3E1KA

Crystal structure of kluyveromyces lactis gal80p in complex with the acidic activation domain of gal4p
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
446
structure length
395
Chain Sequence
SSRPIRVGFVGLTSGKSWVAKTHFLAIQQLSSQFQIVALYNPTLKSSLQTIEQLQLKHATGFDSLESFAQYKDIDMIVVSVKVPEHYEVVKNILEHSSQNLNLRYLYVEWALAASVQQAEELYSISQQRANLQTIICLQGRKSPYIVRAKELISEGCIGDINSIEISGNGGWYGYERPMRSPEYLYDIESGVNLISNSFGHTIDVLQYITGSYFQKINAMISNNIPTQFLLDENGKRTKETISKTCPDHLLFQGILENGKVPVSCSFKGGTPVKKLTKNLVIDIHGTKGDLKIEGDAGFVEISNLVLYFYGIKNGEEQTMEVFHLRNYNSVVGNILRIYESIADYHFLKFDKQGFRFEGFPTFKDAIILHRLIDAVFRSDKEEKTLDVSKIMILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction between an Acidic Transcriptional Activator and Its Inhibitor: THE MOLECULAR BASIS OF Gal4p RECOGNITION BY Gal80p.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
total genus 123
structure length 395
sequence length 446
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3e1kA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3e1kA01
4U8GA 4YBZA 1BRMA 1SOVA 1XLTA 3PJDA 4CLOB 4WECA 4YCAA 4PVCA 4Y6RA 3SBOA 4RF4A 3JQFA 4OXNA 2CDAA 2D2IA 3GNQA 4EITA 4D7AA 1U4SA 2BFOA 4MVJD 3F4LA 1X14A 3PK0A 2P5UA 3NGXA 4BS9A 1NHGA 1W6UA 5KVCA 1GV1A 2C20A 3VZSA 3BA1A 1AUPA 1HLDA 2EF1A 3BAZA 4Q3NA 2JAPA 4WOKA 2P91A 3VH1A 4BNXA 3BXXA 3GEGA 3GPDG 3JQ8A 3ZWOA 4QFDA 2GNAA 5B4TA 3GT0A 4ZN6A 1ZSNA 2ZQYA 1E3SA 1XHLA 1PZHA 2VYVD 5TNXA 2J5RA 1M75A 1PEDA 5FFFA 1NWHA 4Z0HO 4R4JA 1QLHA 4DPKA 2JAHA 3ETGA 3V1YA 2NU9A 3I23A 1SNYA 1HEUA 5BSHA 1ZK4A 3G49A 2PK3A 3PXXA 1MGOA 4YJDA 3WMXA 4LSWA 1PWZA 3AY7A 1YB1A 4XR9A 4GWKA 4J4TA 1R37A 2HMUA 1A4IA 1QSGA 3GNSA 3GHHA 1DC4A 4ILKA 3PI7A 3DAGA 1NQAO 4A7PA 4IQ8A 5EPOA 4BO3A 5THKA 3QY9A 2V65A 2AE1A 5G4LA 3BHJA 1Z7EA 1LDYA 2VUUA 5EL0A 4RQTA 4PG7A 3GDGA 4BB5A 5JYDA 4I8XA 3E18A 1WDLA 4BNNA 4CR8A 2ET6A 4B4UA 3NTRA 4YJHA 5ER9A 4GBJA 3DMTA 1QG6A 4Z9YA 4R16A 5FWNA 4P4NA 4U0JA 2IZZA 2QW8A 1Y5MA 3FD8A 4CMJA 1YL5A 3OP4A 1YH3A 4KWIA 1KOLA 3MOIA 4ZQHA 2W98A 1C0KA 2PD6A 4R68A 2YV3A 2BI8A 2X6TA 4HFJA 5MDHA 1XU7A 4NBWA 4M87A 4J0EA 4TVBA 1BDMA 4BO4A 4FR5A 5TRTA 3AI3A 4WGGA 1B8UA 5BR7A 1VJTA 3VOSA 1EFLA 1ZH8A 4EYEA 1Y9EA 2ZQZA 1C1XB 2C5EA 2YDYA 4E5PA 4XGKA 3GFBA 5BSFA 1JN0A 3QWAA 3U4CA 1PX0A 4FC7A 4CM7A 3LVFO 1XGKA 3B20A 1HSOA 5I7EA 4NI5A 2ZJ0A 3FCOA 3KLPX 3KTDA 1I10A 4F45A 3OJLA 4GLOA 3W8FA 1YBVA 3JYLA 2J6IA 1D1SA 1WW8A 2ZYDA 1DFGA 4X54A 3G1UA 1CF2O 1N7GA 3OQ6A 1DO8A 3DB2A 1SB8A 4FPXA 5EINA 4QEDA 3H6KA 1HZZA 4WJZA 1T2EA 5JMWA 4Y98A 2O2SA 2IE0A 3FBGA 4NMHA 2W2KA 2GLXA 5LCXA 3IP1A 3C1TA 2D8AA 2WSBA 2NLOA 1OZAA 2OBNA 3UFXA 5BNTA 5JAMA 1UXHA 5KTKA 4C4OA 3EAGA 3NYWA 4P22A 2NNLD 1V35A 4AJ4A 1LQUA 1G6KA 3DZKA 2VYND 2WD7B 3D0OA 3RJ9A 4MVJG 2WE8A 1RM0A 2CD9A 4XIJA 1Q0QA 4ZVVA 4DQXA 3DL2A 3GF4A 3GRPA 4J16A 3T7CA 2Q1TA 3GEMA 3G3EA 5I9MA 3A4VA 3ENKA 3LZ6A 4PLTA 2VUTA 4EEZA 3IC5A 1HE3A 4IXTA 3C7AA 4XDZA 3Q6IA 4J9UE 4Q9NA 3M1AA 3E6AA 1Q2XA 2QZZA 2HKIA 1WWKA 4BMNA 1LRLA 2BHLA 2R6JA 3WIDA 5DBIA 5H82A 4PIVA 3JQ8B 3IOYA 2H9IA 5L53A 4KP7A 3IDSA 1MC5A 3E9MA 3H3JA 3PJEA 1FDTA 4RORA 3U9LA 3QVWA 4GLLA 5A03A 1FJHA 1XU9A 5K6AC 4NBTA 4MIYA 3GQVA 2HO5A 2YFHA 1QLJA 1Q7BA 1UR5A 4NK5A 4CMIA 5IF3A 4Q3CA 4UVGA 4TZKA 3H2SA 2PKRA 1XDWA 3HHPA 3AM4A 4N18A 1WVGA 4BGVA 1KVSA 3I9OA 3NAQA 1ZSVA 3PGJA 3QVSA 4BO1A 2ILTA 4GH5A 3IP3A 5JYAA 4CLOA 1RKXA 2XF8A 4TRMA 2Q46A 3GOHA 2BKAA 3H2ZA 3VH4A 4BNUA 5JDCA 2EKQA 2VTDA 3KLMX 1MG0A 3DZGA 3ZGYA 4DWVA 3PFFA 4JBGA 5G4KA 3MZ0A 3JQAD 1L7EA 2NTJA 2FSVA 1HE2A 3INTA 1SAYA 3JQBC 4D45A 4DGSA 1T2AA 5ITVA 4OXKA 2ZB4A 2QYSA 3NTOA 4YB8A 3W6ZA 1T1SA 4FFLA 1IB6A 3QVTA 4QX6A 1UZNA 1ZK1A 2AEMA 2NVBA 1LDEA 3ZWPA 3HFSA 1KVTA 1UZMA 4L4SA 1PL6A 1U7TA 1ONNA 2X58A 1HTBA 4IDFA 4E13A 2NSDA 1X7HA 3NT4A 4XYMA 3JD3A 2DKNA 4OXYA 4RPJA 4MDHA 3NJ8A 2PTGA 4ND1A 4RVGA 1I2BA 3OJFA 4CLRA 2G1UA 2Y1DA 3ORFA 2UUPA 3U0BA 1E6UA 5AQ1A 1GR0A 1NPYA 1U1IA 3ON5A 1T2DA 4WLFA 4IDCA 1VSUA 4BO0A 4NFHA 3DMTC 1ISIA 1R4NA 2BGKA 3UH1A 3AW9A 3OEWA 1ENYA 2Q22A 1UJMA 3Q1LA 1E1NA 3RC9A 2Q50A 1YB5A 3F4BA 4NQZA 3ZU3A 4BNIA 3DZBA 3JQ9A 4CUJA 3OJOA 1Z82A 4BO6A 4ND2A 4CV1A 3QW2A 5C37A 1HETA 4Q39A 3ZCXA 4Q3BA 5CHEA 3MJVA 4PG8A 1K6JA 4J90A 3WFIA 1YGYA 2F1KA 2Z95A 3DHYA 4ONEA 2ZCVA 4KOAA 3HSKA 1ZXBA 2CF6A 1BSVA 2J3JA 1DOHA 1GTMA 2YDXA 3GHYA 3GN1A 2ZB7A 4P8RA 1E6EA 4ALMA 4K1LA 4BMSA 1UXGA 3WICA 2X0NA 1O95A 3GLQA 2WE7A 1PS0A 3BYZA 1GUZA 2VN8A 1U3VA 3RFXA 4YT8A 2PKQP 2PZJA 2IRWA 1P77A 1GEEA 1K5HA 4XX0A 3WQSB 1U8FO 5A9TA 4MVJI 3MCVA 5KKAA 3JYQA 2GZ2A 2NU6A 4CQMA 3MWEB 3K92A 4QQRA 5CEJA 5JCXA 2YV1A 3K2EA 1NR7A 2J3IA 1ENOA 3X2EA 3Q0EA 1AXEA 4R5HA 4PG6A 2C0CA 3KEQA 2NQ8A 3UGKA 4JROA 2I3GA 2VHZA 2O48X 3JYNA 4OMUA 3VC7A 3G79A 4BO2A 4XKJA 2D3TA 1OOEA 2PD3A 3E9NA 3VKUA 4C7KA 4Z3KA 1O0SA 1DC5A 3WFJA 4YR9A 2O7QA 4I9UA 3H9EO 2JCVA 4PZEA 3T4XA 3ZW8A 1YB4A 3K5PA 4WOJA 2JCXA 2O7SA 3O8QA 5T64A 1WPQA 3CZMA 1GD1O 1PL7A 3LLVA 3ABIA 1NQOA 2CVOA 1EVIA 2CFCA 4JIGA 1A71A 1CWUA 3VPSA 4DIFA 3E1KA 3EZYA 3TN7A 4R69A 4U7WA 4PLHA 5L4SA 2GZ1A 3C8MA 5JNLA 5IXYA 3AM5A 4KTTE 1NVGA 4N5NA 1NBOA 1XELA 4UAGA 5IG2A 4Z9FA 1YBAA 5BNIA 3MJ4A 9LDBA 