3E19A

Crystal structure of iron uptake regulatory protein (feoa) solved by sulfur sad in a monoclinic space group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
76
structure length
74
Chain Sequence
LMVVPLSEMGPGDKGIVVNILGGHNARQKLVSMGLTPGATIQVLESMGPIIISVGGVRFAIGKGLAGRVMVRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA
publication title Crystallographic Structure Determination of Iron Uptake Regulatory Protein (FeoA) by Sulfur SAD in a Monoclinic Space Group
rcsb
source organism Thermococcus thioreducens
molecule tags Transcription regulator, metal binding protein
total genus 17
structure length 74
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e19A01
1BI2A 5CVIA 1G3YA 2QQAA 1U8RA 4O5VA 4O6JA 2QQ9A 1BYMA 2GCXA 1FWZA 3HRUA 2LX9A 1G3WA 1G3TA 2K5IA 3HRSA 1G3SA 2H3JA 2K5FA 3GLXA 3E19A 1P92A 1QVPA 1QW1A 1BI0A 3HRTA 3MHXA 1BI1A 1FX7A 2QQBA 2K4YA 2K5LA 1BI3A
chains in the Genus database with same CATH superfamily
4FSXA 2RQWA 4Q5WA 2K2MA 4QQGA 3M0UA 1W4SA 3OYGA 2ZAEA 1QCNA 3HL8A 5D6YA 4E6RA 3JB9D 2EGCA 4PJNA 2EJ9A 3FB9A 5LJ3j 3OYNA 4PJOE 1NEGA 2ZPGB 2IVWA 1BI2A 4RTTA 1VQ6Q 2YRCA 2EAYA 5LJ5g 1Q7YR 3UPUA 4LXCA 3OYFA 2OTJQ 2HL5C 2H8HA 1VQ7T 3BY7A 3C12A 1YNZA 4E7LA 4XQ3A 1VQNA 2HKNA 1M90U 5EG2A 3SD4A 2MI6A 2YUPA 4JJCA 4PJOG 3CC7A 2A37A 3CPWS 2VYTA 1VQ9A 2GTJA 3CCLT 1M1KR 3VV0A 4NOYA 3ME9A 4Z02A 1OZ3A 2OI3A 4FW1A 2FO0A 2QQ9A 4F04B 1ABQA 4RTVA 2ZCFB 2F5KA 2F2XA 4HVWA 2J6OA 3J81E 4M7DA 1GRIA 5GANj 2DD5A 3LGLA 2LNHB 2AZVA 1OPKA 1B07A 2P4RA 2DL8A 1NYGA 2E41A 4HKEA 2DMOA 3DLMA 4M7DB 3TSZA 4JRPA 3INZA 5GANd 4FYYB 2WSCE 2F2VA 3JCMf 1BIAA 5IT9E 2CT3A 5GAMe 1RLPC 3MP8A 3OBYA 4EMGA 2X51A 1JBMA 1W70A 1YJWA 1X6GA 1UTIA 2KT1A 1JU5C 2YRVA 3EFOA 2CP3A 4F7UB 3ULRB 5GAN4 4KGXB 4M77E 4PFOA 4DA4A 1IB8A 2FVUA 2F2WA 4K11A 1ZSZA 3G6EA 2IIMA 5GAN3 2VC8A 3EG9A 2LRQA 3LLRA 1Y71A 1VQ4T 1Y0MA 2GFUA 1KC8R 1ZSZB 3JCMX 3GNFB 4LNPA 1OZ2A 1H92A 4OB3B 2ZPFB 3QDFA 2KGTA 3VUZA 2DL7A 3X26B 4EMHA 4JJBA 4M7AD 1QP3A 3CCET 4M77G 1BYMA 4OB1B 3M53A 3SEMA 1VQ6T 4QVZA 1KD1C 2FPDA 4AG2C 3I56Q 1WNLA 3QWYA 3AT1B 3A5ZB 3JCMd 2RJDA 1QW1A 1JRIA 2LNVA 3OB9A 3M4YA 2EWNA 1ZUYA 3EG2A 2SEMA 3AHUA 1SHFA 1X43A 1NJIU 4E7HA 3PIPA 1SSFA 5GMKe 1ZBXA 1WJSA 5GMKm 1QVFP 2V1RA 3OSVA 3CCST 1VYVA 1WJQA 3LWIA 2L2PA 3FLGA 4XTUA 3CCJQ 2CUBA 2JT4A 4M75F 4C0DB 1RI0A 4N4IA 1SSHA 1HSQA 4LDXA 3HPWA 3CXCS 3M56A 2RA2A 2DYBA 4FYVB 4YTLA 1BI3A 1UGVA 3A8OB 1K9MC 3OYYA 2QEXQ 2OJ2A 4RTWA 3REBB 2JM8A 4PJOD 2DA9A 3JB9H 4FT4A 1U8RA 1VQ5A 1OU9A 1PD0A 5HY6A 1BIBA 4PLIA 2RK2A 3P8DA 1N27A 4RTYA 1K4US 4M4ZA 2YXYA 4IUPA 1WYXA 3GP8A 2MF2A 3JRZA 1NPRA 2G6FX 5LJ3g 5FROA 2HQHA 2CZ0B 1PSFA 4M7AB 1IXDA 4LE9A 1FMKA 1TTHB 1V29B 5GAOq 5LL6S 4HCBA 3TU4K 4M78E 1YWOA 3JCMP 3HRUA 5GAOp 2E10A 1TU0B 2ECZA 3A8LB 4IIMA 3G4SQ 3TSWA 1W6XA 3L42A 4J9BA 1VQNQ 1VQPT 1M4ZA 3CC7Q 5A0DA 1SHGA 5GAOn 1VQ9Q 4O5VA 2NWMA 2NLUA 4E7SA 4M78G 5GAOm 3LX7A 5CKBA 3E2UA 1AEYA 3J80E 2JOYA 3PMTA 4E7KA 1Q86R 1XJWB 3MEUA 3TQ7P 3PE0A 5DLOA 3I55T 2QTVA 1JJ2S 1QKXA 5GANg 2RD1A 5KYYA 1W2BP 2M02A 1PHTA 2HAXA 2HCKA 1BCOA 1RUWA 1M30A 2OX7A 5KYYB 1YJ9T 4M77D 4RTXA 5KYXA 3VS3A 4ANJA 2QA4T 4FYWB 2HBPA 4PJOB 4Y91A 1IGQA 3JCMV 1YJWQ 2E12A 1GXIE 2YT6A 3V8KA 5KYXB 2D1XA 1RLQC 2JS2A 3DLLA 3TEEA 1Y96A 2QEXT 3S3MA 2X9HA 2P0PA 3OY9A 3RIRA 3G6EQ 4OB0B 2E5QA 4PKCC 2EYYA 1Y96B 3NTHA 1WX6A 3SFMA 4C92A 2JMCA 3CMET 2VXFA 1D0YA 4BI3A 2J6FA 1X27A 3JB9J 2RN8A 2DF6A 4JRQA 1KIKA 2EJFA 4OMQA 2EPDA 1FWZA 2BUDA 3ZFJA 2E70A 1JB0E 3H8ZA 2X35A 3EH2A 3UDCA 5CIUA 1RABB 3G71Q 3C0CA 1KC8U 3H0IA 2LX7A 1Q82C 2R5MA 1M90R 3EFRA 1G5VA 4OMOA 1GCQC 1TG0A 1KSWA 3QZ5B 3OQ5A 2AZSA 1I8FA 4AT1B 4M7DF 2JJ9A 1VQ9T 3CPWP 3HTRA 3EG0A 1KQSA 1EX4A 4L6V5 5GJWB 1UUEA 2DIGA 2DTHA 2DBKA 3CC2T 2RHXA 2RF0A 4CC4B 2KVQG 1B7TA 2K7AA 3X20B 1SEMA 1MNEA 2BZ8A 4O6JA 1TSFA 2LQNA 2KY9A 1ZUKA 2BZYA 4C5GA 2FEIA 4M77B 3TREA 3JB9F 1WXTA 2HL3A 8AT1B 4QQDA 2DEQA 3E19A 1IRXA 1B34A 5KE3A 1BI1A 4WCIA 1G8XA 2P0QA 1AWWA 2DM1A 2VV5A 3L2UA 1X2QA 3ER0A 2EYXA 2DBMA 4AG1C 1VQ5Q 1YJNA 1WZOA 2CH4W 3CCVA 2CYZB 4LDWA 3QDRB 2DD4A 2PVDB 1AT1B 2WSFE 2XMFA 4FM4B 5HCKA 2RHZA 3L2ZA 4M78D 1QWEA 1GBRA 3V8JA 4OF1A 1QP2A 3RNJA 2ED0A 2GTOA 3P8BB 1GFCA 2DTIA 2EFIA 3JCMc 2KXDA 2PZ1A 1D1CA 4LDVA 1M3AA 4IUUA 5FLXE 1X6BA 1K9AA 2YSQA 2LX9A 3F70A 4OMLA 3CC4A 1M1FA 1PD1A 3N5BB 1IGUA 1P92A 4X1VA 1JEGA 1FYNA 2DTOA 3WXMB 4EMKA 2AT1B 4DOVA 2RQRA 1WXBA 1ZA1B 4GLKA 4ZGEB 1ARKA 1JXOA 3ASKA 1M27C 1QVGS 1TXQA 2MAMA 2XKOC 4J7IA 1FMVA 2CREA 2VASA 1RAIB 4XTYA 1VQOA 4HCKA 4J9DA 2FB7A 3PIOA 3VS6A 3H0FA 1NJIR 3RMQA 4A4GA 1KHCA 3E9FA 4MZMA 4JZ4A 2X4XA 8ATCB 1K1ZA 2V26A 4C8QD 2C0IA 2K3YA 3I5RA 1T0JA 1OOTA 3QO3A 1W2BA 2ROTA 5CKEA 1Q86U 5KE2A 3VRYA 2RO0A 2KROA 1Z9ZA 1VQKA 2K4YA 3QIIA 2EQMA 2QQSA 5LJ3f 1N8RU 2DRKA 4Z88A 2PNIA 1WPYA 4M78A 2QG9B 1RL2A 3MO8A 4BI8B 2AKLA 3CXCP 2M0OA 3CCMA 2V8JA 4X9DA 1X6OA 3V7SA 4M78B 2F69A 3S3NA 1JO8A 4V2SA 3CBPA 4ME7A 3QG1A 5GMKl 4M75C 1EFNA 3HP9A 1SKUB 1Q81R 1BU1A 2YLCA 1D1BA 2O01E 2QGFB 5ECAA 3QUIA 2KYBA 1K0SA 1S72T 3M58A 4MZTA 1YP5A 2XG8D 3SHWA 2R5AA 3A8MB 2PUKB 1MHNA 1IHVA 1YCYA 1YBYA 3GF5A 1XQHA 3O8VA 1UFFA 4C0FA 4DQ2A 3QZ9B 4KULA 1MGQA 1RADB 2D8HA 1R8OB 4PFPA 2K57A 4RKUE 5LJ3d 5GANf 1VUBA 1IO6A 2E6NA 4BDYA 1IZ6A 5CKDA 1SG5A 3G4SA 4C8QA 2RJCA 4FL6A 2PUOB 4DBHA 4KUDK 2DO3A 4E2FB 2QAZA 2YUQA 1Q7YC 1BI0A 2RMOA 3T9NA 5KYWA 4C8QB 4RG8A 2KRMA 4ZTFA 4HT9A 4E7ZA 1ZSGA 1VQMQ 1Q82U 2P4TA 2COYA 4CC7A 5KYWB 2YWWA 4PJMA 1Y7XA 1D1AA 2EQKA 1YIJA 1K73U 5AYFA 1M1KC 4ZGDB 2KDSA 1JJ2P 1I07A 4LDYA 4IUVA 2DL4A 3JV3A 5J3BA 4BI4A 5I22A 1M8VA 1BKBA 2NYSA 2Y4YA 1SPKA 3S3OA 3C4SA 4LN2A 1AZGB 1XOVA 3CEYA 1D0ZA 5CVIA 4QVDA 2RQVA 1VIFA 1CSKA 1E6HA 1NPPA 3OYHA 4CRIA 1N6AA 4C92F 2RQUA 4HVUA 1J3TA 1YJNQ 1B3QA 5GAOl 4KT0E 2HKQB 3CCVQ 2DEUA 4F7UA 1MMAA 3U23A 3SWNC 1TWBA 4GBQA 4OMMA 4EDUA 2J7IA 2LCLA 1K8AU 2KR3A 1PKTA 5FU7B 3THKA 2WACA 4J9FA 2KI7A 1Z9QA 3M57A 1Y57A 2OTLA 2DIQA 1YI2A 2PVOB 1YWPA 3CC4Q 3JCMQ 2XICA 4DEYA 1VQ8A 2RHYA 2LTOA 1RAFB 1UHFA 5LJ5e 3OYAA 1QLYA 2H3EB 1NLPC 4Y92A 4KH0B 2AK5A 1WFWA 4BD3A 1LPLA 3TCJA 3EH1A 4JS4A 1SRMA 4AFUC 2M0YA 3G71A 1R0BG 4JJDA 1RAHB 3UA6A 1VQOQ 3VU3C 2JVVA 5GAN7 4QW2A 2OTJT 3JCMJ 2E4HA 1UDLA 4BDZA 3QSUA 4AFSC 