3E1IA

Crystal structure of bbetad432a variant fibrinogen fragment d with the peptide ligand gly-his-arg-pro-amide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
QLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Fibrinogen variant BbetaD432A has normal polymerization but does not bind knob "B".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3e1iA00
1RE4C 1M1JC 1N73A 1FZEA 2HODB 2XNXA 2A45H 1RF1C 1JY2N 2FFDC 1LWUC 1FZCA 1M1JB 3GHGC 1RF0C 2H43A 1LTJA 1RF1B 1FZBA 1LT9A 1FZFA 1LWUB 2FFDB 3HUSA 1N73C 2OYIC 3GHGB 1RE3A 3H32A 2HPCB 1JY3P 1FZCC 2OYIB 1W2EA 1N73B 1JY3N 1JY2O 1LTJC 2OYHA 2A45G 2HLOA 1FZCB 1LT9C 3BVHA 1T3UA 2HODA 1FZAA 3HUSC 1RE3C 1LTJB 1LT9B 3E1IA 3HUSB 1RE4A 1M1JA 2A45I 1RF1A 1N86A 3H32B 2OYHC 2FFDA 1LWUA 3GHGA 1FZGA 2Z4EA 1RF0A 1JY3O 2HPCA 2Q9IA 2OYHB 2OYIA 1JY2P
chains in the Genus database with same CATH superfamily
3TGUE 5BU8B 4PJ0H 3L37A 2W8ZA 5KLVD 3AE7C 1OZHA 3H1LJ 2OARA 3L72J 3B5NC 1LTAC 1U57A 1HJ0A 3BCCJ 4H13C 1ZV8A 1FZBA 1DD3A 3IAOA 2BCCG 1W2EA 2WPVB 4HH2A 1NU1D 2L5GB 1N86A 4IFMA 2V4HA 3A0BH 2N1TB 1K04A 2ZXXA 3MUDA 3TNUA 3WMM0 1XTGB 1N7LA 1Q81Q 3CXHH 3E7KA 1YJWP 1NGMB 4I7ZC 2IBZI 3L70E 1EQ7A 4Z1MH 1NTKE 3F5HA 3CXHI 3RK2D 3H1IG 2IDBA 3PRJA 2JEEA 1RF1B 1JCCA 2RH0A 2P7JA 3AE5C 1NTMG 3MIWA 1PFIA 1GTWA 3L73E 2G8YA 2IFMA 1LTJC 4WWIA 1L0LE 2K88A 1G2CA 4HB1A 1FJKA 2LR2A 1EDKA 1SQVK 1FZGA 4YXDC 1U7JA 4TLFA 1GW3A 4LGDE 1KILD 5APWA 3HE4A 1VQPP 2JWAA 1JMBA 3H6PA 2YXRB 4WY4A 3AEFC 1Y9BA 3H1LG 3CWBE 1GK4A 2SPZA 3B5NB 2H8PD 1URQC 1JO5A 1SQBG 2KNCA 4C46A 4EDFA 4GT1A 3AEEC 4H13B 1JUNA 2A06D 1SQBK 4D6TG 2XU6A 1L4AC 3S1KA 4BXLA 1ZR2A 4CPGA 4M3LA 5KLVJ 1BE3D 3L75G 1AVOA 1DEBA 2E75B 1GL2B 4R4MA 2E74B 1GK6A 1FZCA 3MGNA 5GTHH 3OW2O 2WSSH 2FYUK 5KAFH 2OYHA 4KJMA 5CCGA 1WMKA 1KYOH 1NYHA 4H44D 1N7SD 4I7ZB 5K5GB 3CCSP 3CX5E 1NU1J 2ZXEB 3L71G 1EZVG 1NKZB 1JMMA 4JBZA 1S9KD 3VYIA 5KKZC 3AEDC 1LTJB 1KQGB 1QL2A 1SQVE 3GHGA 4AQRD 4I2LC 2W27A 2Y0CA 1PPJD 1KQSO 5CCHC 3CCRP 1PV3A 2HR3A 2WPQA 3T97A 3CC4P 2QIWA 2J5UA 1CZQA 3G4SP 4N78E 4A7PA 1SQPD 2H89C 3CC2P 2OTJP 3L74J 1URQB 1SQBE 4AUWA 4DCKA 1SQXG 1T8ZA 4UB6H 3CMEP 1L4AB 1FBMA 4EYYQ 1JCDA 1PGJA 4PD4H 5KLVG 1RE4C 1BCCG 4UB8H 2GUVA 3KYQA 1LWUC 3Q1MA 1N2DC 1KB9D 2OTLP 1FDMA 4TT3H 2FYUE 3V2NA 5E79E 3AEAC 2O3JA 2Y9ZA 2BEQD 4JYCA 4PD4I 3II6A 5KJ7C 1EDIA 3C1LA 2NPSA 1NTKD 2YMKA 3VMZA 5BU5A 5B66E 4C7NB 3VP9A 4U3FD 3H1KD 1BE3J 2QSIA 5L8RJ 3L71E 3PTZA 3JC22 1FZAA 5KKZB 2WQYC 2XNDH 2KZIA 2KXPB 3P8MC 2Z5IA 1QGKB 2Y0EA 2WSEJ 1YJNP 4QMAA 1WT6A 5TISH 3M0DA 1CI6A 5APYA 3FGAD 2OTKE 2KP8A 3TDKA 5H2FE 1DH3A 5AW0B 4RKUJ 2KSEA 1GU5A 2M0BA 2J58A 2FKWB 1Y47A 3Q5SA 3CPWO 1JY2O 1NO4A 2BEZF 1S4XA 1FE6A 1OMIA 3VTPC 3BASA 5CBNA 1NTZG 4L76A 5CMZA 1IK9A 1P84E 1LWUB 4B86A 3A0HH 1KV4A 1SQPJ 2OYOA 1LTIC 4DT0A 1K8AQ 1GZLA 4KT0J 1S5LH 3MD0A 2ZVNB 2HFED 3V5BA 1M1JC 2A06G 4JQ0D 1AVYA 2E76C 5CCGD 1QLED 1IC2A 3P7KA 3AE9C 1T3JA 1YHQP 1OW6A 1PL5A 2P10A 2OQQA 3GMAA 1QEXA 2RN0A 3AEBC 1W5CE 2KI7B 1NTKJ 1IFMA 1ZN5A 1YYCA 2I1KA 1EXJA 4U3FJ 1ZXGA 3H1KJ 3G71P 4IL6H 2QA4P 1VQLP 1VQ6P 5DJTB 3B71A 1L0LJ 2I1JA 1TU3F 1YQ3C 4OGQD 2R5BA 4W7YA 3TK1A 2KB7P 5AVZB 2D2CC 3AE4C 3H1JE 3M9HA 1RE3C 3H1HD 2PGDA 5AVSB 1Q86Q 3USSA 1PPJG 2WSFJ 1VQOP 5APUA 3TF5A 4WB4A 1OIPA 3FX0A 4K35A 1HBWA 1OXZA 3A7OA 4JYBA 3NFQA 1SQPG 1S3JA 5AW4B 1RF1A 2R44A 2XZRA 2KK7A 1M1JB 1NVOA 3KQGA 3WUUA 3IF4A 1OX3A 2E76B 1IFIA 2Q3IA 2KS1B 4OVNF 5CJ0A 3V2RA 1VF5C 4JPZB 4L75A 3RL0C 2WSEH 4LC1A 3SFDC 4JF7A 1VQ7P 1IFPA 3WU2H 3B5NA 1BGYG 5GTIE 3VOPA 4DZOA 1H89A 1L2PA 5B5EE 3PHLA 2OGUA 1LJ2A 2QJPC 3M06A 3TYYA 1T2KD 2C0WA 4U3FG 2FFDC 3H1KG 3VMAA 2H43A 2BASA 1SVFA 2LXCB 3CI9A 5AVYB 1N73C 3OAKA 5AW3B 3I5CA 4ASVA 2D2CB 2CK3H 4BRYB 4PJ0E 2JP3A 1IO4A 3Q5PA 2AEMA 2FXMA 2LXBA 2ZYDA 2QJKC 3E1RA 3HD7D 1KORA 4AYCA 1KD1Q 5AVWB 2Z5HA 1BDDA 1BSNA 2PFXA 3G3ZA 1OW8A 2YKOA 1IFNA 2E75C 1GL2C 1K73Q 2E74C 2AXTH 2K3RA 3P8CE 