  2ZPG B;  3CBM A;  3OMG A;  3HP9 A;  4IUP A;  2A7Y A;  1V29 B;  5J3B A;  4A4E A;  2DK3 A;  4BY6 B;  1JJ2 A;  4HKE A;  5LJ5 g;  4E7H A;  4BI4 A;  2FHD A;  4E7K A;  4JUV A;  4DOV A;  2LT4 A;  3CCU A;  4XU3 A;  4OF1 A;  5HK3 A;  4C92 F;  2K2V A;  3FIF A;  4C0F A;  3CCL T;  2RK1 A;  2EQJ A;  2KMT A;  4PJO B;  4QVD A;  1M9S A;  4PJO D;  4OB0 B;  1X6O A;  4JLG A;  3MO8 A;  4R56 A;  2K5I A;  5GMK m;  5CQX A;  2YRV A;  1VIF A;  4FT2 A;  4A4H A;  4A4G A;  4C5E A;  4N0A A;  4ZGJ B;  5HKC A;  1U1S A;  3L2U A;  2K4Y A;  1K9M C;  2EFI A;  2DD4 A;  4XU1 A;  4M75 B;  2D0Q B;  1JB0 E;  3G6E A;  1G5V A;  1ZBX A;  1YJ9 T;  1WGS A;  1N8R U;  3JCM e;  3M57 A;  4J5Y A;  2WSF E;  1M5Q 1;  2LRQ A;  2DVE A;  4OGE A;  3ER0 A;  4L6V 5;  4XTX A;  2M1H A;  4C8Q B;  4D6W A;  1M1F A;  4C5G A;  3I56 T;  3BFM A;  3CPW A;  1VQ8 T;  2PVG B;  3G4S A;  5GAO q;  3OBY A;  1QW1 A;  3OW2 S;  5LJ5 d;  4HT8 A;  2E6Z A;  3OYF A;  2BIV A;  3PNW C;  4Y91 A;  3E9G A;  4ME7 A;  5FLX E;  2GF7 A;  2RHI A;  4LD9 K;  1N9R A;  4JRP A;  3X20 B;  4KBM B;  3CEY A;  1VQK T;  5HY6 A;  4MDX A;  1KC8 U;  1N9S A;  4C5I A;  1VQL T;  3CCE T;  1VQ9 A;  1WJR A;  3CCM T;  2PVO B;  4M77 A;  2XID A;  1YHQ A;  2DXB A;  1X75 C;  1TH7 A;  2FVU A;  4C0D C;  5A0L A;  3FLG A;  1U1T A;  4N4G A;  2WSC E;  3JB9 H;  1H3Z A;  4RCC A;  4BDZ A;  2EJG A;  3SWN B;  3GNF B;  1X01 A;  5AYF A;  4PJO A;  4HCB A;  3LW5 E;  4FT4 A;  3OS5 A;  3EFR A;  1M90 C;  2KSS A;  3LWH A;  1ZHI A;  3MET A;  3P8H A;  2KQW A;  3M9Q A;  4J6X A;  4XU2 A;  3OBW A;  1VQ7 A;  4F7U G;  2RI5 A;  3OS0 A;  3OYA A;  2ZGW A;  5I2S A;  1GXI E;  2BKD N;  3BDL A;  3CMA T;  2E10 A;  2QTX A;  2R57 A;  3CD6 T;  5LJ3 f;  5GMK j;  5LJ3 e;  2FL7 A;  4N4H A;  5I21 A;  3CC7 A;  3OMC A;  4M75 A;  1VQ4 A;  1MGQ A;  1IZ6 A;  5GAM e;  5GAM f;  4PNO A;  1Y96 B;  3J80 E;  4N0A C;  2LQ8 A;  3LWI A;  4HT9 A;  3OW2 A;  1WQ7 A;  2O4X B;  4C8Q A;  2PUK B;  3JB9 G;  2EAY A;  3JAM E;  1LNX A;  