3E1QA

Crystal structure of w133f variant e. coli bacterioferritn with iron.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
158
structure length
158
Chain Sequence
b'MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDFLETELDLIQKMGLQNYLQAQIREEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title Monitoring the iron status of the ferroxidase center of Escherichia coli bacterioferritin using fluorescence spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 73
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1qA00
5E1UA 1F30A 2C2UA 5JACA 3FVBA 1TKPA 5D8SA 2XJNA 4TW3A 1JREA 2G4HA 3BVIA 3E1QA 4RC5A 4RC6B 1VLGA 3ISEA 2X170 5IX6A 2ZG7X 3E6RA 2VZBA 4EVEA 4AM2A 4QUWA 4ERUA 1F33A 1MOJA 3R2OA 5J8SA 2IB0A 3ES3A 4ETRA 4M33A 5FFCA 3EGMA 4ZKHA 3QD8A 5GOUA 1Z6OM 4TOFA 2GYDA 3BVFA 4ITWA 2V2SA 3WVUA 3GVYA 1O9IA 1MFRA 3QHCA 1TJOA 4REUA 1VELA 4Y08A 1S30A 3A68A 4LQJA 3EZ0A 2V2IA 3SE1A 3QZ3A 1L8IA 5GU3X 1RYTA 1YUXA 2CLUA 2ITBA 2HTNA 4TOHA 2JD80 1BCFA 4EVCA 4LQNA 2V2JA 3AF9X 1VJXA 3R2MA 1UVHA 5LS9A 2CEIA 2QF9A 4P18A 5JKLA 4CVTA 2WLAA 4M35A 3RGDA 1Z4AA 4LQHA 5JKLG 5AXSA 1H96A 3SHXA 2XJMA 4PGKA 4II4A 4TOBA 1LB3A 4LPNA 2C41A 3PVTA 1DATA 1IERA 1FHAA 3KA9A 3R2SA 4ZKXA 4DZ0A 5ERJA 4XKUA 3AJQA 4TODA 2V2RA 1JI4A 3NOZX 4KVRA 4LQVA 5LG8A 1R03A 5J8WA 2OC5A 2V2PA 3AF7X 4LYUA 2BJYA 5ERKA 3KA3A 2YW7A 2ZURX 3F34A 4CMYA 3PW1B 4DASA 2F7NA 4Z5SA 2V2NA 3Q4RA 2V2OA 1EUMA 5CMRA 3E2CA 3PVYB 2CHPA 4ZKWA 4ZTTA 4RC6A 5FFDA 1DPSA 4PG1A 1Z6OA 2GS4A 3KXUA 2YJKA 2CLBA 5GU1X 4TOEA 4U3GA 4ML5A 1BG7A 2WLUA 1JI5A 3F37A 2VXXA 3F36A 1RCDA 4EVBA 3F33A 3PVRA 4TOAA 3R2HA 1TKOA 2C2JA 5HQOA 2FG8A 1NF6A 5D8RA 4KVQA 2FG4A 3MPSA 1B71A 5GU2X 1JKUA 3R2KA 2V2LA 4CY9A 3E1PA 4RC8A 3RE7A 1RCCA 2PYBA 4MKUA 3KA4A 5D8XA 5D8QA 3KA6A 5FFAA 1RCIA 4LPJA 3RAVA 3BVKA 4RC7B 5CMQA 5CZUA 5FFBA 2OH3A 2C2FA 2Z5PA 5J93A 3SIDA 4DYZA 2BK6A 4PGIA 2GYQA 3WNWA 3HL1A 4PG0A 3AK9A 