2WSCH 1LTJA 2YO2A 3H1HJ 4Y99B 1J2JB 1SS1A 1LP1B 2K9JB 5M1BA 1KB9H 1VDFA 3NMDA 3A0BE 1VQ8P 2GM4A 3SWKA 2IBZE 3MTUE 3PLNA 4OH8B 2M3BA 1VF5B 3CXHE 1FZEA 1KQLA 1GD2E 4NPEA 3RL0B 1M1KQ 1USDA 4GDOA 1Q90D 1KB9I 3L74D 1G1JA 1URQA 1AJYA 2QJYC 1NTMK 1SFCC 5AW9B 2QJPB 2Q3EA 2FFDB 1L0ND 1KMIZ 4IOIH 3MUDC 1ZW0A 1N73B 1VQ9P 3PJSK 1RH5B 2AEFA 2YNYA 1SQQD 2O1JA 2YO3A 3L72G 1JB0J 1PP9D 5AW6B 2P2UA 2QG4A 4RO0A 2V7QJ 1IFDA 3BCCG 1GW4A 1S5LX 2QJKB 1CW5A 2N1TD 1NHLA 1FJPA 3AECC 2BCCE 3A3YB 4C7NA 1HF9A 2N9YB 5CBOA 5CHXA 3P32A 3R4YA 2FY8A 4ZMDA 2JJLA 2HODB 1VPCA 1JOCA 3GF3A 3H1HG 4GODA 2H7HA 3SSUA 1R8EA 2YIUC 2WT7B 2K9YA 5CCHA 5GTHE 1HJBA 1OFCX 3H1IE 1VQNP 1PZQA 1ZRTE 1KYOE 2W90A 1ZMEC 4IL6X 2JDIH 2B87B 3O8ZA 3MP7B 1FDIA 1NTME 2B88A 2NRGA 1HTLC 2XDJA 2QJYB 2N9BA 3TGUD 3JCUH 1SFCB 1NAFA 3CCUP 1NOHA 2Y0DA 1OWAA 3CD6P 3B5ND 1FAVA 1FZCC 2QE7H 1H88A 1AFOA 3TNUB 4H13D 4XA4A 1LWUA 2Z4EA 1JY3O 3H1LE 1JY2P 2FBWC 4PV1C 2W6JH 1A02F 4ZNCA 2WTYA 2E75D 5KJ7A 1GL2D 2POHA 3CL3D 2E74D 4D6TE 2O01J 1LT1A 1SQXK 4HKZH 1L0NJ 3L75E 3QWOC 4XE5B 3MZWB 3TSIA 4UB6E 3WUVA 5KLVK 2P58A 4IFFA 3CC7P 5APVA 1SQQJ 3VP8A 5CJ4A 4PD4E 2CPBA 1PP9J 2IBZD 3L70D 4UB8E 2WITA 5KTBA 1KFNA 2YIUB 4WY4B 3L36A 4IFDK 2YKQA 3VMYA 1NH4A 1FZFA 3L73D 2E5TA 1HVVA 3SWYA 1EZVE 1NU1G 1L0LD 1MKMA 4RJTA 3E1IA 2O01N 3HTKB 4XFJA 1DIPA 1JY2N 3U59A 1LTBC 1RY3A 4HJGH 4H0LC 3D70A 5KAIH 1URQD 1GMJA 1FZCB 3AE1C 1X8YA 3CWBD 3KZIH 5EFWB 1EC5A 4I6MC 3CCLP 2YXQB 2RMZA 2V7QH 3VN0A 1L4AD 4YPCA 2NPSC 5KLIC 2WVRA 5H2FH 5TISE 3ABVC 4PV1B 3H25A 1YBKA 3L74G 3RK3E 2IYOA 3BRVB 3GG2A 3TGUJ 3HD7A 2ZT9B 1SQXE 3RK3C 2E5YA 1M7LA 1L0NG 5KLVE 3HE5B 2KS1A 1BCCE 2KIKA 1NTZK 1VQ5P 2IPPA 4DOJA 1YIJP 4C7RA 4K3AA 3M9BA 1SQQG 3CX5D 1X22A 1PP9G 2WMMA 2QM7A 3A0HE 1OW7A 1H0TB 5AW8B 1KYOD 2LKMA 3V4WA 1HGVA 1NTMD 2IYPA 1S5LE 3G9RA 1SQVD 5AVUB 1BE3G 3FWNA 2M3EA 1MV8A 3QH9A 5CCHD 3OJAB 2XV5A 3S9OA 4KHXA 2ZYGA 1RE3A 3L70J 1G1IA 4H0LB 1S2EA 4U7JA 1FU1A 1N8RQ 4N78D 4N3YB 2I8DA 1X79B 2G3AA 3L73J 3C9IA 1SQBD 4NPDA 1EDJA 2NPSB 5KLIB 2AXCA 1PGQA 2KOGA 2J59M 1H8AA 4D6TD 1YJ9P 3RK2C 2Q6QA 1FOSE 2E42A 1LNQA 4IL6E 4W80A 2N1TA 3A2AA 3TGUG 3RK3B 3L75D 3N7NA 3IR9A 2XNXA 3LIDA 2XKMA 5KJ7D 3CWBJ 1HUCA 2FYUD 1NTZE 1KILE 3OA7A 3HUSC 1RQUA 1KILC 1AV1A 2YMYA 1CI6B 1SQPK 3SWFA 1RF0C 1UIXA 2B9BA 4Y99C 1RHZB 1YTZI 3L71D 1EZVD 2A06E 5AW2B 2M5AB 1ZOYC 3NXSA 2ZYAA 2GUSA 2FFDA 3V2PA 1N73A 5DJUB 2OYIC 1S72P 4YXWH 2O1KA 3LW5J 1Q7YQ 1LT9C 3L4FA 3L70G 2KZJA 1NTKG 2ZFCA 2WPRA 1NTMJ 3WU2E 3L73G 4H44C 1YTZT 1SQVJ 1N7SC 3U1CA 5APXA 1J1DC 1SP4A 3RL0g 1L0LG 1S9KE 1GL2A 3V2QA 5AW7B 2HODA 3RK2B 2KUBA 4EOTA 2R32A 2QRXA 4MN4C 1LGHB 1PGOA 1DX7A 1BCCD 1P84D 1PPJE 2WT7A 3CWBG 3GW6A 1SQBJ 5APSA 1Y8AA 3HUSB 2Q1KA 1KILB 2E76D 2Q9IA 1OVVA 1SQPE 4D6TJ 2B87A 1M90Q 1W2BO 3C8VA 3VMXA 5AVQB 3M9QA 3L75J 1SFCA 3AE6C 3KPEA 3RGUA 1HGZA 3A5TA 3GF7A 2C9NY 2AXTE 3V4QA 2FYUJ 4NPFX 4WVZA 1EDLA 1KZUB 3O6QB 1MFTA 3HRNA 1D7MA 2HPCB 1KB9E 4WBAA 2OYIB 2YKPA 2B89A 1ZR4A 2HLOA 1OVRA 3EWKA 1E79H 1LT9B 1BGYE 1WRGA 2WZ7A 3AEGC 3L71J 1JM0A 1JTHB 3RBZA 2D2CD 2C9LY 1L4AA 4EI2A 1Z56A 4U3FE 4H44B 3H1KE 1JY3P 3H1JD 1A02J 1N7SB 1QVGO 1J1DB 1SQVG 3KDPB 2FXPA 3D71A 2HYNA 2QVAA 2WSFH 1SLQA 1BDCA 1NTZD 1OVUA 2ZVOB 2C0XA 2IFNA 2NZ2A 4Y28J 1Q2NA 2ZJSE 3ZDMA 3NTNA 1R5SA 3H32B 2PP6A 4BWNA 3AE3C 1SQXJ 2RKLA 1MFZA 1VF5D 3HTKA 4O9BA 1IJDB 3RL0D 3U1AA 2JWDA 1BCCJ 1FC2C 1RQVA 2W83C 3CCQP 4WY4C 4OWFA 3UIAA 4L73A 2FYUG 4I1LA 3LW5H 3CX5H 5KAFE 1HWTC 5AW5B 3BRTB 3V6IA 1JY3N 1BSHA 2A45G 2Y9YA 3CX5I 2GA1A 3FWLA 2KSJA 1KYOI 3EFFK 1K9MQ 2W6AA 3BVHA 1KTMA 3JCUE 1RE4A 3HE5A 1KN7A 2OYHC 5CCGC 1USEA 3PP5A 2KYVA 3IN6A 3SFEC 5APTA 3CCMP 3L72E 1X0TA 2ZT9C 1Q82Q 3BCCE 1T3UA 2Q7CA 2Q5UA 1K05A 3EFGA 1H0TA 1YI2P 3P8CD 3H1JJ 2E43A 1G2CB 3GHGC 1T6AA 3I56P 1YITP 1NAYA 3GLMA 1E5WA 1NTZJ 5E79H 4OGQC 3HE4B 3CCEP 3H1HE 3CXHD 1DD4A 1NKNA 2A45H 1QX8A 1SFCD 5B66H 1M56D 2KNCB 1VL2A 1BGYD 1PIXA 