3HL8 A;  4ZN1 A;  5KH6 A;  1OYX A;  4BE2 A;  4M77 E;  2LQK A;  3VYH B;  3VU3 C;  1WJQ A;  1XNI A;  2EQU A;  2KVQ G;  3MP8 A;  1BI0 A;  4X9C A;  3CXC S;  2DEQ A;  2MI6 A;  3PTA A;  3L2W A;  4M77 G;  1VQP T;  4L5G A;  3T9N A;  4RG2 A;  3NTH A;  1IRE B;  4KUI A;  3EAE A;  4M78 F;  4NOY A;  3JCM Q;  2DZC A;  4ZGD B;  3P8D A;  4LDU A;  1QP2 A;  1Q7Y C;  1VQM T;  4OMF B;  2LDM A;  3CCL A;  2C06 A;  4PJO G;  2QQR A;  1UGP B;  5FU7 B;  3WVD B;  4M77 D;  4M7D G;  1BI1 A;  3CCS A;  1WJS A;  1B34 B;  4J6W A;  2HQX A;  3HHT B;  3MP1 A;  4M77 C;  3RMQ A;  3LGL A;  3DKM A;  5D6W A;  3ASK A;  2L3R A;  3CCQ T;  2V8K A;  3M54 A;  3OS2 A;  2GFU A;  4KUD K;  4Q5W A;  1XTD A;  1Y71 A;  4M75 G;  1VQO T;  2ZPI B;  4PJO C;  3H8Z A;  3UWN A;  3A8O B;  2VV5 A;  4C92 B;  4M7A G;  1FWZ A;  4J8O A;  5L8R E;  3MEV A;  4CRI A;  5GAN j;  4C8Q G;  4JRI A;  1Y96 A;  2XU8 A;  1VQ8 A;  5CR2 A;  2VGN A;  2EKO A;  2EQK A;  1RL2 A;  2QXF A;  2RJE A;  3JCM h;  3GP8 A;  1FXX A;  1BKB A;  2YLC A;  2O4X A;  3BW1 A;  1VQ5 T;  4M75 C;  1AHJ B;  5EG2 A;  3SB2 A;  3L42 A;  4IKF A;  1Y07 A;  3QYG B;  1I8F A;  5GAO p;  3CXC A;  4Z02 A;  4O6J A;  4ZGE B;  1M90 U;  1VQK A;  2P4T A;  4X34 A;  4UC4 A;  4C8Q C;  3M58 A;  1VQL A;  3KBG A;  4J83 A;  1YI2 T;  2X4W A;  3PMT A;  3HSB A;  3A8H B;  3CCM A;  3L2Z A;  3LGF A;  4FU6 A;  3L1A A;  3MEU A;  3OYN A;  1G3W A;  3S3N A;  4XTV A;  1KQ2 A;  1EIF A;  2BUD A;  2CYZ B;  3QG1 A;  3WXM B;  1U8R A;  3TCJ A;  2CGH A;  2ZPE B;  2ZPF B;  3QDR B;  4M78 E;  3I55 T;  3KXT A;  2V8J A;  3V8K A;  3JB9 J;  1NZ9 A;  2PUO B;  2H3J A;  3HFO A;  3QII A;  3HKS A;  4OP0 A;  5GAN 5;  3OYY A;  5FRN A;  1B34 A;  4EMK B;  4LDW A;  3OYM A;  3CCS T;  4QVC A;  3CMA A;  2VYT A;  2LCL A;  2QQB A;  3MCA B;  3CD6 A;  1ZQ1 A;  1M4Z A;  3C12 A;  2IG0 A;  3Q1J A;  5CK9 A;  5GAN 4;  5CO7 A;  2LVM A;  5LJ5 f;  2CZ1 B;  5LJ5 e;  1DJ7 B;  4A4K A;  2XK0 A;  1M8V A;  3L2V A;  4JS5 A;  2RI2 A;  3DLM A;  