1LBEA 1U3UA 5EERA 4NG5A 5A3VA 1QYWA 1GV0A 2G76A 4B79A 4GMGA 3DAPA 5A9SA 2GASA 4ZGWA 2RHCA 1MB4A 1LNQA 4RLSA 5DP2A 1PQUA 4DXHA 4YEDA 3PVZA 3E03A 2Q1SA 3FTPA 4CM8B 5CDSA 3GG2A 3FNEA 3CEAA 1YDEA 3ZU2A 5IN4A 1PQPA 3VKVA 7ADHA 3QE3A 3FTNA 4LGVA 3ZHYA 2EERA 1I30A 2TMDA 2IYPA 4YRBA 1JWBB 5FF9A 1OI7A 3JD2A 1HZJA 2FR1A 3LC1O 4OYRA 4MVJP 1MFZA 3TOZA 3M6IA 5G0WA 4B3JA 1XWFA 2C07A 1SMKA 3ASVA 1XIVA 4QO7A 1CRWG 1B3BA 1H2BA 3UF0A 3H9GA 2B0JA 2X0JA 2UV8A 1P33A 4Q3DA 4WCDA 3VVBA 3CUKA 1FDUA 3F5SA 3U09A 1KY5A 3NDJA 2HDHA 3ZWMA 1EBFA 4DC0A 2FOIA 3I6QA 3P5SA 1YOVB 1PJTA 4I5EA 3ROQA 1V8BA 4L73A 1NR1A 4FFMA 1PS8A 4ZQGA 4TKLA 5JS6A 4DA9A 1PL8A 4CR7A 4NPCA 4HV4A 4ALKA 4OHUA 2JD0A 4U6QA 1YXMA 3SVTA 1ULUA 5ITWA 5CG1A 2QRJA 3NKLA 3PZRA 1V0JA 3IS3A 4ZQEA 4FN4A 4A0SA 4AICA 3IAHA 4CQMB 4BQPA 3P2OA 3KHUA 4CODB 1V3TA 1MFPA 2XXBA 3OEYA 4NIMA 1ULSA 4R9RA 4J9VA 3JQ7A 4E32A 5JCJD 2VZ0A 4ZD6A 3PZBA 4GSLA 3GUCA 3GAFA 2VHWA 2VWHA 3WSWA 3IMFA 1P1KA 5KJFA 2POQX 3RWBA 1C1DA 1Y8RA 1U5CA 2NVUA 3DZFA 3RBXA 4CMBA 4IZHA 4EUHA 3IUPA 1P1FA 4PG5A 5G0UA 5TF4A 3UCFA 1S6YA 4NZ9A 2FZEA 4XQ9A 4B8ZA 1E7SA 3GPIA 1PJQA 2Y99A 3A1NA 5HA5A 3WJ7A 1LXCA 4S3MA 4D41A 4MVJH 4FC6A 2E48A 3TL3A 3DOOA 4YWJA 1MXFA 1HLPA 1X1TA 3GR6A 3LC7O 1U7HA 1UAGA 3HNPA 4NR0A 4RO0A 1LEHA 5HS4A 2YHUA 3OQBA 2GRAA 4XA8A 1UDBA 3RI3A 1H2HA 1KVRA 2D1YA 2O3UA 2X0RA 1D8AA 4EI2A 3V2GA 5HS6A 2P9GA 1VLLA 1LRJA 3JSAA 3ADOA 4HBGA 1ZKMA 1I36A 2BI7A 3FR7A 5DBGA 1IULA 4BMVA 2DTDA 2VHXA 5BSGA 4BOYA 1E7QA 1ZMOA 2DC1A 3DTTA 3WWZA 4MPDA 2GPTA 2GN6A 1EVJA 3GC6A 2JFGA 4K26A 3F1LA 1QMGA 3S2GA 3ZNQA 4NJMA 3KUXA 1X1EA 4LVUA 4IDBA 2DTXA 4EEXA 1YJ8A 1E3LA 4FJ1A 1EZ4A 4YJGB 4OL9A 5GY7A 3UHAA 2J3HA 4YAEA 4LRTB 3BMNA 2F00A 3GUYA 2V6GA 4YAGA 2JFHA 1ZVMA 1JKIA 1I33A 5C7IO 1WNTA 1PGQA 2EW8A 1XYGA 3H5RA 2I9PA 3P19A 1UXJA 2OXIA 3WBBA 5L95A 1QRRA 2X5OA 5JXWA 4K28A 1H9BA 3GY0A 4XIYA 4ALLA 1DXYA 3STHA 1GQQA 2Y68A 3DFZA 4Z3DA 1LSJA 1MP0A 1PJ4A 1A27A 1T4DA 1TVEA 1BG6A 1NM5A 2VT2A 1WP4A 3GVXA 1R6DA 3R3SA 4Y6PA 5ENVA 3WGTA 3BTSA 2Y0DA 3GRKA 1O8CA 4AJKA 4E2WA 3LF2A 3QLJA 3AK4A 5A9SB 5IDYA 3K73O 4MKRA 4J49A 4DMMA 3JQ6A 4FIZA 2V6MA 1Z6ZA 2HMVA 5JO0A 4TROA 4YA6A 1FDSA 2VZ9A 1ZW1A 2DFVA 1Z75A 1I2CA 3CH6A 2B36A 1DLJA 5U4QA 1VJ1A 3CZRA 2DBVO 1YQXA 3TL2A 1NXQA 4PCVA 4CMCA 3RUHA 4CLDA 1C1DB 1GFSA 2V6FA 4LW8A 5B12A 5JC8A 5EQFA 1LSOA 3K30A 3IIEA 4OKNA 2OL4A 5IJZA 2NWQA 3EZLA 3QA9A 2PD4A 1W73A 2PV7A 5BQFA 2DBRA 4CV2A 2CY0A 2PFGA 3SEFA 2OHXA 3B1FA 1AHHA 5L7YA 1T2CA 3GGGA 4I1IA 3Q11A 2WMDA 1OBFO 4KUEA 3HN7A 2WJPA 3PDJA 2P2SA 3X2FA 4KDFA 3L9WA 3R3JA 2FPGA 2VOEA 1VL8A 4R1NA 3HDQA 3LT1A 4AJHA 5IFLA 4YJFB 4GKVA 3TRIA 3NUGA 3NT5A 3PIDA 4BV8A 2Z5LA 3BMCB 4BGUA 4L0QA 2AQKA 1B8PA 1ZJZA 1F0YA 4BNKA 4JK3A 3UCEA 1HDYA 5FI3A 2BF7A 5GZ1A 1DFHA 1NQ5A 5T5QA 3HUDA 3TPCA 1D1TA 3WG9A 2D59A 3F1KA 1HSZA 3CPSA 1KS9A 5I7SA 3NEPX 1LJ8A 1E5LA 2EKPA 1KY4A 1E1LA 3WWYA 1YQGA 1ZBQA 3TFQA 3IKTA 5TSDA 1O5IA 4GPD1 3EMKA 1UXKA 3DAFA 2NACA 2NV6A 1DAPA 1IHXA 3DONA 4O0LA 1GPJA 5CAEA 4KQXA 3ZWAA 4P4LA 4UEOA 4GWGA 4B3HA 3O4RA 2B5VA 1ORRA 2I3AA 3TQHA 4XYBA 3AFMA 4CUZA 6ADHA 4Q3AA 1WAMA 5CG2A 3G17A 3I9MA 3K8ZA 3QVOA 2B4RO 5HWSA 3WGZA 2FWMX 4NH4A 2Y1OA 1U5AA 4R51A 1FF9A 4AJEA 4CMHA 1ID1A 1E5QA 3Q9UA 4GGPA 2AXQA 1O9BA 2C7GA 3CSDA 3UAGA 1I2ZA 5A5EA 2X86A 2W4QA 1IZ9A 1E7WA 4WASA 3G0OA 5LDHA 4BO8A 3KSDO 3FHLA 4PRLA 3JCZA 4XB2A 4IY1A 5TT1A 3ZWWA 3PRJA 4Y8VA 5DBFA 3AOEA 1LLUA 1YL6A 4D0SA 3AJRA 3JQBA 4EJ6A 2FZWA 4PLZA 2GN9A 3DC2A 3O8QB 4QFCA 2PZLA 2W2KB 1PJLA 2NUAA 2BGMA 1CERA 2GF2A 2OFPA 1KEUA 4F3YA 4BO7A 5AXDA 3ZDFA 2O3TA 4DREA 1DIGA 3UOGA 4BIIA 1PWXA 4MKZA 3WNQA 2EJWA 3KVOA 3WQQA 2FPPA 2YQ5A 4OSOA 4E6PA 1UP6A 1YVEI 4D3SA 3DO5A 1KC3A 3LT0A 4GX0A 4NJOA 2OGUA 4IBOA 4JGBA 7MDHA 4LN1A 2OUIA 5DULA 1F17A 4KUHA 3RUAA 2XAAA 1VM6A 1NQTA 2Y67A 5FEUA 3RUFA 2HRBA 4B3IA 2QYTA 2V6BA 1ISHA 4M89A 3P7MA 2I76A 1K0UA 4ZU3A 4K6FA 3TZ6A 3QWBA 1HDOA 3KV3O 3RFTA 3GVCA 4UUMA 3AI1A 2FR0A 4O1MA 5ILGA 2EGGA 2YV2A 1ONPA 1EK5A 4EW6A 1K6IA 4WCFC 3IJPA 3PDUA 3I6IA 3ITKA 1GYRA 1E7RA 4QSMA 4PLGA 5DOZA 1R4MB 4BKQA 1UP4A 1HL3A 3VTZA 2W2LA 5L40A 3OIFA 4PLCA 2QRKA 3ULKA 4J7UA 1XCBA 2X9VA 3DQPA 4ZA2A 2DBZA 3WNVA 1P0CA 3U4HA 4D3DA 5JO9A 4RDHA 4UVDA 2Q1WA 2E37A 4JQCA 2I65A 3LQFA 4IGFA 3L6DA 2X7HA 5C7OO 2B5WA 1LLDA 1UUFA 2AEFA 2XPCA 4IPTA 4RVUA 5JMPA 4O5OA 2EW2A 1UDCA 5TGDA 1MX3A 3JQEA 1HYHA 1M76A 1LDNA 4AL4A 3ANMA 1TI7A 4UVIA 1JVBA 4RZIA 2WM3A 4DLBA 4I5GA 5JC1A 2EJVA 2CUKA 1Y5RA 3DEYX 4CM4B 2WD7A 1TXGA 1QR6A 2Y1FA 1BW9A 3D3WA 4U0KA 5TC4A 3L4SO 1LDGA 1I3NA 2DT5A 4BV9A 1ZEJA 4IMRA 2BFAA 4U5QA 4E0BA 3WB9A 3ZHBA 1ZUD1 3S2FA 1R66A 3WOHA 4M55A 2PZKA 5I8WA 5COBA 2Y0CA 4AJOA 5IN5A 1EQUA 2X4GA 3AY6A 1VL6A 1HDGO 1YKFA 4D43A 1GADO 1PR3A 3B6ZA 4JJFA 1GY8A 3CXRA 2P9EA 4TQGA 1R0SA 1QP8A 1I5RA 5IDXA 4FFRA 4RF5A 4PZDA 1YOVA 1LLQA 4MVJA 3FPLA 1ISFA 3W4KA 1W0CA 1Q7CA 3GNTA 4LISA 1LLCA 2HLPA 4CJXA 2VNAA 4TRJA 1QYCA 1EMDA 3HB4X 4FGSA 1X13A 3E9QA 1VRWA 1JKFA 1H9AA 4FSHA 3TZKA 4XRGA 3KRTA 4M86A 1LA2A 2PGLA 3ZHZA 1E3JA 1ENZA 1H0KA 3WGOA 4XDYA 5L4LA 1ADGA 3ZV5A 1PGPA 3L4BA 4II3A 4ND3A 1YJQA 1N5DA 2P9CA 3CMCO 4CMGA 3ITDA 3ROMA 