3EZUA 4CYBA 3UOIA 1S2ZA 4ISPA 1N1QA 5E2DA 3E1OA 4AM4A 5JKMA 2V2MA 5JKMG 4XKTA 3BVEA 2C6RA 3SH6A 1YUZA 4MUDA 2D5KA 3Q4NA 4EVDA 5GN8B 3ERZA 2BKCA 1LKOA 3E6SA 5HJHA 3UOFA 2IU2A 4ISMA 3E1LA 4AM5A 2FL0A 3PW1A 1QGHA 1GWGA 2Z90A 3E1MA 4CVRA 3R2RA 4ZLWA 2IY4A 1BFRA 1NFVA 1XZ1A 2JD60 3T9JA 2XKQA 3PVYA 4MY7A 1JTSA 3PZAA 3QB9A 2HR5A 3AF8X 4CYAA 1RCGA 2VXIA 1QYBA 2ZG8X 3KA8A 4IWJA 3KX9A 3OGHA 1IESA 1SOFA 3Q4QA 4XGSA 5HJFA 3VNXA 4CVPA 3O7SA 5LBHA 3PW8A 2YW6A 3F38A 4KVSA 4OYNA 4TOCA 2XGWA 2Y3QA 4IXKA 3E1JA 3PWQA 1LKPA 3PW8C 1O9RA 4DYXA 4ZL6A 4M34A 4RC7A 4ZMCA 2Z5RA 4E6KA 5GU0X 4TO9A 2RBDA 3PWQC 1KRQA 4DYYA 3NP2X 2CF7A 1XZ3A 3IS8A 1VEIA 2W0OA 2UX1A 1AEWA 1JIGA 3F32A 3RD0A 1OTKA 3PVRB 2CIHA 5FFEA 4R42A 3WVWA 4RC5B 3BT5A 3E1NA 3QVDA 2ZA8A 3GHQA 1NNQA 5GN8A 1VEQA 2Z6MA 1SQ3A 3WVVA 1L8HA 2CN6A 1S3QA 3AJOA 1LKMA 4ZJKA 4DE6A 1RCEA 4XKSA 3R2LA 3ISFA 3TA8A 5J9VA 4ITTA 3PWFA 2FFXJ 2JD70 1NF4A 3FSEA 4TOGA 2ZA6A 1JYBA 3BVLA 5D8OA 5LG2A 2FZFA 3Q4OA 1ZS3A 4MJYA 4DI0A 4ZL5A 4M32A 2XJOA 4CMYV 3F35A 5K53A 3A9QA 5C6FA 2FKZA 3IS7A 3HIUA 2BW1A 2Z5QA 2FJCA 1ZUJA 2QQYA 4LPMA 4IWKA 2WTLA 1J30A 5D8PA 3O7RA 2YJJA 3F39A 3GE4A 4DYUA 1UMNA 4A25A 2ZG9X 4II4B 2V15A 3BKNA 1HRSA 3PVTB 5K52A 2CHIA 4Z3BA 5I4JA 3H7GA 2FHAA 5D8YA 2ZA7A 3UNOA 3AJPA 2CN7A 3U90A 3QHBA 1JKVA 3OJ5A 3KWOA 4MN9A 4LYXA 4YKHA 4CVSA 3IQ1A 3FI6A 3NP0X 3AK8A 1JGCA 5FEJA 3RBCA 1DVBA 1YV1A 1TK6A
chains in the Genus database with same CATH superfamily
5E1UA 1F30A 2C2UA 5JACA 3KDQA 3FVBA 1TKPA 5D8SA 2XJNA 4TW3A 1JREA 2G4HA 3BVIA 3E1QA 4RC5A 4RC6B 1VLGA 3ISEA 2X170 5IX6A 2ZG7X 3E6RA 2VZBA 4EVEA 4AM2A 4QUWA 4ERUA 1F33A 3GGZA 1MOJA 3R2OA 5J8SA 2IB0A 3ES3A 4ETRA 4M33A 5FFCA 3EGMA 4ZKHA 3QD8A 3V3KB 5GOUA 1Z6OM 4TOFA 2GYDA 3BVFA 4ITWA 2V2SA 3WVUA 3GVYA 1O9IA 1MFRA 3QHCA 1TJOA 3VVAA 4REUA 1VELA 4Y08A 1S30A 4YXJA 5JDOA 3A68A 4LQJA 3EZ0A 2V2IA 3SE1A 3QZ3A 1L8IA 5GU3X 1RYTA 1YUXA 2CLUA 2ITBA 2HTNA 4TOHA 2JD80 1BCFA 4EVCA 4LQNA 2V2JA 2Y44A 1VJXA 3AF9X 3R2MA 1UVHA 5LS9A 2V8TA 2CEIA 2QF9A 4P18A 5JKLA 4CVTA 2WLAA 4M35A 3RGDA 1Z4AA 4LQHA 5JKLG 5AXSA 1H96A 3SHXA 4W4LB 2XJMA 4PGKA 4II4A 2V8UA 4TOBA 1LB3A 4LPNA 2C41A 3PVTA 1DATA 1IERA 1FHAA 3KA9A 3R2SA 4ZKXA 4DZ0A 5ERJA 4XKUA 3AJQA 4TODA 2V2RA 1JI4A 3NOZX 4KVRA 4LQVA 5HU6D 1R03A 5LG8A 5J8WA 2OC5A 2V2PA 3AF7X 4LYUA 2BJYA 5ERKA 3KA3A 2YW7A 2ZURX 3F34A 4CMYA 2WWXB 3PW1B 4DASA 2F7NA 4Z5SA 2V2NA 3Q4RA 2V2OA 1EUMA 5CMRA 3E2CA 4E40A 3PVYB 2CHPA 4YVZA 4ZKWA 4ZTTA 3KHKA 4RC6A 5FFDA 1DPSA 4PG1A 1Z6OA 2GS4A 3KXUA 2YJKA 2CLBA 5GU1X 4TOEA 4U3GA 4ML5A 1BG7A 2WLUA 1JI5A 3F37A 2VXXA 3F36A 1RCDA 4EVBA 3F33A 3PVRA 4TOAA 3R2HA 1TKOA 2C2JA 5HQOA 2FG8A 1NF6A 5D8RA 4KVQA 2FG4A 3MPSA 1B71A 5GU2X 1JKUA 3R2KA 2V2LA 4CY9A 3E1PA 4RC8A 3RE7A 1RCCA 2PYBA 4MKUA 3KA4A 5D8XA 5D8QA 3KA6A 5FFAA 1RCIA 4LPJA 3RAVA 3BVKA 4RC7B 5CMQA 3D19A 5CZUA 3VV9A 5FFBA 2OH3A 2C2FA 2Z5PA 5J93A 3SIDA 4DYZA 2BK6A 4PGIA 2GYQA 3WNWA 3HL1A 4PG0A 3FRRA 3AK9A 3EZUA 4CYBA 3UOIA 1S2ZA 4ISPA 1N1QA 5E2DA 3E1OA 4AM4A 5JKMA 2V2MA 5JKMG 4XKTA 3BVEA 2C6RA 3SH6A 1YUZA 4MUDA 2D5KA 3Q4NA 4EVDA 5GN8B 3ERZA 2BKCA 2G38B 1LKOA 3E6SA 3LKDA 5HJHA 3N6OA 3UOFA 2IU2A 4ISMA 3E1LA 4AM5A 2FL0A 3PW1A 1QGHA 1GWGA 2Z90A 3E1MA 4CVRA 3R2RA 4ZLWA 3M6JA 2IY4A 3C1ZA 1BFRA 1NFVA 1XZ1A 2JD60 3T9JA 2XKQA 3PVYA 4MY7A 4W4KB 1JTSA 3PZAA 3QB9A 2HR5A 3AF8X 4CYAA 1RCGA 2VXIA 1QYBA 2ZG8X 3KA8A 4IWJA 3KX9A 3OGHA 1IESA 1SOFA 2AR0A 3Q4QA 4XGSA 5HJFA 3VNXA 4CVPA 3O7SA 5LBHA 3PW8A 4WJG4 3W54A 2YW6A 3F38A 4X0JA 4KVSA 4OYNA 4TOCA 2XGWA 2Y3QA 4IXKA 3E1JA 3PWQA 1LKPA 3PW8C 1O9RA 4DYXA 3UFBA 4ZL6A 4M34A 4RC7A 4ZMCA 2Z5RA 4E6KA 2CWLA 5GU0X 4TO9A 2RBDA 3PWQC 1KRQA 2MGYA 4DYYA 3NP2X 2CF7A 3C23A 1XZ3A 3IS8A 1VEIA 2W0OA 2UX1A 1AEWA 1JIGA 3F32A 3FRSA 3RD0A 1OTKA 3PVRB 2CIHA 5FFEA 4R42A 3WVWA 4RC5B 3BT5A 3E1NA 3QVDA 2ZA8A 3DBYA 1NNQA 3GHQA 2N02A 5GN8A 1VEQA 2Z6MA 1SQ3A 