2K9GA 2DRMA 2DXUA 2V8KA 4R0KA 2ATCB 3JB9I 4XTWA 2HBWA 3CCRA 2EIFA 2E3IA 1PCXA 3ZEHA 3GIBA 4NS5A 2VWFA 2E64A 4PJJA 4AMCA 4J5YA 4QT7A 1WQWA 4M75E 2HZYA 1VQKQ 4M7DC 5A2QE 3OYDA 3CPFA 1NM7A 1MUZA 3CMAA 4J6XA 1WJRA 4LD9K 3MEWA 3OBWA 2D6FA 3FRNA 2M1HA 3CXCA 3CCMQ 3RUXA 3L1AA 2EQJA 2FZGB 1I0CA 4VUBA 2YUNA 3CCQA 2VUBA 3CD6A 3KBGA 5GMKi 1YITQ 1HYOA 4BE1A 4IURA 3H6ZA 4M75G 4EIKA 2LZ6B 2DXTA 2EW3A 1H3ZA 1EIFA 2D0QB 5IHNA 3NGPA 2COWA 5I2SA 5I11A 4M7AA 2CP2A 4PFZA 3UF4A 1PC0A 2DX1A 3M0PA 1NEBA 2OAUA 4EPCA 1Q81U 1BB9A 2LMJA 3ZL7C 1VQLA 3OYLA 2QXFA 1YN8A 3QBYA 3PT9A 1U1SA 4RCBA 2XIDA 5L8RE 1PNJA 3I5SA 3V7CA 4ORZA 1QVGP 1MNDA 5C0MA 4II1A 3I56T 3O5ZA 3OYKA 2RM4A 3OMCA 7AT1B 2VGMA 3QPHA 3VS1A 1D09B 1NE8A 4KGVB 2VVKA 1R0CB 2K2VA 2XI9A 2QYZA 1AZEA 4JS5A 4A4KA 3MCAB 1NLOC 2XU8A 5GAN5 2XDDA 1NG2A 4HCZA 1YIJQ 4E7JA 1WHMA 4ZGJB 5GAMh 4BY6C 4M78F 3KFVA 1VQ7A 5CQXA 4RMOA 1UGSB 2L3SA 1WHGA 3FDRA 2YUOA 1SF9A 2QGGA 1N8RR 1X01A 3QHSA 3L2WA 3CCLA 2LT4A 3HRSA 4PJOA 4OB2B 2OAWA 2KAFA 4CI0C 4F14A 5FRMA 2KT8A 2GQIA 3CCJT 1ZA2B 3V8LA 1VIEA 2E5KA 2DNUA 3M0QA 2KQWA 2KRSA 4B9XA 1K0XA 1TOVA 4FT2A 5FWCA 5GAMf 2GQVA 3S6WA 4ZN1A 4OP0A 1OULA 1U5SA 1WHJA 4A54A 1TUDA 4A53A 2ZZDA 2QTXA 1Q95G 2ED1A 3Q1JA 5L23A 2O31A 2HD0A 3URGA 2EJGA 2OTLQ 1YI2Q 4C0ZA 4J83A 3DB4A 1BK2A 2O4XA 1VQ8Q 3VJPA 4OMNA 4C8QF 4BE0A 4N4HA 1YHQA 4JJNK 1N9SA 2DL5A 3QKJA 3UATA 2O4XB 2X4YA 5FWBA 2L3RA 5GAMj 5GMKh 1WGSA 1I5LA 3OYBA 1D0XA 3A8GB 2E6ZA 4M7DE 1T3LA 4J9GA 1N9RA 1WI7A 3G4ST 4RTZA 5GAMd 1AWXA 1G3YA 1VQ4A 4IUQA 4PLLA 1VQNT 2R58A 4ATOA 1KK7A 4M75D 4HT8A 2IPOB 2LJ0A 1Q82R 5GAN6 4AFZC 3CC7T 4OGCA 3QJ6A 2K5IA 2FL7A 3CCRQ 2C06A 4JLGA 3GLXA 5KCHA 5IXFA 1GL5A 3C95A 1M9SA 1S1NA 1KD1U 1K73R 3CCEA 5GANe 5GAN2 1VQMA 3L2RA 1QVFA 4UC4A 4M7DG 2F5TX 3GNGA 2CP7A 4M77A 2GBQA 2DK3A 4QQ6A 2EYWA 1AD5A 4F7UF 1HK9A 3CMAQ 1I81A 2J6KA 1KQSS 2ZPEB 1D3BA 2XHCA 1UGQB 3A8HB 3JB9G 4N0AA 3CCQQ 3CD6Q 5KYNA 2K6DA 1D3BB 2QDLA 1I4K1 2X3XD 3CCSA 1K8AR 1YJWT 2CZ7B 5IN1A 3CCUQ 5GMKj 2M16A 4JDSA 3P8HA 1FX7A 2FPFA 1ZHIA 4GY5A 2LDMA 1QWFA 3G6ET 4J9IA 4KGZB 3OYEA 1YI2T 4C92C 3JCMe 2LCSA 4MDWA 2CH4A 1K9MU 1VQLQ 1AOJA 4RG2A 4HVVA 4P5NA 3M9QA 1H3HA 1PWTA 1MV3A 1UECA 2ESWA 1MMGA 1YCSB 2X4JA 4J9HA 2DERA 2CS7A 3G71T 1QVGA 5GJVB 2X3WD 3FJPA 4J9EA 2P0KA 2HSPA 1OQKA 4IIOA 2KNBB 5J39A 1AWOA 2NUPA 3OS1A 1UG1A 2KBTA 2E3HA 2Y4XA 1RACB 1WHLA 3NMZC 1NBEB 3M4GA 2JXBA 3UWNA 4LDUA 2NUPB 2MWOA 2WSEE 1WQ7A 4TVRA 4RCCA 3D7SB 3OW2S 3FIFA 1VQ7Q 1I5OB 5D6WA 3M59A 2KYMA 2X4WA 4R56A 2K3BA 1VQPA 4F16A 1LCKA 2L3PA 2LP5A 3SB2A 3VYGA 1CKBA 2YHTA 1FMWA 1QVPA 3CCLQ 2CZ1B 1G2BA 1V1CA 2VB6A 3CMAT 4Z89A 4JUVA 3EGUA 4D8DA 4Z8AA 1VYTA 5KYUA 2PU9B 3NTKA 1OEBA 2QQAA 1RAGB 2DILA 2J05A 5D6XA 4M7AF 3I55A 1M8MA 2IG0A 5KYUB 2AKKA 4J6YA 3M55A 1H641 2BZXA 5FU6C 3C94A 2RJEA 1YITA 1VQ5T 1ZLMA 5IHKA 2HNIA 3LW5E 2EQIA 1YJ9A 3JCMb 4FU6A 1GBQA 2ZGWA 2LQ8A 3OMGA 2QA4A 3NHNA 4XU2A 1UJYA 4LUEA 1XTDA 1YHQQ 4XAXB 3SWNA 2K5FA 3EHRA 3QJYA 2EKOA 1VQLT 2YRDA 2PVGB 2HEQA 2MK5A 5GAMg 3OA6A 1PRMC 2A08A 2DLPA 2GFAA 1OX9A 4EMKC 3SWNB 2ENMA 2COZA 1QQJA 4PNOA 1X69A 3J7AF 3EHQA 3H0HA 1QKWA 4ESRA 4BACA 4X9CA 1VQ4Q 4MMKA 3CMEA 2JTEA 1CKAA 1F1BB 2RNAA 1OPLA 1LOJA 1MV0B 1M3CA 1N5ZA 3BDLA 2KEAA 1FXXA 3A1PA 4NL3A 2KRNA 3CPWA 3VS0A 2CUDA 3I35A 2MYSA 2CKKA 2V8IA 3CCEQ 2A0FB 2C0TA 4LD6A 5FW9A 5AT1B 3META 4XK8E 3PMIA 4PJOF 1T3SA 1IHWA 1H8KA 2I0NA 2A3LA 2VGNA 4KH1B 3HKSA 3RBBB 1I1JA 2EGEA 4ELYC 4PJLA 1PSEA 1M3BA 2KMTA 1OYXA 2D0NA 1KG1A 2FHDA 1HXDA 4L59A 2E1HA 3I9QA 1AWJA 2BIVA 2DYIA 4X34A 4C92E 3E1SA 4QVCA 2DFUA 2E65A 4XTVA 2XK0A 4J6WA 4WTOB 3JCMh 2BE9B 3CC2A 4M78C 1WLPB 4XTXA 5A0GA 1C1AA 2CSQA 3QWXX 2FRYA 3CCSQ 3HFNA 2O2OA 2KXCA 3EGXA 1ACMB 3EFSA 5HK0A 4BB7A 1K76A 1BCMA 3VUBA 2NUTA 2V1QA 2JMAA 3PNWC 3RMSA 4C92G 3EGXB 1VA7A 1TS9A 2EQUA 2A28A 2FZCB 3BE3A 2D9TA 3DB3A 1UEBA 4MZPA 2NUTB 4OVAA 2EKHA 4CC3A 4IUTA 1YHQT 2O88A 2K79A 4LUDA 3OYMA 3SDZA 3X24B 1RAAB 2VXEA 3BDUA 1KC8C 4PK4A 1ABOA 4KUIA 2JTMA 3EFOB 3VS7A 3NTIA 2RJFA 4C8QC 1KQ1A 4FIBA 3R6OA 5FRNA 4M77F 3EG9B 1KD1R 1E6GA 3M0RA 1KJWA 2G3RA 4C0GA 2A36A 4L5GA 3FC3A 4MDXA 1M2VA 2ZPIB 1QCFA 1VQMT 5CAIA 1RI9A 1XNIA 2FPEA 1UJ0A 1VQPQ 2M9UA 2L89A 5CK9A 3REAB 1M2VB 4B6MA 3PVLA 2NUZA 4FYXB 5I21A 5HKCA 3OS2A 1KQSP 1YFNA 1OX8A 1TUCA 1G3WA 3I55Q 3PTAA 3OS0A 3OYJA 3HHTB 3MP1A 1O75A 2GF7A 3LH0A 4ELZC 1O9SA 1KQ2A 2CDTA 3MJXA 3OS5A 4R55A 4J9CA 4BY6B 1YJNT 1M1GA 3CCVT 2YDLA 3KXTA 5FU7C 4RTUA 2DXCA 4JRKA 2KE9A 1YJ9Q 5EC7A 1U3OA 3RKYA 2HMAA 3CCUA 3H9NA 4HCCA 3L2VA 2QA4Q 2EYQA 1K9MR 1TH7A 1LJOA 1ZSZC 2ZPHB 4F17A 3WVEB 4C5IA 3MKDA 2DVJA 1OU8A 1UGPB 6AT1B 3KUFA 1PKSA 4DBRA 3CC4T 1HJDA 5GAOr 3ZBDA 1T0HA 2R57A 2HQEA 2JM9A 2EBPA 3X25B 1G3TA 2L3QA 3EG1A 1LNXA 3CMEQ 2DZ9A 2CP6A 4WF2A 5DY9A 2RQTA 4OMPA 3CBOA 1S72A 2XD0A 2JNGA 1VQOT 3E9GA 2HQXA 3HFOA 3CQTA 2LQWA 3VKIA 4KBMB 4C92D 2DKGA 2EGAA 2DETA 5IAYA 3OW2P 4D8KA 5CKFA 4JRIA 1JJ2A 1W1FA 1IREB 1GCQA 4ZN3A 2JN0A 4PL6A 1Q7YU 1UGRB 3RKXA 3H41A 3RERA 1QMCA 3G1JA 1Q86C 2LCCA 3OYCA 3LGFA 1RAEB 3QXEB 4OMFB 5CQYA 3EGDA 4C0DC 4BE2A 2BTTA 1A0NB 1C6VX 1OV3A 1WIEA 1WA7A 3VRZA 1VQKT 3V7RA 3CC2Q 4HA8A 2L0AA 2H3JA 3EGDB 4XU3A 1N8RC 1QCOA 1M1KU 2DJQA 2K5LA 2JS0A 5D7UA 3CCMT 2QASA 1BBZA 5LJ5h 4C5EA 2L8DA 2PQWA 1KHIA 4A63B 1YITT 2PTKA 1JQQA 2LT1A 4ZTJA 3R6NA 1LVKA 5DM7R 2B86A 4QKUA 4C8QE 4ZNXA 1GCPA 1WHHA 2BE7D 2RI5A 3VYHB 3MHXA 2P84A 5LJ3e 4JZ3A 1PG5B 4M7AC 4B9WA 1AHJB 4FSSA 2GGRA 1TUGB 3MEVA 2JZ2A 2F1LA 3MEAA 4A4HA 5GAN8 2DZCA 2DXBA 3UA7A 1AVZC 3VS4A 4JPBW 3BW1A 5LJ5f 4HXJA 2CP5A 3OYIA 1PM3A 1KFZA 4C8QG 2D8JA 2MMPA 5CCAA 3GOXA 5KH6A 1MMDA 2QI2A 2XDBA 1E7OA 2O9SA 2QK0A 3JSCA 3UT1A 5CR2A 3JCMg 1Y07A 4C92B 4AFQC 1U06A 1M90C 4XTZA 4N4GA 2W10A 2MCNA 3CBMA 5IXBA 3OSSC 1SRLA 3M54A 1G83A 2RB6A 1VQ6A 4F7UE 3VS2A 4KRTA 3RR6A 1YIJT 2LQKA 5LJ5j 2KSSA 1K73C 1DJ7B 2OTJA 2DE0X 4XU0A 2RHIA 2MWPA 2LVMA 3M0SA 3JAME 5LJ5d 4DBFA 2CSIA 4MMLA 3PFSA 5KCOA 1ZBJA 3WVDB 4PJOC 2HDAA 3L2QA 2QQBA 4CC2A 2BKDN 4F7UG 1OI1A 2MPXC 9ATCB 2DPPB 1QVFS 5A0LA 4OGEA 1EZZB 3HSBA 1WHKA 4DBQA 1X75C 4Y28E 3NPFA 2YLBA 3GBQA 3M5AA 4IKFA 2DAQA 2MOXA 4A4FA 3LYIA 1K8AC 4JLIA 2CP0A 2RHUA 2DVEA 4XU1A 3QYGB 3X28B 2FRWA 4E7IA 3TVTA 1B34B 3DKMA 3VS5A 2JW4A 2OTLT 1ZQ1A 2ZPBB 1R77A 3EAEA 3LWHA 3NFCA 2B8AA 1UB4A 3QYHB 4NL2A 1VQ8T 2A7YA 1ZUUA 5C6SA 2RPNA 2DL3A 3PGGA 2C0OA 2K3XA 2M51A 2ABLA 4M75A 3JCMW 5FU6B 1GFDA 1PRLC 2Z0WA 1ZX6A 2LC4A 2RI3A 5DLQE 1S72Q 2FG0A 2EVRA 4M75B 2AHJB 4D6WA 3M0TA 4DEXA 1X2KA 3A98A 2MIOA 3OW2A 3CCRT 2SRCA 2CT4A 2FYKA 1HD3A 3PVQA 5CO7A 5M9OA 4EMKB 3EG3A 1NJIC 2RI2A 5CKHA 3MPUB 3IQLA 3LH5A 4M77C 3I56A 2O9VA 1MMNA 2CGHA 2JTFA 2W0ZA 1C0MA 2VKNA 1WDXA 1UE9A 3HRTA 1M5Q1 1NZ9A 5LJ3h 4M7AE 5J26A 2QQRA 4GLMA 1V76A 3RKWA 4RUGA 1WXUA 3FEOA 2AIRB 3G7ZA 2HSEB 4N0AC 4J7FA 2EYZA 1JXMA 3FJ5A 3CCQT 3CD6T 1UHCA 2J06A 4FW2A 1W2BS 1VYUA 2FZKB 2Y90A 4J8OA 2CZ6B 2QDYB 3GPLA 4FCYA 5HK3A 4M7AG 3CCUT 2JUFA 2RH2A 2XDPA 4A4EA 2ROLA 3RDVA 3MP6A 3CCJA 2RK1A 5I2MA 3BFMA 2GNCA 2LJ1A 2LJ3A 4DOWA 2GCXA 4M7DD 5IH2A 1U1TA 2DJZA 1Q81C 1G3SA 3RESA 2L5QA 5IHIA 4BUGA 4C5HA 1NYFA 1VOMA 2QEXA 2I2LA 2KK4A 4E47A 5GANh 1M2OA
