3E1QA

Crystal structure of w133f variant e. coli bacterioferritn with iron.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDFLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title Monitoring the iron status of the ferroxidase center of Escherichia coli bacterioferritin using fluorescence spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 73
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1qA00
4DZ0A 5FEJA 4M34A 1RYTA 1EUMA 4II4A 1L8HA 3R2KA 1JKUA 1SQ3A 2C41A 2V2RA 3H7GA 2ZG7X 3KX9A 4R42A 2CHIA 4IXKA 5CZUA 1JI4A 3NP2X 2CLUA 2Y3QA 4PGKA 2VXXA 3ES3A 1MFRA 3QD8A 1TJOA 1RCEA 1JYBA 4U3GA 2ZA8A 2D5KA 2HTNA 4ZKHA 4A25A 2YW6A 4RC5B 1RCDA 2V2NA 4P18A 3KA8A 5E1UA 3QHCA 1VEQA 1ZUJA 4XKTA 4M35A 3PWQA 3QHBA 1FHAA 4DASA 5GU3X 4CVPA 4TOAA 1O9RA 1Z6OM 4PG1A 3U90A 2V2OA 5HQOA 3F33A 5GN8A 1LKOA 3PVTB 1N1QA 3Q4QA 1MOJA 3BVKA 1DPSA 1TK6A 5FFAA 1IERA 2FL0A 3BT5A 5JACA 3AF7X 1JKVA 3UOFA 5K53A 2FG8A 5JKLG 2YJKA 1NF6A 4XGSA 3SHXA 3Q4RA 4AM5A 3GE4A 1KRQA 1LKPA 3E6RA 1JREA 4CVRA 1YUZA 3AK8A 1OTKA 5J8WA 3NOZX 2V2IA 3RAVA 3KXUA 3EGMA 2WLAA 3O7RA 1RCGA 3IS8A 1NFVA 4PGIA 4ML5A 4OYNA 2UX1A 1S3QA 1VEIA 2JD80 1XZ1A 4DE6A 4TW3A 3QZ3A 1F30A 1AEWA 5ERKA 4Z5SA 2CN7A 4EVDA 2WTLA 1B71A 5JKLA 2V2PA 2ITBA 5GU2X 1GWGA 2BW1A 3PW8C 5FFCA 3F39A 1JIGA 5E2DA 1QYBA 3BVFA 3KA6A 1LB3A 5GU1X 3VNXA 1HRSA 2VXIA 4RC7B 1F33A 1JGCA 2QQYA 1VJXA 4CVTA 4TODA 3QB9A 2C2FA 2GYDA 4MN9A 4TOBA 3O7SA 3AJQA 3BKNA 5JKMG 1TKOA 4ISMA 3F37A 4CMYA 3T9JA 3E6SA 1IESA 3F38A 3PW1B 3PVYA 3AF8X 5LG2A 4MY7A 5D8YA 4RC6A 3A68A 3F36A 5J9VA 5LBHA 5D8PA 3Q4OA 4TOHA 2CLBA 5GU0X 3E1MA 4ETRA 4MKUA 3E1PA 2YW7A 4EVCA 3BVIA 3AF9X 3UOIA 5J93A 3PWFA 3WVUA 4ITWA 2BKCA 2ZA6A 3E1OA 1NNQA 4ZKWA 4ZLWA 4LYXA 2V2LA 5JKMA 4II4B 5AXSA 4Z3BA 3KA9A 4ZTTA 2OC5A 3RBCA 2Z5PA 3R2SA 5D8RA 2GYQA 3HL1A 2JD70 3IS7A 2IB0A 4LPMA 2ZG8X 3ISEA 1VELA 2QF9A 4YKHA 3SE1A 4LPJA 1RCIA 1DATA 4IWJA 1QGHA 3F32A 1UVHA 1Z4AA 2G4HA 5C6FA 4ITTA 1H96A 3RD0A 2JD60 5HJHA 3UNOA 1SOFA 3FSEA 5J8SA 1S30A 2FHAA 3NP0X 4TO9A 3AK9A 3OJ5A 2ZA7A 3GHQA 3F35A 4DYZA 1YV1A 4MUDA 4RC5A 4ZL6A 2VZBA 4MJYA 3SH6A 5FFBA 2X170 3ERZA 5D8QA 3E1LA 4ZJKA 4XKSA 1BG7A 4ISPA 3E2CA 3F34A 2FKZA 5HJFA 2CIHA 3EZUA 2C2JA 2IU2A 2XJNA 2CEIA 5GN8B 4LQHA 3Q4NA 5CMQA 2V2MA 3TA8A 4DYUA 2BK6A 4DI0A 2ZG9X 3AJPA 5LG8A 2XKQA 3PVTA 4M33A 2V2SA 3AJOA 3R2OA 5GOUA 1UMNA 4EVBA 4CMYV 2OH3A 1BCFA 4ZMCA 4IWKA 2CHPA 2HR5A 4CY9A 4E6KA 4ERUA 4QUWA 3HIUA 2Z6MA 1BFRA 3FI6A 4LQNA 5D8SA 1RCCA 4KVRA 2YJJA 1JI5A 3IQ1A 5LS9A 2RBDA 2XJOA 3A9QA 5I4JA 2W0OA 1XZ3A 4ZL5A 3R2LA 3ISFA 2FFXJ 4CVSA 4KVSA 3E1NA 4KVQA 4LQJA 4REUA 3EZ0A 4AM2A 4TOFA 4DYXA 4PG0A 4XKUA 3E1QA 5ERJA 1JTSA 1DVBA 2CN6A 3PVRA 4Y08A 3KWOA 4RC8A 1S2ZA 2CF7A 3PW8A 2Z90A 3R2MA 1LKMA 2FZFA 4TOEA 2V15A 1J30A 5D8OA 1Z6OA 4RC7A 1O9IA 3KA3A 2C2UA 4AM4A 4TOCA 2BJYA 3QVDA 3BVEA 4CYBA 1ZS3A 3GVYA 4LQVA 1NF4A 4TOGA 4ZKXA 3WNWA 2V2JA 1TKPA 2PYBA 2F7NA 4M32A 3MPSA 2IY4A 2FJCA 3RGDA 2XGWA 2XJMA 3PVYB 1R03A 2Z5QA 5FFEA 5K52A 2C6RA 4RC6B 1VLGA 3OGHA 3PW1A 3FVBA 3R2HA 3SIDA 4DYYA 3WVVA 3PWQC 5IX6A 2Z5RA 3WVWA 4EVEA 4LPNA 2WLUA 5FFDA 5CMRA 4CYAA 3R2RA 2GS4A 3PZAA 1L8IA 3BVLA 4LYUA 2FG4A 1YUXA 3E1JA 3KA4A 2ZURX 3PVRB 5D8XA 3RE7A