5K6AA 3RCBA 3VTFA 1WMAA 2DBQA 2NU8A 4W7HA 4CM4A 4ALNA 1UZLA 5DT9A 3EVTA 3QRWA 1HDRA 2PZMA 4AJPA 1H94A 2JD1A 2G0TA 1KIFA 2SCUA 2Q49A 3GEDA 2VCYA 3EVNA 4H3VA 2R2GA 1BHSA 2BLLA 2W2LD 4YT5A 3MEQA 3DTYA 3AOGA 3LT4A 1EUZA 1PJCA 4DQUA 3PQFA 3FF4A 4XD2A 2C2YA 1VJ0A 3GN2A 4WEOA 2J5QA 2O3QA 2Q45A 1ZK0A 4EDFA 5A05A 1X0VA 1BMDA 1BXGA 4KMSA 3TF5A 1L1FA 4UEJA 5CDUA 5JYEA 4ITUA 5T6BA 3N7UA 4XYLA 3AUTA 2I66A 4PLYA 4PLPA 1P1JA 4W82A 1NASA 1K89A 2JL1A 2DFDA 1E7YA 2CVQA 4WNIA 4FDAA 1E1MA 5CFZA 2CF5A 4PZCA 4L8VA 4J1TA 3KSZO 1DHTA 4XGNA 2WTBA 4YAJA 3VH3A 1NX6A 4GSKA 3S8MA 4OOEA 4ZICA 3D4PA 2OMEA 1KEVA 1XSEA 5DCWA 1GQ2A 4CQLB 4NBVA 4UVEA 3EDMA 5IZCA 3VH2A 1CJCA 3DWFA 3DZJA 3NX4A 1CQJA 1TLTA 2Y05A 2Z1NA 3BMCA 3ONFA 4NU6A 4UVHA 2VT3A 3WDSA 4RQUA 1GPDG 5HM8A 1R0LA 5IDQA 5COAA 1EEHA 1IPFA 3FNGA 5AXCA 2JHGA 1E3WA 1EDZA 4IS3A 4S1VA 1Z74A 4CLXA 3JQFC 3K9QO 4DLLA 5TX7A 4J0FA 1BXGB 3M2TA 3DMYA 5DN9A 4NK4A 2YYYA 4HKTA 3RVDA 2HSDA 2R00C 2BFMA 1Y7TA 4B8WA 2XXJA 1OC4A 5G2OA 4KTVE 1U2GA 1I0ZA 1Y1PA 4HFMA 2IZ1A 1NVTA 2BD0A 5AOVA 1EUCA 5JAZA 1QYXA 5KOIA 4G65A 4IXWA 3ANNA 1IY8A 4FD3A 5I8ZA 2WD8A 4DPMA 2FPIA 3RUEA 5DNAA 4FOSA 3QWHA 1VSVA 4JBHA 3L77A 2UYYA 3JD1A 4DUPA 1YONA 1AE1A 3CINA 1BXZA 5KCZA 1B26A 3KYBA 1GU7A 3ZWXA 2C5AA 1R4NB 2NTNA 3GMSA 2GDZA 5J9GA 1CEQA 4U6SA 4WE3A 3R1IA 3EK2A 2BRUA 4WEQA 5F3RA 3SXPA 4IS2A 1D3AA 1NHWA 2PGDA 4ZRMA 2DPHA 2P4HX 1C0LA 3C7CB 3KYDB 3GA0A 5LC1A 2H1SA 3GVIA 3EC7A 3GVHA 2EG9A 1PGOA 2X1HA 2RH8A 1EE9A 4DIOA 4CM5A 4PGFA 4IDGA 2HK8A 1B15A 3I3OA 4YACA 5L9AA 1K6XA 2AG8A 3BMOB 1O94A 2BELA 1HDCA 5KWEA 1P3DA 2C29D 8LDHA 1DLIA 2Q99A 3H65A 4R5MA 4R41A 1E6WA 1Y6JA 2LDXA 3AU9A 3JYOA 3PYMA 1KC1A 1GUFA 3KSUA 4IMPA 1RWBA 1LRKA 3WYEA 3D1LA 4NJMB 3I9KA 4OQYA 1J6UA 4PVDA 1XG5A 1B14A 2H5LA 1L7DA 4A2CA 4M1QA 4JN6B 1F8GA 2TMGA 3MJTA 1SEVA 4WPGA 5DOVA 4PN3A 3FNHA 4H16A 4MKXA 2Q3EA 5JFOA 3PTZA 3WYCA 4CV3A 3E8XA 4D44A 2GO1A 2YW9A 2IXBA 1BW9B 2O3JA 3D3WB 4NFYA 1F14A 3WGIA 1YRLA 5MGBA 1PJ3A 4GMFA 1N7HA 3E82A 3AFNA 3PJFA 3I9JA 2CDBA 3FPCA 3RIHA 1NPDA 3M1LA 1VE9A 1OFGA 4DYDA 3INRA 4J1QA 3IJRA 4AJIA 4B7CA 1C0IA 1U3TA 5JAQA 4FFOA 3EUWA 1JW9B 5TIIA 3OM9A 4MVJF 3KYCA 1Y8QA 2A92A 5IDWA 4E5NA 1QV7A 4W99A 1B8VA 3KYCB 2I67A 2EV9A 3ZNPA 4RF3A 5C7LO 1DIAA 5TQVA 2EXXA 2NVUB 5A9RA 5JPIA 4IUYA 3M2PA 2ZCUA 4BVAA 1H93A 5LDGA 3GH3A 3PHIA 3TZQA 1BXKA 3CKYA 4E2YA 4C7JA 1BWSA 3WMWA 1RM4A 1HDXA 2O23A 1R12A 1X7DA 3ZU4A 4YRAA 5DCYA 9LDTA 4CMEC 1FXSA 4IQGA 4E2XA 3BTOA 3DDNA 4OQZA 3RUCA 4XJSA 3TWOA 3MTJA 4J4HA 3BZUA 1GYQA 4FCCA 3VDQA 3EHEA 1NPTO 4CM1A 4MP6A 4B4WA 1JTVA 1NAIA 4CLEA 2HUNA 4AJLA 1V3VA 5F5NA 5THQA 3UVEA 2YHIA 4MP8A 1CQIA 1HYGA 4QECA 4DBVO 2Q4EA 2VRBA 5KVVA 2G82A 1KEPA 3ETDA 3U5TA 2VQ3A 1ONOA 1ZIDA 4WCFB 3W4IA 4WLUA 1P31A 3KOUA 1DBVO 3V5NA 1E3EA 2QX7A 4FFPA 4YJFA 2O3RA 2A94A 1IHYA 4HADA 3BMOA 2PGJA 5JE8A 4DIBA 1IL0A 4ID9A 4JCOA 1M2WA 3OMLA 1N8KA 2HAEA 2AMFA 5EQDA 3T7EA 3WX0A 3B1KA 3WIEA 1VI2A 3SC6A 4EUFA 1FMCA 2ZB3A 4NFSA 2Y1CA 4A26A 1P1IA 4GQAA 1Q0LA 3HJAA 4J43A 2VWQA 3BIOA 2FHSA 4NBRA 3OFSA 4YTEA 4JBIA 4INAA 3S2IA 1B7GO 2DTEA 1JKJA 1LSUA 3W8DA 1HRDA 5I7FA 2DQ4A 5HBRA 3EY4A 3B1JA 3LLSA 3V2HA 3SC4A 4DBZA 2B83A 3GDFA 1C1XA 2C7VA 3NT2A 1M6HA 5DF1A 4IQ0A 3AY3A 3H5AA 4AJ1A 3EW7A 3L07A 4CM3A 1UAYA 2YZ7A 2ZYGA 1G1AA 4HWKA 1LI4A 1I32A 2WEKA 3GZ4A 3TOXA 1Y81A 4MIOA 1H6DA 3C7DB 4HP8A 1RM3A 3DBHB 3U4DA 5BNFA 4B4OA 1IOLA 4RLHA 3RJ5A 4GX1A 1DDOA 4Q3EA 1N92A 4J7XA 3WLFA 3ZZNA 5ADHA 1TB4A 1BDBA 3A14A 2GN4A 2EEZA 4LMRA 5COQA 2NQTA 5T57A 4YPOA 4MINA 2JHFA 1E3WB 3VPGA 1QKIA 1GZ3A 1EE2A 3LF1A 2VTEA 2CDCA 2ZK7A 3JQAB 1YL7A 3VAZA 2CNBA 4CM9D 3AWDA 4HFRA 1T24A 3OHSX 4WCFA 1A4UA 3VPFA 2AEJA 3UUWA 1DJQA 2QZ9A 1B16A 1LUAA 5TLSA 4XQEA 2JJYA 1YO6A 1FK8A 1SO8A 2A4KA 4QO8A 3WJAA 4TVOA 3JD0A 2E49A 3TNLA 4NHEA 5KJCA 3HN2A 2O3SA 1NVMB 4BKPA 1PSDA 4AJJA 2B35A 2VRCA 4PG4A 4GX2A 4DMLA 2AQIA 1NNUA 1IUKA 3PYLA 4NU5A 5TJ9A 4RF2A 1DIHA 4CM9A 5BSEA 3ZH2A 4BNFA 1GCUA 5FI5A 4RJTA 3ASUA 4HXYA 3C1AA 3PLRA 5T67A 3CE6A 2E6UX 3I9NA 5ES3A 2QHXA 1CDOA 3ZU5A 4Y6SA 3O26A 3OH8A 3QIVA 1KVQA 3DHNA 2IDZA 3JQCA 3S2EA 1UP7A 2HQ1A 4WK6A 2NVWA 1G0NA 3IKVA 4KZPA 5I9NA 1Y8QB 2PWZA 1M66A 2PA3A 1CYDA 2Q4BA 1PGNA 3F6YA 4BO5A 4F46A 3HB5X 4UUOA 5GZ6A 2FN7A 3NJ4A 2QQ5A 1PJSA 2RH4A 2GCGA 2ZTVA 3GAZA 5G0VA 3ETEA 5F1PA 3PHJA 2PH5A 2PNFA 5DZSA 2GZ3A 2UAGA 4I5DA 4Z6KA 1HT0A 4RPLA 3I9LA 2DVMA 4E5MA 2BH9A 1LDMA 4XJTA 1U2DA 4JP2A 4RGBA 4TKMA 4D79A 1EVZA 4BL5A 4D42A 3OA0A 2YY7A 5C3MA 4CV0A 4L74A 5JYFA 4ZQFA 1F8FA 4EGFA 3WBFA 2H63A 2X5JO 3INGA 3DBRB 4UUPA 4BNWA 5JBIA 3S55A 5L4NA 1EBUA 4TZTA 3TFOA 3WTBA 4WLVA 2IYOA 4WLEA 1JLLA 1ZEMA 3F46A 4BGIA 4DC1A 5IAAA 1IE3A 2EIHA 1H6CA 3RC7A 1T1RA 4URFA 3ROKA 5B4UA 1Q7GA 2O2YA 4ESOA 1S7CA 2ZKLA 5HTOA 3GMDA 3WYBA 3KM0A 5B1YA 1DSSG 3BMNB 1D7OA 3P2YA 4J3FA 3UKOA 4BNVA 2ZTUA 1HDZA 4PLVA 1PGJA 3RROA 6LDHA 1JA9A 4FFNA 2B37A 3C85A 3ZW9A 4IIVA 2VYVA 4TRNA 4LK3A 3ZWNA 4KQWA 1TT5A 2VOJA 1DPGA 1SBYA 3Q3CA 1LDBA 2UDPA 2B4QA 3AOEC 3D5TA 2IZ0A 3AU8A 3E5RA 4R3WA 3ZN2A 4IDEA 5U9CA 4R01A 4IJKA 1DRUA 2GN8A 2Y93A 1E1KA 3AM3A 3L4BC 4AG3A 4J7CA 1RM5A 2DU8A 2X22A 3UICA 2CVZA 1P1HA 3D4NA 