3RBXA 1JEKA 2A45I 1AA0A 1NU1K 1M57D 1FS0E 1GU4A 3R2PA 3D6YA 2FYNC 3G6EP 1EZVI 3N4XA 2K37A 4GIFA 5AVVB 1HH0A 3AE8C 1AQ5A 2KLVA 2OYHB 2UWJE 1VQ4P 5KAIE 5AVRB 2R3CA 1R5LA 3KZIE 5BVZA 2BCCD 1IZNB 2WPSA 3S4RA 2K1AA 1KQFB 1M1JA 3M91A 2WWWA 4RESB 2M5AA 1AQTA 1QVFO 3EQ2A 3H1JG 3GHGB 1X9VA 4WY4D 1KC8Q 4YTPC 1JNMA 4LLHA 1T2KC 1L0NK 1P84H 1IK7A 1NWQA 2QM8A 3ITKA 3B8EB 3M0DC 2KLUA 1FOSF 1J1EC 3FXDA 4OGQB 3FXEA 3T97B 1XTCC 1SQQK 3H1ID 1CSBA 1P84I 1ZRTD 1FDOA 3K5BA 1VQMP 2FXOA 1U7MA 2W6BA 4HYTB 2P67A 1NU1E 3HD7C 2JR8A 5AVTB 1LTGC 4N6JA 4BRYA 2WSCJ 2FYNB 2PAJA 4GOEA 4PV1D 4W7ZA 3H1LD 3BATA 3L72D 2ZT9D 3KXDA 1LTSC 1BGYJ 3CCJP 3JSVC 3HUSA 1EXIA 2O01H 3BCCD 1KILA 3Q3DA 2ZAEB 3L74E 2L91A 2VRSA 2R5DA 3KHUA 1IFJA 4ZKUA 2CPSA 1UIIA 3CCVP 1RF0A 2MJZA 1GDTA 2JO1A 2AEJA 3M0AA 1YQ4C 4EIJA 2IZ1A 1LP1A 2K9JA 3W68A 1L0NE 3PH0A 4PD4D 1S1CX 3AE2C 3CMAP 3O6QA 4ASWA 1ZP0C 3WUTA 4DJGA 3IFMA 2HPCA 1SQQE 1J1EB 2OYIA 3B4SA 1VQKP 2BCCJ 1PP9E 5AW1B 1DEEG 2QEXP 1LT9A 2HG5D 1JTHA 4L74A 2IZ0A 2FYZA 2R3SA 1ZLLA 1MZ9A 5TJHA 3MHVA 2PRRA 4H0LD 3HD7B 1BE3E 2N1TC 3LIEA 2DW3A 1N7SA 1NJIQ 4R4LA 5APQA 5AVXB 3D6ZA 3W67A 2ITAA 2M8RA 4GOFA 3CLQA 3Q5RA 2MKVA 2NPSD 2IBZG 2P1JA 3Q2YA 2H88C 4ZKPA 3H1IJ 3I55P 5GTIH 3F89A 5B5EH 1RF1C 1NTKK 1MUUA 3RK3D 1M8OB 4GKGA 3H32A 5C39A 1QL1A 1PGPA 1SQXD 2IX7C 2JKVA 3L35A 1L0LK 1KFMA 1LTTC
chains in the Genus database with same CATH topology
3L36A 5BU8B 3L37A 4IFDK 2YKQA 3VMYA 1NH4A 1FZFA 1MFZA 1HVVA 1IFMA 3HTKA 4O9BA 3SWYA 1ZN5A 1IJDB 2OARA 1YYCA 2I1KA 3RL0D 3B5NC 3U1AA 1LTAC 3E1IA 3HTKB 4WY4C 3UIAA 1JY2N 3U59A 4I1LA 2I1JA 1LTBC 3LW5H 1ZV8A 1FZBA 1RY3A 1HWTC 5AW5B 2R5BA 4W7YA 3TK1A 2KB7P 1W2EA 5AVZB 1URQD 4HH2A 3BRTB 1JY3N 2A45G 1FZCB 3M9HA 1X8YA 1RE3C 2L5GB 4I6MC 1N86A 5AVSB 4IFMA 3VN0A 1L4AD 2NPSC 2N1TB 3MUDA 5APUA 3TNUA 3WMM0 1XTGB 1N7LA 2KSJA 4WB4A 3BRVB 2W6AA 3HD7A 3BVHA 1HBWA 1OXZA 3A7OA 3RK3C 4JYBA 3NFQA 1RE4A 5AW4B 1RF1A 3HE5A 2OYHC 5CCGC 3PP5A 2KYVA 1EQ7A 2XZRA 3RK2D 1M7LA 5APTA 1M1JB 2JEEA 1RF1B 1JCCA 3HE5B 2P7JA 3KQGA 3MIWA 1NTZK 1PFIA 1GTWA 2IPPA 4DOJA 2IFMA 1LTJC 1IFIA 1T3UA 2Q7CA 4C7RA 2Q3IA 2Q5UA 1G2CA 3EFGA 3M9BA 5CJ0A 3V2RA 1FJKA 1FZGA 1SQVK 3P8CD 2QM7A 3RL0C 2E43A 1G2CB 2WSEH 3GHGC 1GW3A 4LC1A 5AW8B 2LKMA 4LGDE 3V4WA 1KILD 4JF7A 1HGVA 5APWA 3HE4A 3B5NA 3H6PA 4WY4A 3VOPA 1E5WA 4DZOA 1H89A 5AVUB 1MV8A 1GK4A 3HE4B 5CCHD 3B5NB 2H8PD 1URQC 1JO5A 3OJAB 2XV5A 4C46A 1NKNA 3M06A 4GT1A 3TYYA 2A45H 4KHXA 2C0WA 1T2KD 2FFDC 1JUNA 2H43A 1SQBK 1SVFA 2BASA 3CI9A 5AVYB 1N73C 1SFCD 3OAKA 1RE3A 2XU6A 5AW3B 1L4AC 1G1IA 3I5CA 1FU1A 1ZR2A 4M3LA 4N78D 2A45I 4N3YB 1IO4A 1NU1K 1DEBA 1X79B 1GL2B 2FXMA 3C9IA 1GK6A 2NPSB 3MGNA 1FZCA 1GU4A 3R2PA 3HD7D 2KOGA 2J59M 1H8AA 4AYCA 3RK2C 5AVWB 1FOSE 2FYUK 3N4XA 4GIFA 2Z5HA 2OYHA 2E42A 5CCGA 5AVVB 3G3ZA 4W80A 1HH0A 2N1TA 3A2AA 2YKOA 1IFNA 3RK3B 1GL2C 1N7SD 3N7NA 1AQ5A 3IR9A 2KLVA 2OYHB 2XNXA 3P8CE 2ZXEB 2XKMA 3LIDA 5AVRB 2WSCH 1LTJA 1HUCA 5KJ7D 2YO2A 1NKZB 1JMMA 2R3CA 4Y99B 5BVZA 1S9KD 3VYIA 3OA7A 1J2JB 3HUSC 2WPSA 1LTJB 1VDFA 3NMDA 1KILC 1QL2A 1M1JA 3M91A 2GM4A 2WWWA 3MTUE 4RESB 4OH8B 3GHGA 4AQRD 2M3BA 2YMYA 4I2LC 2W27A 1CI6B 1FZEA 1KQLA 1SQPK 3SWFA 1GD2E 1RF0C 3EQ2A 3RL0B 5CCHC 4Y99C 1YTZI 3GHGB 1X9VA 5AW2B 4WY4D 1JNMA 4LLHA 1T2KC 2WPQA 1L0NK 1G1JA 3T97A 1URQA 2QM8A 3NXSA 1NWQA 1NTMK 3B8EB 3M0DC 1CZQA 1SFCC 2GUSA 1FOSF 4N78E 1J1EC 5AW9B 2FFDA 3V2PA 1XTCC 1N73A 1URQB 1SQQK 4AUWA 1CSBA 2FFDB 2OYIC 2O1KA 1N73B 1T8ZA 2W6BA 4HYTB 1LT9C 1L4AB 1FBMA 3L4FA 2P67A 1JCDA 3HD7C 2YNYA 5AVTB 2O1JA 2ZFCA 2YO3A 2WPRA 1LTGC 1RE4C 5AW6B 2GUVA 2P2UA 3KYQA 1LWUC 1N2DC 1IFDA 1YTZT 1FDMA 4N6JA 1N7SC 3U1CA 5APXA 1J1DC 1GW4A 1SP4A 3V2NA 1CW5A 1S9KE 2N1TD 1NHLA 4JYCA 1GL2A 3V2QA 2PAJA 1FJPA 3II6A 2HODA 5AW7B 3RK2B 5KJ7C 3A3YB 4C7NA 4EOTA 2NPSA 2R32A 5CHXA 3P32A 4W7ZA 3BATA 3VMZA 5BU5A 2JJLA 1LGHB 1VPCA 2HODB 1DX7A 4C7NB 3VP9A 1LTSC 3HUSA 1JOCA 2WT7A 2O01H 1KILA 