chains in the Genus database with same CATH superfamily
4DZ0A 5FEJA 4YXMA 4M34A 2MGYA 1RYTA 1EUMA 4W4KB 2AR0A 4II4A 1L8HA 3R2KA 1JKUA 1SQ3A 2C41A 2V2RA 3C1ZA 3H7GA 2ZG7X 3KX9A 4R42A 2CHIA 4IXKA 5CZUA 1JI4A 3NP2X 2CLUA 2Y3QA 4PGKA 2VXXA 3ES3A 2G38B 1MFRA 3QD8A 1TJOA 1RCEA 1JYBA 4U3GA 2ZA8A 2D5KA 2HTNA 4ZKHA 4A25A 2V8TA 2YW6A 4RC5B 1RCDA 3VV9A 2V2NA 4P18A 3KA8A 5E1UA 3QHCA 1VEQA 1ZUJA 4XKTA 4M35A 3PWQA 3QHBA 1FHAA 3L0MA 4DASA 3KHKA 5GU3X 4CVPA 4TOAA 1O9RA 1Z6OM 4PG1A 3U90A 2V2OA 5HQOA 3F33A 5GN8A 1LKOA 3PVTB 4WJG4 1N1QA 3Q4QA 1MOJA 3BVKA 1DPSA 1TK6A 5FFAA 1IERA 2FL0A 2Y44A 3BT5A 5JACA 3AF7X 1JKVA 3UOFA 5K53A 2FG8A 5JKLG 2YJKA 1NF6A 4XGSA 3SHXA 3Q4RA 4AM5A 3GE4A 1KRQA 1LKPA 3E6RA 5JDOB 1JREA 4CVRA 1YUZA 3FRRA 3AK8A 1OTKA 5J8WA 3NOZX 2V2IA 3RAVA 3KXUA 3EGMA 2WLAA 3O7RA 3JZ9A 1RCGA 3IS8A 1NFVA 4PGIA 4ML5A 4OYNA 2UX1A 1S3QA 1VEIA 2JD80 1XZ1A 3GGZA 4DE6A 4TW3A 3V3KB 3QZ3A 1F30A 1AEWA 5ERKA 4Z5SA 2CN7A 4EVDA 2WTLA 1B71A 5JKLA 2V2PA 3W54A 2ITBA 5GU2X 1GWGA 2BW1A 3PW8C 3D19A 5FFCA 3F39A 3C21A 1JIGA 5E2DA 1QYBA 3BVFA 3KA6A 1LB3A 5GU1X 3VNXA 1HRSA 2VXIA 4RC7B 1F33A 1JGCA 2QQYA 1VJXA 4CVTA 3UFBA 4TODA 3QB9A 2C2FA 2GYDA 4MN9A 4TOBA 3O7SA 3AJQA 3BKNA 3N6OA 5JKMG 1TKOA 4ISMA 3F37A 4CMYA 3T9JA 3E6SA 1IESA 3F38A 3PW1B 3PVYA 3AF8X 5LG2A 4MY7A 5D8YA 4RC6A 3A68A 3F36A 5J9VA 5LBHA 5D8PA 3Q4OA 4TOHA 2CLBA 5GU0X 3E1MA 3LKDA 4ETRA 4MKUA 3E1PA 2YW7A 3DBYA 4EVCA 3BVIA 3AF9X 4X0JA 3UOIA 5J93A 3PWFA 3WVUA 4ITWA 2BKCA 2ZA6A 3E1OA 1NNQA 4ZKWA 4ZLWA 4LYXA 2V2LA 4YXJA 5JKMA 3C23A 4II4B 5AXSA 4Z3BA 3KA9A 4ZTTA 2OC5A 3RBCA 2Z5PA 3R2SA 5D8RA 2GYQA 3HL1A 2JD70 3IS7A 2IB0A 4LPMA 4W4LB 2ZG8X 3ISEA 2WWXB 1VELA 2QF9A 4YKHA 3SE1A 4LPJA 1RCIA 1DATA 4IWJA 1QGHA 3F32A 1UVHA 1Z4AA 2G4HA 5C6FA 4ITTA 1H96A 3RD0A 2JD60 5HJHA 3UNOA 1SOFA 3FSEA 3FRSA 5J8SA 1S30A 2FHAA 3NP0X 4TO9A 3AK9A 3OJ5A 2ZA7A 3GHQA 3F35A 4DYZA 1YV1A 4MUDA 3M6JA 4RC5A 2V8UA 4ZL6A 2VZBA 4MJYA 2CWLA 3SH6A 5FFBA 2X170 3ERZA 5D8QA 3E1LA 4ZJKA 4XKSA 1BG7A 4ISPA 3E2CA 3F34A 2FKZA 5HJFA 2CIHA 3C1YA 3EZUA 2C2JA 2IU2A 2XJNA 2CEIA 5GN8B 4LQHA 3Q4NA 5CMQA 2V2MA 3TA8A 4DYUA 2BK6A 4DI0A 2ZG9X 3AJPA 5LG8A 2XKQA 3PVTA 3AJOA 2V2SA 3R2OA 4M33A 5GOUA 1UMNA 4EVBA 4CMYV 2OH3A 1BCFA 4ZMCA 4IWKA 2CHPA 2HR5A 4CY9A 4E6KA 4ERUA 4QUWA 3HIUA 2Z6MA 2N02A 1BFRA 3FI6A 4LQNA 5D8SA 1RCCA 4KVRA 2YJJA 1JI5A 3IQ1A 5LS9A 2RBDA 2XJOA 3A9QA 5I4JA 2W0OA 5JDOA 1XZ3A 4ZL5A 3R2LA 3ISFA 2FFXJ 4CVSA 4KVSA 3E1NA 4KVQA 4LQJA 4REUA 3EZ0A 4AM2A 4TOFA 3VVAA 4DYXA 4PG0A 4XKUA 3E1QA 5ERJA 1JTSA 1DVBA 4YVZA 