3D64A 2FMUA 5KJ6A 3FNFA 2EP7A 3NDRA 1YWGO 1ENPA 2UUOA 4W9NC 2GD1O 1GDHA 3HZZA 4YQYA 2YJZA 1GUYA 3FR8A 4JJGA 5EMHA 5T8KC 1O6ZA 1U3WA 2J8ZA 4QUKA 4K9DA 4GI2A 1ZSYA 3H9QA 1K2WA 3UW3A 2RIRA 4RDIA 4B4VA 1U9JA 1W8DA 2VRCD 4H15A 2QIOA 2BFPA 2PLAA 4Y9DA 3LU1A 4WKGA 1SPXA 1NWCA 4E5YA 2X23A 3EGOA 4N7RA 1LC0A 3WTCA 4JP3A 3QVXA 4RPHA 3ZWBA 2ZIZA 1N1GA 1GAEO 3LSYA 3DOJA 4L4XA 4I5FA 4NNJA 1O89A 2DLDA 4IZIA 3BTUA 1G0OA 4GX5A 1ZZEA 4IDAA 4YQZA 5F21A 1EFKA 4RVHA 4RCVA 3TZHA 3OSUA 5AXBA 4YJHB 3OQ1A 4JXKA 5H81A 3I1JA 1LSSA 3GZNA 1PJBA 1Z7BA 1ISMA 4BNTA 3PGXA 1I3KA 4Z9XA 3D3EA 4QT0A 5FYDA 4K6CA 4Z0TA 1MC4A 4D0RA 4BNYA 3OETA 1A7KA 4MVJM 5KNLA 3ZI0A 2GR9A 4YAIA 1P9LA 2PKQO 4R1SA 1M6WA 4HNHA 4LMPA 3WGQA 4E12A 1YQDA 1HWYA 3ADPA 1ARZA 4J91A 5ENDA 3ROPA 4XCVA 1TT7A 4OSPA 2HU2A 3SJUA 4CMEA 4O63O 3QP9A 1HYEA 2QRLA 5DP1A 2WYUA 2HK7A 4BKUA 4DYVA 1XA0A 1P0FA 3I4CA 1KBZA 3B70A 3DXFA 3OBBA 4GKBA 2YQ4A 3ST7A 4ZRNA 4L76A 2X9GA 1NFRA 4BNGA 4CMKA 4BUCA 4DLAA 3FN4A 3H8VA 3KEOA 4DVJA 1YBMA 2DUWA 2UVDA 3PWKA 1FDWA 2XOXA 3UN1A 5T73A 5CDGA 5L7WA 3BMQB 1LC3A 3TSCA 4PFJA 1E92A 1WZEA 3SX2A 4YDRA 1Q0HA 1I3LA 5BT9A 2P5YA 4CQMD 4ZJUA 4J1SA 4JNKA 3RKRA 1LQTA 1X0XA 1HF3A 1QV6A 3AUSA 4IJVA 2GYYA 5JDIC 4PLFA 2RBEA 2RCYA 3HQ4O 1E77A 1M67A 2AA3A 3RUDA 2R00A 3ANLA 3GVPA 2OOSA 4MP3A 3GGPA 3MJSA 2FY8A 4CMIB 2DUUA 3DR3A 1BTOA 3TZCA 1JAYA 1T26A 2Y1GA 3T4EA 1C14A 4XGIA 2ZTMA 2HMTA 2IEDA 1B0AA 3PHLA 2A35A 2P4QA 1PZGA 1DHRA 2VNSA 4XQCA 1VKOA 3V1TC 1CETA 1LU9A 4RL6A 4OH1A 4OKIA 1P45A 2HJSA 4DRYA 4R54A 3E5MA 3H3FA 3C24A 4XZ3A 3CTMA 4GL4A 4HNGA 4MIEA 4A10A 3O03A 2NTVA 1MA0A 4JJIA 2O50A 3BMQA 3A9WA 3WSVA 5L7TA 1C3VA 3QWFA 1AGNA 5A04A 2JKVA 3W8EA 1BGVA 1R0KA 4UULA 3R6DA 4J6FA 1J5PA 1Z45A 1AXGA 4TMFA 5CDYA 4Y67A 3ICPA 2WDZA 4Z0PA 4L9RA 1EDOA 3KB6A 2HMSA 1I24A 2C2XA 5KIAA 1ISGA 1ZCJA 4XYGA 1V9LA 2PY6A 4GAEA 3SLGA 4FB5A 2G17A 1GCOA 1KVUA 4BNLA 1KERA 1KYQA 5AXAA 3PQEA 2ZYAA 2ZATA 3PWZA 2QG4A 4DTIA 5JW6A 4W6ZA 3V1UA 3HFGA 4EZBA 3JQGA 5JDCC 4R1TA 4P38A 3PFWO 3KXDA 5F1OA 3WGHA 1XQ6A 3GGOA 1VPDA 2A9FA 3C3XA 3TDKA 1JU9A 2OO5A 4N5LA 3LK7A 4XEHA 3A06A 1U4OA 2GUGA 2VYNA 1I8TA 3GK3A 2LDBA 3PP8A 4FJ0A 3EYWA 1J49A 3FRJA 3MOGA 4I9HA 2J3KA 1IPEA 3BTVA 5T8KA 1DEHA 1MLDA 1N2SA 3PHGA 4WLOA 1N1EA 3OF2A 1QORA 5JAIA 4J2OA 4ALIA 4DQVA 3KETA 4XYEA 4GGOA 5JLAA 4LCEA 3DBHA 1DRWA 1ZK2A 4KDEA 4PRKA 3ENNA 4HFNA 3RBVA 3OJ0A 3RUIA 3S1LA 3GDOA 1JWAB 4F6CA 2PH3A 1HE4A 1RPNA 1R4MA 5CPBA 2EGHA 3K2BA 4A73A 4UREA 5EIOA 3AUAA 3PPIA 5CDTA 1ADFA 2CZCA 1KETA 3ZNOA 2V7PA 4EBFA 4RZHA 1R15A 3I83A 1E3IA 2HCTA 1GYPA 4KUGA 4H7PA 3H7AA 1B2LA 2I99A 4FBGA 1OMOA 4BNHA 4ROSA 2AE2A 1HE5A 1T25A 4EJ0A 3I5MA 3ICCA 2DPGA 1JVSA 5KVQA 5EESA 1SC6A 2EKLA 3GG9A 1VL0A 4B7XA 4IINA 2P68A 4IM7A 1UH5A 2GGSA 4YT4A 2VWPA 4J4BA 1FDVA 5ICMA 5A1TA 3FWZA 4BKRA 1P74A 5KVSA 1MV8A 1OAAA 2IODA 3D5QA 4E33A 2H6EA 1XR3A 5IZCC 2X8LA 1DFIA 5K9ZA 1LTHR 3JYPA 2Y66A 5ER6A 2E4AA 4RVFA 3WGGA 4BQRA 4D3FA 2OP0A 3DFUA 1ZJYA 3KZVA 4MOWA 3ZWVA 2D5AA 2Y1EA 2G5CA 2I5PO 2WYWA 3AI2A 2FSSA 1F12A 4E31A 3MTGA 2C82A 3JV7A 3UCXA 3PEFA 5JCJA 1B3RA 4A27A 1HXHA 5KKCA 2EWMA 1XQ1A 4FGWA 2C59A 3H9JA 4RPKA 4NDNE 4W9NA 4A5OA 4WNCA 1U8XX 3HADA 1A7AA 3H4VA 1W4ZA 4OOFA 3GZNB 3WR5A 4B7UA 4LSMA 1SCUA 3VDRA 4G81A 1LX6A 3W4JA 1GEGA 4JX8A 2X5KO 4TWRA 5AYVA 4CMAA 1U28A 1ZNQO 1IYZA 3RC1A 4R1UA 5B4VA 3HDJA 2Q1UA 5L45A 3G1TA 4ND5A 1E7MA 5A06A 1JAXA 4L75A 1A5ZA 2ZJ1A 1TA4A 3HDYA 4HY3A 1Q1NA 3U3XA 1SEPA 5JY6A 1MG5A 3BHMA 3RASA 3JTMA 1ADCA 4RPGA 1Y8RB 3GFGA 3RC2A 3NGLA 1QXSA 1A72A 1NFFA 2DAPA 4N54A 1H5QA 3FWNA 4M49A 3OIDA 3JQ7B 3NTQA 3Q2KA 1RYDA 4ND4A 1EVYA 4BNZA 1HKUA 3U62A 3WXBA 4AJNA 5EJ2A 3ZV6A 3V2UA 5I7VA 2FP4A 4OAQA 3QQPA 5ILOA 4DPLA 3Q9NA 2FR8A 1WDKA 2VUSA 3VZPA 3LC2O 4FS3A 5F1KA 3ZHXA 3F5QA 1N9GB 4UEKA 2OZPA 2NU7A 5A3JA 4XRRA 2IEBA 1VC2A 3JD4A 2D0IA 5TS3A 5K0ZA 1P44A 1V3UA 5G0SA 4FQ8A 4F6LA 1WZIA 3DBLA 1TT5B 2I6TA 5A5FA 3SJ7A 3CIFA 3JQGB 1PZEA 1MUUA 4CLHA 1PU2A 1TEHA 4ZHSA 2HJRA 4I9NA 4J1NA 3QWIA 4BB6A 2WWRA 3QSGA 1I3MA 4W4TA 4IJWA 4AVYA 5L3ZA 2O4UX 3HDHA 3JQDA 5GMOA 1V6AA 2E82A 3IUSA 4LRSB 3C1OA 4RV9A 3W1VA 1NYTA 4D46A 5KJEA 4RVSA 3RD5A 3VVCA 1DC6A 5J23A 4J2HA 2OORA 5CPFA 4OIMA 3DBVO 2W90A 3DBRA 2OP1A 3VPXA 1A9ZA 2YUTA 4BNJA 4P4GA 4OJNA 3QHAA 2CMDA 2EP5A 1CIVA 1DJNA 3F47A 1ZK3A 3L6OO 1YDWA 3D4OA 3AUUA 5F5LA 4CL8A 8ADHA 1KEWA 4L4RA 4BGEA 5GZ3A 5CEEA 4FJ2A 3VZQA 1ADBA 3NDIA 1H6AA 2NADA 1T2FA 3LDHA 2NM0A 4XR4A 5DDIP 5I9LA 5JSFA 1WLYA 4XWYA 3RSHA 4GVXA 5TT0A 3FSRA 3VPHA 2VWGA 3ZWYA 2D4AA 3LYLA 3OECA 3PYXA 2ZB8A 2Q2QA 4QXMA 4E4YA 3U49A 3ONDA 3VZRA 3DOCA 1Y9AA 1IZ0A 4GVLA 2J5KA 3MJCA 3OIGA 3I4FA 3WGYA 4UUNA 3N74A 2JFFA 2X0IA 4E30A 4MO2A 1C0PA 3ONEA 2YFQA 1YE3A 1MXHA 4CUKA 1UDAA 1DAOA 2HRZA 3HE3A 4W7IA 1JQBA 2AQ8A 3OJEA 3H9UA 1JDJA 4BO9A 1I01A 1T4BA 4E5KA 4BKOA 4E3ZA 5CEFA 4O6VA 3NRCA 1SZJG 3ZWCA 1J4AA 4G5HA 3DHEA 3L0DA 4YJGA 1H6BA 2BGLA 1EUDA 3FBTA 4R9SA 4PLWA 2GERA 4ZQBA 2ZTLA 3I52A 3V8BA 2Q2VA 2JCYA 4CL3A 1NTOA 1ZMTA 2EHDA 4YAKA 4YT2A 2YHIB 4KWHA 5JY1A 5L51A 3DBLB 1K3TA 3H5NA 1EQ2A 1Z73A 2O4CA 2AQHA 1A9YA 1ML3A 1EK6A 1PS9A 4CM6A 4CQLA 1BVUA 3QJ5A 5U1PA 1QYVA 2HK9A 