3E1IA

Crystal structure of bbetad432a variant fibrinogen fragment d with the peptide ligand gly-his-arg-pro-amide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
QLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Fibrinogen variant BbetaD432A has normal polymerization but does not bind knob "B".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 15
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3e1iA00
1LT9C 1W2EA 3HUSA 1N73C 1FZCC 1FZFA 2HODA 1LT9B 2OYIA 1LWUC 1T3UA 2FFDC 1N73B 1RE4C 2A45G 3H32B 1FZCB 1JY3O 1RE3C 1RF1C 1JY3P 1LWUB 2FFDB 2A45I 1LT9A 1LTJC 1M1JC 1N73A 3BVHA 3H32A 1FZCA 1RF1B 2OYHC 1LWUA 2FFDA 1FZAA 1FZBA 1RE4A 2H43A 1LTJB 1M1JB 2A45H 1RE3A 2XNXA 3GHGC 2OYHB 1JY2O 1JY3N 1JY2P 1RF1A 2Z4EA 1RF0C 3GHGB 1FZGA 1N86A 1LTJA 1M1JA 2HPCB 2OYHA 1FZEA 3HUSC 2HLOA 3GHGA 2Q9IA 3E1IA 2HPCA 2OYIC 1JY2N 3HUSB 2HODB 1RF0A 2OYIB
chains in the Genus database with same CATH superfamily
2KSJA 5TISE 5APQA 3PRJA 4DJGA 3A2AA 1SQPD 1KQFB 3EFGA 1NTME 4EIJA 5AVRB 5CBNA 2CK3H 4DZOA 2IFMA 1NTKK 1SQVG 2IZ1A 2K88A 2V7QH 4JPZB 1HGZA 1G2CA 1IFMA 1GL2C 4GIFA 1PL5A 1NTZK 3HE5A 1JNMA 2ZXXA 1GK4A 2AXTH 1SQVJ 1S5LE 4A7PA 3B4SA 1K8AQ 1JCCA 4KJMA 3VN0A 2GUSA 1YQ4C 3PH0A 1JUNA 1KFMA 3CLQA 4W7ZA 5AW8B 1N7SD 3R4YA 3L36A 2I8DA 2KZJA 3AEFC 2FYUE 3CMEP 1RF1A 4C7NB 4OGQB 1S4XA 1IFDA 3CCJP 3CD6P 1LJ2A 1DEBA 2R5DA 3D71A 1SFCB 2KLUA 5DJTB 3AEBC 2QA4P 1M8OB 4KT0J 1D7MA 4RO0A 1J1DB 2W6AA 2DW3A 5CCGA 1BSNA 2IDBA 4H0LD 3V5BA 4EYYQ 1KORA 5KAFH 3H1HG 4PV1D 2W8ZA 5CHXA 1RE4A 1N7SC 3PHLA 3H1IG 2QJYB 2ZVNB 2Q9IA 3H1HJ 4OVNF 2PFXA 3IAOA 5AW4B 3H1IJ 2G8YA 3S9OA 3GF7A 3H32A 1X9VA 1PFIA 1P84I 5APYA 2FYNB 2POHA 3Q5SA 3LIEA 4GKGA 1EDKA 2HLOA 2WT7A 1ZRTE 3MHVA 3KDPB 4H0LC 2I1JA 4NPDA 3AEDC 2B89A 2QE7H 3I56P 1BCCE 4WY4D 3L72E 3LW5H 1G2CB 3U1AA 4BWNA 3HE5B 2IYOA 1MKMA 2HFED 2KB7P 3BCCD 1YJNP 5CJ0A 2NPSA 1U57A 3ZDMA 1QVGO 2WQYC 1VQPP 1NWQA 1HWTC 1T3UA 3TK1A 2Q6QA 1SQBE 2KOGA 1SQVK 1FC2C 1SP4A 2QSIA 1OVRA 1OWAA 2QVAA 1DD3A 2BCCE 1N86A 5KAFE 5CBOA 2JR8A 3CCMP 2ZFCA 2ITAA 5KTBA 1RH5B 4JYBA 4GT1A 4AYCA 1VQ7P 1AVOA 4L73A 2C0WA 2KIKA 1RF1B 2O3JA 1CW5A 1AFOA 2RH0A 5KKZC 4WY4C 2K9JB 3BRTB 3GG2A 1GU4A 1Y47A 4OGQD 1IC2A 3VOPA 1HTLC 1SQXG 5AW1B 2JEEA 1FDIA 3L75G 2J5UA 1SFCD 1Q82Q 4L74A 4O9BA 4WBAA 4L75A 2JO1A 1PP9G 3L73E 1ZN5A 1SQXJ 1KV4A 3L75J 2Q5UA 3L37A 1HGVA 3AE3C 3GLMA 2JWDA 1R8EA 1PP9J 1AVYA 1IFNA 1PPJE 3P8MC 3CPWO 1H88A 5APUA 3H1JG 2W6BA 4WVZA 3MGNA 1PGJA 3H1KG 3AE4C 3HE4B 1LTTC 3H32B 1SQPG 1WMKA 3Q5PA 4OGQC 3H1JJ 2FYUD 3H1KJ 3RBZA 1W5CE 2WT7B 4YPCA 3E1IA 1SQPJ 1LT1A 3Q3DA 4EOTA 1J1DC 2WITA 1FAVA 2YXQB 1FDOA 1NOHA 2O01J 1JY2P 2OTLP 1KYOH 2NPSB 2R44A 1OZHA 4JYCA 2FKWB 2XKMA 3IR9A 4HYTB 2KK7A 4HJGH 2D2CB 2QJYC 3AEEC 5KJ7A 1EC5A 3G4SP 1VQKP 4IL6H 2K1AA 5KLIB 4D6TE 3CCLP 2N1TC 2Q7CA 3MUDA 2FYNC 1LP1A 2YIUB 2BEZF 2R32A 4U3FE 2QG4A 3HUSB 1M90Q 2KSEA 1OVUA 3BATA 1ZRTD 3N7NA 3Q2YA 2FXMA 1K04A 5AVWB 3F5HA 1LT9A 2BEQD 1PGPA 3B8EB 2RKLA 3SFDC 2XNDH 1LTJA 5KLVE 3L72D 2E74C 3B5NA 4R4MA 1VQ5P 1JY2N 4DOJA 2H7HA 5CCGD 1S5LX 1SQXK 4YTPC 1KYOE 3AECC 1SQBD 1PV3A 2Y0EA 1RE3A 1DX7A 1NTKE 2PRRA 2BCCD 1NJIQ 2IFNA 2WPVB 3GMAA 1EZVE 2K3RA 4HH2A 2ZT9B 3W67A 4K3AA 2H8PD 1RF1C 1NKZB 3H25A 2YNYA 2LKMA 2OQQA 2XV5A 1T2KD 1IO4A 1KB9D 2KXPB 1KQGB 3BCCG 1SQPK 1CZQA 4PD4D 2FFDB 5GTIE 3A0BE 2Y9YA 5GTHE 2ZJSE 2M8RA 4RKUJ 3BCCJ 1FZGA 4BXLA 1XTCC 4PV1B 2FYZA 1EXIA 2YKOA 1KQSO 3L73D 1LWUB 3A3YB 2NPSD 3KHUA 1FZBA 1AA0A 1JTHA 3G71P 2RMZA 2B87B 2IBZI 1IK7A 1PPJD 3IN6A 5AW7B 1PGQA 2NZ2A 1KFNA 3LIDA 4UB8H 1USEA 2C0XA 2KLVA 1JMBA 2O01N 3IFMA 1LP1B 2XNXA 2WZ7A 2XDJA 4ZNCA 4U7JA 2E76B 3H1KD 1URQA 2LXCB 1LT9B 3L74E 2OYIA 2KS1A 3VP9A 1NTMJ 3TYYA 1L0LD 1LTJB 1Q90D 1L4AA 2WSEJ 1KN7A 3B5NB 3NXSA 1UIIA 3USSA 3RBXA 1RF0A 1HF9A 4I7ZC 1Y9BA 3RK3B 2D2CC 1ZP0C 1EDIA 3CWBD 3AEGC 2FYUG 2OYHA 2C9LY 1LTIC 1FU1A 3OJAB 5KLIC 2R3CA 2MKVA 1RQUA 3CXHD 2JKVA 2FYUJ 