3VYG A;  5A2Q E;  2RB6 A;  3FEO A;  3N5B B;  3L2R A;  4M78 D;  1BI3 A;  1XQH A;  3G71 T;  4MZM A;  3RKY A;  4WF2 A;  4C0Z A;  2E12 A;  3CC2 A;  1QVF A;  3M56 A;  3JCM g;  5D6Y A;  2X4X A;  5GAO r;  1KD1 C;  1UGR B;  2K57 A;  2LT1 A;  1M1K C;  3V8L A;  2AHJ B;  3TEE A;  5FRM A;  3E9F A;  4DOW A;  4V2S A;  4XTY A;  4MML A;  1BIA A;  3WVE B;  4BI3 A;  4E47 A;  1YIT T;  3QO3 A;  1OZ2 A;  3MHX A;  5J39 A;  1VQP A;  3JB9 F;  5GAN 2;  2E1H A;  3PFS A;  2HNI A;  2Y90 A;  3CC2 T;  3OYK A;  5GAN 8;  5I2M A;  5GMK i;  1G3T A;  3OYE A;  1VQM A;  2DIQ A;  3INZ A;  5GAN h;  5C0M A;  3UPU A;  2NLU A;  3DB3 A;  1K8A C;  1D3B B;  2HAX A;  1O9S A;  4C0G A;  3CCQ A;  1Y7X A;  2EWN A;  2XDP A;  3QJY A;  1PSE A;  2KAF A;  2P0P A;  2VC8 A;  3X26 B;  1Q82 C;  4EMK A;  3ZFJ A;  4C92 E;  4PJO F;  3CCR T;  1VQO A;  2IVW A;  3CME T;  4JJN K;  4M78 B;  2JNG A;  3FDR A;  3VUZ A;  3HFN A;  1K73 C;  1VQ6 T;  3OYJ A;  4M7D F;  1O75 A;  3V7S A;  3FC3 A;  5FU7 C;  2WSE E;  3JB9 I;  2JZ2 A;  3A8M B;  4QQG A;  3HRU A;  2RA2 A;  2VGM A;  3P8B B;  4IUT A;  3QZ9 B;  3GOX A;  5IT9 E;  2YHT A;  2M16 A;  2QQA A;  5IAY A;  4BAC A;  3NFC A;  1VQ5 A;  4XU0 A;  2RI3 A;  5CQY A;  4ELY C;  4M7A F;  3RIR A;  4C92 D;  2Y4Y A;  1G3Y A;  4JLI A;  4C8Q F;  1YCY A;  3LLR A;  3LYI A;  2E65 A;  2ZPH B;  5FU6 C;  3VV0 A;  2QA4 T;  1YIJ T;  4BB7 A;  5DM7 R;  1YI2 A;  4HCC A;  2L5Q A;  2EYQ A;  4EMH A;  1K9M U;  4L59 A;  4EMG A;  4B9X A;  3M53 A;  3OY9 A;  3OYG A;  5J26 A;  1S72 T;  3LX7 A;  5LJ3 j;  3M59 A;  4PKC C;  1OI1 A;  2ZPB B;  2WAC A;  5IN1 A;  2K3Y A;  3QSU A;  5GAM j;  3I55 A;  5DLQ E;  1QVG S;  1KQS S;  3V7R A;  4MZT A;  3A5Z B;  1NPR A;  4GLK A;  5GAN g;  2E5Q A;  4ZTF A;  4OGC A;  4Y28 E;  1WNL A;  2PVD B;  2O01 E;  4RKU E;  3SWN A;  2E6N A;  1D3B A;  2XDD A;  4FM4 B;  1KD1 U;  3QJ6 A;  4BUG A;  1M1K U;  2RHY A;  4BY6 C;  1OZ3 A;  2RJC A;  5KE2 A;  2F69 A;  4KUL A;  4LD6 A;  3G71 A;  1Q86 C;  2HD0 A;  