4KXRB 2CN6A 3PVRA 3GGYA 4Y08A 3KWOA 4RC8A 1S2ZA 2CF7A 3PW8A 2Z90A 3R2MA 1LKMA 2FZFA 4TOEA 2V15A 1J30A 3KDQA 5D8OA 1Z6OA 5HU6D 3JZAB 4RC7A 1O9IA 3KA3A 2C2UA 4AM4A 4TOCA 2BJYA 3QVDA 3BVEA 4CYBA 1ZS3A 3GVYA 4LQVA 1NF4A 4TOGA 4ZKXA 3WNWA 2V2JA 1TKPA 2PYBA 4E40A 2F7NA 4M32A 3MPSA 2IY4A 2FJCA 3RGDA 2XGWA 2XJMA 3PVYB 1R03A 2Z5QA 4MXPA 5FFEA 5K52A 2C6RA 4RC6B 1VLGA 3OGHA 3PW1A 3FVBA 3R2HA 3SIDA 4DYYA 3WVVA 3PWQC 5IX6A 2Z5RA 2OKCA 3WVWA 4EVEA 4LPNA 2WLUA 5FFDA 5CMRA 4CYAA 3R2RA 2GS4A 3PZAA 1L8IA 3BVLA 4LYUA 2FG4A 1YUXA 3E1JA 3KA4A 2ZURX 3PVRB 5D8XA 3RE7A
chains in the Genus database with same CATH topology
4DZ0A 5FEJA 4YXMA 4M34A 2MGYA 1RYTA 1EUMA 4W4KB 2AR0A 4II4A 1L8HA 3R2KA 1JKUA 1SQ3A 2C41A 2V2RA 3C1ZA 3H7GA 2ZG7X 3KX9A 4R42A 2CHIA 4IXKA 5CZUA 1JI4A 3NP2X 2CLUA 2Y3QA 4PGKA 2VXXA 3ES3A 2G38B 1MFRA 3QD8A 1TJOA 1RCEA 1JYBA 4U3GA 2ZA8A 2D5KA 2HTNA 4ZKHA 4A25A 2V8TA 2YW6A 4RC5B 1RCDA 3VV9A 2V2NA 4P18A 3KA8A 5E1UA 3QHCA 1VEQA 1ZUJA 4XKTA 4M35A 3PWQA 3QHBA 1FHAA 3L0MA 4DASA 3KHKA 5GU3X 4CVPA 4TOAA 1O9RA 1Z6OM 4PG1A 3U90A 2V2OA 5HQOA 3F33A 5GN8A 1LKOA 3PVTB 4WJG4 1N1QA 3Q4QA 1MOJA 3BVKA 1DPSA 1TK6A 5FFAA 1IERA 2FL0A 2Y44A 3BT5A 5JACA 3AF7X 1JKVA 3UOFA 5K53A 2FG8A 5JKLG 2YJKA 1NF6A 4XGSA 3SHXA 3Q4RA 4AM5A 3GE4A 1KRQA 1LKPA 3E6RA 5JDOB 1JREA 4CVRA 1YUZA 3FRRA 3AK8A 1OTKA 5J8WA 3NOZX 2V2IA 3RAVA 3KXUA 3EGMA 2WLAA 3O7RA 3JZ9A 1RCGA 3IS8A 1NFVA 4PGIA 4ML5A 4OYNA 2UX1A 1S3QA 1VEIA 2JD80 1XZ1A 3GGZA 4DE6A 4TW3A 3V3KB 3QZ3A 1F30A 1AEWA 5ERKA 4Z5SA 2CN7A 4EVDA 2WTLA 1B71A 5JKLA 2V2PA 3W54A 2ITBA 5GU2X 1GWGA 2BW1A 3PW8C 3D19A 5FFCA 3F39A 3C21A 1JIGA 5E2DA 1QYBA 3BVFA 3KA6A 1LB3A 5GU1X 3VNXA 1HRSA 2VXIA 4RC7B 1F33A 1JGCA 2QQYA 1VJXA 4CVTA 3UFBA 4TODA 3QB9A 2C2FA 2GYDA 4MN9A 4TOBA 3O7SA 3AJQA 3BKNA 3N6OA 5JKMG 1TKOA 4ISMA 3F37A 4CMYA 3T9JA 3E6SA 1IESA 3F38A 3PW1B 3PVYA 3AF8X 5LG2A 4MY7A 5D8YA 4RC6A 3A68A 3F36A 5J9VA 5LBHA 5D8PA 3Q4OA 4TOHA 2CLBA 5GU0X 3E1MA 3LKDA 4ETRA 4MKUA 3E1PA 2YW7A 3DBYA 4EVCA 3BVIA 3AF9X 4X0JA 3UOIA 5J93A 3PWFA 3WVUA 4ITWA 2BKCA 2ZA6A 3E1OA 1NNQA 4ZKWA 4ZLWA 4LYXA 2V2LA 4YXJA 5JKMA 3C23A 4II4B 5AXSA 4Z3BA 3KA9A 4ZTTA 2OC5A 3RBCA 2Z5PA 3R2SA 5D8RA 2GYQA 3HL1A 2JD70 3IS7A 2IB0A 4LPMA 4W4LB 2ZG8X 3ISEA 2WWXB 1VELA 2QF9A 4YKHA 3SE1A 4LPJA 1RCIA 1DATA 4IWJA 1QGHA 3F32A 1UVHA 1Z4AA 2G4HA 5C6FA 4ITTA 1H96A 3RD0A 2JD60 5HJHA 3UNOA 1SOFA 3FSEA 3FRSA 5J8SA 1S30A 2FHAA 3NP0X 4TO9A 3AK9A 3OJ5A 2ZA7A 3GHQA 3F35A 4DYZA 1YV1A 4MUDA 3M6JA 4RC5A 2V8UA 4ZL6A 2VZBA 4MJYA 2CWLA 3SH6A 5FFBA 2X170 3ERZA 5D8QA 3E1LA 4ZJKA 4XKSA 1BG7A 4ISPA 3E2CA 3F34A 2FKZA 5HJFA 2CIHA 3C1YA 3EZUA 2C2JA 2IU2A 2XJNA 2CEIA 5GN8B 4LQHA 3Q4NA 5CMQA 2V2MA 3TA8A 4DYUA 2BK6A 4DI0A 2ZG9X 3AJPA 5LG8A 2XKQA 3PVTA 3AJOA 2V2SA 3R2OA 4M33A 5GOUA 1UMNA 4EVBA 4CMYV 2OH3A 1BCFA 4ZMCA 4IWKA 2CHPA 2HR5A 4CY9A 4E6KA 4ERUA 4QUWA 3HIUA 2Z6MA 2N02A 1BFRA 