4D6TD 2YIUC 1SQVE 2PGDA 1KTMA 3WUUA 2ZT9D 1P84H 3HUSC 4Z1MH 4U3FD 4I1LA 3SWKA 2ZYDA 1ZR2A 2MJZA 3FWLA 3PTZA 2ZAEB 3CCQP 4W80A 3TNUA 5AW6B 4UB6H 1KQLA 1VQLP 2WSSH 3C9IA 5KLVD 3CCEP 3QH9A 2BASA 2WSCJ 2P58A 2V7QJ 5BU5A 3C8VA 1YHQP 3S1KA 2K9YA 1RHZB 3VMZA 1JTHB 4WWIA 3AE2C 3L4FA 3D70A 1GK6A 3KQGA 1ZMEC 2AXTE 2YXRB 2ZXEB 2E43A 1J1EB 3CX5D 1EDLA 3TGUE 2ZT9C 2A06E 5KJ7D 1JOCA 1JM0A 1EZVD 1UIXA 4ASVA 5APTA 1NAFA 1XTGB 2Z5IA 3R2PA 1MUUA 1IFJA 1KILA 3A0HH 1VPCA 1BCCG 2VRSA 3FGAD 1CI6B 3L72G 3G9RA 1URQB 2YMYA 2OYIB 2KS1B 1QGKB 2RN0A 2GA1A 2FFDC 1HBWA 1BCCJ 2QJKB 1Q7YQ 1L4AB 5L8RJ 1RQVA 3WUTA 3L72J 1HVVA 1SQBG 3H1IE 2E76D 4PV1C 1QEXA 3RL0B 3CMAP 1VQ4P 3A5TA 4H13B 2BCCG 4R4LA 3PLNA 4UB6E 4LC1A 1SQBJ 3VMXA 1LWUC 5AW5B 2Y9ZA 3L70D 3B5ND 1A02J 1NHLA 1OVVA 2BCCJ 4ZMDA 2OYHB 3MD0A 2QRXA 2OARA 3ABVC 3RK3D 1DIPA 3AE5C 3MUDC 1IFPA 3OA7A 1ZXGA 1U7MA 1LTGC 4H44B 2FYUK 1M57D 5KAIH 5M1BA 2E75B 3FXDA 3M0DC 1KILE 4GOEA 3NMDA 2K37A 1LT9C 2WSFH 2WWWA 4N6JA 1KB9I 4XE5B 2YMKA 4MN4C 3TNUB 1GU5A 3L73G 3D6ZA 1LTJC 3CCVP 4PD4I 1MFZA 1VDFA 5TJHA 2P67A 1SQQE 1YTZT 1VQ6P 3B5NC 3BASA 2HG5D 1NTMD 1T6AA 2O1KA 4YXWH 3AE6C 3L73J 1PPJG 2W27A 3AEAC 3RK3C 2O01H 4C46A 3CC2P 1PZQA 1ZW0A 4N78E 3SFEC 2IYPA 3WMM0 1VQ8P 1X79B 3WUVA 3AE7C 3GHGA 2PP6A 1EDJA 3SWYA 2FBWC 2A45G 4Y28J 3L75E 3JSVC 1KILB 2IZ0A 3CXHH 1L0LG 1AJYA 1TU3F 1BDDA 1PP9E 3RGUA 5KAIE 2WPQA 3CI9A 2OTJP 1L0LJ 1SFCC 1FOSF 4QMAA 2NRGA 2A45I 2H88C 1URQD 2J58A 1DD4A 3H1JE 3CWBG 3ITKA 1L4AD 1L0NE 1SQBK 1SQPE 3VMYA 3FX0A 3CWBJ 2P1JA 2XZRA 3RL0D 4M3LA 2Q3EA 4H13D 4D6TG 2E5TA 1VQ9P 5APWA 1OFCX 1JY2O 1J1EC 1BE3E 3QWOC 3L71E 4U3FG 1T8ZA 2GUVA 4D6TJ 3TGUD 1YJ9P 3P7KA 1AV1A 1H89A 3CXHI 5DJUB 5AVUB 1X22A 3VMAA 5CCHA 4U3FJ 3I5CA 1QL2A 1URQC 4DCKA 4PJ0H 4L76A 4H44D 5KLVG 2PAJA 1N8RQ 1H0TA 4LLHA 3FWNA 2HODA 4Y99B 2QJKC 5H2FH 2E75D 5AVZB 1L4AC 1Y8AA 4AUWA 4N3YB 2XU6A 1NU1E 1NGMB 3NTNA 1QVFO 1M56D 5KLVJ 3Q1MA 3RL0C 1BCCD 1QL1A 1RF0C 4H13C 3CC4P 2AXCA 1PGOA 3MZWB 5AVVB 1EZVG 2UWJE 4GOFA 1BGYE 2OYHC 2WPSA 3GF3A 4GDOA 3V2RA 3H1LE 3GHGB 2KUBA 3JCUH 1YITP 1QLED 3N4XA 2M0BA 2P7JA 3CX5I 4LGDE 1JB0J 3EWKA 3RL0g 1NTZE 4H44C 1FDMA 1LTAC 1Q86Q 2LXBA 1MV8A 1EZVI 3P8CE 2E75C 3WU2H 1FZAA 4IL6E 2Y0DA 1OIPA 1M1KQ 5BU8B 1U7JA 1KILD 3I55P 1T3JA 1L0LK 3L70G 4PJ0E 2P2UA 5AW3B 5CCGC 3AE1C 1GW4A 5H2FE 1EQ7A 1SQQD 2L5GB 1S72P 2WMMA 1FJKA 3L70J 1W2EA 1OMIA 1NYHA 1RE4C 2WSEH 4JF7A 3PJSK 1JY3P 2QM8A 2GM4A 3GW6A 3V4QA 2Q1KA 3BCCE 4TLFA 2E42A 3TF5A 3M9QA 3KYQA 1T2KC 2HYNA 3JCUE 4DT0A 1OX3A 2IBZE 3L74G 1K73Q 5AW9B 3II6A 3HD7A 1AQTA 1YQ3C 4IFDK 1NTMG 5AVYB 2KP8A 4OH8B 1H0TB 3WU2E 2HODB 2QJPB 3L74J 1M7LA 2KI7B 5C39A 1N73A 1SS1A 2E5YA 2N1TA 5KLVK 3KPEA 2NPSC 1R5LA 2M5AA 1FZEA 1BDCA 3B71A 1HUCA 2W6JH 2WPRA 1ZV8A 2IPPA 1S9KE 1L0ND 3CC7P 1MFTA 3TSIA 1NO4A 1G1JA 4HKZH 4CPGA 2Q3IA 3VYIA 2V4HA 1JY3N 1KD1Q 2WSCH 1BE3D 2G3AA 3L71D 1GTWA 1VF5B 3RK2B 2H43A 1USDA 4UB8E 5AVQB 2H89C 4XA4A 1S1CX 4IFMA 2HPCA 3IF4A 3C1LA 4Y99C 1GW3A 3CCRP 1G1IA 4EDFA 1GMJA 1ZLLA 1NU1D 3JC22 3HTKA 1YJWP 2OYOA 3MTUE 1N7LA 5E79H 1FOSE 2K9JA 2M3BA 3TGUG 1ZR4A 1EXJA 2A06G 3KZIH 3VP8A 5APXA 1FZCA 2AEMA 1KYOD 1GZLA 2LR2A 5AW0B 1BGYD 3GHGC 2WVRA 3MIWA 4WB4A 5EFWB 3V4WA 1M1JA 3TGUJ 1MZ9A 3H1LD 1NTKD 2Y0CA 1NKNA 1NTZD 3HD7B 3U59A 1E79H 3P8CD 1OXZA 2N9YB 2W90A 3L35A 5CCHD 1PIXA 4GODA 2SPZA 2JP3A 3H1HE 5B66H 3UIAA 1N73B 1P84E 3G3ZA 1KB9H 1NTMK 3HE4A 2N1TB 2JJLA 1YIJP 1H8AA 2M5AB 4PD4H 1YTZI 1SVFA 1FBMA 1FZFA 3AE9C 3M9HA 5K5GB 5E79E 1WT6A 4RESB 5KJ7C 1L2PA 1VQMP 3OW2O 3KZIE 2QM7A 2E74B 3G6EP 3EQ2A 2Z5HA 1OW8A 5CCHC 3OAKA 5APVA 1IJDB 1GL2A 1HJBA 2IBZD 1Q2NA 2L91A 1Q81Q 1X0TA 1AQ5A 3CL3D 4EI2A 2HPCB 1SQQG 3O8ZA 3M0AA 4NPFX 2QJPC 3T97A 2E76C 1VF5D 3M9BA 3RK2D 1WRGA 3A0HE 1SQQJ 3L74D 1KMIZ 4C7RA 3HTKB 2A45H 5B66E 3W68A 1KB9E 5APSA 4NPEA 1S3JA 3AE8C 3LW5J 4PD4E 3HUSA 1FE6A 2QIWA 2KZIA 1FZCB 1RE3C 3CCSP 1S9KD 2KNCA 3HRNA 1M1JB 1CSBA 3KXDA 2M3EA 3VTPC 