3E1S A;  3RMS A;  3X28 B;  4IUQ A;  4M78 A;  5FRO A;  1YBY A;  5CCA A;  4QQD A;  3OYI A;  2P0Q A;  4JDS A;  4O5V A;  4RCB A;  3PT9 A;  5CVI A;  3OYL A;  3MEA A;  1W2B S;  4PLI A;  1KHI A;  2I2L A;  4EMK C;  1VQN T;  1UB4 A;  4XTW A;  2OTL T;  4IUR A;  3MEW A;  2E41 A;  1P92 A;  3UDC A;  3QHS A;  2MF2 A;  2RJD A;  1QVF S;  2RHU A;  3CC4 T;  1RI0 A;  3HRT A;  1YIT A;  4ZN3 A;  2JTM A;  2XHC A;  3BDU A;  1N27 A;  3E19 A;  4F7U F;  5GAN d;  1Q82 U;  3GIB A;  1HK9 A;  3PIO A;  4CI0 C;  3VKI A;  3QZ5 B;  2F5K A;  5CKD A;  4X9D A;  1I81 A;  3OS1 A;  2D9T A;  2DTI A;  2K3X A;  2JTF A;  3S6W A;  5GAN 6;  2LTO A;  1K73 U;  2MMP A;  3X24 B;  2DTO A;  3FJP A;  5C6S A;  2VXE A;  3RES A;  4NL3 A;  3JCM b;  4OB3 B;  2B8A A;  1LJO A;  3PGG A;  1QVG A;  1KQS A;  3J7A F;  3OSS C;  3L2Q A;  1WPY A;  2DKG A;  3QYH B;  2CKK A;  2DXU A;  4B9W A;  3OYB A;  2GQV A;  3C4S A;  3OYD A;  3PMI A;  2PU9 B;  5DY9 A;  3CCV T;  3V7C A;  2LNV A;  3GLX A;  5CIU A;  3CCR A;  3GPL A;  5GAN 3;  2JVV A;  3ME9 A;  4HA8 A;  3CME A;  3VJP A;  4M78 G;  5CKB A;  1VQ6 A;  2CZ7 B;  2V8I A;  4XQ3 A;  4IUU A;  5A0D A;  3FRN A;  3OB9 A;  4A4F A;  2G3R A;  3TRE A;  2K5L A;  2PQW A;  4QQ6 A;  4R55 A;  3SWN C;  5LL6 S;  1W2B A;  1KG1 A;  2HBP A;  1VUB A;  4VUB A;  2L8D A;  5D6X A;  3OQ5 A;  1WQW A;  2XIC A;  5LJ3 h;  3CCJ T;  3GNG A;  4NL2 A;  4C92 A;  2OTJ T;  3RUX A;  3SD4 A;  3JSC A;  1YJN T;  1Q7Y U;  4M78 C;  3DB4 A;  2XI9 A;  5GAM h;  3RKX A;  4A54 A;  4RMO A;  2CZ6 B;  3X25 B;  2RM4 A;  4BD3 A;  5GAO l;  3OSV A;  1YJW T;  2VXF A;  3LH0 A;  3URG A;  4M7D B;  3FB9 A;  4ELZ C;  2QA4 A;  3C95 A;  2QEX T;  4DA4 A;  1YIJ A;  5CAI A;  4KT0 E;  5CKF A;  2M0O A;  4QW2 A;  1Q81 C;  1Q86 U;  1NJI C;  2DXC A;  2LCC A;  1UGS B;  2QQ9 A;  4BE0 A;  1S72 A;  1BI2 A;  4ZTJ A;  3OYH A;  2XKO C;  4F7U E;  3ZBD A;  5LJ5 j;  2DTH A;  3JCM f;  3S3M A;  3KUF A;  2ZZD A;  2FYK A;  2X4Y A;  5CKH A;  4M7A B;  2YLB A;  3JCM J;  2JN0 