3FI6A 4LQNA 5D8SA 1RCCA 4KVRA 2YJJA 1JI5A 3IQ1A 5LS9A 2RBDA 2XJOA 3A9QA 5I4JA 2W0OA 5JDOA 1XZ3A 4ZL5A 3R2LA 3ISFA 2FFXJ 4CVSA 4KVSA 3E1NA 4KVQA 4LQJA 4REUA 3EZ0A 4AM2A 4TOFA 3VVAA 4DYXA 4PG0A 4XKUA 3E1QA 5ERJA 1JTSA 1DVBA 4YVZA 4KXRB 2CN6A 3PVRA 3GGYA 4Y08A 3KWOA 4RC8A 1S2ZA 2CF7A 3PW8A 2Z90A 3R2MA 1LKMA 2FZFA 4TOEA 2V15A 1J30A 3KDQA 5D8OA 1Z6OA 5HU6D 3JZAB 4RC7A 1O9IA 3KA3A 2C2UA 4AM4A 4TOCA 2BJYA 3QVDA 3BVEA 4CYBA 1ZS3A 3GVYA 4LQVA 1NF4A 4TOGA 4ZKXA 3WNWA 2V2JA 1TKPA 2PYBA 4E40A 2F7NA 4M32A 3MPSA 2IY4A 2FJCA 3RGDA 2XGWA 2XJMA 3PVYB 1R03A 2Z5QA 4MXPA 5FFEA 5K52A 2C6RA 4RC6B 1VLGA 3OGHA 3PW1A 3FVBA 3R2HA 3SIDA 4DYYA 3WVVA 3PWQC 5IX6A 2Z5RA 2OKCA 3WVWA 4EVEA 4LPNA 2WLUA 5FFDA 5CMRA 4CYAA 3R2RA 2GS4A 3PZAA 1L8IA 3BVLA 4LYUA 2FG4A 1YUXA 3E1JA 3KA4A 2ZURX 3PVRB 5D8XA 3RE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZ0 A;  5FEJ A;  4M34 A;  1RYT A;  1EUM A;  4II4 A;  1L8H A;  3R2K A;  1JKU A;  1SQ3 A;  2C41 A;  2V2R A;  3H7G A;  2ZG7 X;  3KX9 A;  4R42 A;  2CHI A;  4IXK A;  5CZU A;  1JI4 A;  3NP2 X;  2CLU A;  2Y3Q A;  4PGK A;  2VXX A;  3ES3 A;  1MFR A;  3QD8 A;  1TJO A;  1RCE A;  1JYB A;  4U3G A;  2ZA8 A;  2D5K A;  2HTN A;  4ZKH A;  4A25 A;  2YW6 A;  4RC5 B;  1RCD A;  2V2N A;  4P18 A;  3KA8 A;  5E1U A;  3QHC A;  1VEQ A;  1ZUJ A;  4XKT A;  4M35 A;  3PWQ A;  3QHB A;  1FHA A;  4DAS A;  5GU3 X;  4CVP A;  4TOA A;  1O9R A;  1Z6O M;  4PG1 A;  3U90 A;  2V2O A;  5HQO A;  3F33 A;  5GN8 A;  1LKO A;  3PVT B;  1N1Q A;  3Q4Q A;  1MOJ A;  3BVK A;  1DPS A;  1TK6 A;  5FFA A;  1IER A;  2FL0 A;  3BT5 A;  5JAC A;  3AF7 X;  1JKV A;  3UOF A;  5K53 A;  2FG8 A;  5JKL G;  2YJK A;  1NF6 A;  4XGS A;  3SHX A;  3Q4R A;  4AM5 A;  3GE4 A;  1KRQ A;  1LKP A;  3E6R A;  1JRE A;  4CVR A;  1YUZ A;  3AK8 A;  1OTK A;  5J8W A;  3NOZ X;  2V2I A;  3RAV A;  3KXU A;  3EGM A;  2WLA A;  3O7R A;  1RCG A;  3IS8 A;  1NFV A;  4PGI A;  4ML5 A;  4OYN A;  2UX1 A;  1S3Q A;  1VEI A;  2JD8 0;  1XZ1 A;  4DE6 A;  4TW3 A;  3QZ3 A;  1F30 A;  1AEW A;  5ERK A;  4Z5S A;  2CN7 A;  4EVD A;  2WTL A;  1B71 A;  5JKL A;  2V2P A;  2ITB A;  5GU2 X;  1GWG A;  2BW1 A;  3PW8 C;  5FFC A;  3F39 A;  1JIG A;  5E2D A;  1QYB A;  3BVF A;  3KA6 A;  1LB3 A;  5GU1 X;  3VNX A;  1HRS A;  2VXI A;  4RC7 B;  1F33 A;  1JGC A;  2QQY A;  1VJX A;  4CVT A;  4TOD A;  3QB9 A;  2C2F A;  2GYD A;  4MN9 A;  4TOB A;  3O7S A;  3AJQ A;  3BKN A;  5JKM G;  1TKO A;  4ISM A;  3F37 A;  4CMY A;  3T9J A;  3E6S A;  1IES A;  3F38 A;  3PW1 B;  3PVY A;  3AF8 X;  5LG2 A;  4MY7 A;  5D8Y A;  4RC6 A;  3A68 A;  3F36 A;  5J9V A;  5LBH A;  5D8P A;  3Q4O A;  4TOH A;  2CLB A;  5GU0 X;  3E1M A;  4ETR A;  4MKU A;  3E1P A;  2YW7 A;  4EVC A;  3BVI A;  3AF9 X;  3UOI A;  5J93 A;  3PWF A;  3WVU A;  4ITW A;  2BKC A;  2ZA6 A;  3E1O A;  1NNQ A;  4ZKW A;  4ZLW A;  4LYX A;  2V2L A;  5JKM A;  4II4 B;  5AXS A;  4Z3B A;  