1VQNP 4BRYA 3O6QA 1N2DC 3S4RA 2I1KA 1SLQA 4IL6X 3K5BA 2KYVA 1VF5C 1SQXE 2AEJA 3RK2C 4JBZA 1SQVD 5CMZA 1KC8Q 2JDIH 1N7SA 3HD7D 3FXEA 2ZYGA 1R5SA 5AW2B 1GD2E 3F89A 2R3SA 1L0NG 1J2JB 2WSFJ 3SWFA 1JEKA 2HR3A 1LNQA 4KHXA 1L0NJ 1JO5A 1Z56A 2FY8A 2P10A 3H1KE 1RY3A 1BE3G 4B86A 2N1TD 3D6YA 3L71G 1YYCA 5AVTB 1ZOYC 1L0LE 2C9NY 3E7KA 2AEFA 2FFDA 1BE3J 2R5BA 3L71J 1OW7A 2OTKE 1FS0E 1GL2B 4I7ZB 1E5WA 4I6MC 3V2NA 5BVZA 3CX5H 3HD7C 2A06D 1IFIA 3E1RA 3CWBE 1LWUA 1NU1G 2E74D 4AQRD 1NAYA 4ZKUA 5B5EH 1S2EA 3T97B 2B87A 4OWFA 5AVSB 2OYIC 1JMMA 3M91A 3CXHE 4TT3H 1N73C 1NVOA 1NU1J 3H1HD 2QEXP 4YXDC 1DH3A 1SQQK 1FJPA 1P84D 2YKPA 1BGYG 3P32A 3H1ID 5GTIH 3H1LG 3A0BH 3M0DA 5GTHH 1LTBC 1X8YA 1NTKG 4WY4A 2FXOA 3TDKA 2KNCB 1BSHA 3SSUA 1BGYJ 1DEEG 1NTZG 3H1LJ 1KZUB 1VQOP 1KYOI 1NTKJ 1IK9A 4BRYB 3O6QB 3A7OA 1A02F 1OW6A 1YI2P 1NTZJ 4JQ0D 1N7SB 3CX5E 2OGUA 2JWAA 2YO2A 3M06A 2Z4EA 4HB1A 1QX8A 5B5EE 3NFQA 1K9MQ 2WTYA 5TISH 4RJTA 4I2LC 4C7NA 1L0NK 3BRVB 4W7YA 5CJ4A 1FZCC 2IX7C 4H0LB 5AVXB 1HJ0A 1M1JC 2YO3A 1SFCA 2IBZG 1W2BO 4N78D 2CPBA 3MP7B 4XFJA 2W83C 1K05A 1YBKA 3L70E 1JCDA 1S5LH 2B9BA 2B88A 3CCUP 1LGHB 1JY3O 1KILC 3BVHA 2O1JA 4K35A 1SQXD 4ZKPA 3L75D 3RK3E 4IFFA 3H6PA 1GL2D 2N9BA 1NH4A 3EFFK 1GDTA 3U1CA 4ASWA 2ZYAA 1PP9D 3V6IA 2FXPA 3PP5A 1NU1K 2D2CD 1LTSC 2J59M 4IOIH 1IZNB 2ZVOB 1VL2A 3V2PA 3V2QA 2YKQA 3Q5RA 1CI6A 2CPSA 5KKZB 4WY4B 3H1JD 1HH0A
chains in the Genus database with same CATH topology
2KSJA 2H7HA 5CCGD 3UIAA 1SQXK 5APQA 1N73B 2A45G 3G3ZA 3A2AA 1NTMK 3HE4A 1KILB 2N1TB 2JJLA 3EFGA 4EIJA 5AVRB 1RE3A 1H8AA 4DZOA 2IFMA 1NTKK 1DX7A 1YTZI 1SVFA 1FBMA 2IFNA 1HGZA 2WPQA 1G2CA 1IFMA 3CI9A 1GL2C 4GIFA 1NTZK 3HE5A 4HH2A 1JNMA 1FZFA 3M9HA 1SFCC 1GK4A 1FOSF 1WT6A 2H8PD 1RF1C 4RESB 1NKZB 2A45I 5KJ7C 2YNYA 2LKMA 1URQD 2J58A 2XV5A 1JCCA 1T2KD 3VN0A 2GUSA 2QM7A 1IO4A 1L4AD 1JUNA 1SQPK 1KFMA 3CLQA 4W7ZA 1CZQA 1SQBK 3EQ2A 2Z5HA 5AW8B 3VMYA 5CCHC 3OAKA 1N7SD 5APVA 2P1JA 1IJDB 1GL2A 2XZRA 3L36A 3RL0D 1HJBA 2FFDB 4M3LA 5APWA 2M8RA 1JY2O 1RF1A 1AQ5A 1J1EC 3CL3D 4C7NB 1FZGA 2HPCB 3O8ZA 1IFDA 1XTCC 3M0AA 2FYZA 3T97A 1DEBA 1T8ZA 3M9BA 2GUVA 2R5DA 2YKOA 3RK2D 1WRGA 3P7KA 1SFCB 1LWUB 1H89A 3A3YB 2NPSD 5AVUB 4C7RA 3HTKB 1FZBA 2A45H 5CCHA 1JTHA 1J1DB 2W6AA 5CCGA 3I5CA 1QL2A 1URQC 5APSA 5AW7B 3V5BA 1KFNA 2PAJA 3LIDA 3HUSA 4LLHA 2C0XA 2HODA 4Y99B 1JY2N 2KLVA 5AVZB 1L4AC 1FZCB 4AUWA 1RE3C 1S9KD 4N3YB 3IFMA 2XU6A 3NTNA 3HRNA 5CHXA 1RE4A 1M1JB 1N7SC 1CSBA 2XNXA 3RL0C 1RF0C 1QL1A 2WZ7A 2XDJA 3VTPC 2Q9IA 5AVVB 1N2DC 2I1KA 1SLQA 1URQA 1LT9B 2OYIA 3VP9A 2KYVA 3TYYA 3RK2C 5AW4B 2OYHC 3H32A 1X9VA 2WPSA 1PFIA 1LTJB 1L4AA 5APYA 3V2RA 2POHA 3LIEA 3B5NB 3GHGB 3NXSA 5CMZA 4GKGA 2HLOA 1N7SA 3N4XA 2WT7A 1RF0A 3HD7D 2P7JA 4LGDE 5AW2B 1GD2E 3KDPB 2I1JA 1FDMA 1J2JB 1LTAC 3RK3B 1MV8A 3P8CE 4WY4D 3SWFA 1FZAA 3LW5H 2OYHA 2C9LY 1G2CB 4KHXA 1JO5A 1Z56A 3U1AA 3HE5B 1RY3A 1LTIC 2HFED 2KB7P 5BU8B 4B86A 1KILD 2N1TD 2NPSA 5CJ0A 1FU1A 3OJAB 1T3JA 2R3CA 1NWQA 1HWTC 1L0LK 1T3UA 1YYCA 5AVTB 3TK1A 2C9NY 2KOGA 1SQVK 2P2UA 5AW3B 1SP4A 5CCGC 2FFDA 2R5BA 1GW4A 1OWAA 1EQ7A 2L5GB 1N86A 3HUSC 2ZFCA 5KTBA 1FJKA 4JYBA 4I1LA 4GT1A 1W2EA 4AYCA 1ZR2A 1GL2B 1E5WA 4I6MC 3V2NA 2MJZA 5BVZA 1RE4C 3HD7C 2WSEH 4JF7A 1IFIA 1JY3P 2QM8A 2C0WA 4W80A 3TNUA 1RF1B 1LWUA 5AW6B 2GM4A 3V4QA 1CW5A 1AFOA 4AQRD 4ZKUA 1KQLA 4WY4C 3C9IA 2E42A 5AVSB 2OYIC 2BASA 1JMMA 3M91A 3M9QA 3KYQA 1N73C 3BRTB 1T2KC 2HYNA 1GU4A 5BU5A 3VOPA 1IC2A 1HTLC 1DH3A 1SQQK 3VMZA 1JTHB 1FJPA 5AW9B 3L4FA 3II6A 5AW1B 1GK6A 2JEEA 2YKPA 3KQGA 3HD7A 3P32A 4IFDK 2ZXEB 5AVYB 2E43A 1J1EB 2KP8A 1SFCD 4OH8B 3M0DA 1LTBC 1X8YA 2HODB 4O9BA 4WBAA 1M7LA 4WY4A 1ZN5A 5KJ7D 1JOCA 2Q5UA 3L37A 5APTA 1HGVA 1NAFA 1N73A 1XTGB 2Z5IA 1KZUB 3R2PA 1MUUA 1IFJA 1KILA 2N1TA 5KLVK 3KPEA 1IK9A 1VPCA 2VRSA 1CI6B 1IFNA 2NPSC 3P8MC 1FZEA 1H88A 5APUA 3A7OA 1A02F 1URQB 1HUCA 2W6BA 2YMYA 2WPRA 3MGNA 2OYIB 1ZV8A 2IPPA 1S9KE 2FFDC 3TSIA 1NO4A 