A;  2KK4 A;  3QXE B;  4J7F A;  2R5A A;  4M77 F;  2R5M A;  3TU4 K;  2GFA A;  1XOV A;  4HCZ A;  2EQM A;  4LDV A;  2A3L A;  1UGQ B;  3MP6 A;  1N6A A;  2EIF A;  4J6Y A;  3JCM d;  4JS4 A;  4BDY A;  2RO0 A;  1SSF A;  5GMK e;  2QQS A;  2MWP A;  3C94 A;  4E7L A;  2EJF A;  2Y4X A;  3JCM c;  4C92 G;  4MZP A;  2GCX A;  3CPF A;  4C5H A;  1VQN A;  3AHU A;  5DLO A;  1R8O B;  3HRS A;  2JOY A;  4EPC A;  4E7I A;  2OTL A;  4M75 F;  5LJ3 g;  1JBM A;  2DZ9 A;  3CBO A;  5GAN 7;  4N4I A;  3CCU T;  2XG8 D;  5GAM g;  3CC4 A;  1BIB A;  2LC4 A;  3J81 E;  5KCO A;  2FB7 A;  3RER A;  1VIE A;  3RKW A;  3SDZ A;  4II1 A;  1HXD A;  4C92 C;  2XDB A;  4M7D A;  3V8J A;  3A8L B;  4MMK A;  4XTZ A;  3M4G A;  2DAQ A;  1QVP A;  4OB1 B;  1M1G A;  4TVR A;  4YTL A;  4DQ2 A;  2MAM A;  2DPP B;  4NS5 A;  4OVA A;  1MHN A;  2DD5 A;  3EFS A;  3QPH A;  3NTI A;  4JRQ A;  3QBY A;  2RH2 A;  3G6E T;  2P0K A;  4QVZ A;  3JCM V;  1LOJ A;  1KQ1 A;  3UT1 A;  5KCH A;  3JCM W;  4XK8 E;  3CBP A;  4LDX A;  3DLL A;  4M7A A;  4FIB A;  4RG8 A;  3GF5 A;  3CCV A;  1UEB A;  2CZ0 B;  5GAM d;  4E7J A;  4F7U B;  5GMK l;  1W4S A;  4OB2 B;  2X35 A;  1PSF A;  3SFM A;  3A8G B;  5LJ3 d;  1I4K 1;  1QP3 A;  3G4S T;  4C0D B;  5GAO m;  2DIG A;  2RHX A;  2E70 A;  1KHC A;  2K5F A;  3JRZ A;  3M5A A;  2QI2 A;  2R58 A;  4J7I A;  5HK0 A;  4A53 A;  1Q81 U;  1NJI U;  2HQE A;  2ZCF B;  5A0G A;  2F5T X;  3OA6 A;  3JB9 D;  5GAO n;  1N8R C;  3CCJ A;  2OTJ A;  5GAN f;  5GAN e;  4PJO E;  3JCM X;  5LJ5 h;  3HPW A;  4XAX B;  1YJN A;  4M7D E;  2L89 A;  4PLL A;  1NE8 A;  4IUV A;  4BE1 A;  1FX7 A;  2EJ9 A;  4LDY A;  1VQ9 T;  3PIP A;  1YHQ T;  2KDS A;  3R6O A;  2RK2 A;  5KE3 A;  1JJ2 S;  1JRI A;  1YJW A;  2DJZ A;  1K8A U;  2QEX A;  4GY5 A;  2M9U A;  4M75 E;  3S3O A;  2D6F A;  2XD0 A;  3JCM P;  2RD1 A;  1H64 1;  3M55 A;  1G3S A;  2X4J A;  2E64 A;  2JUF A;  3BY7 A;  4XTU A;  4M7A E;  1VQ7 T;  1KC8 C;  4P5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...