2RHRA 5C5IA 1DC3A 2PR2A 4IJUA 4BHTA 3LT2A 5ICSA 4YXFA 1DRVA 5G0TA 4BNMA 1AN9A 2AW5A 2WYVA 3A28A 3PQDA 4CPDA 3JQAA 3F3SA 5IXSA 4WUVA 1F06A 3D7LA 3UXYA 3L9XA 5B37A 1SB9A 2C54A 3KBOA 3O9ZA 2Z1MA 4HX5A 3E48A 5M6DA 3OICA 4G2NA 1PIWA 4IGEA 2AHRA 3PJGA 4OGWA 4LCJA 3ZV3A 2JD2A 1ZXLA 1ISJA 1PR9A 4RVDA 2OBYA 2D5CA 3R0IA 1RYEA 3WQRA 1DIRA 5H83A 1PQWA 5CP8A 5TJHA 1WDMA 1GQYA 4E21A 4CR6A 1VKNA 5AVOA 3K6JA 4A03A 4FOOA 1PTJA 3F9IA 3RAJA 5IZ4A 3U4IA 4MJLA 3IQDB 4HUJA 3WLEA 5KJ1A 3OA2A 5A02A 4OM8A 3RKUA 1YS4A 3PIIA 3RU9A 2B4TO 4IDDA 3Q2IA 5HRUA 3VHRA 1D4FA 2Y0EA 3N58A 3RQSA 1WXDA 1PZFA 3DZHA 3IL2A 1NFQA 1ZO8A 3PHHA 4NBUA 1NAHA 2AG5A 4YVFA 1WMBA 1UXIA 2HMWA 2Q2WA 3RBZA 1GZ6A 3RFVA 1ZFNA 3ZV4A 2BMAA 1GZ4A 4FW8A 3QV1A 5JDIA 1NP3A 4I08A 5A4DA 4AJ2A 4II2A 1XKQA 2W8ZA 1PJ2A 3ZNNA 3HWRA 1OC2A 4XQGA 4JLWA 1R16A 2VZ8A 3BHIA 4O59O 3CMMA 3O38A 4TSKA 3RU7A 4EJMA 2B69A 2CSUA 4AFNA 4MVJE 1SOWA 1XEAA 3K31A 1DB3A 3NV9A 1E0DA 4CLRB 4EUEA 3HG7A 4R3NA 2VHVA 4ALJA 3DZIA 1J0XO 3COSA 4WLNA 4QTZA 2GSDA 3JQ9C 1BVRA 4DL9A 1X15A 2IXAA 4M8SA 5EN4A 3MJEA 1P1RA 2X9NA 3TJRA 3FI9A 1DIBA 4LVCA 1X7GA 3W6UA 3KO8A 1AHIA 5DCUA 4XB1A 3KYDA 1QYDA 2RAFA 4IIUA 4M54A 1RJWA 3MWDB 4N5MA 4E2ZA 4YRDA 4YYZA 2FRDA 3PLNA 4CM8A 2DM6A 3SLKA 3WS7A 1N9GA 3K96A 3L6EA 5G4KB 4OO3A 2VHYA 4TRRA 3PWSA 1GL3A
chains in the Genus database with same CATH superfamily
5EHXA 1G5TA 1RWWA 3BZBA 3PJDA 1SOVA 2RKWA 1EINA 3EP7B 4Y6RA 4RF4A 4HNUA 1W4LA 1XP5A 2P2DA 4I55B 4OXNA 1OIXA 4YQFA 2R8ZA 1DEKA 3GNQA 1H2YA 3UY4A 4WY5A 4MWGA 4ED9A 4MCJA 4C03A 5JOQA 1I7DA 4P82A 4NE7A 2NXCA 2C94A 1U4SA 3OPQA 3L7BA 1WOMA 3H87A 1X14A 3A2LA 3PK0A 1E62A 1SWVA 2P5UA 1NHGA 3NGXA 4LY9A 1W6UA 1Z36A 2G9QA 4TT3A 2HU5A 1KKUA 2FE4A 2C20A 4XSGA 5KVCA 3BA1A 4GPTA 4KGDA 4JLDA 2G36A 4Q3NA 4WOKA 3SF0A 2GTPA 4V03A 1IN7A 1ESZA 1L5ZA 3IUQA 4ZOLA 3NNSA 3LIIA 7YASA 2GEDA 3QBEA 3UJ8A 4CHGA 4LVNA 2JFPA 1W4AA 1MO5A 3IXQA 3UMVA 5B4TA 2GH1A 5HRCA 4ZO8A 1E3SA 2OHIA 1EUYA 4MV0A 2LD4A 3D4BA 3JALB 2XAUA 5TNXA 3ILXA 1PWEA 2J5RA 1M75A 1PEDA 3OFJA 5FFFA 4X6LA 4JJAA 4DG9A 4HEJA 1NWHA 1TO2E 3Q3IA 4R4JA 4AC9A 3V48A 2COUA 1Q0PA 2D7DA 2WAAA 1KQPA 2JAHA 2OT3B 3LJKA 5EGSA 2RGXA 5J63A 3R5HA 2NU9A 1X1QA 2OYSA 4BCBA 3R75A 4TKUA 3GRFA 1TEVA 2I7XA 2G06A 2P90A 1FP7A 4XTCS 2Y77A 4GZMA 3TV1A 3DWGA 1N6PA 2GPBA 1PWZA 3I72A 1YHYA 2QP9X 4XR9A 5KMGB 2ZRAA 2F6RA 2OV1A 1IBSA 1R37A 2JA1A 1SHJA 2ZWPA 1WSWA 2P6UA 4FYXA 1LWOA 3E3MA 2XNDD 4ILKA 4LF8B 4YDQA 1E2QA 3M4XA 2CD7A 4RKQA 5IKPA 5JRZA 2IEZA 3SZRA 3STVA 2WBLC 2FPSA 2VDOB 4PYQA 3M4JA 2V65A 2Y4OA 4IUCS 1KI6B 4TTAA 1K97A 1RPAA 3NTUA 1OTXA 4GZ6A 5HDBB 4BVGA 1XZDA 4RQTA 4WI1A 2H59A 3GDGA 2CFRA 3MFQA 4C30A 4BB5A 4C6RA 4F3TA 1P29A 2JGEA 3ODPA 5AHXA 3SC3A 4LKRA 5C1PA 1S02A 2F9FA 1GXSA 2JAOA 2MHCA 1U3DA 1V1JA 4P4SB 2P6NA 2EBHX 3AEKA 2O14A 3GLRA 2QJOA 4F5YA 5AVXA 4YJHA 4Q4HA 2X8AA 4X7RA 5FXMA 5AVRA 3KWFA 1MN6A 3W9BA 1QG6A 1M6NA 1AUVA 4HAIA 3VR6H 4JI8B 4R16A 5FWNA 4K05A 1RYFA 1Y5MA 1R1DA 2ATEA 3C48A 3GCDA 4MAFA 4RGVA 3V1NA 3W04A 4B75A 4LDRA 1Q22A 1YH3A 3UJCA 4HDMA 5E2IA 4GI5A 4W5QA 3C8HA 2PD6A 2A59A 1FU4A 3I12A 4AY2A 3P9IA 1T13A 3TSOA 4DCGA 3DKVA 5CXUA 2WFZA 4N5HX 3IEVA 2B98A 2H1LA 4AO6A 4J0EA 4DJDC 4PZLA 1BDMA 3IAS1 4K9KA 4OHFA 3VUEA 2ZIEA 4ZT2A 4BO4A 2JZNA 2F3PA 1XZMA 5BMVB 4BEVA 3BCSA 3VC3A 2AZDA 1U7OA 4UHEA 1U0EA 3O95A 3V4OA 1CDDA 5K51A 4DLNA 5LPNA 5FL3A 1J0DA 4N0MA 1VJTA 3A6ZA 2O5EA 3VOSA 3NH9A 3OJWA 1OXVA 3U3RA 2OD7A 1ZRMA 3KDAA 2X19A 1WABA 3QYJA 2Z1DA 5DHPA 3VYVA 1Y9EA 2VF7A 1YB7A 4WW0A 1I3CA 1VYTA 3MBOA 3KALA 4F4FA 3GFBA 1W0KA 2CMGA 2O2ZA 1VFNA 5IUKC 4B35A 3U4CA 3DEFA 3UEOA 4HQRA 5KU7A 3LVFO 3ZBPA 1Z5WA 1I3OA 3ZWKA 1GGHA 4FMCB 4TN1A 1T2UA 3IVMA 3OQIB 4UTOA 3FCOA 4RMGA 2X4LA 1NQWA 3WB1A 4ZT4A 1FS4A 2PVPA 1W9HA 1CB7A 4GT1A 3RSQA 1QHYA 4IAOA 1NW3A 5DX1A 1SWWA 3W8FA 4JCCA 2BR4A 3COPA 1SXQA 1DFGA 4AKIA 2AV6A 4H0FA 2KB0A 5T3YA 4C4RA 1A4XA 1N7GA 5CLGA 1DO8A 1RZRA 1SB8A 5EINA 3CH5A 2OFFA 4KEAA 5AW0A 1JB1A 3HM2A 4NECA 2VK1A 2Z6UA 1HZZA 1IONA 3F6EX 3MQFA 4Y98A 1NVVQ 2AGVA 2ZYVX 3CY6A 3II6X 3R7WB 1QP0A 2IE0A 2WPDA 3FBGA 4ZK6A 2GLXA 2K87A 3BQNB 3HGMA 4P58A 3C1TA 4RIFA 2B4AA 4QSHA 3PX7A 2A9PA 4GF5A 3UFXA 4F4UA 1ZA1A 2WV9A 3IQEA 3ZYZA 3CC8A 5AO9A 3A11A 2AMLA 2VIIA 1XROA 2FMKA 3DEHA 1U1EA 3DZKA 3RJ9A 1F38A 3QFCA 3TQCA 2WE8A 1RM0A 1Q3KA 3DL2A 4DM4A 1QAQA 3WZLA 3GEMA 2QF7A 5HHTA 2C0QA 3OWHA 5EJ4A 1AQYA 3W7AA 1AS0A 3ISTA 4GMKA 3TS1A 2ZRCA 4Q34A 5SY6A 2K7FA 1JT9A 3OLYA 4PLTA 4C7MA 1M2VB 1L7NA 3FE2A 2ZBFA 4GZLA 4IXTA 1H22A 4U1RA 1OZFA 4AUMA 2BTOA 3KTAB 4WSOA 2HJHA 5EUMA 3E6AA 4TM8A 1Q2XA 2ZIVB 3UAYA 2C9MA 3H83A 1MAAA 1O4VA 5AKHA 3P9XA 1A7UA 3R40A 4FSDA 1C4XA 2JAWA 2BHLA 4BMNA 5K8TA 4WJKB 1XZLA 5C81A 2QTHA 3LYAA 2FW6A 5IJWA 2BKVA 4TMZA 1C7RA 2HD4A 3KD3A 2H9IA 4MRMB 4KITB 1I7PA 4KP7A 3EXG2 1OI2A 3QNWA 4NYJR 4Y2GA 3IDSA 4TS1A 1MAUA 3ENVA 5ALTA 3WLPA 5KTRA 2AFRA 2FZCA 3U9LA 3QVWA 2ZE7A 4P84A 5DHUA 1RQLA 1TX4B 4KGZA 5FWXB 5K6AC 2TSYB 2UYCA 3GXBA 4GLJA 3CNNA 3N2KA 4BWYA 1PUXA 1Q7BA 2YS6A 2Q4DA 3LKZA 5IF3A 4RCZA 4G86A 1NUSA 1G17A 3CVJA 2FUG6 5C9ZA 2QMOA 3H2SA 1XDWA 4X44A 5C8ZA 3F96A 3O3OB 1I0LA 3LFUA 2HHLA 2H7VA 