3HE4B 1LTTC 3H32B 1G1JA 1HBWA 1L4AB 2Q3IA 1HVVA 3VYIA 1JY3N 1N7SB 3RL0B 2WT7B 3A5TA 2WSCH 2YO2A 3M06A 3E1IA 2Z4EA 4LC1A 3VMXA 1LWUC 5AW5B 3NFQA 3B5ND 4EOTA 1A02J 1GTWA 2WTYA 1J1DC 3RK2B 1NHLA 2WITA 1FAVA 2H43A 2OYHB 3MD0A 1NOHA 5AVQB 1JY2P 2OARA 4XA4A 4IFMA 2NPSB 4I2LC 4C7NA 3RK3D 1L0NK 2HPCA 3BRVB 4W7YA 4Y99C 4JYCA 1GW3A 1G1IA 5CJ4A 1FZCC 2FKWB 2XKMA 3OA7A 3IR9A 1ZLLA 2IX7C 1LTGC 2FYUK 5AVXB 4HYTB 1M1JC 2YO3A 1SFCA 4N78D 3HTKA 3M0DC 3MTUE 5KJ7A 1N7LA 1FOSE 2CPBA 3NMDA 1LT9C 2WSFH 2WWWA 1JCDA 2M3BA 4N6JA 4XE5B 1ZR4A 3TNUB 1LGHB 1GU5A 1JY3O 3VP8A 1KILC 2N1TC 2Q7CA 3MUDA 1LTJC 3BVHA 2O1JA 5APXA 1FZCA 1MFZA 1GZLA 1VDFA 5AW0B 2P67A 4ZKPA 1YTZT 3B5NC 3GHGC 3BASA 3MIWA 4WB4A 2HG5D 2R32A 3V4WA 4IFFA 3H6PA 1GL2D 1M1JA 2N9BA 2O1KA 1NH4A 1MZ9A 1GDTA 3HUSB 2W27A 3U1CA 3BATA 3RK3C 3PP5A 3N7NA 1NU1K 2FXMA 5AVWB 1NKNA 1LTSC 2O01H 4C46A 1LT9A 2J59M 3HD7B 3U59A 4N78E 3WMM0 3P8CD 1X79B 1OXZA 3B8EB 3V2PA 3V2QA 1LTJA 2YKQA 1CI6A 2CPSA 3L35A 4WY4B 3B5NA 3GHGA 2PP6A 1HH0A 5CCHD 4DOJA 3SWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 C;  1W2E A;  3HUS A;  1N73 C;  1FZC C;  1FZF A;  2HOD A;  1LT9 B;  2OYI A;  1LWU C;  1T3U A;  2FFD C;  1N73 B;  1RE4 C;  2A45 G;  3H32 B;  1FZC B;  1JY3 O;  1RE3 C;  1RF1 C;  1JY3 P;  1LWU B;  2FFD B;  2A45 I;  1LT9 A;  1LTJ C;  1M1J C;  1N73 A;  3BVH A;  3H32 A;  1FZC A;  1RF1 B;  2OYH C;  1LWU A;  2FFD A;  1FZA A;  1FZB A;  1RE4 A;  2H43 A;  1LTJ B;  1M1J B;  2A45 H;  1RE3 A;  2XNX A;  3GHG C;  2OYH B;  1JY2 O;  1JY3 N;  1JY2 P;  1RF1 A;  2Z4E A;  1RF0 C;  3GHG B;  1FZG A;  1N86 A;  1LTJ A;  1M1J A;  2HPC B;  2OYH A;  1FZE A;  3HUS C;  2HLO A;  3GHG A;  2Q9I A;  3E1I A;  2HPC A;  2OYI C;  1JY2 N;  3HUS B;  2HOD B;  1RF0 A;  2OYI B; 
#chains in the Genus database with same CATH topology
 2KSJ A;  5TIS E;  5APQ A;  3PRJ A;  4DJG A;  3A2A A;  1SQP D;  1KQF B;  3EFG A;  1NTM E;  4EIJ A;  5AVR B;  5CBN A;  2CK3 H;  4DZO A;  2IFM A;  1NTK K;  1SQV G;  2IZ1 A;  2K88 A;  2V7Q H;  4JPZ B;  1HGZ A;  1G2C A;  1IFM A;  1GL2 C;  4GIF A;  1PL5 A;  1NTZ K;  3HE5 A;  1JNM A;  2ZXX A;  1GK4 A;  2AXT H;  1SQV J;  1S5L E;  4A7P A;  3B4S A;  1K8A Q;  1JCC A;  4KJM A;  3VN0 A;  2GUS A;  1YQ4 C;  3PH0 A;  1JUN A;  1KFM A;  3CLQ A;  4W7Z A;  5AW8 B;  1N7S D;  3R4Y A;  3L36 A;  2I8D A;  2KZJ A;  3AEF C;  2FYU E;  3CME P;  1RF1 A;  4C7N B;  4OGQ B;  1S4X A;  1IFD A;  3CCJ P;  3CD6 P;  1LJ2 A;  1DEB A;  2R5D A;  3D71 A;  1SFC B;  2KLU A;  5DJT B;  3AEB C;  2QA4 P;  1M8O B;  4KT0 J;  1D7M A;  4RO0 A;  1J1D B;  2W6A A;  2DW3 A;  5CCG A;  1BSN A;  2IDB A;  4H0L D;  3V5B A;  4EYY Q;  1KOR A;  5KAF H;  3H1H G;  4PV1 D;  2W8Z A;  5CHX A;  1RE4 A;  1N7S C;  3PHL A;  3H1I G;  2QJY B;  2ZVN B;  2Q9I A;  3H1H J;  4OVN F;  2PFX A;  3IAO A;  5AW4 B;  3H1I J;  2G8Y A;  3S9O A;  3GF7 A;  3H32 A;  1X9V A;  1PFI A;  1P84 I;  5APY A;  2FYN B;  2POH A;  3Q5S A;  3LIE A;  4GKG A;  1EDK A;  2HLO A;  2WT7 A;  1ZRT E;  3MHV A;  3KDP B;  4H0L C;  2I1J A;  4NPD A;  3AED C;  2B89 A;  2QE7 H;  3I56 P;  1BCC E;  4WY4 D;  3L72 E;  3LW5 H;  1G2C B;  3U1A A;  4BWN A;  3HE5 B;  2IYO A;  1MKM A;  2HFE D;  2KB7 P;  3BCC D;  1YJN P;  5CJ0 A;  2NPS A;  1U57 A;  3ZDM A;  1QVG O;  2WQY C;  1VQP P;  1NWQ A;  1HWT C;  1T3U A;  3TK1 A;  2Q6Q A;  1SQB E;  2KOG A;  1SQV K;  1FC2 C;  1SP4 A;  2QSI A;  1OVR A;  1OWA A;  2QVA A;  1DD3 A;  2BCC E;  1N86 A;  5KAF E;  5CBO A;  2JR8 A;  3CCM P;  2ZFC A;  2ITA A;  5KTB A;  1RH5 B;  4JYB A;  4GT1 A;  4AYC A;  1VQ7 P;  1AVO A;  4L73 A;  2C0W A;  2KIK A;  1RF1 B;  2O3J A;  1CW5 A;  1AFO A;  2RH0 A;  5KKZ C;  4WY4 C;  2K9J B;  3BRT B;  3GG2 A;  1GU4 A;  1Y47 A;  4OGQ D;  1IC2 A;  3VOP A;  1HTL C;  1SQX G;  5AW1 B;  2JEE A;  1FDI A;  3L75 G;  2J5U A;  1SFC D;  1Q82 Q;  4L74 A;  4O9B A;  4WBA A;  4L75 A;  2JO1 A;  1PP9 G;  3L73 E;  1ZN5 A;  1SQX J;  1KV4 A;  3L75 J;  2Q5U