3KA9 A;  4ZTT A;  2OC5 A;  3RBC A;  2Z5P A;  3R2S A;  5D8R A;  2GYQ A;  3HL1 A;  2JD7 0;  3IS7 A;  2IB0 A;  4LPM A;  2ZG8 X;  3ISE A;  1VEL A;  2QF9 A;  4YKH A;  3SE1 A;  4LPJ A;  1RCI A;  1DAT A;  4IWJ A;  1QGH A;  3F32 A;  1UVH A;  1Z4A A;  2G4H A;  5C6F A;  4ITT A;  1H96 A;  3RD0 A;  2JD6 0;  5HJH A;  3UNO A;  1SOF A;  3FSE A;  5J8S A;  1S30 A;  2FHA A;  3NP0 X;  4TO9 A;  3AK9 A;  3OJ5 A;  2ZA7 A;  3GHQ A;  3F35 A;  4DYZ A;  1YV1 A;  4MUD A;  4RC5 A;  4ZL6 A;  2VZB A;  4MJY A;  3SH6 A;  5FFB A;  2X17 0;  3ERZ A;  5D8Q A;  3E1L A;  4ZJK A;  4XKS A;  1BG7 A;  4ISP A;  3E2C A;  3F34 A;  2FKZ A;  5HJF A;  2CIH A;  3EZU A;  2C2J A;  2IU2 A;  2XJN A;  2CEI A;  5GN8 B;  4LQH A;  3Q4N A;  5CMQ A;  2V2M A;  3TA8 A;  4DYU A;  2BK6 A;  4DI0 A;  2ZG9 X;  3AJP A;  5LG8 A;  2XKQ A;  3PVT A;  4M33 A;  2V2S A;  3AJO A;  3R2O A;  5GOU A;  1UMN A;  4EVB A;  4CMY V;  2OH3 A;  1BCF A;  4ZMC A;  4IWK A;  2CHP A;  2HR5 A;  4CY9 A;  4E6K A;  4ERU A;  4QUW A;  3HIU A;  2Z6M A;  1BFR A;  3FI6 A;  4LQN A;  5D8S A;  1RCC A;  4KVR A;  2YJJ A;  1JI5 A;  3IQ1 A;  5LS9 A;  2RBD A;  2XJO A;  3A9Q A;  5I4J A;  2W0O A;  1XZ3 A;  4ZL5 A;  3R2L A;  3ISF A;  2FFX J;  4CVS A;  4KVS A;  3E1N A;  4KVQ A;  4LQJ A;  4REU A;  3EZ0 A;  4AM2 A;  4TOF A;  4DYX A;  4PG0 A;  4XKU A;  3E1Q A;  5ERJ A;  1JTS A;  1DVB A;  2CN6 A;  3PVR A;  4Y08 A;  3KWO A;  4RC8 A;  1S2Z A;  2CF7 A;  3PW8 A;  2Z90 A;  3R2M A;  1LKM A;  2FZF A;  4TOE A;  2V15 A;  1J30 A;  5D8O A;  1Z6O A;  4RC7 A;  1O9I A;  3KA3 A;  2C2U A;  4AM4 A;  4TOC A;  2BJY A;  3QVD A;  3BVE A;  4CYB A;  1ZS3 A;  3GVY A;  4LQV A;  1NF4 A;  4TOG A;  4ZKX A;  3WNW A;  2V2J A;  1TKP A;  2PYB A;  2F7N A;  4M32 A;  3MPS A;  2IY4 A;  2FJC A;  3RGD A;  2XGW A;  2XJM A;  3PVY B;  1R03 A;  2Z5Q A;  5FFE A;  5K52 A;  2C6R A;  4RC6 B;  1VLG A;  3OGH A;  3PW1 A;  3FVB A;  3R2H A;  3SID A;  4DYY A;  3WVV A;  3PWQ C;  5IX6 A;  2Z5R A;  3WVW A;  4EVE A;  4LPN A;  2WLU A;  5FFD A;  5CMR A;  4CYA A;  3R2R A;  2GS4 A;  3PZA A;  1L8I A;  3BVL A;  4LYU A;  2FG4 A;  1YUX A;  3E1J A;  3KA4 A;  2ZUR X;  3PVR B;  5D8X A;  3RE7 A; 
#chains in the Genus database with same CATH topology
 4DZ0 A;  5FEJ A;  4YXM A;  4M34 A;  2MGY A;  1RYT A;  1EUM A;  4W4K B;  2AR0 A;  4II4 A;  1L8H A;  3R2K A;  1JKU A;  1SQ3 A;  2C41 A;  2V2R A;  3C1Z A;  3H7G A;  2ZG7 X;  3KX9 A;  4R42 A;  2CHI A;  4IXK A;  5CZU A;  1JI4 A;  3NP2 X;  2CLU A;  2Y3Q A;  4PGK A;  2VXX A;  3ES3 A;  2G38 B;  1MFR A;  3QD8 A;  1TJO A;  1RCE A;  1JYB A;  4U3G A;  2ZA8 A;  2D5K A;  2HTN A;  4ZKH A;  4A25 A;  2V8T A;  2YW6 A;  4RC5 B;  1RCD A;  3VV9 A;  2V2N A;  4P18 A;  3KA8 A;  5E1U A;  3QHC A;  1VEQ A;  1ZUJ A;  4XKT A;  4M35 A;  3PWQ A;  3QHB A;  1FHA A;  3L0M A;  4DAS A;  3KHK A;  5GU3 X;  4CVP A;  4TOA A;  1O9R A;  1Z6O M;  4PG1 A;  3U90 A;  2V2O