chains in the Genus database with same CATH topology
2VV5A 4FSXA 3L2UA 4RMOA 1UGSB 3ER0A 2G3RA 3FDRA 4Q5WA 4C0GA 3FC3A 4L5GA 4MDXA 4QQGA 1W4SA 3OYGA 2ZPIB 1X01A 3HL8A 3QHSA 5D6YA 3L2WA 3JB9D 1VQMT 5CAIA 1XNIA 1YJNA 3CCLA 3CCVA 2LT4A 2CYZB 2EJ9A 3HRSA 4LDWA 2M9UA 2L89A 3FB9A 3QDRB 2DD4A 4OB2B 5CK9A 4PJOA 2PVDB 2KAFA 2WSFE 4CI0C 4FM4B 5LJ3j 3OYNA 1VQ7A 5FRMA 2RHZA 4PJOE 3CCJT 3L2ZA 4M78D 3V8LA 1VIEA 3V8JA 4OF1A 1QP2A 2KQWA 4B9XA 4FT2A 2ZPGB 5I21A 2IVWA 5GAMf 2GQVA 3S6WA 3P8BB 2EFIA 2DTIA 1BI2A 3JCMc 5HKCA 4LDVA 2EAYA 4ZN1A 5LJ5g 4IUUA 3OS2A 4OP0A 5FLXE 3UPUA 4A54A 3OYFA 4A53A 2ZZDA 2LX9A 2QTXA 3F70A 1G3WA 3Q1JA 1VQ7T 3CC4A 3BY7A 3C12A 3PTAA 2HD0A 3OS0A 1M1FA 3OYJA 3HHTB 3MP1A 1O75A 2GF7A 3N5BB 1P92A 4XQ3A 4E7LA 1M90U 3LH0A 5EG2A 4ELZC 3URGA 2EJGA 1O9SA 2MI6A 3SD4A 1KQ2A 2DTOA 3WXMB 4PJOG 4EMKA 3OS5A 4DOVA 4C0ZA 4R55A 3CC7A 4J83A 3CPWS 3DB4A 4BY6B 2VYTA 1VQ9A 2O4XA 3CCLT 1YJNT 3VJPA 1M1GA 4C8QF 4GLKA 3VV0A 4NOYA 3ME9A 3KXTA 4N4HA 5FU7C 3CCVT 4ZGEB 4Z02A 1OZ3A 2DXCA 3ASKA 4JRKA 1QVGS 1YHQA 4JJNK 2MAMA 2QQ9A 1N9SA 2XKOC 4J7IA 3QKJA 3RKYA 3CCUA 2O4XB 4XTYA 1VQOA 4HCCA 3L2VA 2FB7A 3PIOA 2EYQA 2ZCFB 2F5KA 1TH7A 2X4YA 2L3RA 3J81E 5GAMj 1LJOA 5GMKh 2ZPHB 1WGSA 1I5LA 3OYBA 3WVEB 3RMQA 4M7DA 4A4GA 1KHCA 4C5IA 5GANj 2DD5A 2E6ZA 3A8GB 3LGLA 3E9FA 4MZMA 3G4ST 4M7DE 1N9RA 2X4XA 1UGPB 3KUFA 4C8QD 2K3YA 2E41A 3CC4T 5GAOr 4HKEA 5GAMd 3ZBDA 1VQ4A 1G3YA 3DLMA 4IUQA 4M7DB 4PLLA 1VQNT 2R58A 4M7DG 4ATOA 4JRPA 3INZA 3QO3A 1W2BA 4M75D 5GANd 4HT8A 2R57A 5CKEA 2WSCE 2HQEA 5GAN6 1Q86U 3CC7T 4OGCA 3X25B 3QJ6A 5KE2A 1G3TA 2K5IA 2FL7A 3JCMf 1BIAA 2C06A 4JLGA 3GLXA 5KCHA 5IT9E 1LNXA 2DZ9A 5GAMe 2RO0A 3C95A 1M9SA 4WF2A 3MP8A 3OBYA 5DY9A 4EMGA 1KD1U 3CCEA 1VQKA 1JBMA 5GANe 2K4YA 3QIIA 5GAN2 3CBOA 1YJWA 1S72A 1VQMA 2XD0A 3L2RA 1QVFA 2JNGA 2EQMA 2QQSA 4UC4A 3E9GA 1VQOT 5LJ3f 2YRVA 2HQXA 2F5TX 3GNGA 1N8RU 3HFOA 1WPYA 4M77A 4F7UB 4M78A 2DK3A 5GAN4 3VKIA 4M77E 1RL2A 3MO8A 4QQ6A 4BI8B 4DA4A 2M0OA 2FVUA 4F7UF 4KBMB 3CCMA 1HK9A 2V8JA 3G6EA 4C92D 2DKGA 5GAN3 4X9DA 1I81A 1X6OA 3V7SA 4M78B 2VC8A 2F69A 5IAYA 2LRQA 3LLRA 1Y71A 3S3NA 1VQ4T 1KQSS 2ZPEB 2GFUA 1D3BA 5CKFA 4JRIA 1JJ2A 2XHCA 1IREB 4ZN3A 3JCMX 4V2SA 2JN0A 3GNFB 3CBPA 4ME7A 1OZ2A 3QG1A 4PL6A 5GMKl 4M75C 3HP9A 1Q7YU 4OB3B 1UGQB 1UGRB 2ZPFB 3A8HB 3RKXA 3RERA 3JB9G 4N0AA 3VUZA 1Q86C 2LCCA 3X26B 2YLCA 4EMHA 3OYCA 3LGFA 1D3BB 2O01E 3QXEB 4OMFB 5CQYA 4C0DC 4BE2A 3QUIA 1VQKT 1QP3A 3CCET 4M77G 1I4K1 4OB1B 3M53A 1VQ6T 1BYMA 3V7RA 3CCSA 4QVZA 1KD1C 1YJWT 4HA8A 1S72T 1WNLA 2CZ7B 3M58A 4MZTA 2H3JA 5IN1A 5GMKj 2XG8D 3A5ZB 3JCMd 2RJDA 2M16A 1QW1A 2R5AA 3A8MB 1JRIA 2LNVA 2PUKB 3P8HA 4JDSA 4XU3A 1MHNA 1N8RC 1FX7A 1M1KU 1YCYA 1ZHIA 3OB9A 4GY5A 1YBYA 3M4YA 3GF5A 1XQHA 2K5LA 2EWNA 2LDMA 3O8VA 3CCMT 3G6ET 4C0FA 4DQ2A 3QZ9B 1YI2T 4KULA 3OYEA 1MGQA 4C92C 4RKUE 1R8OB 4C5EA 2K57A 2L8DA 5LJ3d 2PQWA 5LJ5h 3JCMe 1KHIA 4MDWA 1VUBA 5GANf 3AHUA 2E6NA 1YITT 1K9MU 4BDYA 1IZ6A 5CKDA 2LT1A 4ZTJA 3G4SA 4C8QA 4RG2A 1NJIU 2RJCA 5DM7R 4E7HA 4FL6A 4P5NA 3M9QA 2PUOB 4C8QE 3PIPA 1SSFA 5GMKe 4KUDK 1ZBXA 2DO3A 2RI5A 1WJSA 5GMKm 1Q7YC 1BI0A 3VYHB 3MHXA 5LJ3e 2X4JA 3T9NA 4M7AC 4B9WA 4RG8A 4C8QB 1AHJB 3OSVA 2CS7A 4ZTFA 3CCST 3G71T 1QVGA 3MEVA 4HT9A 2JZ2A 1WJQA 3FJPA 1Q82U 2P4TA 3MEAA 4A4HA 5GAN8 2DZCA 2DXBA 2P0KA 3LWIA 3FLGA 3BW1A 4XTUA 5LJ5f 1Y7XA 5J39A 4M75F 4C0DB 2EQKA 1RI0A 4N4IA 1YIJA 1K73U 5AYFA 3OYIA 4ZGDB 3OS1A 1M1KC 2KDSA 4LDYA 2Y4XA 4LDXA 4C8QG 4IUVA 3HPWA 5J3BA 2MMPA 5CCAA 3CXCS 4BI4A 3M56A 3M4GA 3GOXA 1M8VA 2RA2A 3UWNA 1BKBA 2Y4YA 4LDUA 2MWOA 4YTLA 2WSEE 2QI2A 1WQ7A 1BI3A 3C4SA 5KH6A 3S3OA 2XDBA 3A8OB 1K9MC 3OYYA 4TVRA 1XOVA 3CEYA 4RCCA 3JSCA 3UT1A 3OW2S 5CVIA 3FIFA 4QVDA 4PJOD 5CR2A 3JB9H 4FT4A 5D6WA 1U8RA 1VQ5A 3M59A 2X4WA 5HY6A 1VIFA 4R56A 1BIBA 1Y07A 2RK2A 4PLIA 3JCMg 4C92B 3P8DA 1VQPA 1N27A 1VQNA 1NPPA 3OYHA 1M90C 4XTZA 3SB2A 4N4GA 4IUPA 3VYGA 3CBMA 4CRIA 1N6AA 4C92F 2YHTA 3GP8A 1QVPA 2MF2A 2CZ1B 3OSSC 4KT0E 5GAOl 4F7UA 3JRZA 1NPRA 3SWNC 3M54A 5LJ3g 5FROA 3CMAT 2RB6A 1VQ6A 4JUVA 4F7UE 2CZ0B 1PSFA 4EDUA 2LCLA 4M7AB 1YIJT 2LQKA 5LJ5j 2PU9B 3NTKA 2QQAA 1V29B 2KSSA 5GAOq 1K73C 1K8AU 1DJ7B 5LL6S 2OTJA 5D6XA 4HCBA 4XU0A 3TU4K 2RHIA 4M7AF 4M78E 2MWPA 2LVMA 3I55A 5FU7B 3JCMP 2IG0A 3HRUA 2WACA 3JAME 3M57A 2E10A 5LJ5d 5GAOp 3A8LB 4J6YA 3M55A 2OTLA 1H641 2DIQA 1YI2A 5FU6C 3L42A 3C94A 4MMLA 2PVOB 3PFSA 5KCOA 2RJEA 2XICA 3WVDB 3JCMQ 4PJOC 1YITA 1VQ5T 3L2QA 2QQBA 1VQ8A 2RHYA 2LTOA 1VQPT 2HNIA 2BKDN 3LW5E 1M4ZA 4F7UG 1OI1A 5LJ5e 3OYAA 1YJ9A 3JCMb 5A0DA 2DPPB 4FU6A 5GAOn 1QVFS 5A0LA 4OGEA 4BD3A 2ZGWA 4O5VA 3HSBA 3TCJA 2NLUA 4JS4A 2LQ8A 3OMGA 2QA4A 1X75C 4XU2A 4M78G 4Y28E 5GAOm 1XTDA 3LX7A 5CKBA 3G71A 4XAXB 2YLBA 3M5AA 3SWNA 2K5FA 2JOYA 3PMTA 3J80E 3QJYA 2EKOA 2DAQA 4E7KA 1VQLT 4IKFA 2PVGB 3VU3C 2JVVA 5GAN7 3MEUA 4QW2A 4A4FA 2OTJT 3LYIA 3JCMJ 5GAMg 5DLOA 3OA6A 1K8AC 4JLIA 3I55T 4BDZA 2RHUA 3QSUA 2GFAA 2DVEA 4XU1A 3QYGB 3SWNB 3X28B 4EMKC 1JJ2S 5GANg 4E7IA 1B34B 2DXUA 3DKMA 2RD1A 1ZQ1A 2OTLT 4PNOA 2ZPBB 3J7AF 2V8KA 2HAXA 3EAEA 3JB9I 4XTWA 3NFCA 4X9CA 3LWHA 2B8AA 4BACA 1UB4A 3CCRA 2EIFA 3QYHB 4MMKA 4NL2A 1VQ8T 2A7YA 3ZEHA 3CMEA 3GIBA 4NS5A 5C6SA 1LOJA 3BDLA 2E64A 1YJ9T 1FXXA 3PGGA 4M77D 4NL3A 2K3XA 3CPWA 4J5YA 4M75A 3JCMW 5FU6B 1WQWA 4M75E 2QA4T 2CKKA 2HBPA 2V8IA 4Y91A 4PJOB 2LC4A 4M7DC 2RI3A 4LD6A 5DLQE 