A;  3L37 A;  1HGV A;  3AE3 C;  3GLM A;  2JWD A;  1R8E A;  1PP9 J;  1AVY A;  1IFN A;  1PPJ E;  3P8M C;  3CPW O;  1H88 A;  5APU A;  3H1J G;  2W6B A;  4WVZ A;  3MGN A;  1PGJ A;  3H1K G;  3AE4 C;  3HE4 B;  1LTT C;  3H32 B;  1SQP G;  1WMK A;  3Q5P A;  4OGQ C;  3H1J J;  2FYU D;  3H1K J;  3RBZ A;  1W5C E;  2WT7 B;  4YPC A;  3E1I A;  1SQP J;  1LT1 A;  3Q3D A;  4EOT A;  1J1D C;  2WIT A;  1FAV A;  2YXQ B;  1FDO A;  1NOH A;  2O01 J;  1JY2 P;  2OTL P;  1KYO H;  2NPS B;  2R44 A;  1OZH A;  4JYC A;  2FKW B;  2XKM A;  3IR9 A;  4HYT B;  2KK7 A;  4HJG H;  2D2C B;  2QJY C;  3AEE C;  5KJ7 A;  1EC5 A;  3G4S P;  1VQK P;  4IL6 H;  2K1A A;  5KLI B;  4D6T E;  3CCL P;  2N1T C;  2Q7C A;  3MUD A;  2FYN C;  1LP1 A;  2YIU B;  2BEZ F;  2R32 A;  4U3F E;  2QG4 A;  3HUS B;  1M90 Q;  2KSE A;  1OVU A;  3BAT A;  1ZRT D;  3N7N A;  3Q2Y A;  2FXM A;  1K04 A;  5AVW B;  3F5H A;  1LT9 A;  2BEQ D;  1PGP A;  3B8E B;  2RKL A;  3SFD C;  2XND H;  1LTJ A;  5KLV E;  3L72 D;  2E74 C;  3B5N A;  4R4M A;  1VQ5 P;  1JY2 N;  4DOJ A;  2H7H A;  5CCG D;  1S5L X;  1SQX K;  4YTP C;  1KYO E;  3AEC C;  1SQB D;  1PV3 A;  2Y0E A;  1RE3 A;  1DX7 A;  1NTK E;  2PRR A;  2BCC D;  1NJI Q;  2IFN A;  2WPV B;  3GMA A;  1EZV E;  2K3R A;  4HH2 A;  2ZT9 B;  3W67 A;  4K3A A;  2H8P D;  1RF1 C;  1NKZ B;  3H25 A;  2YNY A;  2LKM A;  2OQQ A;  2XV5 A;  1T2K D;  1IO4 A;  1KB9 D;  2KXP B;  1KQG B;  3BCC G;  1SQP K;  1CZQ A;  4PD4 D;  2FFD B;  5GTI E;  3A0B E;  2Y9Y A;  5GTH E;  2ZJS E;  2M8R A;  4RKU J;  3BCC J;  1FZG A;  4BXL A;  1XTC C;  4PV1 B;  2FYZ A;  1EXI A;  2YKO A;  1KQS O;  3L73 D;  1LWU B;  3A3Y B;  2NPS D;  3KHU A;  1FZB A;  1AA0 A;  1JTH A;  3G71 P;  2RMZ A;  2B87 B;  2IBZ I;  1IK7 A;  1PPJ D;  3IN6 A;  5AW7 B;  1PGQ A;  2NZ2 A;  1KFN A;  3LID A;  4UB8 H;  1USE A;  2C0X A;  2KLV A;  1JMB A;  2O01 N;  3IFM A;  1LP1 B;  2XNX A;  2WZ7 A;  2XDJ A;  4ZNC A;  4U7J A;  2E76 B;  3H1K D;  1URQ A;  2LXC B;  1LT9 B;  3L74 E;  2OYI A;  2KS1 A;  3VP9 A;  1NTM J;  3TYY A;  1L0L D;  1LTJ B;  1Q90 D;  1L4A A;  2WSE J;  1KN7 A;  3B5N B;  3NXS A;  1UII A;  3USS A;  3RBX A;  1RF0 A;  1HF9 A;  4I7Z C;  1Y9B A;  3RK3 B;  2D2C C;  1ZP0 C;  1EDI A;  3CWB D;  3AEG C;  2FYU G;  2OYH A;  2C9L Y;  1LTI C;  1FU1 A;  3OJA B;  5KLI C;  2R3C A;  2MKV A;  1RQU A;  3CXH D;  2JKV A;  2FYU J;  4D6T D;  2YIU C;  1SQV E;  2PGD A;  1KTM A;  3WUU A;  2ZT9 D;  1P84 H;  3HUS C;  4Z1M H;  4U3F D;  4I1L A;  3SWK A;  2ZYD A;  1ZR2 A;  2MJZ A;  3FWL A;  3PTZ A;  2ZAE B;  3CCQ P;  4W80 A;  3TNU A;  5AW6 B;  4UB6 H;  1KQL A;  1VQL P;  2WSS H;  3C9I A;  5KLV D;  3CCE P;  3QH9 A;  2BAS A;  2WSC J;  2P58 A;  2V7Q J;  5BU5 A;  3C8V A;  1YHQ P;  3S1K A;  2K9Y A;  1RHZ B;  3VMZ A;  1JTH B;  4WWI A;  3AE2 C;  3L4F A;  3D70 A;  1GK6 A;  3KQG A;  1ZME C;  2AXT E;  2YXR B;  2ZXE B;  2E43 A;  1J1E B;  3CX5 D;  1EDL A;  3TGU E;  2ZT9 C;  2A06 E;  5KJ7 D;  1JOC A;  1JM0 A;  1EZV D;  1UIX A;  4ASV A;  5APT A;  1NAF A;  1XTG B;  2Z5I A;  3R2P A;  1MUU A;  1IFJ A;  1KIL A;  3A0H H;  1VPC A;  1BCC G;  2VRS A;  3FGA D;  1CI6 B;  3L72 G;  3G9R A;  1URQ B;  2YMY A;  2OYI B;  2KS1 B;  1QGK B;  2RN0 A;  2GA1 A;  2FFD C;  1HBW A;  1BCC J;  2QJK B;  1Q7Y Q;  1L4A B;  5L8R J;  1RQV A;  3WUT A;  3L72 J;  1HVV A;  1SQB G;  3H1I E;  2E76 D;  4PV1 C;  1QEX A;  3RL0 B;  3CMA P;  1VQ4 P;  3A5T A;  4H13 B;  2BCC G;  4R4L A;  3PLN A;  4UB6 E;  4LC1 A;  1SQB J;  3VMX A;  1LWU C;  5AW5 B;  2Y9Z A;  3L70 D;  3B5N D;  1A02 J;  1NHL A;  1OVV A;  2BCC J;  4ZMD A;  2OYH B;  3MD0 A;  2QRX A;  2OAR A;  3ABV C;  3RK3 D;  1DIP A;  3AE5 C;  3MUD C;  1IFP A;  3OA7 A;  1ZXG A;  1U7M A;  1LTG C;  4H44 B;  2FYU K;  1M57 D;  5KAI H;  5M1B A;  2E75 B;  3FXD A;  3M0D C;  1KIL E;  4GOE A;  3NMD A;  2K37 A;  1LT9 C;  2WSF H;  2WWW A;  4N6J A;  1KB9 I;  4XE5 B;  2YMK A;  4MN4 C;  3TNU B;  1GU5 A;  3L73 G;  3D6Z A;  1LTJ C;  3CCV P;  