A;  5HQO A;  3F33 A;  5GN8 A;  1LKO A;  3PVT B;  4WJG 4;  1N1Q A;  3Q4Q A;  1MOJ A;  3BVK A;  1DPS A;  1TK6 A;  5FFA A;  1IER A;  2FL0 A;  2Y44 A;  3BT5 A;  5JAC A;  3AF7 X;  1JKV A;  3UOF A;  5K53 A;  2FG8 A;  5JKL G;  2YJK A;  1NF6 A;  4XGS A;  3SHX A;  3Q4R A;  4AM5 A;  3GE4 A;  1KRQ A;  1LKP A;  3E6R A;  5JDO B;  1JRE A;  4CVR A;  1YUZ A;  3FRR A;  3AK8 A;  1OTK A;  5J8W A;  3NOZ X;  2V2I A;  3RAV A;  3KXU A;  3EGM A;  2WLA A;  3O7R A;  3JZ9 A;  1RCG A;  3IS8 A;  1NFV A;  4PGI A;  4ML5 A;  4OYN A;  2UX1 A;  1S3Q A;  1VEI A;  2JD8 0;  1XZ1 A;  3GGZ A;  4DE6 A;  4TW3 A;  3V3K B;  3QZ3 A;  1F30 A;  1AEW A;  5ERK A;  4Z5S A;  2CN7 A;  4EVD A;  2WTL A;  1B71 A;  5JKL A;  2V2P A;  3W54 A;  2ITB A;  5GU2 X;  1GWG A;  2BW1 A;  3PW8 C;  3D19 A;  5FFC A;  3F39 A;  3C21 A;  1JIG A;  5E2D A;  1QYB A;  3BVF A;  3KA6 A;  1LB3 A;  5GU1 X;  3VNX A;  1HRS A;  2VXI A;  4RC7 B;  1F33 A;  1JGC A;  2QQY A;  1VJX A;  4CVT A;  3UFB A;  4TOD A;  3QB9 A;  2C2F A;  2GYD A;  4MN9 A;  4TOB A;  3O7S A;  3AJQ A;  3BKN A;  3N6O A;  5JKM G;  1TKO A;  4ISM A;  3F37 A;  4CMY A;  3T9J A;  3E6S A;  1IES A;  3F38 A;  3PW1 B;  3PVY A;  3AF8 X;  5LG2 A;  4MY7 A;  5D8Y A;  4RC6 A;  3A68 A;  3F36 A;  5J9V A;  5LBH A;  5D8P A;  3Q4O A;  4TOH A;  2CLB A;  5GU0 X;  3E1M A;  3LKD A;  4ETR A;  4MKU A;  3E1P A;  2YW7 A;  3DBY A;  4EVC A;  3BVI A;  3AF9 X;  4X0J A;  3UOI A;  5J93 A;  3PWF A;  3WVU A;  4ITW A;  2BKC A;  2ZA6 A;  3E1O A;  1NNQ A;  4ZKW A;  4ZLW A;  4LYX A;  2V2L A;  4YXJ A;  5JKM A;  3C23 A;  4II4 B;  5AXS A;  4Z3B A;  3KA9 A;  4ZTT A;  2OC5 A;  3RBC A;  2Z5P A;  3R2S A;  5D8R A;  2GYQ A;  3HL1 A;  2JD7 0;  3IS7 A;  2IB0 A;  4LPM A;  4W4L B;  2ZG8 X;  3ISE A;  2WWX B;  1VEL A;  2QF9 A;  4YKH A;  3SE1 A;  4LPJ A;  1RCI A;  1DAT A;  4IWJ A;  1QGH A;  3F32 A;  1UVH A;  1Z4A A;  2G4H A;  5C6F A;  4ITT A;  1H96 A;  3RD0 A;  2JD6 0;  5HJH A;  3UNO A;  1SOF A;  3FSE A;  3FRS A;  5J8S A;  1S30 A;  2FHA A;  3NP0 X;  4TO9 A;  3AK9 A;  3OJ5 A;  2ZA7 A;  3GHQ A;  3F35 A;  4DYZ A;  1YV1 A;  4MUD A;  3M6J A;  4RC5 A;  2V8U A;  4ZL6 A;  2VZB A;  4MJY A;  2CWL A;  3SH6 A;  5FFB A;  2X17 0;  3ERZ A;  5D8Q A;  3E1L A;  4ZJK A;  4XKS A;  1BG7 A;  4ISP A;  3E2C A;  3F34 A;  2FKZ A;  5HJF A;  2CIH A;  3C1Y A;  3EZU A;  2C2J A;  2IU2 A;  2XJN A;  2CEI A;  5GN8 B;  4LQH A;  3Q4N A;  5CMQ A;  2V2M A;  3TA8 A;  4DYU A;  2BK6 A;  4DI0 A;  2ZG9 X;  3AJP A;  5LG8 A;  2XKQ A;  3PVT A;  3AJO A;  2V2S A;  3R2O A;  4M33 A;  5GOU A;  1UMN A;  4EVB A;  4CMY V;  2OH3 A;  1BCF A;  4ZMC A;  4IWK A;  2CHP A;  2HR5 A;  4CY9 A;  4E6K A;  4ERU A;  4QUW A;  3HIU A;  2Z6M A;  2N02 A;  1BFR A;  3FI6 A;  4LQN A;  5D8S A;  1RCC A;  4KVR A;  2YJJ A;  1JI5 A;  3IQ1 A;  5LS9 A;  2RBD A;  2XJO A;  3A9Q A;  5I4J A;  2W0O A;  5JDO A;  1XZ3 A;  4ZL5 A;  3R2L A;  3ISF A;  