3JCMV 5A2QE 3OYDA 2E12A 1GXIE 3V8KA 3CPFA 3META 4M75B 4XK8E 3PMIA 4PJOF 3DLLA 2AHJB 3CMAA 4J6XA 3TEEA 1Y96A 2QEXT 1WJRA 3S3MA 4D6WA 4LD9K 2A3LA 3MEWA 2VGNA 3OBWA 2D6FA 2P0PA 3FRNA 3HKSA 2M1HA 3CXCA 4ELYC 1PSEA 3RUXA 3RIRA 3L1AA 2EQJA 3OY9A 4OB0B 2KMTA 1OYXA 2E5QA 4PKCC 1Y96B 1KG1A 3NTHA 4VUBA 2FHDA 1HXDA 4L59A 3SFMA 2E1HA 3OW2A 3CCQA 2VUBA 3CD6A 2BIVA 3KBGA 3CCRT 4X34A 4C92A 5GMKi 4BE1A 4IURA 3H6ZA 4M75G 2VXFA 3CMET 4BI3A 4C92E 3E1SA 2FYKA 4QVCA 2DXTA 5CO7A 3JB9J 2E65A 4XTVA 2XK0A 4EMKB 5M9OA 1NJIC 2RI2A 4J6WA 3CC2A 3JCMh 5CKHA 4JRQA 1H3ZA 1EIFA 2D0QB 4M77C 3I56A 2EJFA 4M78C 1FWZA 2BUDA 4XTXA 5I2SA 5A0GA 3ZFJA 2E70A 2CGHA 2JTFA 1JB0E 3H8ZA 4BE0A 2X35A 3UDCA 5CIUA 1KC8U 4M7AA 3HRTA 3HFNA 1Q81C 1M5Q1 1NZ9A 5LJ3h 4M7AE 2OAUA 4EPCA 5J26A 3EFSA 1Q82C 2R5MA 5HK0A 1Q81U 2QQRA 3EFRA 4BB7A 3RKWA 1G5VA 3VUBA 1VQLA 3PNWC 3RMSA 3FEOA 4C92G 3G7ZA 3QZ5B 3OYLA 4N0AC 2EQUA 2QXFA 4J7FA 3OQ5A 3QBYA 1I8FA 3PT9A 1U1SA 4RCBA 4M7DF 3CCQT 2XIDA 2D9TA 5L8RE 3CD6T 3DB3A 1UEBA 1VQ9T 4MZPA 1KQSA 1W2BS 4OVAA 2Y90A 3V7CA 4J8OA 4L6V5 2CZ6B 2DIGA 2DTHA 2QDYB 3GPLA 4IUTA 1YHQT 3CC2T 2RHXA 5HK3A 5C0MA 4II1A 4M7AG 3I56T 3OYKA 2RM4A 2KVQG 3CCUT 2JUFA 2RH2A 2VGMA 2XDPA 3OMCA 3OYMA 3SDZA 3QPHA 4A4EA 3X20B 1NE8A 3MP6A 3X24B 3CCJA 2RK1A 5I2MA 3BFMA 2K2VA 2VXEA 4O6JA 4DOWA 3BDUA 2XI9A 1KC8C 2KY9A 2GCXA 4M7DD 4M7AD 4KUIA 1U1TA 4A4KA 2JTMA 2DJZA 3MCAB 4JS5A 4C5GA 4M77B 3TREA 3JB9F 2XU8A 5GAN5 2XDDA 3NTIA 1G3SA 2RJFA 4QQDA 2L5QA 4HCZA 3RESA 4C8QC 2DEQA 1KQ1A 3E19A 4FIBA 4BUGA 4C5HA 3R6OA 4E7JA 1B34A 5KE3A 1BI1A 4ZGJB 5GAMh 4M77F 5FRNA 4BY6C 4M78F 2QEXA 2P0QA 2I2LA 2KK4A 4E47A 5GANh 5CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI2 A;  5CVI A;  1G3Y A;  2QQA A;  1U8R A;  4O5V A;  4O6J A;  2QQ9 A;  1BYM A;  2GCX A;  1FWZ A;  3HRU A;  2LX9 A;  1G3W A;  1G3T A;  2K5I A;  3HRS A;  1G3S A;  2H3J A;  2K5F A;  3GLX A;  3E19 A;  1P92 A;  1QVP A;  1QW1 A;  1BI0 A;  3HRT A;  3MHX A;  1BI1 A;  1FX7 A;  2QQB A;  2K4Y A;  2K5L A;  1BI3 A; 
#chains in the Genus database with same CATH topology
 4FSX A;  2RQW A;  4Q5W A;  2K2M A;  4QQG A;  3M0U A;  1W4S A;  3OYG A;  2ZAE A;  1QCN A;  3HL8 A;  5D6Y A;  4E6R A;  3JB9 D;  2EGC A;  4PJN A;  2EJ9 A;  3FB9 A;  5LJ3 j;  3OYN A;  4PJO E;  1NEG A;  2ZPG B;  2IVW A;  1BI2 A;  4RTT A;  1VQ6 Q;  2YRC A;  2EAY A;  5LJ5 g;  1Q7Y R;  3UPU A;  4LXC A;  3OYF A;  2OTJ Q;  2HL5 C;  2H8H A;  1VQ7 T;  3BY7 A;  3C12 A;  1YNZ A;  4E7L A;  4XQ3 A;  1VQN A;  2HKN A;  1M90 U;  5EG2 A;  3SD4 A;  2MI6 A;  2YUP A;  4JJC A;  4PJO G;  3CC7 A;  2A37 A;  3CPW S;  2VYT A;  1VQ9 A;  2GTJ A;  3CCL T;  1M1K R;  3VV0 A;  4NOY A;  3ME9 A;  4Z02 A;  1OZ3 A;  2OI3 A;  4FW1 A;  2FO0 A;  2QQ9 A;  4F04 B;  1ABQ A;  4RTV A;  2ZCF B;  2F5K A;  2F2X A;  4HVW A;  2J6O A;  3J81 E;  4M7D A;  1GRI A;  5GAN j;  2DD5 A;  3LGL A;  2LNH B;  2AZV A;  1OPK A;  1B07 A;  2P4R A;  2DL8 A;  1NYG A;  2E41 A;  4HKE A;  2DMO A;  3DLM A;  4M7D B;  3TSZ A;  4JRP A;  3INZ A;  5GAN d;  4FYY B;  2WSC E;  2F2V A;  3JCM f;  1BIA A;  5IT9 E;  2CT3 A;  5GAM e;  1RLP C;  3MP8 A;  3OBY A;  4EMG A;  2X51 A;  1JBM A;  1W70 A;  1YJW A;  1X6G A;  1UTI A;  2KT1 A;  1JU5 C;  2YRV A;  3EFO A;  2CP3 A;  4F7U B;  3ULR B;  5GAN 4;  4KGX B;  4M77 E;  4PFO A;  4DA4 A;  1IB8 A;  2FVU A;  2F2W A;  4K11 A;  1ZSZ A;  3G6E A;  2IIM A;  5GAN 3;  2VC8 A;  3EG9 A;  2LRQ A;  3LLR A;  1Y71 A;  1VQ4 T;  1Y0M A;  2GFU A;  1KC8 R;  1ZSZ B;  3JCM X;  3GNF B;  4LNP A;  1OZ2 A;  1H92 A;  4OB3 B;  2ZPF B;  3QDF A;  2KGT A;  3VUZ A;  2DL7 A;  3X26 B;  4EMH A;  4JJB A;  4M7A D;  1QP3 A;  3CCE T;  4M77 G;  1BYM A;  4OB1 B;  3M53 A;  3SEM A;  1VQ6 T;  4QVZ A;  1KD1 C;  2FPD A;  4AG2 C;  3I56 Q;  1WNL A;  3QWY A;  3AT1 B;  3A5Z B;  3JCM d;  2RJD A;  1QW1 A;  1JRI A;  2LNV A;  3OB9 A;  3M4Y A;  2EWN A;  1ZUY A;  3EG2 A;  2SEM A;  3AHU A;  1SHF A;  1X43 A;  1NJI U;  4E7H A;  3PIP A;  1SSF A;  5GMK e;  1ZBX A;  1WJS A;  5GMK m;  1QVF P;  2V1R A;  3OSV A;  3CCS T;  1VYV A;  1WJQ A;  3LWI A;  2L2P A;  3FLG A;  4XTU A;  3CCJ Q;  2CUB A;  2JT4 A;  4M75 F;  4C0D B;  1RI0 A;  4N4I A;  1SSH A;  1HSQ A;  4LDX A;  3HPW A;  3CXC S;  3M56 A;  2RA2 A;  2DYB A;  4FYV B;  4YTL A;  1BI3 A;  1UGV A;  3A8O B;  1K9M C;  3OYY A;  2QEX Q;  2OJ2 A;  4RTW A;  3REB B;  2JM8 A;  4PJO D;  2DA9 A;  3JB9 H;  4FT4 A;  1U8R A;  1VQ5 A;  1OU9 A;  1PD0 A;  5HY6 A;  1BIB A;  4PLI A;  2RK2 A;  3P8D A;  1N27 A;  4RTY A;  1K4U S;  4M4Z A;  2YXY A;  4IUP A;  1WYX A;  3GP8 A;  2MF2 A;  3JRZ A;  1NPR A;  2G6F X;  5LJ3 g;  5FRO A;  2HQH A;  2CZ0 B;  1PSF A;  4M7A B;  1IXD A;  4LE9 A;  1FMK A;  1TTH B;  1V29 B;  5GAO q;  5LL6 S;  4HCB A;  3TU4 K;  4M78 E;  1YWO A;  3JCM P;  3HRU A;  5GAO p;  2E10 A;  1TU0 B;  2ECZ A;  3A8L B;  4IIM A;  3G4S Q;  3TSW A;  1W6X A;  3L42 A;  4J9B A;  1VQN Q;  1VQP T;  1M4Z A;  3CC7 Q;  5A0D A;  1SHG A;  5GAO n;  1VQ9 Q;  4O5V A;  2NWM A;  2NLU A;  4E7S A;  4M78 G;  5GAO m;  3LX7 A;  5CKB A;  3E2U A;  1AEY A;  3J80 E;  2JOY A;  3PMT A;  4E7K A;  1Q86 R;  1XJW B;  3MEU A;  3TQ7 P;  3PE0 A;  5DLO A;  3I55 T;  2QTV A;  1JJ2 S;  1QKX A;  5GAN g;  2RD1 A;  5KYY A;  1W2B P;  2M02 A;  1PHT A;  2HAX A;  2HCK A;  1BCO A;  1RUW A;  1M30 A;  2OX7 A;  5KYY B;  1YJ9 T;  4M77 D;  4RTX A;  5KYX A;  3VS3 A;  4ANJ A;  2QA4 T;  4FYW B;  2HBP A;  4PJO B;  4Y91 A;  1IGQ A;  3JCM V;  1YJW Q;  2E12 A;  1GXI E;  2YT6 A;  3V8K A;  5KYX B;  2D1X A;  1RLQ C;  2JS2 A;  3DLL A;  3TEE A;  1Y96 A;  2QEX T;  3S3M A;  2X9H A;  2P0P A;  3OY9 A;  3RIR A;  3G6E Q;  4OB0 B;  2E5Q A;  4PKC C;  2EYY A;  1Y96 B;  3NTH A;  1WX6 A;  3SFM A;  4C92 A;  2JMC A;  3CME T;  2VXF A;  1D0Y A;  4BI3 A;  2J6F A;  1X27 A;  3JB9 J;  2RN8 A;  2DF6 A;  4JRQ A;  1KIK A;  2EJF A;  4OMQ A;  2EPD A;  1FWZ A;  2BUD A;  3ZFJ A;  2E70 A;  1JB0 E;  3H8Z A;  2X35 A;  3EH2 A;  3UDC A;  5CIU A;  1RAB B;  3G71 Q;  3C0C A;  1KC8 U;  3H0I A;  2LX7 A;  1Q82 C;  2R5M A;  1M90 R;  3EFR A;  1G5V A;  4OMO A;  1GCQ C;  1TG0 A;  1KSW A;  3QZ5 B;  3OQ5 A;  2AZS A;  1I8F A;  4AT1 B;  4M7D F;  2JJ9 A;  1VQ9 T;  3CPW P;  3HTR A;  3EG0 A;  1KQS A;  1EX4 A;  4L6V 5;  5GJW B;  1UUE A;  2DIG A;  