4PD4 I;  1MFZ A;  1VDF A;  5TJH A;  2P67 A;  1SQQ E;  1YTZ T;  1VQ6 P;  3B5N C;  3BAS A;  2HG5 D;  1NTM D;  1T6A A;  2O1K A;  4YXW H;  3AE6 C;  3L73 J;  1PPJ G;  2W27 A;  3AEA C;  3RK3 C;  2O01 H;  4C46 A;  3CC2 P;  1PZQ A;  1ZW0 A;  4N78 E;  3SFE C;  2IYP A;  3WMM 0;  1VQ8 P;  1X79 B;  3WUV A;  3AE7 C;  3GHG A;  2PP6 A;  1EDJ A;  3SWY A;  2FBW C;  2A45 G;  4Y28 J;  3L75 E;  3JSV C;  1KIL B;  2IZ0 A;  3CXH H;  1L0L G;  1AJY A;  1TU3 F;  1BDD A;  1PP9 E;  3RGU A;  5KAI E;  2WPQ A;  3CI9 A;  2OTJ P;  1L0L J;  1SFC C;  1FOS F;  4QMA A;  2NRG A;  2A45 I;  2H88 C;  1URQ D;  2J58 A;  1DD4 A;  3H1J E;  3CWB G;  3ITK A;  1L4A D;  1L0N E;  1SQB K;  1SQP E;  3VMY A;  3FX0 A;  3CWB J;  2P1J A;  2XZR A;  3RL0 D;  4M3L A;  2Q3E A;  4H13 D;  4D6T G;  2E5T A;  1VQ9 P;  5APW A;  1OFC X;  1JY2 O;  1J1E C;  1BE3 E;  3QWO C;  3L71 E;  4U3F G;  1T8Z A;  2GUV A;  4D6T J;  3TGU D;  1YJ9 P;  3P7K A;  1AV1 A;  1H89 A;  3CXH I;  5DJU B;  5AVU B;  1X22 A;  3VMA A;  5CCH A;  4U3F J;  3I5C A;  1QL2 A;  1URQ C;  4DCK A;  4PJ0 H;  4L76 A;  4H44 D;  5KLV G;  2PAJ A;  1N8R Q;  1H0T A;  4LLH A;  3FWN A;  2HOD A;  4Y99 B;  2QJK C;  5H2F H;  2E75 D;  5AVZ B;  1L4A C;  1Y8A A;  4AUW A;  4N3Y B;  2XU6 A;  1NU1 E;  1NGM B;  3NTN A;  1QVF O;  1M56 D;  5KLV J;  3Q1M A;  3RL0 C;  1BCC D;  1QL1 A;  1RF0 C;  4H13 C;  3CC4 P;  2AXC A;  1PGO A;  3MZW B;  5AVV B;  1EZV G;  2UWJ E;  4GOF A;  1BGY E;  2OYH C;  2WPS A;  3GF3 A;  4GDO A;  3V2R A;  3H1L E;  3GHG B;  2KUB A;  3JCU H;  1YIT P;  1QLE D;  3N4X A;  2M0B A;  2P7J A;  3CX5 I;  4LGD E;  1JB0 J;  3EWK A;  3RL0 g;  1NTZ E;  4H44 C;  1FDM A;  1LTA C;  1Q86 Q;  2LXB A;  1MV8 A;  1EZV I;  3P8C E;  2E75 C;  3WU2 H;  1FZA A;  4IL6 E;  2Y0D A;  1OIP A;  1M1K Q;  5BU8 B;  1U7J A;  1KIL D;  3I55 P;  1T3J A;  1L0L K;  3L70 G;  4PJ0 E;  2P2U A;  5AW3 B;  5CCG C;  3AE1 C;  1GW4 A;  5H2F E;  1EQ7 A;  1SQQ D;  2L5G B;  1S72 P;  2WMM A;  1FJK A;  3L70 J;  1W2E A;  1OMI A;  1NYH A;  1RE4 C;  2WSE H;  4JF7 A;  3PJS K;  1JY3 P;  2QM8 A;  2GM4 A;  3GW6 A;  3V4Q A;  2Q1K A;  3BCC E;  4TLF A;  2E42 A;  3TF5 A;  3M9Q A;  3KYQ A;  1T2K C;  2HYN A;  3JCU E;  4DT0 A;  1OX3 A;  2IBZ E;  3L74 G;  1K73 Q;  5AW9 B;  3II6 A;  3HD7 A;  1AQT A;  1YQ3 C;  4IFD K;  1NTM G;  5AVY B;  2KP8 A;  4OH8 B;  1H0T B;  3WU2 E;  2HOD B;  2QJP B;  3L74 J;  1M7L A;  2KI7 B;  5C39 A;  1N73 A;  1SS1 A;  2E5Y A;  2N1T A;  5KLV K;  3KPE A;  2NPS C;  1R5L A;  2M5A A;  1FZE A;  1BDC A;  3B71 A;  1HUC A;  2W6J H;  2WPR A;  1ZV8 A;  2IPP A;  1S9K E;  1L0N D;  3CC7 P;  1MFT A;  3TSI A;  1NO4 A;  1G1J A;  4HKZ H;  4CPG A;  2Q3I A;  3VYI A;  2V4H A;  1JY3 N;  1KD1 Q;  2WSC H;  1BE3 D;  2G3A A;  3L71 D;  1GTW A;  1VF5 B;  3RK2 B;  2H43 A;  1USD A;  4UB8 E;  5AVQ B;  2H89 C;  4XA4 A;  1S1C X;  4IFM A;  2HPC A;  3IF4 A;  3C1L A;  4Y99 C;  1GW3 A;  3CCR P;  1G1I A;  4EDF A;  1GMJ A;  1ZLL A;  1NU1 D;  3JC2 2;  3HTK A;  1YJW P;  2OYO A;  3MTU E;  1N7L A;  5E79 H;  1FOS E;  2K9J A;  2M3B A;  3TGU G;  1ZR4 A;  1EXJ A;  2A06 G;  3KZI H;  3VP8 A;  5APX A;  1FZC A;  2AEM A;  1KYO D;  1GZL A;  2LR2 A;  5AW0 B;  1BGY D;  3GHG C;  2WVR A;  3MIW A;  4WB4 A;  5EFW B;  3V4W A;  1M1J A;  3TGU J;  1MZ9 A;  3H1L D;  1NTK D;  2Y0C A;  1NKN A;  1NTZ D;  3HD7 B;  3U59 A;  1E79 H;  3P8C D;  1OXZ A;  2N9Y B;  2W90 A;  3L35 A;  5CCH D;  1PIX A;  4GOD A;  2SPZ A;  2JP3 A;  3H1H E;  5B66 H;  3UIA A;  1N73 B;  1P84 E;  3G3Z A;  1KB9 H;  1NTM K;  3HE4 A;  2N1T B;  2JJL A;  1YIJ P;  1H8A A;  2M5A B;  4PD4 H;  1YTZ I;  1SVF A;  1FBM A;  1FZF A;  3AE9 C;  3M9H A;  5K5G B;  5E79 E;  1WT6 A;  4RES B;  5KJ7 C;  1L2P A;  1VQM P;  3OW2 O;  3KZI E;  2QM7 A;  2E74 B;  3G6E P;  3EQ2 A;  2Z5H A;  1OW8 A;  5CCH C;  3OAK A;  5APV A;  1IJD B;  1GL2 A;  1HJB A;  2IBZ D;  1Q2N A;  2L91 A;  1Q81 Q;  1X0T A;  1AQ5 A;  3CL3 D;  4EI2 A;  2HPC B;  1SQQ G;  