1P4RA 4DIKA 3E8MA 4N01A 3SVZA 1GP2A 3D2AA 2HIAA 1RKXA 2VLIA 1TYDE 2ZBDA 1V6CA 2V7XA 5KNDA 3T7RA 4JHXA 1O8BA 3IPXA 2EATA 4BNUA 2VTDA 2FWPA 3DZGA 3DOEA 5ALHA 3ZGYA 5GIOE 2ZJ5A 1L7EA 5B1SA 4EFMA 1I7LA 4D45A 5BSUA 3UMFA 2NUAB 2CJFA 2JLQA 2IF0A 4MI6A 3D7SA 1IU9A 1T1SA 1VXRA 1IB6A 4FFLA 2V45A 4JB2A 5T6MA 2AOUB 3NEYA 3QVTA 5CFPA 1TJPB 2AEMA 2NVBA 2OCIA 2V5VA 2VA9A 4EG5A 1IBKB 2F43A 1KVTA 1UZMA 4OHRA 3B6MA 4K88A 4DR4B 1TIKA 2AOXA 5AHRA 2X58A 4L5YA 4HNTA 4MUYA 3QSYA 4P86A 2NSDA 3E7WA 5JVDA 4WFIA 3I39X 4EELA 1QF9A 3JD3A 4OXYA 4RPJA 5HKBA 3LZCA 1LF5A 2I7VA 2A88A 5P8WA 1I2BA 3HU5A 2N42A 5FR1A 4F8YA 2Y1DA 2PUJA 2X7JA 5HKLA 1E6UA 2B1QA 5AQ1A 1GR0A 2HZ7A 1I6WA 1VLQA 1NPYA 4RFSA 1U1IA 2BWJA 2LZ0A 3P0HA 4QUHA 2YY5A 3T6KA 4BO0A 4KQHA 4Y1RB 3C6ZA 2BGKA 1R4NA 2QOEA 1ENYA 3O4IA 2Q22A 2LRHA 4MLDA 4P0QB 1YVPA 1JHAA 3WYAA 4BAZA 3CX8A 1H5UA 3LCJA 3Q1LA 1E1NA 1SVNA 2YXEA 2Z8YM 3COZA 3MERA 5FPSA 4C7BA 4F0JA 4B2LA 1QB7A 1M2OB 2W0SA 3IT2A 4AJ9A 1LBIA 4NOMA 5CYFA 3JVEA 1P2BA 4U7JA 1X7ZB 3L93A 3QVJA 1TTHA 1Z82A 3LQ1A 3VU1A 1WBDA 3ZDRA 2MWMA 4BEWA 4CV1A 3QW2A 5DYTA 5G40A 3RLFA 3TZLA 2XUGA 3G8YA 1NXSA 4Q39A 3ZCXA 5DTEA 5DM4A 2R6DA 4J90A 2IOYA 3AESA 3WFIA 4YRMA 2QAGA 3THXA 3DWEX 4AMVA 1Y3AA 4O8JA 3MXTA 1XCLA 3DHYA 1ABEA 2JKYA 2JGRA 3G5AA 4X1OA 1K88A 2CF6A 1BSVA 3WWDA 2I55A 2FFAA 2DWCA 1AQ6A 4XGRA 1LD3A 1NL3A 1JFRA 2J3JA 3K8OE 5FWYA 2AYZA 3UO8B 3V1KA 3GHYA 1E6EA 3F6BX 3WLKX 1H3NA 4Q47A 4MW4A 4MULA 1TZCA 2WICA 5E3JA 2X0NA 2JIPA 5EAIA 3WGMA 1XLUA 3GLQA 3BYZA 1WXEA 3GZJA 4IWNA 2QT1A 3RFXA 3ZIDA 1TGYA 3M7IA 4TMYA 1R6BX 2JLBA 2IRWA 3S44A 2B1GA 1MPTA 1XCPA 1IQUA 1XDGA 2QL5A 4QOJA 2JLUA 1VPVA 3PFNA 1MB3A 4TL7A 1WOYA 3OD1A 1U98A 1Z5NA 5FRDA 5KKAA 2NU6A 3H17A 2DZDA 2IHNA 3VSCA 4CQMA 3IP8A 3MWEB 1PT7A 3K92A 4QQRA 5CEJA 5KB3A 1LTKA 2YV1A 2FFJA 3AXSA 2KM1A 4G09A 4O4HA 3T15A 4ZK2A 3LGSA 4FB4A 4B3SB 4OY3A 3IEXA 2RB5A 4PBSA 4QGFA 1MMFB 5CFMA 3GYGA 1US8B 2C88A 3EFOA 5HMMA 5TPWA 3T52A 2YIJA 1WZUA 4Q4AA 1CUJA 3KEQA 1Q57A 4RQBA 5FD8A 2V1UA 3DMHA 1FFXB 2I3GA 2JATA 2YV5A 3NHLA 3VU9A 2IE8A 4HEQA 3ZU6A 4ER3A 1QGYA 2IYWA 3LYHA 2VPTA 1YE8A 3DZCA 2O8BB 3E9NA 2PZBA 3VKUA 2NZVG 2V6JA 4Z3KA 4MAMA 1SVUA 1QGZA 1ZH0A 1Z34A 3H9EO 2DECA 2JCVA 1JSRA 4OJYA 1QGUB 4B81A 2B61A 3ZW8A 5LB4A 1TADA 1QNLA 2JCXA 2YWDA 3N0WA 2O7SA 4QIHA 3TNJA 3GDWA 1X7XB 3THYB 4TKZA 5H4HA 1RWNA 2AOWA 1GD1O 1M8JA 1ZINA 3LLVA 3ABIA 4LTNA 3RBAA 1JHVA 2CFCA 4XM0A 3VTAA 4M1ZA 3D9QX 1TYCA 4B6SA 4WQMA 4DIFA 1GWNA 3ZGXA 4U7WA 2KX7A 3MQ4A 2HQBA 3CA8A 3LMKA 3CW8X 4JVMA 4MQEB 1HFWA 3IOEA 3CCBA 4N5NA 1ZJ5A 5I7WA 4UAGA 2YCLA 5FBZA 3BK1A 3HKCB 5AI6A 2BLNA 1QH8A 1QDEA 1YBAA 4JLAA 4Z9FA 1BEZA 3MJ4A 2IVZA 1LBEA 1U3UA 5AJYA 4TQAA 2CMFA 4AXXA 2VXOA 5A3VA 5CBPA 1QYWA 3W7VA 5GPBA 5TV2A 4NCBA 2O7VA 3EUAA 1QIKA 3MMNA 2B21A 4IIGA 3KE8A 3ZXSA 1J2RA 2ZR0A 4B79A 1XU4A 5B58T 2HPHA 3GXOA 2J33A 3ZHUA 3PSAA 2RHCA 2MT9A 2V98A 1MB4A 1NDQA 1RXUA 2I62A 1OASA 4FDVA 4NZZA 3VPDA 1HTWA 4J0CA 4YEDA 3PVZA 3FYHA 2Q1SA 3VJKA 3FTPA 2P69A 1I4WA 4L4YA 3U6BA 1JI3A 4B3GA 1YR8A 3C43A 1WQ1R 1BWRA 2KQUA 5I9BA 3FNEA 5IN4A 4LE0A 2VRNA 4P98A 4U6NA 1RQGA 3FTNA 3HKCA 1JWBB 4JY7A 5FF9A 1XDUA 3CNBA 5LWQA 4G4IA 4Z4EA 1JJ7A 3NBYC 1VE3A 3FTEA 2ID8A 2BBTA 2JFOA 3DM5A 2GMWA 5C0OE 3M83A 5H3CA 3M6LA 2YUIA 5G0WA 3SYLA 5KYWB 5LMCA 4PAOA 1XWFA 3K4HA 1SMKA 4QPCA 3KCQA 5AI0A 1KDZA 1XL1A 1X94A 1XIVA 1CY1A 3HCFA 4QO7A 4DFDA 3PR3A 1H2BA 4Y0NA 3VVLA 3H9GA 3SS8A 4GG1A 4HJRA 4B6PA 1VRCA 2X0JA 2UV8A 4Q3DA 4B6FA 1FDUA 1R4AA 3ZD8A 3NDJA 1EBFA 3TK1A 4PYMA 3ANTA 3HP1A 2MCFA 3K0BA 3I6QA 2CCKA 4EPTA 3CBQA 5K2OA 1OH8A 2Z4SA 2AFIB 1SVKA 4L73A 2I33A 3G5LA 3SKXA 4M83A 3DDZX 4XB6B 4EKGA 4AKGA 4W7SA 2X13A 3B7WA 2RDMA 4QXOA 1CQIB 4OXXA 5A0FA 5AW5A 2E9SA 1PFYA 4DA9A 4YUYA 4KQ1A 1F6BA 4X6YA 3RVOA 3E1GA 3E9EA 3PI6A 3C0KA 2NOAA 1QIMA 2YJNA 3E05A 3GJXC 3L4EA 3L8ZA 3QU9A 4U6QA 3PC4A 1NN3A 2GCNA 5K3FB 5K8JB 1AIPA 3PZRA 4H6VA 3CZPA 4B87A 5MGNA 4P6VF 4DJFC 2ZRDA 4CQMB 3UUGA 3NASA 4F2DA 1F8XA 1O6FA 1QCYA 4RDCA 4DV0B 1MFPA 1D4AA 3OEYA 2FX3A 3MUOA 4KV9A 3DLHA 1T0IA 4CEIB 2X40A 4Q7JB 3ROXA 5JCJD 1IY9A 3P0IA 5EA2A 1GSOA 4ZD6A 1VHJA 1U5BB 2ZFUA 5AESA 2FVXA 1KFCB 3GAFA 2VHWA 2VWHA 3SHTA 3IMFA 1P1KA 5KJFA 3T1HB 1Q77A 4G4GA 2POQX 3QNUA 4CNBA 1U81A 1N2OA 2A4MA 4H18A 2VZLA 3CV3A 3L1JA 3V8PA 1Y8RA 1XZQA 4XPIB 4CMBA 1O4WA 2NT3A 2V9CA 2XGGA 1G8SA 4IZHA 4UU7A 5DSXA 4PG5A 2RHDA 1SKUA 2R8PA 4P32A 5G0UA 5TF4A 1S6YA 1E7SA 1FYWA 3A1NA 3K1AA 1T9AA 1YJBA 1P18A 2QAGC 4MVJH 1Z0SA 3GJ8A 3NC1C 1K7FB 3KR2A 3TL3A 4F2WA 4PN7A 4WWHA 5HJEA 4IHJF 3UXMA 4YWJA 2OXEA 4FYPA 1E2HA 1RLOA 2BSAA 5CD9A 3WGKA 3CFYA 1X7WB 3R7SA 5GVSA 3NDBB 1J24A 3DEZA 4AQDA 3GI1A 3WDMA 2YHUA 1OB5A 2O7NA 1R5JA 1CZUA 1G18A 2LNDA 4ICIA 3LDUA 1H2HA 2MR6A 4P7KA 4V0ME 2HLDA 4Z9AA 1NTRA 3X1XA 2V3WA 5KHAA 4QUGA 3C3PA 4EI2A 4HN2A 3O8CA 3MW8A 3R9WA 2P9GA 1S8NA 2XBLA 2YZMA 4OVKA 4DMGA 1WW2A 4BWVA 4HBGA 2BI7A 2L19A 3JVDA 4BMVA 3BAFA 1IULA 2F3QA 5BVGA 3MLEA 3N7TA 5BSGA 4LOHA 5F12A 1WA5A 2AOVA 4K6OA 1AF4A 4LNHA 4RMIA 3M34A 3L4KA 2QV7A 1TC2A 2XYRA 4BRZA 2C2MA 1OW3B 4DE5A 4MPDA 2GN6A 3MTAA 1EVJA 3MTEA 3GC6A 2JFGA 1G63A 3F1LA 1QMGA 2J6BA 4QXQA 2HB6A 