2VRSA 2R5DA 1FZAA 5APSA 1IFJA 2H7HA 4ZKUA 3HUSB 2CPSA 2WT7B 1KILB 1RF0A 2MJZA 5CCHA 2Q9IA 1GDTA 1HJBA 3P8MC 3M0AA 2Z5IA 4EIJA 3VMXA 5AVQB 1WT6A 3M9QA 3M0DA 1SFCA 3KPEA 3O8ZA 1HGZA 3A5TA 1CI6A 5APYA 2C9NY 1HTLC 2XDJA 3V4QA 2KP8A 2N9BA 1DH3A 3IFMA 1SFCB 2HPCA 1NAFA 1J1EB 5AW0B 2OYIA 1KZUB 1NOHA 1GU5A 1OWAA 5AW1B 2J58A 2FKWB 3B5ND 1LT9A 2HG5D 3HRNA 2HPCB 1FAVA 4WBAA 1FZCC 2OYIB 2YKPA 1H88A 1ZR4A 1JY2O 1JTHA 1NO4A 2HLOA 1AFOA 3TNUB 2FYZA 1LT9B 4XA4A 1ZLLA 1MZ9A 1WRGA 2WZ7A 3VTPC 3BASA 1LWUA 2Z4EA 3HD7B 1JY3O 2N1TC 3LIEA 1JTHB 1JY2P 1N7SA 5CMZA 5APQA 2C9LY 1L4AA 1IK9A 5AVXB 1A02F 1LWUB 1Z56A 2WTYA 4B86A 5KJ7A 2M8RA 1GL2D 1JY3P 3CLQA 1A02J 1N7SB 2POHA 3CL3D 1J1DB 3KDPB 2NPSD 1LTIC 2P1JA 4ZKPA 2HYNA 1GZLA 2WSFH 1SQXK 1SLQA 3MD0A 2HFED 3V5BA 1M1JC 4XE5B 1RF1C 1NTKK 3TSIA 1MUUA 3RK3D 4GKGA 3H32A 5KLVK 5CCGD 4IFFA 1IC2A 2C0XA 5APVA 2IFNA 1QL1A 3P7KA 3VP8A 5CJ4A 2CPBA 2IX7C 1T3JA 3NTNA 3L35A 3H32B 1L0LK 2WITA 2PP6A 5KTBA 1KFMA 1LTTC 1KFNA 4WY4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 C;  1M1J C;  1N73 A;  1FZE A;  2HOD B;  2XNX A;  2A45 H;  1RF1 C;  1JY2 N;  2FFD C;  1LWU C;  1FZC A;  1M1J B;  3GHG C;  1RF0 C;  2H43 A;  1LTJ A;  1RF1 B;  1FZB A;  1LT9 A;  1FZF A;  1LWU B;  2FFD B;  3HUS A;  1N73 C;  2OYI C;  3GHG B;  1RE3 A;  3H32 A;  2HPC B;  1JY3 P;  1FZC C;  2OYI B;  1W2E A;  1N73 B;  1JY3 N;  1JY2 O;  1LTJ C;  2OYH A;  2A45 G;  2HLO A;  1FZC B;  1LT9 C;  3BVH A;  1T3U A;  2HOD A;  1FZA A;  3HUS C;  1RE3 C;  1LTJ B;  1LT9 B;  3E1I A;  3HUS B;  1RE4 A;  1M1J A;  2A45 I;  1RF1 A;  1N86 A;  3H32 B;  2OYH C;  2FFD A;  1LWU A;  3GHG A;  1FZG A;  2Z4E A;  1RF0 A;  1JY3 O;  2HPC A;  2Q9I A;  2OYH B;  2OYI A;  1JY2 P; 
#chains in the Genus database with same CATH topology
 3TGU E;  5BU8 B;  4PJ0 H;  3L37 A;  2W8Z A;  5KLV D;  3AE7 C;  1OZH A;  3H1L J;  2OAR A;  3L72 J;  3B5N C;  1LTA C;  1U57 A;  1HJ0 A;  3BCC J;  4H13 C;  1ZV8 A;  1FZB A;  1DD3 A;  3IAO A;  2BCC G;  1W2E A;  2WPV B;  4HH2 A;  1NU1 D;  2L5G B;  1N86 A;  4IFM A;  2V4H A;  3A0B H;  2N1T B;  1K04 A;  2ZXX A;  3MUD A;  3TNU A;  3WMM 0;  1XTG B;  1N7L A;  1Q81 Q;  3CXH H;  3E7K A;  1YJW P;  1NGM B;  4I7Z C;  2IBZ I;  3L70 E;  1EQ7 A;  4Z1M H;  1NTK E;  3F5H A;  3CXH I;  3RK2 D;  3H1I G;  2IDB A;  3PRJ A;  2JEE A;  1RF1 B;  1JCC A;  2RH0 A;  2P7J A;  3AE5 C;  1NTM G;  3MIW A;  1PFI A;  1GTW A;  3L73 E;  2G8Y A;  2IFM A;  1LTJ C;  4WWI A;  1L0L E;  2K88 A;  1G2C A;  4HB1 A;  1FJK A;  2LR2 A;  1EDK A;  1SQV K;  1FZG A;  4YXD C;  1U7J A;  4TLF A;  1GW3 A;  4LGD E;  1KIL D;  5APW A;  3HE4 A;  1VQP P;  2JWA A;  1JMB A;  3H6P A;  2YXR B;  4WY4 A;  3AEF C;  1Y9B A;  3H1L G;  3CWB E;  1GK4 A;  2SPZ A;  3B5N B;  2H8P D;  1URQ C;  1JO5 A;  1SQB G;  2KNC A;  4C46 A;  4EDF A;  4GT1 A;  3AEE C;  4H13 B;  1JUN A;  2A06 D;  1SQB K;  4D6T G;  2XU6 A;  1L4A C;  3S1K A;  4BXL A;  1ZR2 A;  4CPG A;  4M3L A;  5KLV J;  1BE3 D;  3L75 G;  1AVO A;  1DEB A;  2E75 B;  1GL2 B;  4R4M A;  2E74 B;  1GK6 A;  1FZC A;  3MGN A;  5GTH H;  3OW2 O;  2WSS H;  2FYU K;  5KAF H;  2OYH A;  4KJM A;  5CCG A;  1WMK A;  1KYO H;  1NYH A;  4H44 D;  1N7S D;  4I7Z B;  5K5G B;  3CCS P;  3CX5 E;  1NU1 J;  2ZXE B;  3L71 G;  1EZV G;  1NKZ B;  1JMM A;  4JBZ A;  1S9K D;  3VYI A;  5KKZ C;  3AED C;  1LTJ B;  1KQG B;  1QL2 A;  1SQV E;  3GHG A;  4AQR D;  4I2L C;  2W27 A;  2Y0C A;  1PPJ D;  1KQS O;  5CCH C;  3CCR P;  1PV3 A;  2HR3 A;  2WPQ A;  3T97 A;  3CC4 P;  2QIW A;  2J5U A;  1CZQ A;  3G4S P;  4N78 E;  4A7P A;  1SQP D;  2H89 C;  3CC2 P;  2OTJ P;  3L74 J;  1URQ B;  1SQB E;  4AUW A;  4DCK A;  1SQX G;  1T8Z A;  4UB6 H;  3CME P;  1L4A B;  1FBM A;  4EYY Q;  1JCD A;  1PGJ A;  4PD4 H;  5KLV G;  1RE4 C;  1BCC G;  4UB8 H;  2GUV A;  3KYQ A;  1LWU C;  3Q1M A;  1N2D C;  1KB9 D;  2OTL P;  1FDM A;  4TT3 H;  2FYU E;  3V2N A;  5E79 E;  3AEA C;  2O3J A;  2Y9Z A;  2BEQ D;  