3O8Z A;  3M0A A;  4NPF X;  2QJP C;  3T97 A;  2E76 C;  1VF5 D;  3M9B A;  3RK2 D;  1WRG A;  3A0H E;  1SQQ J;  3L74 D;  1KMI Z;  4C7R A;  3HTK B;  2A45 H;  5B66 E;  3W68 A;  1KB9 E;  5APS A;  4NPE A;  1S3J A;  3AE8 C;  3LW5 J;  4PD4 E;  3HUS A;  1FE6 A;  2QIW A;  2KZI A;  1FZC B;  1RE3 C;  3CCS P;  1S9K D;  2KNC A;  3HRN A;  1M1J B;  1CSB A;  3KXD A;  2M3E A;  3VTP C;  1VQN P;  4BRY A;  3O6Q A;  1N2D C;  3S4R A;  2I1K A;  1SLQ A;  4IL6 X;  3K5B A;  2KYV A;  1VF5 C;  1SQX E;  2AEJ A;  3RK2 C;  4JBZ A;  1SQV D;  5CMZ A;  1KC8 Q;  2JDI H;  1N7S A;  3HD7 D;  3FXE A;  2ZYG A;  1R5S A;  5AW2 B;  1GD2 E;  3F89 A;  2R3S A;  1L0N G;  1J2J B;  2WSF J;  3SWF A;  1JEK A;  2HR3 A;  1LNQ A;  4KHX A;  1L0N J;  1JO5 A;  1Z56 A;  2FY8 A;  2P10 A;  3H1K E;  1RY3 A;  1BE3 G;  4B86 A;  2N1T D;  3D6Y A;  3L71 G;  1YYC A;  5AVT B;  1ZOY C;  1L0L E;  2C9N Y;  3E7K A;  2AEF A;  2FFD A;  1BE3 J;  2R5B A;  3L71 J;  1OW7 A;  2OTK E;  1FS0 E;  1GL2 B;  4I7Z B;  1E5W A;  4I6M C;  3V2N A;  5BVZ A;  3CX5 H;  3HD7 C;  2A06 D;  1IFI A;  3E1R A;  3CWB E;  1LWU A;  1NU1 G;  2E74 D;  4AQR D;  1NAY A;  4ZKU A;  5B5E H;  1S2E A;  3T97 B;  2B87 A;  4OWF A;  5AVS B;  2OYI C;  1JMM A;  3M91 A;  3CXH E;  4TT3 H;  1N73 C;  1NVO A;  1NU1 J;  3H1H D;  2QEX P;  4YXD C;  1DH3 A;  1SQQ K;  1FJP A;  1P84 D;  2YKP A;  1BGY G;  3P32 A;  3H1I D;  5GTI H;  3H1L G;  3A0B H;  3M0D A;  5GTH H;  1LTB C;  1X8Y A;  1NTK G;  4WY4 A;  2FXO A;  3TDK A;  2KNC B;  1BSH A;  3SSU A;  1BGY J;  1DEE G;  1NTZ G;  3H1L J;  1KZU B;  1VQO P;  1KYO I;  1NTK J;  1IK9 A;  4BRY B;  3O6Q B;  3A7O A;  1A02 F;  1OW6 A;  1YI2 P;  1NTZ J;  4JQ0 D;  1N7S B;  3CX5 E;  2OGU A;  2JWA A;  2YO2 A;  3M06 A;  2Z4E A;  4HB1 A;  1QX8 A;  5B5E E;  3NFQ A;  1K9M Q;  2WTY A;  5TIS H;  4RJT A;  4I2L C;  4C7N A;  1L0N K;  3BRV B;  4W7Y A;  5CJ4 A;  1FZC C;  2IX7 C;  4H0L B;  5AVX B;  1HJ0 A;  1M1J C;  2YO3 A;  1SFC A;  2IBZ G;  1W2B O;  4N78 D;  2CPB A;  3MP7 B;  4XFJ A;  2W83 C;  1K05 A;  1YBK A;  3L70 E;  1JCD A;  1S5L H;  2B9B A;  2B88 A;  3CCU P;  1LGH B;  1JY3 O;  1KIL C;  3BVH A;  2O1J A;  4K35 A;  1SQX D;  4ZKP A;  3L75 D;  3RK3 E;  4IFF A;  3H6P A;  1GL2 D;  2N9B A;  1NH4 A;  3EFF K;  1GDT A;  3U1C A;  4ASW A;  2ZYA A;  1PP9 D;  3V6I A;  2FXP A;  3PP5 A;  1NU1 K;  2D2C D;  1LTS C;  2J59 M;  4IOI H;  1IZN B;  2ZVO B;  1VL2 A;  3V2P A;  3V2Q A;  2YKQ A;  3Q5R A;  1CI6 A;  2CPS A;  5KKZ B;  4WY4 B;  3H1J D;  1HH0 A; 
#chains in the Genus database with same CATH homology
 2KSJ A;  2H7H A;  5CCG D;  3UIA A;  1SQX K;  5APQ A;  1N73 B;  2A45 G;  3G3Z A;  3A2A A;  1NTM K;  3HE4 A;  1KIL B;  2N1T B;  2JJL A;  3EFG A;  4EIJ A;  5AVR B;  1RE3 A;  1H8A A;  4DZO A;  2IFM A;  1NTK K;  1DX7 A;  1YTZ I;  1SVF A;  1FBM A;  2IFN A;  1HGZ A;  2WPQ A;  1G2C A;  1IFM A;  3CI9 A;  1GL2 C;  4GIF A;  1NTZ K;  3HE5 A;  4HH2 A;  1JNM A;  1FZF A;  3M9H A;  1SFC C;  1GK4 A;  1FOS F;  1WT6 A;  2H8P D;  1RF1 C;  4RES B;  1NKZ B;  2A45 I;  5KJ7 C;  2YNY A;  2LKM A;  1URQ D;  2J58 A;  2XV5 A;  1JCC A;  1T2K D;  3VN0 A;  2GUS A;  2QM7 A;  1IO4 A;  1L4A D;  1JUN A;  1SQP K;  1KFM A;  3CLQ A;  4W7Z A;  1CZQ A;  1SQB K;  3EQ2 A;  2Z5H A;  5AW8 B;  3VMY A;  5CCH C;  3OAK A;  1N7S D;  5APV A;  2P1J A;  1IJD B;  1GL2 A;  2XZR A;  3L36 A;  3RL0 D;  1HJB A;  2FFD B;  4M3L A;  5APW A;  2M8R A;  1JY2 O;  1RF1 A;  1AQ5 A;  1J1E C;  3CL3 D;  4C7N B;  1FZG A;  2HPC B;  3O8Z A;  1IFD A;  1XTC C;  3M0A A;  2FYZ A;  3T97 A;  1DEB A;  1T8Z A;  3M9B A;  2GUV A;  2R5D A;  2YKO A;  3RK2 D;  1WRG A;  3P7K A;  1SFC B;  1LWU B;  1H89 A;  3A3Y B;  2NPS D;  5AVU B;  4C7R A;  3HTK B;  1FZB A;  2A45 H;  5CCH A;  1JTH A;  1J1D B;  2W6A A;  5CCG A;  3I5C A;  1QL2 A;  1URQ C;  5APS A;  5AW7 B;  3V5B A;  1KFN A;  2PAJ A;  3LID A;  3HUS A;  4LLH A;  2C0X A;  2HOD A;  4Y99 B;  1JY2 N;  2KLV A;  5AVZ B;  1L4A C;  1FZC