3MWEA 3L5KA 5MN6A 2NU6B 2DTXA 4BJHB 3FVTA 1W88A 3OFKA 1DKRA 4FWTA 3RHZA 2HNAA 4Z4HA 4BPBA 4FJ1A 1WKCA 4G6ZA 4HI0E 2EC5A 1Z56C 4MW7A 5BNWA 1P9NA 2O0MA 2XYGA 2O20A 3TUTA 3L46A 5J2UF 3IXLA 4UXJA 4KDCA 4LRTB 3BMNA 2ZCJA 3NOVA 1OGYA 3WZ2A 4OFZA 2PV0A 3PUWA 3ZGOA 3M89A 1ZVMA 3CF6R 5EE5B 3WK4A 1G8KA 1P4AA 2V1XA 1ETUA 1W2WB 3BL8A 4KAAA 1MJFA 2JDID 2JA2A 1QK3A 3AB7A 3IESA 4MGIR 5EC8A 3FB4A 3I92A 3IOCA 2OXIA 3R09A 1QRRA 3WKCA 3IEMA 1UEIA 1JECA 2HLNA 2LIPA 3GY0A 4XIYA 5FO0A 4AG6A 1GQQA 1W94A 3Q87B 4Z3DA 3O2JA 4IOKA 2H08A 4OHCA 1A27A 1T4DA 3H7IA 4GU5A 4EQZA 1NM5A 4QBHA 3CLRD 1Q2UA 4Y6PA 3WGTA 3WLSA 4EO7A 3BTSA 3SHFA 3GRKA 2FU5C 1DXQA 1PUIA 1XJCA 4HGPA 1P62B 1Z8HA 1FVFA 1YU9A 1P39A 4EHFA 3D3QA 1T5OA 5C18A 3DDWA 1V37A 1WCIA 5EMJA 2PQ0A 4FIZA 4TTRA 4KR2A 3VYUB 1UOQA 4L3VA 4YA6A 1ZW1A 3ZCQA 3ESRA 3MS4A 1Z75A 1I2CA 2B36A 5U4QA 3N6VA 5ICCA 3W6OA 3PL1A 3CZRA 4KIUA 1YQXA 4LWOA 1NXQA 4D6YA 4QODA 2J45A 2QGFA 4NP6A 2AKAB 3RUHA 3TYXA 4FINA 4MUNA 2JJ1D 1DOAA 5B12A 2JJ2A 2WQ6A 2Q3MA 1DX4A 1JQLB 1LSOA 2JEOA 3K30A 4RFSB 4NY1A 3MD9A 2Q29A 4OKNA 1ZWLA 2NWQA 4KQ2A 2CXUA 3QA9A 1QMIA 2PV7A 1V26A 2WAMA 2PFGA 2X8JA 2DFPA 2GAIA 1QIDA 2XOKD 5BSTA 5HYVA 2HL6A 1UPBA 1O87A 1GQRA 1AGXA 1DL5A 1TF7A 1ZAKA 2XE7A 3L0CA 3NNNA 2CHUA 1IOVA 2QSUA 3OQMA 2QVYX 1TC1A 2AYYA 1RIFA 3SG0A 1OBFO 1X3SA 2E2WA 4KUEA 3HXLA 2WJPA 4MI3A 2CKMA 5JYBA 1E8MA 2PUTA 2ZEJA 3QEAZ 2JHAA 3L9WA 5CW1A 1L5HA 1HT1E 3SAJA 2H17A 4R1NA 2UZIR 3JQRA 4LDPA 2X2OA 4GKVA 3TRIA 3PIDA 1DKMA 1W44A 2ZDHA 3UANA 5BPFA 3G7NA 2R751 2AQKA 1U7ZA 1N77A 1EVKA 2IZ5A 1TLFA 3CF4G 3CT4A 2JRCA 2O1XA 3LHSA 3S70A 4YV2A 2PLNA 1X38A 4NONA 1HNXB 3GJ3A 5LP6F 3AH8A 5HTKA 3UCEA 1E4EB 521PA 3P9RA 4W6QA 4DR1B 3E27A 4ZWNA 4OQNA 1MZVA 2VPZA 4EB6B 5LQSA 2R84A 2IUTA 2QSYA 5T5QA 3AM1A 3THOA 1OI4A 1TZJA 4PF1A 3WG9A 1K4MA 3G2IA 2J3DA 4RA9A 5DHSA 2MINA 3W5HA 4BJ1A 2CXQA 3F1KA 5FUYA 3U7JA 4MEAA 2I4LA 3I1FA 4K1XA 4FYIA 2ZIGA 1C8KA 1Z0JA 3EIHA 5HQ3A 4CKBB 3OLCX 3VR4H 5J1SB 3WWYA 4B40A 3IKTA 5TSDA 1X80A 1KBQA 1O5IA 2CL0X 2W48A 1RP7A 3HU2A 3NHZA 4BNDA 4D9JA 4WESA 2NACA 4EVRA 2VUHB 1QE0A 2NV6A 3FSEA 5ALRA 2IYEA 1J21A 3DT6A 3MBIA 3OQIA 4KQXA 3AMVA 4P4LA 2KHZA 3QPCA 3W3ZB 1MTZA 4N9QA 3K09C 4B3HA 2Z2XA 3O4RA 2B5VA 2YVAA 4TV9B 2FWBA 3PT9A 1XKXA 3A3OA 3QTTA 3P45A 2F17A 3ND6A 6ADHA 5CG2A 1Z88A 4FR0A 4J07A 2UZ4A 4NH4A 5F2KA 4TQ9A 3S5JA 3CR3C 4UBNA 4R1OA 1VE6A 2IPOA 5IULC 4EB3A 1U1GA 3AG6A 4P7FA 4IIBA 2X86A 3ZTYA 4INJA 4DIMA 3UB3A 4RM2A 3NOQA 1A9TA 2QV0A 2A3NA 4NAVA 4TXHA 1TKRA 3G0OA 1JKJB 3P27A 2WUVA 3LY8A 4MQEA 4PSAA 4B09A 5HRAA 2ZITA 2CL5A 2P75A 2RCNA 3FDIA 3OM0A 4ZOCA 1SCDA 1E2GA 5TB5A 5TT1A 4BNDB 3PRJA 2CWDA 4Y8VA 5HOEA 3O3MB 2JLZA 5DNYB 1IG0A 4I8IA 4HPXB 2RHWA 4AZVA 4LWZA 4DWJA 1N5IA 4ZEOA 4D0SA 1YL6A 3QYFA 3TIXB 2C2BA 2FZWA 3EUFA 3DZDA 4Q4HB 5LQDA 2PZLA 1RWMA 5EIXA 1F0PA 1PJLA 1YZYA 1ZMXA 2FK7A 1EH5A 1XVUA 3V7UA 4DN6A 4F3YA 4BO7A 5IT5A 1EESA 1OJLA 5REQB 5CJ2A 5CB4F 2VP3A 1PWXA 4PQGA 1QNFA 2E7ZA 5DU2A 5KYWA 1ICEA 5FDFA 1O2DA 1UC4B 1JLSA 1HE1C 2QY9A 1XZCA 3V7WA 1AJEA 4ZV9A 3D2BA 4DIUA 3H5IA 4X5OA 3TUXA 1KI6A 3LV8A 5KDDA 1U80A 4WKPA 3NLLA 3ESZA 3P9YA 2WQ7A 1S96A 4FUTA 3T3OA 5EI5A 4DR7B 2BI4A 2V7QA 1YVEI 5KDOA 2GZSA 1KC3A 3KTOA 4Q9JA 3W3AD 4NJOA 3S81A 3CEJA 1RYNA 1WKBA 1VB3A 1GZ7A 1AZSC 2WA2A 4OGGA 2OGUA 4IBOA 4L8LA 4QJBA 2Z6AA 3VMFA 3STTA 4EA8A 1XL0A 1OLSA 4GLFA 1CD5A 4IF4A 1IJFA 1JYFA 1JJAA 2AUMA 4KUHA 5DULA 3RUAA 2VEOA 2XAAA 3BK2A 4B2PA 1NQTA 1UBUS 1UBLS 1U6JA 4CDRA 2HRBA 2V6BA 3EEYA 4XVHA 4E88A 4NE9A 1ISHA 2C1XA 1DWQA 2ZRBA 2OD2A 3P7MA 2JIOA 3LO5A 1RZVA 3U7EB 2FSHA 2I76A 4RK1A 4YAOA 4ZU3A 1Q7RA 4WL0A 3T7TA 4XJXA 4P9NA 3NBMA 1DCTA 1AURA 1EXDA 3O1HB 3KV3O 2FEOA 1EFUA 3GVCA 1DAMA 1DTWA 3D8UA 5DX0A 4KHPB 2GAAA 1QS0B 1SUBA 4MPTA 4UUAA 4O1MA 1PDOA 5DFAA 3TLYA 3JALA 2X3UA 2YV2A 1ECPA 3A05A 3RS4A 4EF6A 1E64A 1EK5A 4EW6A 4Z0NA 5AIBA 4WCFC 3IJPA 1MB0A 3V4RA 1JF8A 1GYRA 5FBLB 1CE8B 3TR5A 3UJBA 3IE0A 1PAUA 1R4MB 3VTZA 1BDHA 1DJPA 2QT9A 4YONB 5IJAA 1FYDA 3AKCA 5ALQA 3ULKA 4ARZB 1C9JA 5K3EA 3TE7A 3ND9A 3A1UA 3DQPA 4OHVA 1ZYUA 3L8HA 1P0CA 1TECE 3LHFA 5E4FA 4QM7A 1UJ5A 1Z62A 3WY9A 4JQCA 4QGHA 1MJ5A 1EEXB 4IGFA 3L6DA 2X7HA 2WIDA 2B5WA 2AEFA 3VO1A 2GTHA 4IPTA 1PK9A 1QIFA 2QUIA 2QW0X 1UOPA 4YCDA 2C42A 3O3CA 2IHBA 4JLSA 2BL4A 1KNQA 3JQEA 4ZDJA 1PLJA 1YZTA 2WWWA 2VZEA 3MMSA 3ANMA 2ZUUA 3N2EA 2A0YA 3B89A 4KRXA 2PS0A 4UVIA 4OLAA 2PBZA 1XKTA 1GPKA 5JADA 3TECE 4PZAA 1GQFA 1YHNA 2HRQA 1TXGA 2WD7A 4Q1DA 2Y1FA 3D3WA 4U0KA 2B30A 4Y0AA 1I3NA 4BV9A 4E5SA 1UT6A 5AJUA 4O3FA 1IIBA 2G83A 2XYHA 4M8KA 5DBHX 2Q3FA 3WL5A 1W59A 3B3FA 5FPQA 3SP1A 1EQUA 2ZIXA 3VJLA 1V8DA 2IUYA 2ENUA 2IX9A 3HKEA 4D9CA 1H2XA 1HDGO 1YKFA 1GADO 3B6ZA 2PEZA 1GY8A 2PKCA 4PYKA 2WF6A 2P9EA 1KXJA 1T4MA 3SF8B 5JBQA 3I8SA 4DJ5X 1L3CA 2ZT7A 2ZUCA 3TCNA 3WNDA 3HB9A 3D3KA 3VZCA 1YOVA 1F2DA 4MVJA 1Q1QA 2I6SA 3KJHA 4UDXX 3W4KA 5A4IS 2DETA 3IPYA 4TRJA 1QYCA 1EMDA 1CZHA 3HB4X 3T1VA 1WTAA 1R0WA 1C4KA 3FFTA 3NHYA 2P5TB 1F7UA 2ZULA 2OC4A 4JI7B 2HO4A 1K98A 2PGLA 1JT2A 2INGX 5E0KB 1MHMB 3HR7A 3OZRA 3ZHZA 1QIGA 5L4LA 4FONA 3KR9A 4M6WA 4UNRA 2FW9A 4ND3A 2FDCA 1YS6A 2ZDGA 1YJQA 1RJEA 3PDIB 