3WVVA 1L8HA 3GGYA 2CN6A 1S3QA 3AJOA 1LKMA 4ZJKA 4DE6A 1RCEA 4XKSA 3R2LA 4KXRB 3C21A 3ISFA 3TA8A 5J9VA 4ITTA 3PWFA 2FFXJ 2JD70 3L0MA 1NF4A 3JZ9A 3FSEA 4TOGA 2ZA6A 4YXMA 3C1YA 1JYBA 3BVLA 5JDOB 5D8OA 5LG2A 2FZFA 3Q4OA 1ZS3A 4MJYA 4DI0A 4MXPA 4ZL5A 4M32A 2XJOA 4CMYV 3F35A 5K53A 3A9QA 5C6FA 2FKZA 3IS7A 3HIUA 2BW1A 2Z5QA 2FJCA 1ZUJA 2QQYA 4LPMA 4IWKA 2WTLA 1J30A 5D8PA 3O7RA 2YJJA 3F39A 3GE4A 4DYUA 3JZAB 1UMNA 4A25A 2ZG9X 4II4B 2V15A 3BKNA 1HRSA 3PVTB 5K52A 2CHIA 4Z3BA 5I4JA 3H7GA 2FHAA 5D8YA 2OKCA 2ZA7A 3UNOA 3AJPA 2CN7A 3U90A 3QHBA 1JKVA 3OJ5A 3KWOA 4MN9A 4LYXA 4YKHA 4CVSA 3IQ1A 3FI6A 3NP0X 3AK8A 1JGCA 5FEJA 3RBCA 1DVBA 1YV1A 1TK6A
chains in the Genus database with same CATH topology
5E1UA 1F30A 2C2UA 5JACA 3KDQA 3FVBA 1TKPA 5D8SA 2XJNA 4TW3A 1JREA 2G4HA 3BVIA 3E1QA 4RC5A 4RC6B 1VLGA 3ISEA 2X170 5IX6A 2ZG7X 3E6RA 2VZBA 4EVEA 4AM2A 4QUWA 4ERUA 1F33A 3GGZA 1MOJA 3R2OA 5J8SA 2IB0A 3ES3A 4ETRA 4M33A 5FFCA 3EGMA 4ZKHA 3QD8A 3V3KB 5GOUA 1Z6OM 4TOFA 2GYDA 3BVFA 4ITWA 2V2SA 3WVUA 3GVYA 1O9IA 1MFRA 3QHCA 1TJOA 3VVAA 4REUA 1VELA 4Y08A 1S30A 4YXJA 5JDOA 3A68A 4LQJA 3EZ0A 2V2IA 3SE1A 3QZ3A 1L8IA 5GU3X 1RYTA 1YUXA 2CLUA 2ITBA 2HTNA 4TOHA 2JD80 1BCFA 4EVCA 4LQNA 2V2JA 2Y44A 1VJXA 3AF9X 3R2MA 1UVHA 5LS9A 2V8TA 2CEIA 2QF9A 4P18A 5JKLA 4CVTA 2WLAA 4M35A 3RGDA 1Z4AA 4LQHA 5JKLG 5AXSA 1H96A 3SHXA 4W4LB 2XJMA 4PGKA 4II4A 2V8UA 4TOBA 1LB3A 4LPNA 2C41A 3PVTA 1DATA 1IERA 1FHAA 3KA9A 3R2SA 4ZKXA 4DZ0A 5ERJA 4XKUA 3AJQA 4TODA 2V2RA 1JI4A 3NOZX 4KVRA 4LQVA 5HU6D 1R03A 5LG8A 5J8WA 2OC5A 2V2PA 3AF7X 4LYUA 2BJYA 5ERKA 3KA3A 2YW7A 2ZURX 3F34A 4CMYA 2WWXB 3PW1B 4DASA 2F7NA 4Z5SA 2V2NA 3Q4RA 2V2OA 1EUMA 5CMRA 3E2CA 4E40A 3PVYB 2CHPA 4YVZA 4ZKWA 4ZTTA 3KHKA 4RC6A 5FFDA 1DPSA 4PG1A 1Z6OA 2GS4A 3KXUA 2YJKA 2CLBA 5GU1X 4TOEA 4U3GA 4ML5A 1BG7A 2WLUA 1JI5A 3F37A 2VXXA 3F36A 1RCDA 4EVBA 3F33A 3PVRA 4TOAA 3R2HA 1TKOA 2C2JA 5HQOA 2FG8A 1NF6A 5D8RA 