4JYC A;  4PD4 I;  3II6 A;  5KJ7 C;  1EDI A;  3C1L A;  2NPS A;  1NTK D;  2YMK A;  3VMZ A;  5BU5 A;  5B66 E;  4C7N B;  3VP9 A;  4U3F D;  3H1K D;  1BE3 J;  2QSI A;  5L8R J;  3L71 E;  3PTZ A;  3JC2 2;  1FZA A;  5KKZ B;  2WQY C;  2XND H;  2KZI A;  2KXP B;  3P8M C;  2Z5I A;  1QGK B;  2Y0E A;  2WSE J;  1YJN P;  4QMA A;  1WT6 A;  5TIS H;  3M0D A;  1CI6 A;  5APY A;  3FGA D;  2OTK E;  2KP8 A;  3TDK A;  5H2F E;  1DH3 A;  5AW0 B;  4RKU J;  2KSE A;  1GU5 A;  2M0B A;  2J58 A;  2FKW B;  1Y47 A;  3Q5S A;  3CPW O;  1JY2 O;  1NO4 A;  2BEZ F;  1S4X A;  1FE6 A;  1OMI A;  3VTP C;  3BAS A;  5CBN A;  1NTZ G;  4L76 A;  5CMZ A;  1IK9 A;  1P84 E;  1LWU B;  4B86 A;  3A0H H;  1KV4 A;  1SQP J;  2OYO A;  1LTI C;  4DT0 A;  1K8A Q;  1GZL A;  4KT0 J;  1S5L H;  3MD0 A;  2ZVN B;  2HFE D;  3V5B A;  1M1J C;  2A06 G;  4JQ0 D;  1AVY A;  2E76 C;  5CCG D;  1QLE D;  1IC2 A;  3P7K A;  3AE9 C;  1T3J A;  1YHQ P;  1OW6 A;  1PL5 A;  2P10 A;  2OQQ A;  3GMA A;  1QEX A;  2RN0 A;  3AEB C;  1W5C E;  2KI7 B;  1NTK J;  1IFM A;  1ZN5 A;  1YYC A;  2I1K A;  1EXJ A;  4U3F J;  1ZXG A;  3H1K J;  3G71 P;  4IL6 H;  2QA4 P;  1VQL P;  1VQ6 P;  5DJT B;  3B71 A;  1L0L J;  2I1J A;  1TU3 F;  1YQ3 C;  4OGQ D;  2R5B A;  4W7Y A;  3TK1 A;  2KB7 P;  5AVZ B;  2D2C C;  3AE4 C;  3H1J E;  3M9H A;  1RE3 C;  3H1H D;  2PGD A;  5AVS B;  1Q86 Q;  3USS A;  1PPJ G;  2WSF J;  1VQO P;  5APU A;  3TF5 A;  4WB4 A;  1OIP A;  3FX0 A;  4K35 A;  1HBW A;  1OXZ A;  3A7O A;  4JYB A;  3NFQ A;  1SQP G;  1S3J A;  5AW4 B;  1RF1 A;  2R44 A;  2XZR A;  2KK7 A;  1M1J B;  1NVO A;  3KQG A;  3WUU A;  3IF4 A;  1OX3 A;  2E76 B;  1IFI A;  2Q3I A;  2KS1 B;  4OVN F;  5CJ0 A;  3V2R A;  1VF5 C;  4JPZ B;  4L75 A;  3RL0 C;  2WSE H;  4LC1 A;  3SFD C;  4JF7 A;  1VQ7 P;  1IFP A;  3WU2 H;  3B5N A;  1BGY G;  5GTI E;  3VOP A;  4DZO A;  1H89 A;  1L2P A;  5B5E E;  3PHL A;  2OGU A;  1LJ2 A;  2QJP C;  3M06 A;  3TYY A;  1T2K D;  2C0W A;  4U3F G;  2FFD C;  3H1K G;  3VMA A;  2H43 A;  2BAS A;  1SVF A;  2LXC B;  3CI9 A;  5AVY B;  1N73 C;  3OAK A;  5AW3 B;  3I5C A;  4ASV A;  2D2C B;  2CK3 H;  4BRY B;  4PJ0 E;  2JP3 A;  1IO4 A;  3Q5P A;  2AEM A;  2FXM A;  2LXB A;  2ZYD A;  2QJK C;  3E1R A;  3HD7 D;  1KOR A;  4AYC A;  1KD1 Q;  5AVW B;  2Z5H A;  1BDD A;  1BSN A;  2PFX A;  3G3Z A;  1OW8 A;  2YKO A;  1IFN A;  2E75 C;  1GL2 C;  1K73 Q;  2E74 C;  2AXT H;  2K3R A;  3P8C E;  2WSC H;  1LTJ A;  2YO2 A;  3H1H J;  4Y99 B;  1J2J B;  1SS1 A;  1LP1 B;  2K9J B;  5M1B A;  1KB9 H;  1VDF A;  3NMD A;  3A0B E;  1VQ8 P;  2GM4 A;  3SWK A;  2IBZ E;  3MTU E;  3PLN A;  4OH8 B;  2M3B A;  1VF5 B;  3CXH E;  1FZE A;  1KQL A;  1GD2 E;  4NPE A;  3RL0 B;  1M1K Q;  1USD A;  4GDO A;  1Q90 D;  1KB9 I;  3L74 D;  1G1J A;  1URQ A;  1AJY A;  2QJY C;  1NTM K;  1SFC C;  5AW9 B;  2QJP B;  2Q3E A;  2FFD B;  1L0N D;  1KMI Z;  4IOI H;  3MUD C;  1ZW0 A;  1N73 B;  1VQ9 P;  3PJS K;  1RH5 B;  2AEF A;  2YNY A;  1SQQ D;  2O1J A;  2YO3 A;  3L72 G;  1JB0 J;  1PP9 D;  5AW6 B;  2P2U A;  2QG4 A;  4RO0 A;  2V7Q J;  1IFD A;  3BCC G;  1GW4 A;  1S5L X;  2QJK B;  1CW5 A;  2N1T D;  1NHL A;  1FJP A;  3AEC C;  2BCC E;  3A3Y B;  4C7N A;  1HF9 A;  2N9Y B;  5CBO A;  5CHX A;  3P32 A;  3R4Y A;  2FY8 A;  4ZMD A;  2JJL A;  2HOD B;  1VPC A;  1JOC A;  3GF3 A;  3H1H G;  4GOD A;  2H7H A;  3SSU A;  1R8E A;  2YIU C;  2WT7 B;  2K9Y A;  5CCH A;  5GTH E;  1HJB A;  1OFC X;  3H1I E;  1VQN P;  1PZQ A;  1ZRT E;  1KYO E;  2W90 A;  1ZME C;  4IL6 X;  2JDI H;  2B87 B;  3O8Z A;  3MP7 B;  1FDI A;  1NTM E;  2B88 A;  2NRG A;  1HTL C;  2XDJ A;  2QJY B;  2N9B A;  3TGU D;  3JCU H;  1SFC B;  1NAF A;  3CCU P;  1NOH A;  2Y0D A;  1OWA A;  3CD6 P;  3B5N D;  1FAV A;  1FZC C;  2QE7 H;  1H88 A;  1AFO A;  3TNU B;  4H13 D;  4XA4 A;  1LWU A;  2Z4E A;  1JY3 O;  3H1L E;  1JY2 P;  2FBW C;  4PV1 C;  2W6J H;  1A02 F;  4ZNC A;  2WTY A;  2E75 D;  5KJ7 A;  1GL2 D;  2POH A;  3CL3 D;  2E74 D;  4D6T