4CFZA 5DO9A 1Y8ZA 5BWCA 3ITDA 3K5IA 4D5GA 2I2XB 4G8JA 1X1AA 4PZZA 2XB2A 1ZI6A 4NYIQ 3MTIA 4W7HA 4UE3S 3H8JA 3QE4A 3RTGA 5DT9A 3ZDAA 4A8TA 1UKZA 3A04A 1Q92A 2MIIA 5CCBA 2PMDA 3IV9A 3HVUA 4I1UA 5EOVA 2PAFA 5JI3E 1TU0A 2ZAMA 1PO7A 1I4OA 4QHSA 1FX0A 2XDWA 3F2VA 3GGJA 2PQMA 3V8MA 3RF6A 1H0SA 1U63A 5B36A 1FUYB 1PWYE 2BLLA 2W2LD 1XQXA 2IUSA 3BWMA 3MEQA 4MV8A 4C07A 1B6RA 2XZPA 3PGLA 3PQFA 3EX7C 2G9UA 3FF4A 1G98A 3HJBA 3ELWA 4Y6LA 2C2YA 3AHJA 1F8UA 5K0JA 3GN2A 2OPHA 1EGQA 2J5QA 4LWPA 2O3QA 3QMVA 4RSRA 4KVGA 2CEKA 3S0JA 5BY2A 1YT5A 2VTVA 2GVNA 2YQZA 3RRBA 1I2DA 1DUVG 1CT9A 3H0VB 3LDGA 3EEQA 4P5EA 5K4HA 4CE6A 1Z5PA 3MTGA 1L1QA 4ETWA 1BXGA 1NRJB 2I9KA 2E0IA 4PSCA 2V3CC 5CDUA 4BMCA 3WL8A 3GJ0A 4KR7A 5JYEA 4XYLA 2I66A 1HGXA 3UAZA 3DXYA 2I0FA 2W6NA 3F78A 4RTNA 4AKHA 2DFDA 3KEGA 1JL3A 1B1CA 5LUBA 2CVQA 2J30A 3EZFA 1X8LA 1J00A 5DM2A 4FDAA 2GF9A 3R7NA 4QFMA 4C0XA 5K0TA 1DJOA 1FTWA 1CF4A 4PX9A 2PRZA 5JVDF 4YQEA 1DHTA 2H2GA 3BDAA 2WTBA 3OQJA 1JPJA 1NX6A 2FEPA 4GSKA 4OOEA 4ZICA 1V8OA 3D4PA 1HH4A 4MCAA 5AM5A 4X93A 4ZGBA 4BLSA 2WMYA 2GBLA 2OMEA 2X0FA 3TZBA 1PR5A 5IHPA 4HGYA 1YF3A 1ZIOA 4Q3LA 1SA0A 3EDMA 4DMRA 3G0IA 1MIHA 3WB2A 3DZJA 3R7WA 4EG1A 3DBOB 1LX7A 3H16A 2Z1NA 4Q1VA 3ONFA 4YRQA 1KRHA 1Z0KA 4NJEA 3BPSA 3DZ8A 1GPDG 5IBRA 3CW2A 1R0LA 5IDQA 4HF7A 1IPFA 3RRXA 2RJ3A 3R9XA 1R0RE 1O54A 2JHGA 2QMHA 3W2FA 1LPOA 4CF5A 3DH0A 4Q9LA 3GLFE 1KO7A 2GX6A 1E3WA 3M6VA 4S1VA 2Y3IA 4MRNA 3VX3A 3DE3X 3QEJA 3HBFA 2XF2A 3JQFC 2ZJ4A 4DLLA 2D2FA 4YWHA 5TX7A 2NXEA 4NCAA 3ZDDA 3M2TA 3HDGA 3CUUA 4B3FX 2YYYA 1VBNA 3RVDA 1O3YA 5DMHA 4Z4QA 2R00C 1HMYA 3ZI7A 1CULC 3KSAC 2JIBA 3GQBA 4O3MA 2XXJA 3U0VA 1W581 4KTVE 2ABWA 1NBAA 3OQPA 1KE1A 3IIKA 1NVTA 4ZJZA 5F98A 2GF0A 4HDKA 4P31A 5C5EA 1QYXA 1RADA 4NYMQ 4BLOA 3ZQ4A 5BXQC 2EHJA 4ABYA 1WS6A 2FPIA 2I2CA 2PG3A 4FOSA 4G4JA 4OHXA 4FHFA 4Z5XA 3EQ9A 4XGQA 1YONA 4HTFB 3FCUB 3EXIA 1T1JA 1WCWA 1IUPA 1VKRA 2W6QA 3Q15C 4FQ5A 4GDFA 4F6RB 1OE0A 5BSKA 5PGMA 3DE2X 5AR1A 4PO1A 3ZWXA 4UM7A 4JEIA 4DSOA 4IJQA 3GMSA 3UOWA 4ENWA 1PJZA 3RGGA 1PWHA 2ZPAA 1V43A 1XPJA 1T1EA 4WE3A 3U7IA 3VNRA 4BUJA 5A4JA 1Q3TA 2HHAA 3BVPA 4HRVA 2IDKA 3UB2A 5DNDA 1D3AA 3KZ1E 4QL3A 1HBJA 3C41J 5LMNB 4KO4S 3TI7A 2JAUA 2O9JA 5CFOA 2P6PA 1R9MA 5LC1A 3EC7A 3GVHA 5K3AA 2G1PA 4C0QC 2X1HA 3DD5A 4KQCA 3H1BA 1MABB 3EY9A 4CM5A 3WA6A 2NPFA 3FTFA 3E84A 3PA6A 1TDJA 3IQHX 2ZAGA 4BE7B 4EIWA 1ZRHA 2H4HA 1HC7A 3KYJB 1YFJA 2QVXX 2DLCX 2I2WA 4GUAA 5TQ0A 4FLEA 3V8RA 2GDJA 3TRDA 4LZLA 4PHHA 3EGVA 1P3DA 2C29D 4AIRA 3J81k 3I62A 2WWIA 1DLIA 3H65A 1QIJA 4MIKA 1XMQB 5SYMA 4NEHB 1Y6JA 2GPSA 2FK8A 5A7HA 3OE7A 5IXJA 5JCOC 2EQBA 3A9RA 4NJMB 3L3BA 2UYHA 3WISA 4OQYA 1E6KA 4PS1A 2JFXA 4MMZB 3O90A 2BFBB 5IBPA 2I3ZA 1L7DA 3I2FA 3KKLA 3LQKA 5DOVA 4WPGA 1UKBA 1K8RA 1SEVA 3UOAB 2Q8NA 2XJ9A 3P2IA 2IWHA 1KYTA 4CI9A 2FPRA 3CTPA 4OMFG 3KOZA 4HG2A 1BW9B 2AN3A 5JSQA 3VKWA 1F14A 5BWLA 1GITA 2YFYA 5AJZA 4A6EA 5KQMA 2IXTA 3SFVA 1HDEA 3UB4A 3E82A 5HIAA 3HBMA 3QKSB 4KX5A 1TJ3A 4BEBA 1SCBA 4WUTA 3TW8B 1NPDA 1OFGA 2PX4A 4RK6A 4CW7A 2IPNA 2QRQA 3IJRA 3OCVA 4IO1A 4LGMA 4AJIA 4B7CA 3IQZA 1Z37A 4II7A 4LKOA 4B6GA 2FAXA 5LFAA 5TIIA 4MVJF 1VHQA 4OLHA 3R23A 1EVEA 4QTXA 4NATA 2J5XA 5JNSA 2VA8A 1DI0A 1L9KA 3ZCVA 5DLQC 1GU0A 3KYCB 5EPEA 1DBSA 4GOMD 4H1WA 3ZNPA 2XZOA 1NW7A 4MYUA 2BJWA 5AVVA 1DIAA 2WTUA 3KXIA 2PWBA 1GZDA 2FF5A 4JV5B 1AKTA 1K8XB 3M2PA 1ZU4A 1EG2A 1LPAB 1QJ4A 3URMA 4BVAA 1H93A 1LPNA 2H07A 1P81A 2QTLA 3GH3A 2WUGA 3S7TA 3ZJUA 1BXKA 2YL2A 1WZCA 3EIUA 1OYYA 1C8VB 1Y37A 1RM4A 3DYIA 4LRYA 3FCSB 4NOKA 1RAEA 1KMQA 4HAXA 1XCMA 4Y1GA 1KMCA 3H13A 3WKBA 2E87A 3ZU4A 1V5EA 2A5DA 4OJQA 5FV7A 3NS7A 3MCZA 4F7DA 1BCRA 2NUTA 4YRAA 5AVZA 2QS9A 3KQVA 1Z2CA 4Q7EA 2H1HA 3BGOS 1NE2A 4CCYA 3BTOA 3SOZA 1OKKD 2O05A 3TWOA 3MTJA 4RK0A 5CJJA 4ESEA 3BZUA 4FCCA 1UKAA 3PNSA 3GW8A 3LPLA 1NAIA 4B4WA 4HNSA 4ZGGA 4CLEA 5ULLA 2HUNA 4DIDA 2QR3A 4FNMA 1A96A 5LL6P 1V3VA 2JC3A 3FBWA 4I1SA 1SQ6A 1ZI8A 5F5NA 5THQA 1LNSA 1NSTA 3FMIA 4O33A 3S29A 4QECA 5I51A 5INTA 2Q4EA 5KVVA 2OPBA 2G82A 1KEPA 3ETDA 4FXPA 4LJAA 4PS0A 1CUIA 1E59A 5LZ2A 3PTAA 3KOUA 2CB9A 4PFKA 4FFPA 1DO2A 4CETA 5EIBC 1TMOA 4MZDA 2A94A 3BMOA 3KZKA 1WD5A 3VHQA 1OLOA 1SKYE 3U2QA 3QUQA 3T0GA 4N39A 1NATA 3QPVA 3MLBA 5EXPA 4JCOA 4NS1A 2FZGA 2ZRIA 4FTWA 3SQDA 2CHVA 2HAEA 3DE6X 2SKDA 4GICA 3WYGA 5FPTA 4ACAA 4HLUA 2VF4X 1JVNA 4J0HA 3T7EA 3WX0A 3B1KA 1SU4A 2J3MA 4EVSA 3N39C 3NC4A 5ES4B 1REQB 4JXXA 3KJZA 2FUCA 5KYYA 2DFNA 1GSAA 3HYCA 2VDWA 4EUFA 2VP4A 1FMCA 4P7JA 4B0PA 4W9MC 4P4TA 1COWA 1C3OA 1UK6A 3ZUGA 3OMWA 2VWQA 3BIOA 2WZQA 1JV2B 2XMPA 3A58B 2FHSA 2CBZA 5EMMA 5E1MA 2JIQA 5LP1A 1DKUA 1SHTX 4JVNA 2CL6X 1B7GO 1J7JA 1MOZA 3MB5A 1J2YA 4BJ3A 5BW6B 3W8DA 1Z5VA 1NQUA 1ZRSA 5HBRA 3ZK9A 5A4AA 3DULA 4LHYA 3QELA 3O0TA 1YVUA 3CNEA 1E1CA 2GVZC 3LLSA 1B1AA 3WNZA 5LQAA 3SC4A 1A2KC 3ET4A 3HLTA 3VAYA 3MWLA 1DADA 1C1XA 2VJMA 1M6HA 3AEUB 5DF1A 4IQ0A 1H0RA 3H5AA 1P3JA 3L07A 4PXYA 4CNQA 4C2TA 1G1AA 1NF8A 1TA0A 2KPOA 3WNBA 5JXGA 1I32A 2WEKA 2AJBA 2CNKA 2JJ2D 1XNJA 1YVRA 4UAUA 2A1TS 2G5GX 4KPYA 2WKPA 4KYTA 5AOCA 3KPWA 1VKHA 3DBHB 4GE0A 2B3TA 1EXVA 4Y2UA 1H69A 1TJNA 4L6IA 1GLGA 3OESA 1IOL