2DTH A;  2DBK A;  3CC2 T;  2RHX A;  2RF0 A;  4CC4 B;  2KVQ G;  1B7T A;  2K7A A;  3X20 B;  1SEM A;  1MNE A;  2BZ8 A;  4O6J A;  1TSF A;  2LQN A;  2KY9 A;  1ZUK A;  2BZY A;  4C5G A;  2FEI A;  4M77 B;  3TRE A;  3JB9 F;  1WXT A;  2HL3 A;  8AT1 B;  4QQD A;  2DEQ A;  3E19 A;  1IRX A;  1B34 A;  5KE3 A;  1BI1 A;  4WCI A;  1G8X A;  2P0Q A;  1AWW A;  2DM1 A;  2VV5 A;  3L2U A;  1X2Q A;  3ER0 A;  2EYX A;  2DBM A;  4AG1 C;  1VQ5 Q;  1YJN A;  1WZO A;  2CH4 W;  3CCV A;  2CYZ B;  4LDW A;  3QDR B;  2DD4 A;  2PVD B;  1AT1 B;  2WSF E;  2XMF A;  4FM4 B;  5HCK A;  2RHZ A;  3L2Z A;  4M78 D;  1QWE A;  1GBR A;  3V8J A;  4OF1 A;  1QP2 A;  3RNJ A;  2ED0 A;  2GTO A;  3P8B B;  1GFC A;  2DTI A;  2EFI A;  3JCM c;  2KXD A;  2PZ1 A;  1D1C A;  4LDV A;  1M3A A;  4IUU A;  5FLX E;  1X6B A;  1K9A A;  2YSQ A;  2LX9 A;  3F70 A;  4OML A;  3CC4 A;  1M1F A;  1PD1 A;  3N5B B;  1IGU A;  1P92 A;  4X1V A;  1JEG A;  1FYN A;  2DTO A;  3WXM B;  4EMK A;  2AT1 B;  4DOV A;  2RQR A;  1WXB A;  1ZA1 B;  4GLK A;  4ZGE B;  1ARK A;  1JXO A;  3ASK A;  1M27 C;  1QVG S;  1TXQ A;  2MAM A;  2XKO C;  4J7I A;  1FMV A;  2CRE A;  2VAS A;  1RAI B;  4XTY A;  1VQO A;  4HCK A;  4J9D A;  2FB7 A;  3PIO A;  3VS6 A;  3H0F A;  1NJI R;  3RMQ A;  4A4G A;  1KHC A;  3E9F A;  4MZM A;  4JZ4 A;  2X4X A;  8ATC B;  1K1Z A;  2V26 A;  4C8Q D;  2C0I A;  2K3Y A;  3I5R A;  1T0J A;  1OOT A;  3QO3 A;  1W2B A;  2ROT A;  5CKE A;  1Q86 U;  5KE2 A;  3VRY A;  2RO0 A;  2KRO A;  1Z9Z A;  1VQK A;  2K4Y A;  3QII A;  2EQM A;  2QQS A;  5LJ3 f;  1N8R U;  2DRK A;  4Z88 A;  2PNI A;  1WPY A;  4M78 A;  2QG9 B;  1RL2 A;  3MO8 A;  4BI8 B;  2AKL A;  3CXC P;  2M0O A;  3CCM A;  2V8J A;  4X9D A;  1X6O A;  3V7S A;  4M78 B;  2F69 A;  3S3N A;  1JO8 A;  4V2S A;  3CBP A;  4ME7 A;  3QG1 A;  5GMK l;  4M75 C;  1EFN A;  3HP9 A;  1SKU B;  1Q81 R;  1BU1 A;  2YLC A;  1D1B A;  2O01 E;  2QGF B;  5ECA A;  3QUI A;  2KYB A;  1K0S A;  1S72 T;  3M58 A;  4MZT A;  1YP5 A;  2XG8 D;  3SHW A;  2R5A A;  3A8M B;  2PUK B;  1MHN A;  1IHV A;  1YCY A;  1YBY A;  3GF5 A;  1XQH A;  3O8V A;  1UFF A;  4C0F A;  4DQ2 A;  3QZ9 B;  4KUL A;  1MGQ A;  1RAD B;  2D8H A;  1R8O B;  4PFP A;  2K57 A;  4RKU E;  5LJ3 d;  5GAN f;  1VUB A;  1IO6 A;  2E6N A;  4BDY A;  1IZ6 A;  5CKD A;  1SG5 A;  3G4S A;  4C8Q A;  2RJC A;  4FL6 A;  2PUO B;  4DBH A;  4KUD K;  2DO3 A;  4E2F B;  2QAZ A;  2YUQ A;  1Q7Y C;  1BI0 A;  2RMO A;  3T9N A;  5KYW A;  4C8Q B;  4RG8 A;  2KRM A;  4ZTF A;  4HT9 A;  4E7Z A;  1ZSG A;  1VQM Q;  1Q82 U;  2P4T A;  2COY A;  4CC7 A;  5KYW B;  2YWW A;  4PJM A;  1Y7X A;  1D1A A;  2EQK A;  1YIJ A;  1K73 U;  5AYF A;  1M1K C;  4ZGD B;  2KDS A;  1JJ2 P;  1I07 A;  4LDY A;  4IUV A;  2DL4 A;  3JV3 A;  5J3B A;  4BI4 A;  5I22 A;  1M8V A;  1BKB A;  2NYS A;  2Y4Y A;  1SPK A;  3S3O A;  3C4S A;  4LN2 A;  1AZG B;  1XOV A;  3CEY A;  1D0Z A;  5CVI A;  4QVD A;  2RQV A;  1VIF A;  1CSK A;  1E6H A;  1NPP A;  3OYH A;  4CRI A;  1N6A A;  4C92 F;  2RQU A;  4HVU A;  1J3T A;  1YJN Q;  1B3Q A;  5GAO l;  4KT0 E;  2HKQ B;  3CCV Q;  2DEU A;  4F7U A;  1MMA A;  3U23 A;  3SWN C;  1TWB A;  4GBQ A;  4OMM A;  4EDU A;  2J7I A;  2LCL A;  1K8A U;  2KR3 A;  1PKT A;  5FU7 B;  3THK A;  2WAC A;  4J9F A;  2KI7 A;  1Z9Q A;  3M57 A;  1Y57 A;  2OTL A;  2DIQ A;  1YI2 A;  2PVO B;  1YWP A;  3CC4 Q;  3JCM Q;  2XIC A;  4DEY A;  1VQ8 A;  2RHY A;  2LTO A;  1RAF B;  1UHF A;  5LJ5 e;  3OYA A;  1QLY A;  2H3E B;  1NLP C;  4Y92 A;  4KH0 B;  2AK5 A;  1WFW A;  4BD3 A;  1LPL A;  3TCJ A;  3EH1 A;  4JS4 A;  1SRM A;  4AFU C;  2M0Y A;  3G71 A;  1R0B G;  4JJD A;  1RAH B;  3UA6 A;  1VQO Q;  3VU3 C;  2JVV A;  5GAN 7;  4QW2 A;  2OTJ T;  3JCM J;  2E4H A;  1UDL A;  4BDZ A;  3QSU A;  4AFS C;  2K9G A;  2DRM A;  2DXU A;  2V8K A;  4R0K A;  2ATC B;  3JB9 I;  4XTW A;  2HBW A;  3CCR A;  2EIF A;  2E3I A;  1PCX A;  3ZEH A;  3GIB A;  4NS5 A;  2VWF A;  2E64 A;  4PJJ A;  4AMC A;  4J5Y A;  4QT7 A;  1WQW A;  4M75 E;  2HZY A;  1VQK Q;  4M7D C;  5A2Q E;  3OYD A;  3CPF A;  1NM7 A;  1MUZ A;  3CMA A;  4J6X A;  1WJR A;  4LD9 K;  3MEW A;  3OBW A;  2D6F A;  3FRN A;  2M1H A;  3CXC A;  3CCM Q;  3RUX A;  3L1A A;  2EQJ A;  2FZG B;  1I0C A;  4VUB A;  2YUN A;  3CCQ A;  2VUB A;  3CD6 A;  3KBG A;  5GMK i;  1YIT Q;  1HYO A;  4BE1 A;  4IUR A;  3H6Z A;  4M75 G;  4EIK A;  2LZ6 B;  2DXT A;  2EW3 A;  1H3Z A;  1EIF A;  2D0Q B;  5IHN A;  3NGP A;  2COW A;  5I2S A;  5I11 A;  4M7A A;  2CP2 A;  4PFZ A;  3UF4 A;  1PC0 A;  2DX1 A;  3M0P A;  1NEB A;  2OAU A;  4EPC A;  1Q81 U;  1BB9 A;  2LMJ A;  3ZL7 C;  1VQL A;  3OYL A;  2QXF A;  1YN8 A;  3QBY A;  3PT9 A;  1U1S A;  4RCB A;  2XID A;  5L8R E;  1PNJ A;  3I5S A;  3V7C A;  4ORZ A;  1QVG P;  1MND A;  5C0M A;  4II1 A;  3I56 T;  3O5Z A;  3OYK A;  2RM4 A;  3OMC A;  7AT1 B;  2VGM A;  3QPH A;  3VS1 A;  1D09 B;  1NE8 A;  4KGV B;  2VVK A;  1R0C B;  2K2V A;  2XI9 A;  2QYZ A;  1AZE A;  4JS5 A;  4A4K A;  3MCA B;  1NLO C;  2XU8 A;  5GAN 5;  2XDD A;  1NG2 A;  4HCZ A;  1YIJ Q;  4E7J A;  1WHM A;  4ZGJ B;  5GAM h;  4BY6 C;  4M78 F;  3KFV A;  1VQ7 A;  5CQX A;  4RMO A;  1UGS B;  2L3S A;  1WHG A;  3FDR A;  2YUO A;  1SF9 A;  2QGG A;  1N8R R;  1X01 A;  3QHS A;  3L2W A;  3CCL A;  2LT4 A;  3HRS A;  4PJO A;  4OB2 B;  2OAW A;  2KAF A;  4CI0 C;  4F14 A;  5FRM A;  2KT8 A;  2GQI A;  3CCJ T;  1ZA2 B;  3V8L A;  1VIE A;  2E5K A;  2DNU A;  3M0Q A;  2KQW A;  2KRS A;  4B9X A;  1K0X A;  1TOV A;  4FT2 A;  5FWC A;  5GAM f;  2GQV A;  3S6W A;  4ZN1 A;  4OP0 A;  1OUL A;  1U5S A;  1WHJ A;  4A54 A;  1TUD A;  4A53 A;  2ZZD A;  2QTX A;  1Q95 G;  2ED1 A;  3Q1J A;  5L23 A;  2O31 A;  2HD0 A;  3URG A;  2EJG A;  2OTL Q;  1YI2 Q;  4C0Z A;  4J83 A;  3DB4 A;  1BK2 A;  2O4X A;  1VQ8 Q;  3VJP A;  4OMN A;  4C8Q F;  4BE0 A;  4N4H A;  1YHQ A;  4JJN K;  1N9S A;  2DL5 A;  3QKJ A;  3UAT A;  2O4X B;  2X4Y A;  5FWB A;  2L3R A;  5GAM j;  5GMK h;  1WGS A;  1I5L A;  3OYB A;  1D0X A;  3A8G B;  2E6Z A;  4M7D E;  1T3L A;  4J9G A;  1N9R A;  1WI7 A;  3G4S T;  4RTZ A;  5GAM d;  1AWX A;  1G3Y A;  1VQ4 A;  4IUQ A;  4PLL A;  1VQN T;  2R58 A;  4ATO A;  1KK7 A;  4M75 D;  4HT8 A;  2IPO B;  2LJ0 A;  1Q82 R;  5GAN 6;  4AFZ C;  3CC7 T;  4OGC A;  3QJ6 A;  2K5I A;  2FL7 A;  3CCR Q;  2C06 A;  4JLG A;  3GLX