E;  2O01 J;  1LT1 A;  1SQX K;  4HKZ H;  1L0N J;  3L75 E;  3QWO C;  4XE5 B;  3MZW B;  3TSI A;  4UB6 E;  3WUV A;  5KLV K;  2P58 A;  4IFF A;  3CC7 P;  5APV A;  1SQQ J;  3VP8 A;  5CJ4 A;  4PD4 E;  2CPB A;  1PP9 J;  2IBZ D;  3L70 D;  4UB8 E;  2WIT A;  5KTB A;  1KFN A;  2YIU B;  4WY4 B;  3L36 A;  4IFD K;  2YKQ A;  3VMY A;  1NH4 A;  1FZF A;  3L73 D;  2E5T A;  1HVV A;  3SWY A;  1EZV E;  1NU1 G;  1L0L D;  1MKM A;  4RJT A;  3E1I A;  2O01 N;  3HTK B;  4XFJ A;  1DIP A;  1JY2 N;  3U59 A;  1LTB C;  1RY3 A;  4HJG H;  4H0L C;  3D70 A;  5KAI H;  1URQ D;  1GMJ A;  1FZC B;  3AE1 C;  1X8Y A;  3CWB D;  3KZI H;  5EFW B;  1EC5 A;  4I6M C;  3CCL P;  2YXQ B;  2RMZ A;  2V7Q H;  3VN0 A;  1L4A D;  4YPC A;  2NPS C;  5KLI C;  2WVR A;  5H2F H;  5TIS E;  3ABV C;  4PV1 B;  3H25 A;  1YBK A;  3L74 G;  3RK3 E;  2IYO A;  3BRV B;  3GG2 A;  3TGU J;  3HD7 A;  2ZT9 B;  1SQX E;  3RK3 C;  2E5Y A;  1M7L A;  1L0N G;  5KLV E;  3HE5 B;  2KS1 A;  1BCC E;  2KIK A;  1NTZ K;  1VQ5 P;  2IPP A;  4DOJ A;  1YIJ P;  4C7R A;  4K3A A;  3M9B A;  1SQQ G;  3CX5 D;  1X22 A;  1PP9 G;  2WMM A;  2QM7 A;  3A0H E;  1OW7 A;  1H0T B;  5AW8 B;  1KYO D;  2LKM A;  3V4W A;  1HGV A;  1NTM D;  2IYP A;  1S5L E;  3G9R A;  1SQV D;  5AVU B;  1BE3 G;  3FWN A;  2M3E A;  1MV8 A;  3QH9 A;  5CCH D;  3OJA B;  2XV5 A;  3S9O A;  4KHX A;  2ZYG A;  1RE3 A;  3L70 J;  1G1I A;  4H0L B;  1S2E A;  4U7J A;  1FU1 A;  1N8R Q;  4N78 D;  4N3Y B;  2I8D A;  1X79 B;  2G3A A;  3L73 J;  3C9I A;  1SQB D;  4NPD A;  1EDJ A;  2NPS B;  5KLI B;  2AXC A;  1PGQ A;  2KOG A;  2J59 M;  1H8A A;  4D6T D;  1YJ9 P;  3RK2 C;  2Q6Q A;  1FOS E;  2E42 A;  1LNQ A;  4IL6 E;  4W80 A;  2N1T A;  3A2A A;  3TGU G;  3RK3 B;  3L75 D;  3N7N A;  3IR9 A;  2XNX A;  3LID A;  2XKM A;  5KJ7 D;  3CWB J;  1HUC A;  2FYU D;  1NTZ E;  1KIL E;  3OA7 A;  3HUS C;  1RQU A;  1KIL C;  1AV1 A;  2YMY A;  1CI6 B;  1SQP K;  3SWF A;  1RF0 C;  1UIX A;  2B9B A;  4Y99 C;  1RHZ B;  1YTZ I;  3L71 D;  1EZV D;  2A06 E;  5AW2 B;  2M5A B;  1ZOY C;  3NXS A;  2ZYA A;  2GUS A;  2FFD A;  3V2P A;  1N73 A;  5DJU B;  2OYI C;  1S72 P;  4YXW H;  2O1K A;  3LW5 J;  1Q7Y Q;  1LT9 C;  3L4F A;  3L70 G;  2KZJ A;  1NTK G;  2ZFC A;  2WPR A;  1NTM J;  3WU2 E;  3L73 G;  4H44 C;  1YTZ T;  1SQV J;  1N7S C;  3U1C A;  5APX A;  1J1D C;  1SP4 A;  3RL0 g;  1L0L G;  1S9K E;  1GL2 A;  3V2Q A;  5AW7 B;  2HOD A;  3RK2 B;  2KUB A;  4EOT A;  2R32 A;  2QRX A;  4MN4 C;  1LGH B;  1PGO A;  1DX7 A;  1BCC D;  1P84 D;  1PPJ E;  2WT7 A;  3CWB G;  3GW6 A;  1SQB J;  5APS A;  1Y8A A;  3HUS B;  2Q1K A;  1KIL B;  2E76 D;  2Q9I A;  1OVV A;  1SQP E;  4D6T J;  2B87 A;  1M90 Q;  1W2B O;  3C8V A;  3VMX A;  5AVQ B;  3M9Q A;  3L75 J;  1SFC A;  3AE6 C;  3KPE A;  3RGU A;  1HGZ A;  3A5T A;  3GF7 A;  2C9N Y;  2AXT E;  3V4Q A;  2FYU J;  4NPF X;  4WVZ A;  1EDL A;  1KZU B;  3O6Q B;  1MFT A;  3HRN A;  1D7M A;  2HPC B;  1KB9 E;  4WBA A;  2OYI B;  2YKP A;  2B89 A;  1ZR4 A;  2HLO A;  1OVR A;  3EWK A;  1E79 H;  1LT9 B;  1BGY E;  1WRG A;  2WZ7 A;  3AEG C;  3L71 J;  1JM0 A;  1JTH B;  3RBZ A;  2D2C D;  2C9L Y;  1L4A A;  4EI2 A;  1Z56 A;  4U3F E;  4H44 B;  3H1K E;  1JY3 P;  3H1J D;  1A02 J;  1N7S B;  1QVG O;  1J1D B;  1SQV G;  3KDP B;  2FXP A;  3D71 A;  2HYN A;  2QVA A;  2WSF H;  1SLQ A;  1BDC A;  1NTZ D;  1OVU A;  2ZVO B;  2C0X A;  2IFN A;  2NZ2 A;  4Y28 J;  1Q2N A;  2ZJS E;  3ZDM A;  3NTN A;  1R5S A;  3H32 B;  2PP6 A;  4BWN A;  3AE3 C;  1SQX J;  2RKL A;  1MFZ A;  1VF5 D;  3HTK A;  4O9B A;  1IJD B;  3RL0 D;  3U1A A;  2JWD A;  1BCC J;  1FC2 C;  1RQV A;  2W83 C;  3CCQ P;  4WY4 C;  4OWF A;  3UIA A;  4L73 A;  2FYU G;  4I1L A;  3LW5 H;  3CX5 H;  5KAF E;  1HWT C;  5AW5 B;  3BRT B;  3V6I A;  1JY3 N;  1BSH A;  2A45 G;  2Y9Y A;  3CX5 I;  2GA1 A;  3FWL A;  2KSJ A;  1KYO I;  3EFF K;  1K9M Q;  2W6A A;  3BVH A;  1KTM A;  3JCU E;  1RE4 A;  3HE5 A;  1KN7 A;  2OYH C;  5CCG C;  1USE A;  3PP5 A;  