4KVQA 2FG4A 3MPSA 1B71A 5GU2X 1JKUA 3R2KA 2V2LA 4CY9A 3E1PA 4RC8A 3RE7A 1RCCA 2PYBA 4MKUA 3KA4A 5D8XA 5D8QA 3KA6A 5FFAA 1RCIA 4LPJA 3RAVA 3BVKA 4RC7B 5CMQA 3D19A 5CZUA 3VV9A 5FFBA 2OH3A 2C2FA 2Z5PA 5J93A 3SIDA 4DYZA 2BK6A 4PGIA 2GYQA 3WNWA 3HL1A 4PG0A 3FRRA 3AK9A 3EZUA 4CYBA 3UOIA 1S2ZA 4ISPA 1N1QA 5E2DA 3E1OA 4AM4A 5JKMA 2V2MA 5JKMG 4XKTA 3BVEA 2C6RA 3SH6A 1YUZA 4MUDA 2D5KA 3Q4NA 4EVDA 5GN8B 3ERZA 2BKCA 2G38B 1LKOA 3E6SA 3LKDA 5HJHA 3N6OA 3UOFA 2IU2A 4ISMA 3E1LA 4AM5A 2FL0A 3PW1A 1QGHA 1GWGA 2Z90A 3E1MA 4CVRA 3R2RA 4ZLWA 3M6JA 2IY4A 3C1ZA 1BFRA 1NFVA 1XZ1A 2JD60 3T9JA 2XKQA 3PVYA 4MY7A 4W4KB 1JTSA 3PZAA 3QB9A 2HR5A 3AF8X 4CYAA 1RCGA 2VXIA 1QYBA 2ZG8X 3KA8A 4IWJA 3KX9A 3OGHA 1IESA 1SOFA 2AR0A 3Q4QA 4XGSA 5HJFA 3VNXA 4CVPA 3O7SA 5LBHA 3PW8A 4WJG4 3W54A 2YW6A 3F38A 4X0JA 4KVSA 4OYNA 4TOCA 2XGWA 2Y3QA 4IXKA 3E1JA 3PWQA 1LKPA 3PW8C 1O9RA 4DYXA 3UFBA 4ZL6A 4M34A 4RC7A 4ZMCA 2Z5RA 4E6KA 2CWLA 5GU0X 4TO9A 2RBDA 3PWQC 1KRQA 2MGYA 4DYYA 3NP2X 2CF7A 3C23A 1XZ3A 3IS8A 1VEIA 2W0OA 2UX1A 1AEWA 1JIGA 3F32A 3FRSA 3RD0A 1OTKA 3PVRB 2CIHA 5FFEA 4R42A 3WVWA 4RC5B 3BT5A 3E1NA 3QVDA 2ZA8A 3DBYA 1NNQA 3GHQA 2N02A 5GN8A 1VEQA 2Z6MA 1SQ3A 3WVVA 1L8HA 3GGYA 2CN6A 1S3QA 3AJOA 1LKMA 4ZJKA 4DE6A 1RCEA 4XKSA 3R2LA 4KXRB 3C21A 3ISFA 3TA8A 5J9VA 4ITTA 3PWFA 2FFXJ 2JD70 3L0MA 1NF4A 3JZ9A 3FSEA 4TOGA 2ZA6A 4YXMA 3C1YA 1JYBA 3BVLA 5JDOB 5D8OA 5LG2A 2FZFA 3Q4OA 1ZS3A 4MJYA 4DI0A 4MXPA 4ZL5A 4M32A 2XJOA 4CMYV 3F35A 5K53A 3A9QA 5C6FA 2FKZA 3IS7A 3HIUA 2BW1A 2Z5QA 2FJCA 1ZUJA 2QQYA 4LPMA 4IWKA 2WTLA 1J30A 5D8PA 3O7RA 2YJJA 3F39A 3GE4A 4DYUA 3JZAB 1UMNA 4A25A 2ZG9X 4II4B 2V15A 3BKNA 1HRSA 3PVTB 5K52A 2CHIA 4Z3BA 5I4JA 3H7GA 2FHAA 5D8YA 2OKCA 2ZA7A 3UNOA 3AJPA 2CN7A 3U90A 3QHBA 1JKVA 3OJ5A 3KWOA 4MN9A 4LYXA 4YKHA 4CVSA 3IQ1A 3FI6A 3NP0X 3AK8A 1JGCA 5FEJA 3RBCA 1DVBA 1YV1A 1TK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1U A;  1F30 A;  2C2U