A;  5KCH A;  5IXF A;  1GL5 A;  3C95 A;  1M9S A;  1S1N A;  1KD1 U;  1K73 R;  3CCE A;  5GAN e;  5GAN 2;  1VQM A;  3L2R A;  1QVF A;  4UC4 A;  4M7D G;  2F5T X;  3GNG A;  2CP7 A;  4M77 A;  2GBQ A;  2DK3 A;  4QQ6 A;  2EYW A;  1AD5 A;  4F7U F;  1HK9 A;  3CMA Q;  1I81 A;  2J6K A;  1KQS S;  2ZPE B;  1D3B A;  2XHC A;  1UGQ B;  3A8H B;  3JB9 G;  4N0A A;  3CCQ Q;  3CD6 Q;  5KYN A;  2K6D A;  1D3B B;  2QDL A;  1I4K 1;  2X3X D;  3CCS A;  1K8A R;  1YJW T;  2CZ7 B;  5IN1 A;  3CCU Q;  5GMK j;  2M16 A;  4JDS A;  3P8H A;  1FX7 A;  2FPF A;  1ZHI A;  4GY5 A;  2LDM A;  1QWF A;  3G6E T;  4J9I A;  4KGZ B;  3OYE A;  1YI2 T;  4C92 C;  3JCM e;  2LCS A;  4MDW A;  2CH4 A;  1K9M U;  1VQL Q;  1AOJ A;  4RG2 A;  4HVV A;  4P5N A;  3M9Q A;  1H3H A;  1PWT A;  1MV3 A;  1UEC A;  2ESW A;  1MMG A;  1YCS B;  2X4J A;  4J9H A;  2DER A;  2CS7 A;  3G71 T;  1QVG A;  5GJV B;  2X3W D;  3FJP A;  4J9E A;  2P0K A;  2HSP A;  1OQK A;  4IIO A;  2KNB B;  5J39 A;  1AWO A;  2NUP A;  3OS1 A;  1UG1 A;  2KBT A;  2E3H A;  2Y4X A;  1RAC B;  1WHL A;  3NMZ C;  1NBE B;  3M4G A;  2JXB A;  3UWN A;  4LDU A;  2NUP B;  2MWO A;  2WSE E;  1WQ7 A;  4TVR A;  4RCC A;  3D7S B;  3OW2 S;  3FIF A;  1VQ7 Q;  1I5O B;  5D6W A;  3M59 A;  2KYM A;  2X4W A;  4R56 A;  2K3B A;  1VQP A;  4F16 A;  1LCK A;  2L3P A;  2LP5 A;  3SB2 A;  3VYG A;  1CKB A;  2YHT A;  1FMW A;  1QVP A;  3CCL Q;  2CZ1 B;  1G2B A;  1V1C A;  2VB6 A;  3CMA T;  4Z89 A;  4JUV A;  3EGU A;  4D8D A;  4Z8A A;  1VYT A;  5KYU A;  2PU9 B;  3NTK A;  1OEB A;  2QQA A;  1RAG B;  2DIL A;  2J05 A;  5D6X A;  4M7A F;  3I55 A;  1M8M A;  2IG0 A;  5KYU B;  2AKK A;  4J6Y A;  3M55 A;  1H64 1;  2BZX A;  5FU6 C;  3C94 A;  2RJE A;  1YIT A;  1VQ5 T;  1ZLM A;  5IHK A;  2HNI A;  3LW5 E;  2EQI A;  1YJ9 A;  3JCM b;  4FU6 A;  1GBQ A;  2ZGW A;  2LQ8 A;  3OMG A;  2QA4 A;  3NHN A;  4XU2 A;  1UJY A;  4LUE A;  1XTD A;  1YHQ Q;  4XAX B;  3SWN A;  2K5F A;  3EHR A;  3QJY A;  2EKO A;  1VQL T;  2YRD A;  2PVG B;  2HEQ A;  2MK5 A;  5GAM g;  3OA6 A;  1PRM C;  2A08 A;  2DLP A;  2GFA A;  1OX9 A;  4EMK C;  3SWN B;  2ENM A;  2COZ A;  1QQJ A;  4PNO A;  1X69 A;  3J7A F;  3EHQ A;  3H0H A;  1QKW A;  4ESR A;  4BAC A;  4X9C A;  1VQ4 Q;  4MMK A;  3CME A;  2JTE A;  1CKA A;  1F1B B;  2RNA A;  1OPL A;  1LOJ A;  1MV0 B;  1M3C A;  1N5Z A;  3BDL A;  2KEA A;  1FXX A;  3A1P A;  4NL3 A;  2KRN A;  3CPW A;  3VS0 A;  2CUD A;  3I35 A;  2MYS A;  2CKK A;  2V8I A;  3CCE Q;  2A0F B;  2C0T A;  4LD6 A;  5FW9 A;  5AT1 B;  3MET A;  4XK8 E;  3PMI A;  4PJO F;  1T3S A;  1IHW A;  1H8K A;  2I0N A;  2A3L A;  2VGN A;  4KH1 B;  3HKS A;  3RBB B;  1I1J A;  2EGE A;  4ELY C;  4PJL A;  1PSE A;  1M3B A;  2KMT A;  1OYX A;  2D0N A;  1KG1 A;  2FHD A;  1HXD A;  4L59 A;  2E1H A;  3I9Q A;  1AWJ A;  2BIV A;  2DYI A;  4X34 A;  4C92 E;  3E1S A;  4QVC A;  2DFU A;  2E65 A;  4XTV A;  2XK0 A;  4J6W A;  4WTO B;  3JCM h;  2BE9 B;  3CC2 A;  4M78 C;  1WLP B;  4XTX A;  5A0G A;  1C1A A;  2CSQ A;  3QWX X;  2FRY A;  3CCS Q;  3HFN A;  2O2O A;  2KXC A;  3EGX A;  1ACM B;  3EFS A;  5HK0 A;  4BB7 A;  1K76 A;  1BCM A;  3VUB A;  2NUT A;  2V1Q A;  2JMA A;  3PNW C;  3RMS A;  4C92 G;  3EGX B;  1VA7 A;  1TS9 A;  2EQU A;  2A28 A;  2FZC B;  3BE3 A;  2D9T A;  3DB3 A;  1UEB A;  4MZP A;  2NUT B;  4OVA A;  2EKH A;  4CC3 A;  4IUT A;  1YHQ T;  2O88 A;  2K79 A;  4LUD A;  3OYM A;  3SDZ A;  3X24 B;  1RAA B;  2VXE A;  3BDU A;  1KC8 C;  4PK4 A;  1ABO A;  4KUI A;  2JTM A;  3EFO B;  3VS7 A;  3NTI A;  2RJF A;  4C8Q C;  1KQ1 A;  4FIB A;  3R6O A;  5FRN A;  4M77 F;  3EG9 B;  1KD1 R;  1E6G A;  3M0R A;  1KJW A;  2G3R A;  4C0G A;  2A36 A;  4L5G A;  3FC3 A;  4MDX A;  1M2V A;  2ZPI B;  1QCF A;  1VQM T;  5CAI A;  1RI9 A;  1XNI A;  2FPE A;  1UJ0 A;  1VQP Q;  2M9U A;  2L89 A;  5CK9 A;  3REA B;  1M2V B;  4B6M A;  3PVL A;  2NUZ A;  4FYX B;  5I21 A;  5HKC A;  3OS2 A;  1KQS P;  1YFN A;  1OX8 A;  1TUC A;  1G3W A;  3I55 Q;  3PTA A;  3OS0 A;  3OYJ A;  3HHT B;  3MP1 A;  1O75 A;  2GF7 A;  3LH0 A;  4ELZ C;  1O9S A;  1KQ2 A;  2CDT A;  3MJX A;  3OS5 A;  4R55 A;  4J9C A;  4BY6 B;  1YJN T;  1M1G A;  3CCV T;  2YDL A;  3KXT A;  5FU7 C;  4RTU A;  2DXC A;  4JRK A;  2KE9 A;  1YJ9 Q;  5EC7 A;  1U3O A;  3RKY A;  2HMA A;  3CCU A;  3H9N A;  4HCC A;  3L2V A;  2QA4 Q;  2EYQ A;  1K9M R;  1TH7 A;  1LJO A;  1ZSZ C;  2ZPH B;  4F17 A;  3WVE B;  4C5I A;  3MKD A;  2DVJ A;  1OU8 A;  1UGP B;  6AT1 B;  3KUF A;  1PKS A;  4DBR A;  3CC4 T;  1HJD A;  5GAO r;  3ZBD A;  1T0H A;  2R57 A;  2HQE A;  2JM9 A;  2EBP A;  3X25 B;  1G3T A;  2L3Q A;  3EG1 A;  1LNX A;  3CME Q;  2DZ9 A;  2CP6 A;  4WF2 A;  5DY9 A;  2RQT A;  4OMP A;  3CBO A;  1S72 A;  2XD0 A;  2JNG A;  1VQO T;  3E9G A;  2HQX A;  3HFO A;  3CQT A;  2LQW A;  3VKI A;  4KBM B;  4C92 D;  2DKG A;  2EGA A;  2DET A;  5IAY A;  3OW2 P;  4D8K A;  5CKF A;  4JRI A;  1JJ2 A;  1W1F A;  1IRE B;  1GCQ A;  4ZN3 A;  2JN0 A;  4PL6 A;  1Q7Y U;  1UGR B;  3RKX A;  3H41 A;  3RER A;  1QMC A;  3G1J A;  1Q86 C;  2LCC A;  3OYC A;  3LGF A;  1RAE B;  3QXE B;  4OMF B;  5CQY A;  3EGD A;  4C0D C;  4BE2 A;  2BTT A;  1A0N B;  1C6V X;  1OV3 A;  1WIE A;  1WA7 A;  3VRZ A;  1VQK T;  3V7R A;  3CC2 Q;  4HA8 A;  2L0A A;  2H3J A;  3EGD B;  4XU3 A;  1N8R C;  1QCO A;  1M1K U;  2DJQ A;  2K5L A;  2JS0 A;  5D7U A;  3CCM T;  2QAS A;  1BBZ A;  5LJ5 h;  4C5E A;  2L8D A;  2PQW A;  1KHI A;  4A63 B;  1YIT T;  2PTK A;  1JQQ A;  2LT1 A;  4ZTJ A;  3R6N A;  1LVK A;  5DM7 R;  2B86 A;  4QKU A;  4C8Q E;  4ZNX A;  1GCP A;  1WHH A;  2BE7 D;  2RI5 A;  3VYH B;  3MHX A;  2P84 A;  5LJ3 e;  4JZ3 A;  1PG5 B;  4M7A C;  4B9W A;  1AHJ B;  4FSS A;  2GGR A;  1TUG B;  3MEV A;  2JZ2 A;  2F1L A;  3MEA A;  4A4H A;  5GAN 8;  2DZC A;  2DXB A;  3UA7 A;  1AVZ C;  3VS4 A;  4JPB W;  3BW1 A;  5LJ5 f;  4HXJ A;  2CP5 A;  3OYI A;  1PM3 A;  1KFZ A;  4C8Q G;  2D8J A;  2MMP A;  5CCA A;  3GOX A;  5KH6 A;  1MMD A;  2QI2 A;  2XDB A;  1E7O A;  2O9S A;  2QK0 A;  3JSC A;  3UT1 A;  5CR2 A;  3JCM g;  1Y07 A;  4C92 B;  4AFQ C;  1U06 A;  1M90 C;  4XTZ A;  4N4G A;  2W10 A;  2MCN A;  3CBM A;  5IXB A;  3OSS C;  1SRL A;  3M54 A;  1G83 A;  2RB6 A;  1VQ6 A;  4F7U E;  3VS2 A;  4KRT A;  3RR6 A;  1YIJ T;  2LQK A;  5LJ5 j;  2KSS A;  1K73 C;  1DJ7 B;  2OTJ A;  2DE0 X;  4XU0 A;  2RHI A;  2MWP A;  2LVM A;  3M0S A;  3JAM E;  5LJ5 d;  4DBF A;  2CSI A;  4MML A;  3PFS A;  5KCO A;  1ZBJ A;  3WVD B;  4PJO C;  2HDA A;  3L2Q A;  2QQB A;  4CC2 A;  2BKD N;  4F7U G;  1OI1 A;  2MPX C;  9ATC B;  2DPP B;  1QVF S;  5A0L A;  4OGE A;  1EZZ B;  3HSB A;  1WHK A;  4DBQ A;  1X75 C;  4Y28 E;  3NPF A;  2YLB A;  3GBQ A;  3M5A A;  4IKF A;  2DAQ A;  2MOX A;  4A4F A;  3LYI A;  1K8A C;  4JLI A;  2CP0 A;  2RHU A;  2DVE A;  4XU1 A;  3QYG B;  3X28 B;  2FRW A;  4E7I A;  3TVT A;  1B34 B;  3DKM A;  3VS5 A;  2JW4 A;  2OTL T;  1ZQ1 A;  2ZPB B;  1R77 A;  3EAE A;  3LWH A;  3NFC A;  2B8A A;  1UB4 A;  3QYH B;  4NL2 A;  1VQ8 T;  2A7Y A;  1ZUU A;  5C6S A;  2RPN A;  2DL3 A;  3PGG A;  2C0O A;  2K3X A;  2M51 A;  2ABL A;  4M75 A;  3JCM W;  5FU6 B;  1GFD A;  1PRL C;  2Z0W A;  1ZX6 A;  2LC4 A;  2RI3 A;  5DLQ E;  1S72 Q;  2FG0 A;  2EVR A;  4M75 B;  2AHJ B;  4D6W A;  3M0T A;  4DEX A;  1X2K A;  3A98 A;  2MIO A;  3OW2 A;  3CCR T;  2SRC A;  2CT4 A;  2FYK A;  1HD3 A;  3PVQ A;  5CO7 A;  5M9O A;  4EMK B;  3EG3 A;  1NJI C;  2RI2 A;  5CKH A;  3MPU B;  3IQL A;  3LH5 A;  4M77 C;  3I56 A;  2O9V A;  1MMN A;  2CGH A;  2JTF A;  2W0Z A;  1C0M A;  2VKN A;  1WDX A;  1UE9 A;  3HRT A;  1M5Q 1;  1NZ9 A;  5LJ3 h;  4M7A E;  5J26 A;  2QQR A;  4GLM A;  1V76 A;  3RKW A;  4RUG A;  1WXU A;  3FEO A;  2AIR B;  3G7Z A;  2HSE B;  4N0A C;  4J7F A;  2EYZ A;  1JXM A;  3FJ5 A;  3CCQ T;  3CD6 T;  1UHC A;  2J06 A;  4FW2 A;  1W2B S;  1VYU A;  2FZK B;  2Y90 A;  4J8O A;  2CZ6 B;  2QDY B;  3GPL A;  4FCY A;  5HK3 A;  4M7A G;  3CCU T;  2JUF A;  2RH2 A;  2XDP A;  4A4E A;  2ROL A;  3RDV A;  3MP6 A;  3CCJ A;  2RK1 A;  5I2M A;  3BFM A;  2GNC A;  2LJ1 A;  2LJ3 A;  4DOW A;  2GCX A;  4M7D D;  5IH2 A;  1U1T A;  2DJZ A;  1Q81 C;  1G3S A;  3RES A;  2L5Q A;  5IHI A;  4BUG A;  4C5H A;  1NYF A;  1VOM A;  2QEX A;  2I2L A;  2KK4 A;  4E47 A;  5GAN h;  1M2O A; 
#chains in the Genus database with same CATH homology
 2VV5 A;  4FSX A;  3L2U A;  4RMO A;  1UGS B;  3ER0 A;  2G3R A;  3FDR A;  4Q5W A;  4C0G A;  3FC3 A;  4L5G A;  4MDX A;  4QQG A;  1W4S A;  3OYG A;  2ZPI B;  1X01 A;  3HL8 A;  3QHS A;  5D6Y A;  3L2W A;  3JB9 D;  1VQM T;  5CAI A;  1XNI A;  1YJN A;  3CCL A;  3CCV A;  2LT4 A;  2CYZ B;  2EJ9 A;  3HRS A;  4LDW A;  2M9U A;  2L89 A;  3FB9 A;  3QDR B;  2DD4 A;  4OB2 B;  5CK9 A;  4PJO A;  2PVD B;  2KAF A;  2WSF E;  4CI0 C;  4FM4 B;  5LJ3 j;  3OYN A;  1VQ7 A;  5FRM A;  2RHZ A;  4PJO E;  3CCJ T;  3L2Z A;  4M78 D;  3V8L A;  1VIE A;  3V8J A;  4OF1 A;  1QP2 A;  2KQW A;  4B9X A;  4FT2 A;  2ZPG B;  5I21 A;  2IVW A;  5GAM f;  2GQV A;  3S6W A;  3P8B B;  2EFI A;  2DTI A;  1BI2 A;  3JCM c;  5HKC A;  4LDV A;  2EAY A;  4ZN1 A;  5LJ5 g;  4IUU A;  3OS2 A;  4OP0 A;  5FLX E;  3UPU A;  4A54 A;  3OYF A;  4A53 A;  2ZZD A;  2LX9 A;  2QTX A;  3F70 A;  1G3W A;  3Q1J A;  1VQ7 T;  3CC4 A;  3BY7 A;  3C12 A;  3PTA A;  2HD0 A;  3OS0 A;  1M1F A;  3OYJ A;  3HHT B;  3MP1 A;  1O75 A;  2GF7 A;  3N5B B;  1P92 A;  4XQ3 A;  4E7L A;  1M90 U;  3LH0 A;  5EG2 A;  4ELZ C;  3URG A;  2EJG A;  1O9S A;  2MI6 A;  3SD4 A;  1KQ2 A;  2DTO A;  3WXM B;  4PJO G;  4EMK A;  3OS5 A;  4DOV A;  4C0Z A;  4R55 A;  3CC7 A;  4J83 A;  3CPW S;  3DB4 A;  4BY6 B;  2VYT A;  1VQ9 A;  2O4X A;  3CCL T;  1YJN T;  3VJP A;  1M1G A;  4C8Q F;  4GLK A;  3VV0 A;  4NOY A;  3ME9 A;  3KXT A;  4N4H A;  5FU7 C;  3CCV T;  4ZGE B;  4Z02 A;  1OZ3 A;  2DXC A;  3ASK A;  4JRK A;  1QVG S;  1YHQ A;  4JJN K;  2MAM A;  2QQ9 A;  1N9S A;  2XKO C;  4J7I A;  3QKJ A;  3RKY A;  3CCU A;  2O4X B;  4XTY A;  1VQO A;  4HCC A;  3L2V A;  2FB7 A;  3PIO A;  2EYQ A;  2ZCF B;  2F5K A;  1TH7 A;  2X4Y A;  2L3R A;  3J81 E;  5GAM j;  1LJO A;  5GMK h;  2ZPH B;  1WGS A;  1I5L A;  3OYB A;  3WVE B;  3RMQ A;  4M7D A;  4A4G A;  1KHC A;  4C5I A;  5GAN j;  2DD5 A;  2E6Z A;  3A8G B;  3LGL A;  3E9F A;  4MZM A;  3G4S T;  4M7D E;  1N9R A;  2X4X A;  1UGP B;  3KUF A;  4C8Q D;  2K3Y A;  2E41 A;  3CC4 T;  5GAO r;  4HKE A;  5GAM d;  3ZBD A;  1VQ4 A;  1G3Y A;  3DLM A;  4IUQ A;  4M7D B;  4PLL A;  1VQN T;  2R58 A;  4M7D G;  4ATO A;  4JRP A;  3INZ A;  3QO3 A;  1W2B A;  4M75 D;  5GAN d;  4HT8 A;  2R57 A;  5CKE A;  2WSC E;  2HQE A;  5GAN 6;  1Q86 U;  3CC7 T;  4OGC A;  3X25 B;  3QJ6 A;  5KE2 A;  1G3T A;  2K5I A;  2FL7 A;  3JCM f;  1BIA A;  2C06 A;  4JLG A;  3GLX A;  5KCH A;  5IT9 E;  1LNX A;  2DZ9 A;  5GAM e;  2RO0 A;  3C95 A;  1M9S A;  4WF2 A;  3MP8 A;  3OBY A;  5DY9 A;  4EMG A;  1KD1 U;  3CCE A;  1VQK A;  1JBM A;  5GAN e;  2K4Y A;  3QII A;  5GAN 2;  3CBO A;  1YJW A;  1S72 A;  1VQM A;  2XD0 A;  3L2R A;  1QVF A;  2JNG A;  2EQM A;  2QQS A;  4UC4 A;  3E9G A;  1VQO T;  5LJ3 f;  2YRV A;  2HQX A;  2F5T X;  3GNG A;  1N8R U;  3HFO A;  1WPY A;  4M77 A;  4F7U B;  4M78 A;  2DK3 A;  5GAN 4;  3VKI A;  4M77 E;  1RL2 A;  3MO8 A;  4QQ6 A;  4BI8 B;  4DA4 A;  2M0O A;  2FVU A;  4F7U F;  4KBM B;  3CCM A;  1HK9 A;  2V8J A;  3G6E A;  4C92 D;  2DKG A;  5GAN 3;  4X9D A;  1I81 A;  1X6O A;  3V7S A;  4M78 B;  2VC8 A;  2F69 A;  5IAY A;  2LRQ A;  3LLR A;  1Y71 A;  3S3N A;  1VQ4 T;  1KQS S;  2ZPE B;  2GFU A;  1D3B A;  5CKF A;  4JRI A;  1JJ2 A;  2XHC A;  1IRE B;  4ZN3 A;  3JCM X;  4V2S A;  2JN0 A;  3GNF B;  3CBP A;  4ME7 A;  1OZ2 A;  3QG1 A;  4PL6 A;  5GMK l;  4M75 C;  3HP9 A;  1Q7Y U;  4OB3 B;  1UGQ B;  1UGR B;  2ZPF B;  3A8H B;  3RKX A;  3RER A;  3JB9 G;  4N0A A;  3VUZ A;  1Q86 C;  2LCC A;  3X26 B;  2YLC A;  4EMH A;  3OYC A;  3LGF A;  1D3B B;  2O01 E;  3QXE B;  4OMF B;  5CQY A;  4C0D C;  4BE2 A;  3QUI A;  1VQK T;  1QP3 A;  3CCE T;  4M77 G;  1I4K 1;  4OB1 B;  3M53 A;  1VQ6 T;  1BYM A;  3V7R A;  3CCS A;  4QVZ A;  1KD1 C;  1YJW T;  4HA8 A;  1S72 T;  1WNL A;  2CZ7 B;  3M58 A;  4MZT A;  2H3J A;  5IN1 A;  5GMK j;  2XG8 D;  3A5Z B;  3JCM d;  2RJD A;  2M16 A;  1QW1 A;  2R5A A;  3A8M B;  1JRI A;  2LNV A;  2PUK B;  3P8H A;  4JDS A;  4XU3 A;  1MHN A;  1N8R C;  1FX7 A;  1M1K U;  1YCY A;  1ZHI A;  3OB9 A;  4GY5 A;  1YBY A;  3M4Y A;  3GF5 A;  1XQH A;  2K5L A;  2EWN A;  2LDM A;  3O8V A;  3CCM T;  3G6E T;  4C0F A;  4DQ2 A;  3QZ9 B;  1YI2 T;  4KUL A;  3OYE A;  1MGQ A;  4C92 C;  4RKU E;  1R8O B;  4C5E A;  2K57 A;  2L8D A;  5LJ3 d;  2PQW