2KYV A;  3IN6 A;  3SFE C;  5APT A;  3CCM P;  3L72 E;  1X0T A;  2ZT9 C;  1Q82 Q;  3BCC E;  1T3U A;  2Q7C A;  2Q5U A;  1K05 A;  3EFG A;  1H0T A;  1YI2 P;  3P8C D;  3H1J J;  2E43 A;  1G2C B;  3GHG C;  1T6A A;  3I56 P;  1YIT P;  1NAY A;  3GLM A;  1E5W A;  1NTZ J;  5E79 H;  4OGQ C;  3HE4 B;  3CCE P;  3H1H E;  3CXH D;  1DD4 A;  1NKN A;  2A45 H;  1QX8 A;  1SFC D;  5B66 H;  1M56 D;  2KNC B;  1VL2 A;  1BGY D;  1PIX A;  3RBX A;  1JEK A;  2A45 I;  1AA0 A;  1NU1 K;  1M57 D;  1FS0 E;  1GU4 A;  3R2P A;  3D6Y A;  2FYN C;  3G6E P;  1EZV I;  3N4X A;  2K37 A;  4GIF A;  5AVV B;  1HH0 A;  3AE8 C;  1AQ5 A;  2KLV A;  2OYH B;  2UWJ E;  1VQ4 P;  5KAI E;  5AVR B;  2R3C A;  1R5L A;  3KZI E;  5BVZ A;  2BCC D;  1IZN B;  2WPS A;  3S4R A;  2K1A A;  1KQF B;  1M1J A;  3M91 A;  2WWW A;  4RES B;  2M5A A;  1AQT A;  1QVF O;  3EQ2 A;  3H1J G;  3GHG B;  1X9V A;  4WY4 D;  1KC8 Q;  4YTP C;  1JNM A;  4LLH A;  1T2K C;  1L0N K;  1P84 H;  1IK7 A;  1NWQ A;  2QM8 A;  3ITK A;  3B8E B;  3M0D C;  2KLU A;  1FOS F;  1J1E C;  3FXD A;  4OGQ B;  3FXE A;  3T97 B;  1XTC C;  1SQQ K;  3H1I D;  1CSB A;  1P84 I;  1ZRT D;  1FDO A;  3K5B A;  1VQM P;  2FXO A;  1U7M A;  2W6B A;  4HYT B;  2P67 A;  1NU1 E;  3HD7 C;  2JR8 A;  5AVT B;  1LTG C;  4N6J A;  4BRY A;  2WSC J;  2FYN B;  2PAJ A;  4GOE A;  4PV1 D;  4W7Z A;  3H1L D;  3BAT A;  3L72 D;  2ZT9 D;  3KXD A;  1LTS C;  1BGY J;  3CCJ P;  3JSV C;  3HUS A;  1EXI A;  2O01 H;  3BCC D;  1KIL A;  3Q3D A;  2ZAE B;  3L74 E;  2L91 A;  2VRS A;  2R5D A;  3KHU A;  1IFJ A;  4ZKU A;  2CPS A;  1UII A;  3CCV P;  1RF0 A;  2MJZ A;  1GDT A;  2JO1 A;  2AEJ A;  3M0A A;  1YQ4 C;  4EIJ A;  2IZ1 A;  1LP1 A;  2K9J A;  3W68 A;  1L0N E;  3PH0 A;  4PD4 D;  1S1C X;  3AE2 C;  3CMA P;  3O6Q A;  4ASW A;  1ZP0 C;  3WUT A;  4DJG A;  3IFM A;  2HPC A;  1SQQ E;  1J1E B;  2OYI A;  3B4S A;  1VQK P;  2BCC J;  1PP9 E;  5AW1 B;  1DEE G;  2QEX P;  1LT9 A;  2HG5 D;  1JTH A;  4L74 A;  2IZ0 A;  2FYZ A;  2R3S A;  1ZLL A;  1MZ9 A;  5TJH A;  3MHV A;  2PRR A;  4H0L D;  3HD7 B;  1BE3 E;  2N1T C;  3LIE A;  2DW3 A;  1N7S A;  1NJI Q;  4R4L A;  5APQ A;  5AVX B;  3D6Z A;  3W67 A;  2ITA A;  2M8R A;  4GOF A;  3CLQ A;  3Q5R A;  2MKV A;  2NPS D;  2IBZ G;  2P1J A;  3Q2Y A;  2H88 C;  4ZKP A;  3H1I J;  3I55 P;  5GTI H;  3F89 A;  5B5E H;  1RF1 C;  1NTK K;  1MUU A;  3RK3 D;  1M8O B;  4GKG A;  3H32 A;  5C39 A;  1QL1 A;  1PGP A;  1SQX D;  2IX7 C;  2JKV A;  3L35 A;  1L0L K;  1KFM A;  1LTT C; 
#chains in the Genus database with same CATH homology
 3L36 A;  5BU8 B;  3L37 A;  4IFD K;  2YKQ A;  3VMY A;  1NH4 A;  1FZF A;  1MFZ A;  1HVV A;  1IFM A;  3HTK A;  4O9B A;  3SWY A;  1ZN5 A;  1IJD B;  2OAR A;  1YYC A;  2I1K A;  3RL0 D;  3B5N C;  3U1A A;  1LTA C;  3E1I A;  3HTK B;  4WY4 C;  3UIA A;  1JY2 N;  3U59 A;  4I1L A;  2I1J A;  1LTB C;  3LW5 H;  1ZV8 A;  1FZB A;  1RY3 A;  1HWT C;  5AW5 B;  2R5B A;  4W7Y A;  3TK1 A;  2KB7 P;  1W2E A;  5AVZ B;  1URQ D;  4HH2 A;  3BRT B;  1JY3 N;  2A45 G;  1FZC B;  3M9H A;  1X8Y A;  1RE3 C;  2L5G B;  4I6M C;  1N86 A;  5AVS B;  4IFM A;  3VN0 A;  1L4A D;  2NPS C;  2N1T B;  3MUD A;  5APU A;  3TNU A;  3WMM 0;  1XTG B;  1N7L A;  2KSJ A;  4WB4 A;  3BRV B;  2W6A A;  3HD7 A;  3BVH A;  1HBW A;  1OXZ A;  3A7O A;  3RK3 C;  4JYB A;  3NFQ A;  1RE4 A;  5AW4 B;  1RF1 A;  3HE5 A;  2OYH C;  5CCG C;  3PP5 A;  2KYV A;  1EQ7 A;  2XZR A;  3RK2 D;  1M7L A;  5APT A;  1M1J B;  2JEE A;  1RF1 B;  1JCC A;  3HE5 B;  2P7J A;  3KQG A;  3MIW A;  1NTZ K;  1PFI A;  1GTW A;  2IPP A;  4DOJ A;  2IFM A;  1LTJ C;  1IFI A;  1T3U A;  2Q7C A;  4C7R A;  2Q3I A;  2Q5U A;  1G2C A;  3EFG A;  3M9B A;  5CJ0 A;  3V2R A;  1FJK A;  1FZG A;  1SQV K;  3P8C D;  2QM7 A;  3RL0 C;  2E43 A;  1G2C B;  2WSE H;  3GHG C;  1GW3 A;  4LC1 A;  5AW8 B;  2LKM A;  4LGD E;  3V4W A;  1KIL D;  4JF7 A;  1HGV A;  5APW A;  3HE4 A;  3B5N A;  3H6P A;  4WY4 A;  3VOP A;  1E5W A;  4DZO A;  