A;  5JAC A;  3FVB A;  1TKP A;  5D8S A;  2XJN A;  4TW3 A;  1JRE A;  2G4H A;  3BVI A;  3E1Q A;  4RC5 A;  4RC6 B;  1VLG A;  3ISE A;  2X17 0;  5IX6 A;  2ZG7 X;  3E6R A;  2VZB A;  4EVE A;  4AM2 A;  4QUW A;  4ERU A;  1F33 A;  1MOJ A;  3R2O A;  5J8S A;  2IB0 A;  3ES3 A;  4ETR A;  4M33 A;  5FFC A;  3EGM A;  4ZKH A;  3QD8 A;  5GOU A;  1Z6O M;  4TOF A;  2GYD A;  3BVF A;  4ITW A;  2V2S A;  3WVU A;  3GVY A;  1O9I A;  1MFR A;  3QHC A;  1TJO A;  4REU A;  1VEL A;  4Y08 A;  1S30 A;  3A68 A;  4LQJ A;  3EZ0 A;  2V2I A;  3SE1 A;  3QZ3 A;  1L8I A;  5GU3 X;  1RYT A;  1YUX A;  2CLU A;  2ITB A;  2HTN A;  4TOH A;  2JD8 0;  1BCF A;  4EVC A;  4LQN A;  2V2J A;  3AF9 X;  1VJX A;  3R2M A;  1UVH A;  5LS9 A;  2CEI A;  2QF9 A;  4P18 A;  5JKL A;  4CVT A;  2WLA A;  4M35 A;  3RGD A;  1Z4A A;  4LQH A;  5JKL G;  5AXS A;  1H96 A;  3SHX A;  2XJM A;  4PGK A;  4II4 A;  4TOB A;  1LB3 A;  4LPN A;  2C41 A;  3PVT A;  1DAT A;  1IER A;  1FHA A;  3KA9 A;  3R2S A;  4ZKX A;  4DZ0 A;  5ERJ A;  4XKU A;  3AJQ A;  4TOD A;  2V2R A;  1JI4 A;  3NOZ X;  4KVR A;  4LQV A;  5LG8 A;  1R03 A;  5J8W A;  2OC5 A;  2V2P A;  3AF7 X;  4LYU A;  2BJY A;  5ERK A;  3KA3 A;  2YW7 A;  2ZUR X;  3F34 A;  4CMY A;  3PW1 B;  4DAS A;  2F7N A;  4Z5S A;  2V2N A;  3Q4R A;  2V2O A;  1EUM A;  5CMR A;  3E2C A;  3PVY B;  2CHP A;  4ZKW A;  4ZTT A;  4RC6 A;  5FFD A;  1DPS A;  4PG1 A;  1Z6O A;  2GS4 A;  3KXU A;  2YJK A;  2CLB A;  5GU1 X;  4TOE A;  4U3G A;  4ML5 A;  1BG7 A;  2WLU A;  1JI5 A;  3F37 A;  2VXX A;  3F36 A;  1RCD A;  4EVB A;  3F33 A;  3PVR A;  4TOA A;  3R2H A;  1TKO A;  2C2J A;  5HQO A;  2FG8 A;  1NF6 A;  5D8R A;  4KVQ A;  2FG4 A;  3MPS A;  1B71 A;  5GU2 X;  1JKU A;  3R2K A;  2V2L A;  4CY9 A;  3E1P A;  4RC8 A;  3RE7 A;  1RCC A;  2PYB A;  4MKU A;  3KA4 A;  5D8X A;  5D8Q A;  3KA6 A;  5FFA A;  1RCI A;  4LPJ A;  3RAV A;  3BVK A;  4RC7 B;  5CMQ A;  5CZU A;  5FFB A;  2OH3 A;  2C2F A;  2Z5P