2FFX J;  4CVS A;  4KVS A;  3E1N A;  4KVQ A;  4LQJ A;  4REU A;  3EZ0 A;  4AM2 A;  4TOF A;  3VVA A;  4DYX A;  4PG0 A;  4XKU A;  3E1Q A;  5ERJ A;  1JTS A;  1DVB A;  4YVZ A;  4KXR B;  2CN6 A;  3PVR A;  3GGY A;  4Y08 A;  3KWO A;  4RC8 A;  1S2Z A;  2CF7 A;  3PW8 A;  2Z90 A;  3R2M A;  1LKM A;  2FZF A;  4TOE A;  2V15 A;  1J30 A;  3KDQ A;  5D8O A;  1Z6O A;  5HU6 D;  3JZA B;  4RC7 A;  1O9I A;  3KA3 A;  2C2U A;  4AM4 A;  4TOC A;  2BJY A;  3QVD A;  3BVE A;  4CYB A;  1ZS3 A;  3GVY A;  4LQV A;  1NF4 A;  4TOG A;  4ZKX A;  3WNW A;  2V2J A;  1TKP A;  2PYB A;  4E40 A;  2F7N A;  4M32 A;  3MPS A;  2IY4 A;  2FJC A;  3RGD A;  2XGW A;  2XJM A;  3PVY B;  1R03 A;  2Z5Q A;  4MXP A;  5FFE A;  5K52 A;  2C6R A;  4RC6 B;  1VLG A;  3OGH A;  3PW1 A;  3FVB A;  3R2H A;  3SID A;  4DYY A;  3WVV A;  3PWQ C;  5IX6 A;  2Z5R A;  2OKC A;  3WVW A;  4EVE A;  4LPN A;  2WLU A;  5FFD A;  5CMR A;  4CYA A;  3R2R A;  2GS4 A;  3PZA A;  1L8I A;  3BVL A;  4LYU A;  2FG4 A;  1YUX A;  3E1J A;  3KA4 A;  2ZUR X;  3PVR B;  5D8X A;  3RE7 A; 
#chains in the Genus database with same CATH homology
 4DZ0 A;  5FEJ A;  4YXM A;  4M34 A;  2MGY A;  1RYT A;  1EUM A;  4W4K B;  2AR0 A;  4II4 A;  1L8H A;  3R2K A;  1JKU A;  1SQ3 A;  2C41 A;  2V2R A;  3C1Z A;  3H7G A;  2ZG7 X;  3KX9 A;  4R42 A;  2CHI A;  4IXK A;  5CZU A;  1JI4 A;  3NP2 X;  2CLU A;  2Y3Q A;  4PGK A;  2VXX A;  3ES3 A;  2G38 B;  1MFR A;  3QD8 A;  1TJO A;  1RCE A;  1JYB A;  4U3G A;  2ZA8 A;  2D5K A;  2HTN A;  4ZKH A;  4A25 A;  2V8T A;  2YW6 A;  4RC5 B;  1RCD A;  3VV9 A;  2V2N A;  4P18 A;  3KA8 A;  5E1U A;  3QHC A;  1VEQ A;  1ZUJ A;  4XKT A;  4M35 A;  3PWQ A;  3QHB A;  1FHA A;  3L0M A;  4DAS A;  3KHK A;  5GU3 X;  4CVP A;  4TOA A;  1O9R A;  1Z6O M;  4PG1 A;  3U90 A;  2V2O A;  5HQO A;  3F33 A;  5GN8 A;  1LKO A;  3PVT B;  4WJG 4;  1N1Q A;  3Q4Q A;  1MOJ A;  3BVK A;  1DPS A;  1TK6 A;  5FFA A;  1IER A;  2FL0 A;  2Y44 A;  3BT5 A;  5JAC A;  3AF7 X;  1JKV A;  3UOF A;  5K53 A;  2FG8 A;  5JKL G;  2YJK A;  1NF6 A;  4XGS A;  3SHX A;  3Q4R A;  4AM5 A;  3GE4 A;  1KRQ A;  1LKP A;  3E6R A;  5JDO B;  1JRE A;  4CVR A;  1YUZ A;  3FRR A;  3AK8 A;  1OTK A;  5J8W A;  3NOZ X;  2V2I A;  3RAV A;  3KXU A;  3EGM A;  2WLA A;  3O7R A;  3JZ9 A;  1RCG A;  3IS8 A;  1NFV A;  4PGI A;  4ML5 A;  4OYN A;  2UX1 A;  1S3Q A;  1VEI A;  2JD8 0;  1XZ1 A;  3GGZ A;  4DE6 A;  4TW3 A;  3V3K B;  3QZ3 A;  1F30 A;  1AEW A;  5ERK A;  4Z5S A;  2CN7 A;  4EVD A;  2WTL A;  1B71 A;  5JKL A;  2V2P A;  3W54 A;  2ITB A;  5GU2 X;  1GWG A;  2BW1 A;  3PW8 C;  3D19 A;  5FFC A;  3F39 A;  3C21 A;  1JIG A;  5E2D A;  1QYB A;  3BVF A;  3KA6 A;  1LB3 A;  5GU1 X;  3VNX A;  1HRS A;  2VXI A;  4RC7 B;  1F33 A;  1JGC A;  2QQY A;  1VJX A;  4CVT A;  3UFB A;  4TOD A;  3QB9 A;  2C2F A;  2GYD A;  4MN9 A;  4TOB A;  3O7S A;  3AJQ A;  3BKN A;  3N6O A;  5JKM G;  1TKO A;  4ISM A;  