B;  4AUW A;  1RE3 C;  1S9K D;  4N3Y B;  3IFM A;  2XU6 A;  3NTN A;  3HRN A;  5CHX A;  1RE4 A;  1M1J B;  1N7S C;  1CSB A;  2XNX A;  3RL0 C;  1RF0 C;  1QL1 A;  2WZ7 A;  2XDJ A;  3VTP C;  2Q9I A;  5AVV B;  1N2D C;  2I1K A;  1SLQ A;  1URQ A;  1LT9 B;  2OYI A;  3VP9 A;  2KYV A;  3TYY A;  3RK2 C;  5AW4 B;  2OYH C;  3H32 A;  1X9V A;  2WPS A;  1PFI A;  1LTJ B;  1L4A A;  5APY A;  3V2R A;  2POH A;  3LIE A;  3B5N B;  3GHG B;  3NXS A;  5CMZ A;  4GKG A;  2HLO A;  1N7S A;  3N4X A;  2WT7 A;  1RF0 A;  3HD7 D;  2P7J A;  4LGD E;  5AW2 B;  1GD2 E;  3KDP B;  2I1J A;  1FDM A;  1J2J B;  1LTA C;  3RK3 B;  1MV8 A;  3P8C E;  4WY4 D;  3SWF A;  1FZA A;  3LW5 H;  2OYH A;  2C9L Y;  1G2C B;  4KHX A;  1JO5 A;  1Z56 A;  3U1A A;  3HE5 B;  1RY3 A;  1LTI C;  2HFE D;  2KB7 P;  5BU8 B;  4B86 A;  1KIL D;  2N1T D;  2NPS A;  5CJ0 A;  1FU1 A;  3OJA B;  1T3J A;  2R3C A;  1NWQ A;  1HWT C;  1L0L K;  1T3U A;  1YYC A;  5AVT B;  3TK1 A;  2C9N Y;  2KOG A;  1SQV K;  2P2U A;  5AW3 B;  1SP4 A;  5CCG C;  2FFD A;  2R5B A;  1GW4 A;  1OWA A;  1EQ7 A;  2L5G B;  1N86 A;  3HUS C;  2ZFC A;  5KTB A;  1FJK A;  4JYB A;  4I1L A;  4GT1 A;  1W2E A;  4AYC A;  1ZR2 A;  1GL2 B;  1E5W A;  4I6M C;  3V2N A;  2MJZ A;  5BVZ A;  1RE4 C;  3HD7 C;  2WSE H;  4JF7 A;  1IFI A;  1JY3 P;  2QM8 A;  2C0W A;  4W80 A;  3TNU A;  1RF1 B;  1LWU A;  5AW6 B;  2GM4 A;  3V4Q A;  1CW5 A;  1AFO A;  4AQR D;  4ZKU A;  1KQL A;  4WY4 C;  3C9I A;  2E42 A;  5AVS B;  2OYI C;  2BAS A;  1JMM A;  3M91 A;  3M9Q A;  3KYQ A;  1N73 C;  3BRT B;  1T2K C;  2HYN A;  1GU4 A;  5BU5 A;  3VOP A;  1IC2 A;  1HTL C;  1DH3 A;  1SQQ K;  3VMZ A;  1JTH B;  1FJP A;  5AW9 B;  3L4F A;  3II6 A;  5AW1 B;  1GK6 A;  2JEE A;  2YKP A;  3KQG A;  3HD7 A;  3P32 A;  4IFD K;  2ZXE B;  5AVY B;  2E43 A;  1J1E B;  2KP8 A;  1SFC D;  4OH8 B;  3M0D A;  1LTB C;  1X8Y A;  2HOD B;  4O9B A;  4WBA A;  1M7L A;  4WY4 A;  1ZN5 A;  5KJ7 D;  1JOC A;  2Q5U A;  3L37 A;  5APT A;  1HGV A;  1NAF A;  1N73 A;  1XTG B;  2Z5I A;  1KZU B;  3R2P A;  1MUU A;  1IFJ A;  1KIL A;  2N1T A;  5KLV K;  3KPE A;  1IK9 A;  1VPC A;  2VRS A;  1CI6 B;  1IFN A;  2NPS C;  3P8M C;  1FZE A;  1H88 A;  5APU A;  3A7O A;  1A02 F;  1URQ B;  1HUC A;  2W6B A;  2YMY A;  2WPR A;  3MGN A;  2OYI B;  1ZV8 A;  2IPP A;  1S9K E;  2FFD C;  3TSI A;  1NO4 A;  3HE4 B;  1LTT C;  3H32 B;  1G1J A;  1HBW A;  1L4A B;  2Q3I A;  1HVV A;  3VYI A;  1JY3 N;  1N7S B;  3RL0 B;  2WT7 B;  3A5T A;  2WSC H;  2YO2 A;  3M06 A;  3E1I A;  2Z4E A;  4LC1 A;  3VMX A;  1LWU C;  5AW5 B;  3NFQ A;  3B5N D;  4EOT A;  1A02 J;  1GTW A;  2WTY A;  1J1D C;  3RK2 B;  1NHL A;  2WIT A;  1FAV A;  2H43 A;  2OYH B;  3MD0 A;  1NOH A;  5AVQ B;  1JY2 P;  2OAR A;  4XA4 A;  4IFM A;  2NPS B;  4I2L C;  4C7N A;  3RK3 D;  1L0N K;  2HPC A;  3BRV B;  4W7Y A;  4Y99 C;  4JYC A;  1GW3 A;  1G1I A;  5CJ4 A;  1FZC C;  2FKW B;  2XKM A;  3OA7 A;  3IR9 A;  1ZLL A;  2IX7 C;  1LTG C;  2FYU K;  5AVX B;  4HYT B;  1M1J C;  2YO3 A;  1SFC A;  4N78 D;  3HTK A;  3M0D C;  3MTU E;  5KJ7 A;  1N7L A;  1FOS E;  2CPB A;  3NMD A;  1LT9 C;  2WSF H;  2WWW A;  1JCD A;  2M3B A;  4N6J A;  4XE5 B;  1ZR4 A;  3TNU B;  1LGH B;  1GU5 A;  1JY3 O;  3VP8 A;  1KIL C;  2N1T C;  2Q7C A;  3MUD A;  1LTJ C;  3BVH A;  2O1J A;  5APX A;  1FZC A;  1MFZ A;  1GZL A;  1VDF A;  5AW0 B;  2P67 A;  4ZKP A;  1YTZ T;  3B5N C;  3GHG C;  3BAS A;  3MIW A;  4WB4 A;  2HG5 D;  2R32 A;  3V4W A;  4IFF A;  3H6P A;  1GL2 D;  1M1J A;  2N9B A;  2O1K A;  1NH4 A;  1MZ9 A;  1GDT A;  3HUS B;  2W27 A;  3U1C A;  3BAT A;  3RK3 C;  3PP5 A;  3N7N A;  1NU1 K;  2FXM A;  5AVW B;  1NKN A;  1LTS C;  2O01 H;  4C46 A;  1LT9 A;  2J59 M;  3HD7 B;  3U59 A;  4N78 E;  3WMM 0;  3P8C D;  1X79 B;  1OXZ A;  3B8E B;  3V2P A;  3V2Q A;  1LTJ A;  2YKQ A;  1CI6 A;  2CPS A;  3L35 A;  4WY4 B;  3B5N A;  3GHG A;  2PP6 A;  1HH0 A;  5CCH D;  4DOJ A;  3SWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...