1H89 A;  5AVU B;  1MV8 A;  1GK4 A;  3HE4 B;  5CCH D;  3B5N B;  2H8P D;  1URQ C;  1JO5 A;  3OJA B;  2XV5 A;  4C46 A;  1NKN A;  3M06 A;  4GT1 A;  3TYY A;  2A45 H;  4KHX A;  2C0W A;  1T2K D;  2FFD C;  1JUN A;  2H43 A;  1SQB K;  1SVF A;  2BAS A;  3CI9 A;  5AVY B;  1N73 C;  1SFC D;  3OAK A;  1RE3 A;  2XU6 A;  5AW3 B;  1L4A C;  1G1I A;  3I5C A;  1FU1 A;  1ZR2 A;  4M3L A;  4N78 D;  2A45 I;  4N3Y B;  1IO4 A;  1NU1 K;  1DEB A;  1X79 B;  1GL2 B;  2FXM A;  3C9I A;  1GK6 A;  2NPS B;  3MGN A;  1FZC A;  1GU4 A;  3R2P A;  3HD7 D;  2KOG A;  2J59 M;  1H8A A;  4AYC A;  3RK2 C;  5AVW B;  1FOS E;  2FYU K;  3N4X A;  4GIF A;  2Z5H A;  2OYH A;  2E42 A;  5CCG A;  5AVV B;  3G3Z A;  4W80 A;  1HH0 A;  2N1T A;  3A2A A;  2YKO A;  1IFN A;  3RK3 B;  1GL2 C;  1N7S D;  3N7N A;  1AQ5 A;  3IR9 A;  2KLV A;  2OYH B;  2XNX A;  3P8C E;  2ZXE B;  2XKM A;  3LID A;  5AVR B;  2WSC H;  1LTJ A;  1HUC A;  5KJ7 D;  2YO2 A;  1NKZ B;  1JMM A;  2R3C A;  4Y99 B;  5BVZ A;  1S9K D;  3VYI A;  3OA7 A;  1J2J B;  3HUS C;  2WPS A;  1LTJ B;  1VDF A;  3NMD A;  1KIL C;  1QL2 A;  1M1J A;  3M91 A;  2GM4 A;  2WWW A;  3MTU E;  4RES B;  4OH8 B;  3GHG A;  4AQR D;  2M3B A;  2YMY A;  4I2L C;  2W27 A;  1CI6 B;  1FZE A;  1KQL A;  1SQP K;  3SWF A;  1GD2 E;  1RF0 C;  3EQ2 A;  3RL0 B;  5CCH C;  4Y99 C;  1YTZ I;  3GHG B;  1X9V A;  5AW2 B;  4WY4 D;  1JNM A;  4LLH A;  1T2K C;  2WPQ A;  1L0N K;  1G1J A;  3T97 A;  1URQ A;  2QM8 A;  3NXS A;  1NWQ A;  1NTM K;  3B8E B;  3M0D C;  1CZQ A;  1SFC C;  2GUS A;  1FOS F;  4N78 E;  1J1E C;  5AW9 B;  2FFD A;  3V2P A;  1XTC C;  1N73 A;  1URQ B;  1SQQ K;  4AUW A;  1CSB A;  2FFD B;  2OYI C;  2O1K A;  1N73 B;  1T8Z A;  2W6B A;  4HYT B;  1LT9 C;  1L4A B;  1FBM A;  3L4F A;  2P67 A;  1JCD A;  3HD7 C;  2YNY A;  5AVT B;  2O1J A;  2ZFC A;  2YO3 A;  2WPR A;  1LTG C;  1RE4 C;  5AW6 B;  2GUV A;  2P2U A;  3KYQ A;  1LWU C;  1N2D C;  1IFD A;  1YTZ T;  1FDM A;  4N6J A;  1N7S C;  3U1C A;  5APX A;  1J1D C;  1GW4 A;  1SP4 A;  3V2N A;  1CW5 A;  1S9K E;  2N1T D;  1NHL A;  4JYC A;  1GL2 A;  3V2Q A;  2PAJ A;  1FJP A;  3II6 A;  2HOD A;  5AW7 B;  3RK2 B;  5KJ7 C;  3A3Y B;  4C7N A;  4EOT A;  2NPS A;  2R32 A;  5CHX A;  3P32 A;  4W7Z A;  3BAT A;  3VMZ A;  5BU5 A;  2JJL A;  1LGH B;  1VPC A;  2HOD B;  1DX7 A;  4C7N B;  3VP9 A;  1LTS C;  3HUS A;  1JOC A;  2WT7 A;  2O01 H;  1KIL A;  2VRS A;  2R5D A;  1FZA A;  5APS A;  1IFJ A;  2H7H A;  4ZKU A;  3HUS B;  2CPS A;  2WT7 B;  1KIL B;  1RF0 A;  2MJZ A;  5CCH A;  2Q9I A;  1GDT A;  1HJB A;  3P8M C;  3M0A A;  2Z5I A;  4EIJ A;  3VMX A;  5AVQ B;  1WT6 A;  3M9Q A;  3M0D A;  1SFC A;  3KPE A;  3O8Z A;  1HGZ A;  3A5T A;  1CI6 A;  5APY A;  2C9N Y;  1HTL C;  2XDJ A;  3V4Q A;  2KP8 A;  2N9B A;  1DH3 A;  3IFM A;  1SFC B;  2HPC A;  1NAF A;  1J1E B;  5AW0 B;  2OYI A;  1KZU B;  1NOH A;  1GU5 A;  1OWA A;  5AW1 B;  2J58 A;  2FKW B;  3B5N D;  1LT9 A;  2HG5 D;  3HRN A;  2HPC B;  1FAV A;  4WBA A;  1FZC C;  2OYI B;  2YKP A;  1H88 A;  1ZR4 A;  1JY2 O;  1JTH A;  1NO4 A;  2HLO A;  1AFO A;  3TNU B;  2FYZ A;  1LT9 B;  4XA4 A;  1ZLL A;  1MZ9 A;  1WRG A;  2WZ7 A;  3VTP C;  3BAS A;  1LWU A;  2Z4E A;  3HD7 B;  1JY3 O;  2N1T C;  3LIE A;  1JTH B;  1JY2 P;  1N7S A;  5CMZ A;  5APQ A;  2C9L Y;  1L4A A;  1IK9 A;  5AVX B;  1A02 F;  1LWU B;  1Z56 A;  2WTY A;  4B86 A;  5KJ7 A;  2M8R A;  1GL2 D;  1JY3 P;  3CLQ A;  1A02 J;  1N7S B;  2POH A;  3CL3 D;  1J1D B;  3KDP B;  2NPS D;  1LTI C;  2P1J A;  4ZKP A;  2HYN A;  1GZL A;  2WSF H;  1SQX K;  1SLQ A;  3MD0 A;  2HFE D;  3V5B A;  1M1J C;  4XE5 B;  1RF1 C;  1NTK K;  3TSI A;  1MUU A;  3RK3 D;  4GKG A;  3H32 A;  5KLV K;  5CCG D;  4IFF A;  1IC2 A;  2C0X A;  5APV A;  2IFN A;  1QL1 A;  3P7K A;  3VP8 A;  5CJ4 A;  2CPB A;  2IX7 C;  1T3J A;  3NTN A;  3L35 A;  3H32 B;  1L0L K;  2WIT A;  2PP6 A;  5KTB A;  1KFM A;  1LTT C;  1KFN A;  4WY4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...