3F37 A;  4CMY A;  3T9J A;  3E6S A;  1IES A;  3F38 A;  3PW1 B;  3PVY A;  3AF8 X;  5LG2 A;  4MY7 A;  5D8Y A;  4RC6 A;  3A68 A;  3F36 A;  5J9V A;  5LBH A;  5D8P A;  3Q4O A;  4TOH A;  2CLB A;  5GU0 X;  3E1M A;  3LKD A;  4ETR A;  4MKU A;  3E1P A;  2YW7 A;  3DBY A;  4EVC A;  3BVI A;  3AF9 X;  4X0J A;  3UOI A;  5J93 A;  3PWF A;  3WVU A;  4ITW A;  2BKC A;  2ZA6 A;  3E1O A;  1NNQ A;  4ZKW A;  4ZLW A;  4LYX A;  2V2L A;  4YXJ A;  5JKM A;  3C23 A;  4II4 B;  5AXS A;  4Z3B A;  3KA9 A;  4ZTT A;  2OC5 A;  3RBC A;  2Z5P A;  3R2S A;  5D8R A;  2GYQ A;  3HL1 A;  2JD7 0;  3IS7 A;  2IB0 A;  4LPM A;  4W4L B;  2ZG8 X;  3ISE A;  2WWX B;  1VEL A;  2QF9 A;  4YKH A;  3SE1 A;  4LPJ A;  1RCI A;  1DAT A;  4IWJ A;  1QGH A;  3F32 A;  1UVH A;  1Z4A A;  2G4H A;  5C6F A;  4ITT A;  1H96 A;  3RD0 A;  2JD6 0;  5HJH A;  3UNO A;  1SOF A;  3FSE A;  3FRS A;  5J8S A;  1S30 A;  2FHA A;  3NP0 X;  4TO9 A;  3AK9 A;  3OJ5 A;  2ZA7 A;  3GHQ A;  3F35 A;  4DYZ A;  1YV1 A;  4MUD A;  3M6J A;  4RC5 A;  2V8U A;  4ZL6 A;  2VZB A;  4MJY A;  2CWL A;  3SH6 A;  5FFB A;  2X17 0;  3ERZ A;  5D8Q A;  3E1L A;  4ZJK A;  4XKS A;  1BG7 A;  4ISP A;  3E2C A;  3F34 A;  2FKZ A;  5HJF A;  2CIH A;  3C1Y A;  3EZU A;  2C2J A;  2IU2 A;  2XJN A;  2CEI A;  5GN8 B;  4LQH A;  3Q4N A;  5CMQ A;  2V2M A;  3TA8 A;  4DYU A;  2BK6 A;  4DI0 A;  2ZG9 X;  3AJP A;  5LG8 A;  2XKQ A;  3PVT A;  3AJO A;  2V2S A;  3R2O A;  4M33 A;  5GOU A;  1UMN A;  4EVB A;  4CMY V;  2OH3 A;  1BCF A;  4ZMC A;  4IWK A;  2CHP A;  2HR5 A;  4CY9 A;  4E6K A;  4ERU A;  4QUW A;  3HIU A;  2Z6M A;  2N02 A;  1BFR A;  3FI6 A;  4LQN A;  5D8S A;  1RCC A;  4KVR A;  2YJJ A;  1JI5 A;  3IQ1 A;  5LS9 A;  2RBD A;  2XJO A;  3A9Q A;  5I4J A;  2W0O A;  5JDO A;  1XZ3 A;  4ZL5 A;  3R2L A;  3ISF A;  2FFX J;  4CVS A;  4KVS A;  3E1N A;  4KVQ A;  4LQJ A;  4REU A;  3EZ0 A;  4AM2 A;  4TOF A;  3VVA A;  4DYX A;  4PG0 A;  4XKU A;  3E1Q A;  5ERJ A;  1JTS A;  1DVB A;  4YVZ A;  4KXR B;  2CN6 A;  3PVR A;  3GGY A;  4Y08 A;  3KWO A;  4RC8 A;  1S2Z A;  2CF7 A;  3PW8 A;  2Z90 A;  3R2M A;  1LKM A;  2FZF A;  4TOE A;  2V15 A;  1J30 A;  3KDQ A;  5D8O A;  1Z6O A;  5HU6 D;  3JZA B;  4RC7 A;  1O9I A;  3KA3 A;  2C2U A;  4AM4 A;  4TOC A;  2BJY A;  3QVD A;  3BVE A;  4CYB A;  1ZS3 A;  3GVY A;  4LQV A;  1NF4 A;  4TOG A;  4ZKX A;  3WNW A;  2V2J A;  1TKP A;  2PYB A;  4E40 A;  2F7N A;  4M32 A;  3MPS A;  2IY4 A;  2FJC A;  3RGD A;  2XGW A;  2XJM A;  3PVY B;  1R03 A;  2Z5Q A;  4MXP A;  5FFE A;  5K52 A;  2C6R A;  4RC6 B;  1VLG A;  3OGH A;  3PW1 A;  3FVB A;  3R2H A;  3SID A;  4DYY A;  3WVV A;  3PWQ C;  5IX6 A;  2Z5R A;  2OKC A;  3WVW A;  4EVE A;  4LPN A;  2WLU A;  5FFD A;  5CMR A;  4CYA A;  3R2R A;  2GS4 A;  3PZA A;  1L8I A;  3BVL A;  4LYU A;  2FG4 A;  1YUX A;  3E1J A;  3KA4 A;  2ZUR X;  3PVR B;  5D8X A;  3RE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...