A;  5LJ5 h;  3JCM e;  1KHI A;  4MDW A;  1VUB A;  5GAN f;  3AHU A;  2E6N A;  1YIT T;  1K9M U;  4BDY A;  1IZ6 A;  5CKD A;  2LT1 A;  4ZTJ A;  3G4S A;  4C8Q A;  4RG2 A;  1NJI U;  2RJC A;  5DM7 R;  4E7H A;  4FL6 A;  4P5N A;  3M9Q A;  2PUO B;  4C8Q E;  3PIP A;  1SSF A;  5GMK e;  4KUD K;  1ZBX A;  2DO3 A;  2RI5 A;  1WJS A;  5GMK m;  1Q7Y C;  1BI0 A;  3VYH B;  3MHX A;  5LJ3 e;  2X4J A;  3T9N A;  4M7A C;  4B9W A;  4RG8 A;  4C8Q B;  1AHJ B;  3OSV A;  2CS7 A;  4ZTF A;  3CCS T;  3G71 T;  1QVG A;  3MEV A;  4HT9 A;  2JZ2 A;  1WJQ A;  3FJP A;  1Q82 U;  2P4T A;  3MEA A;  4A4H A;  5GAN 8;  2DZC A;  2DXB A;  2P0K A;  3LWI A;  3FLG A;  3BW1 A;  4XTU A;  5LJ5 f;  1Y7X A;  5J39 A;  4M75 F;  4C0D B;  2EQK A;  1RI0 A;  4N4I A;  1YIJ A;  1K73 U;  5AYF A;  3OYI A;  4ZGD B;  3OS1 A;  1M1K C;  2KDS A;  4LDY A;  2Y4X A;  4LDX A;  4C8Q G;  4IUV A;  3HPW A;  5J3B A;  2MMP A;  5CCA A;  3CXC S;  4BI4 A;  3M56 A;  3M4G A;  3GOX A;  1M8V A;  2RA2 A;  3UWN A;  1BKB A;  2Y4Y A;  4LDU A;  2MWO A;  4YTL A;  2WSE E;  2QI2 A;  1WQ7 A;  1BI3 A;  3C4S A;  5KH6 A;  3S3O A;  2XDB A;  3A8O B;  1K9M C;  3OYY A;  4TVR A;  1XOV A;  3CEY A;  4RCC A;  3JSC A;  3UT1 A;  3OW2 S;  5CVI A;  3FIF A;  4QVD A;  4PJO D;  5CR2 A;  3JB9 H;  4FT4 A;  5D6W A;  1U8R A;  1VQ5 A;  3M59 A;  2X4W A;  5HY6 A;  1VIF A;  4R56 A;  1BIB A;  1Y07 A;  2RK2 A;  4PLI A;  3JCM g;  4C92 B;  3P8D A;  1VQP A;  1N27 A;  1VQN A;  1NPP A;  3OYH A;  1M90 C;  4XTZ A;  3SB2 A;  4N4G A;  4IUP A;  3VYG A;  3CBM A;  4CRI A;  1N6A A;  4C92 F;  2YHT A;  3GP8 A;  1QVP A;  2MF2 A;  2CZ1 B;  3OSS C;  4KT0 E;  5GAO l;  4F7U A;  3JRZ A;  1NPR A;  3SWN C;  3M54 A;  5LJ3 g;  5FRO A;  3CMA T;  2RB6 A;  1VQ6 A;  4JUV A;  4F7U E;  2CZ0 B;  1PSF A;  4EDU A;  2LCL A;  4M7A B;  1YIJ T;  2LQK A;  5LJ5 j;  2PU9 B;  3NTK A;  2QQA A;  1V29 B;  2KSS A;  5GAO q;  1K73 C;  1K8A U;  1DJ7 B;  5LL6 S;  2OTJ A;  5D6X A;  4HCB A;  4XU0 A;  3TU4 K;  2RHI A;  4M7A F;  4M78 E;  2MWP A;  2LVM A;  3I55 A;  5FU7 B;  3JCM P;  2IG0 A;  3HRU A;  2WAC A;  3JAM E;  3M57 A;  2E10 A;  5LJ5 d;  5GAO p;  3A8L B;  4J6Y A;  3M55 A;  2OTL A;  1H64 1;  2DIQ A;  1YI2 A;  5FU6 C;  3L42 A;  3C94 A;  4MML A;  2PVO B;  3PFS A;  5KCO A;  2RJE A;  2XIC A;  3WVD B;  3JCM Q;  4PJO C;  1YIT A;  1VQ5 T;  3L2Q A;  2QQB A;  1VQ8 A;  2RHY A;  2LTO A;  1VQP T;  2HNI A;  2BKD N;  3LW5 E;  1M4Z A;  4F7U G;  1OI1 A;  5LJ5 e;  3OYA A;  1YJ9 A;  3JCM b;  5A0D A;  2DPP B;  4FU6 A;  5GAO n;  1QVF S;  5A0L A;  4OGE A;  4BD3 A;  2ZGW A;  4O5V A;  3HSB A;  3TCJ A;  2NLU A;  4JS4 A;  2LQ8 A;  3OMG A;  2QA4 A;  1X75 C;  4XU2 A;  4M78 G;  4Y28 E;  5GAO m;  1XTD A;  3LX7 A;  5CKB A;  3G71 A;  4XAX B;  2YLB A;  3M5A A;  3SWN A;  2K5F A;  2JOY A;  3PMT A;  3J80 E;  3QJY A;  2EKO A;  2DAQ A;  4E7K A;  1VQL T;  4IKF A;  2PVG B;  3VU3 C;  2JVV A;  5GAN 7;  3MEU A;  4QW2 A;  4A4F A;  2OTJ T;  3LYI A;  3JCM J;  5GAM g;  5DLO A;  3OA6 A;  1K8A C;  4JLI A;  3I55 T;  4BDZ A;  2RHU A;  3QSU A;  2GFA A;  2DVE A;  4XU1 A;  3QYG B;  3SWN B;  3X28 B;  4EMK C;  1JJ2 S;  5GAN g;  4E7I A;  1B34 B;  2DXU A;  3DKM A;  2RD1 A;  1ZQ1 A;  2OTL T;  4PNO A;  2ZPB B;  3J7A F;  2V8K A;  2HAX A;  3EAE A;  3JB9 I;  4XTW A;  3NFC A;  4X9C A;  3LWH A;  2B8A A;  4BAC A;  1UB4 A;  3CCR A;  2EIF A;  3QYH B;  4MMK A;  4NL2 A;  1VQ8 T;  2A7Y A;  3ZEH A;  3CME A;  3GIB A;  4NS5 A;  5C6S A;  1LOJ A;  3BDL A;  2E64 A;  1YJ9 T;  1FXX A;  3PGG A;  4M77 D;  4NL3 A;  2K3X A;  3CPW A;  4J5Y A;  4M75 A;  3JCM W;  5FU6 B;  1WQW A;  4M75 E;  2QA4 T;  2CKK A;  2HBP A;  2V8I A;  4Y91 A;  4PJO B;  2LC4 A;  4M7D C;  2RI3 A;  4LD6 A;  5DLQ E;  3JCM V;  5A2Q E;  3OYD A;  2E12 A;  1GXI E;  3V8K A;  3CPF A;  3MET A;  4M75 B;  4XK8 E;  3PMI A;  4PJO F;  3DLL A;  2AHJ B;  3CMA A;  4J6X A;  3TEE A;  1Y96 A;  2QEX T;  1WJR A;  3S3M A;  4D6W A;  4LD9 K;  2A3L A;  3MEW A;  2VGN A;  3OBW A;  2D6F A;  2P0P A;  3FRN A;  3HKS A;  2M1H A;  3CXC A;  4ELY C;  1PSE A;  3RUX A;  3RIR A;  3L1A A;  2EQJ A;  3OY9 A;  4OB0 B;  2KMT A;  1OYX A;  2E5Q A;  4PKC C;  1Y96 B;  1KG1 A;  3NTH A;  4VUB A;  2FHD A;  1HXD A;  4L59 A;  3SFM A;  2E1H A;  3OW2 A;  3CCQ A;  2VUB A;  3CD6 A;  2BIV A;  3KBG A;  3CCR T;  4X34 A;  4C92 A;  5GMK i;  4BE1 A;  4IUR A;  3H6Z A;  4M75 G;  2VXF A;  3CME T;  4BI3 A;  4C92 E;  3E1S A;  2FYK A;  4QVC A;  2DXT A;  5CO7 A;  3JB9 J;  2E65 A;  4XTV A;  2XK0 A;  4EMK B;  5M9O A;  1NJI C;  2RI2 A;  4J6W A;  3CC2 A;  3JCM h;  5CKH A;  4JRQ A;  1H3Z A;  1EIF A;  2D0Q B;  4M77 C;  3I56 A;  2EJF A;  4M78 C;  1FWZ A;  2BUD A;  4XTX A;  5I2S A;  5A0G A;  3ZFJ A;  2E70 A;  2CGH A;  2JTF A;  1JB0 E;  3H8Z A;  4BE0 A;  2X35 A;  3UDC A;  5CIU A;  1KC8 U;  4M7A A;  3HRT A;  3HFN A;  1Q81 C;  1M5Q 1;  1NZ9 A;  5LJ3 h;  4M7A E;  2OAU A;  4EPC A;  5J26 A;  3EFS A;  1Q82 C;  2R5M A;  5HK0 A;  1Q81 U;  2QQR A;  3EFR A;  4BB7 A;  3RKW A;  1G5V A;  3VUB A;  1VQL A;  3PNW C;  3RMS A;  3FEO A;  4C92 G;  3G7Z A;  3QZ5 B;  3OYL A;  4N0A C;  2EQU A;  2QXF A;  4J7F A;  3OQ5 A;  3QBY A;  1I8F A;  3PT9 A;  1U1S A;  4RCB A;  4M7D F;  3CCQ T;  2XID A;  2D9T A;  5L8R E;  3CD6 T;  3DB3 A;  1UEB A;  1VQ9 T;  4MZP A;  1KQS A;  1W2B S;  4OVA A;  2Y90 A;  3V7C A;  4J8O A;  4L6V 5;  2CZ6 B;  2DIG A;  2DTH A;  2QDY B;  3GPL A;  4IUT A;  1YHQ T;  3CC2 T;  2RHX A;  5HK3 A;  5C0M A;  4II1 A;  4M7A G;  3I56 T;  3OYK A;  2RM4 A;  2KVQ G;  3CCU T;  2JUF A;  2RH2 A;  2VGM A;  2XDP A;  3OMC A;  3OYM A;  3SDZ A;  3QPH A;  4A4E A;  3X20 B;  1NE8 A;  3MP6 A;  3X24 B;  3CCJ A;  2RK1 A;  5I2M A;  3BFM A;  2K2V A;  2VXE A;  4O6J A;  4DOW A;  3BDU A;  2XI9 A;  1KC8 C;  2KY9 A;  2GCX A;  4M7D D;  4M7A D;  4KUI A;  1U1T A;  4A4K A;  2JTM A;  2DJZ A;  3MCA B;  4JS5 A;  4C5G A;  4M77 B;  3TRE A;  3JB9 F;  2XU8 A;  5GAN 5;  2XDD A;  3NTI A;  1G3S A;  2RJF A;  4QQD A;  2L5Q A;  4HCZ A;  3RES A;  4C8Q C;  2DEQ A;  1KQ1 A;  3E19 A;  4FIB A;  4BUG A;  4C5H A;  3R6O A;  4E7J A;  1B34 A;  5KE3 A;  1BI1 A;  4ZGJ B;  5GAM h;  4M77 F;  5FRN A;  4BY6 C;  4M78 F;  2QEX A;  2P0Q A;  2I2L A;  2KK4 A;  4E47 A;  5GAN h;  5CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...