A;  5J93 A;  3SID A;  4DYZ A;  2BK6 A;  4PGI A;  2GYQ A;  3WNW A;  3HL1 A;  4PG0 A;  3AK9 A;  3EZU A;  4CYB A;  3UOI A;  1S2Z A;  4ISP A;  1N1Q A;  5E2D A;  3E1O A;  4AM4 A;  5JKM A;  2V2M A;  5JKM G;  4XKT A;  3BVE A;  2C6R A;  3SH6 A;  1YUZ A;  4MUD A;  2D5K A;  3Q4N A;  4EVD A;  5GN8 B;  3ERZ A;  2BKC A;  1LKO A;  3E6S A;  5HJH A;  3UOF A;  2IU2 A;  4ISM A;  3E1L A;  4AM5 A;  2FL0 A;  3PW1 A;  1QGH A;  1GWG A;  2Z90 A;  3E1M A;  4CVR A;  3R2R A;  4ZLW A;  2IY4 A;  1BFR A;  1NFV A;  1XZ1 A;  2JD6 0;  3T9J A;  2XKQ A;  3PVY A;  4MY7 A;  1JTS A;  3PZA A;  3QB9 A;  2HR5 A;  3AF8 X;  4CYA A;  1RCG A;  2VXI A;  1QYB A;  2ZG8 X;  3KA8 A;  4IWJ A;  3KX9 A;  3OGH A;  1IES A;  1SOF A;  3Q4Q A;  4XGS A;  5HJF A;  3VNX A;  4CVP A;  3O7S A;  5LBH A;  3PW8 A;  2YW6 A;  3F38 A;  4KVS A;  4OYN A;  4TOC A;  2XGW A;  2Y3Q A;  4IXK A;  3E1J A;  3PWQ A;  1LKP A;  3PW8 C;  1O9R A;  4DYX A;  4ZL6 A;  4M34 A;  4RC7 A;  4ZMC A;  2Z5R A;  4E6K A;  5GU0 X;  4TO9 A;  2RBD A;  3PWQ C;  1KRQ A;  4DYY A;  3NP2 X;  2CF7 A;  1XZ3 A;  3IS8 A;  1VEI A;  2W0O A;  2UX1 A;  1AEW A;  1JIG A;  3F32 A;  3RD0 A;  1OTK A;  3PVR B;  2CIH A;  5FFE A;  4R42 A;  3WVW A;  4RC5 B;  3BT5 A;  3E1N A;  3QVD A;  2ZA8 A;  3GHQ A;  1NNQ A;  5GN8 A;  1VEQ A;  2Z6M A;  1SQ3 A;  3WVV A;  1L8H A;  2CN6 A;  1S3Q A;  3AJO A;  1LKM A;  4ZJK A;  4DE6 A;  1RCE A;  4XKS A;  3R2L A;  3ISF A;  3TA8 A;  5J9V A;  4ITT A;  3PWF A;  2FFX J;  2JD7 0;  1NF4 A;  3FSE A;  4TOG A;  2ZA6 A;  1JYB A;  3BVL A;  5D8O A;  5LG2 A;  2FZF A;  3Q4O A;  1ZS3 A;  4MJY A;  4DI0 A;  4ZL5 A;  4M32 A;  2XJO A;  4CMY V;  3F35 A;  5K53 A;  3A9Q A;  5C6F A;  2FKZ A;  3IS7 A;  3HIU A;  2BW1 A;  2Z5Q A;  2FJC A;  1ZUJ A;  2QQY A;  4LPM A;  4IWK A;  2WTL A;  1J30 A;  5D8P A;  3O7R A;  2YJJ A;  3F39 A;  3GE4 A;  4DYU A;  1UMN A;  4A25 A;  2ZG9 X;  4II4 B;  2V15 A;  3BKN A;  1HRS A;  3PVT B;  5K52 A;  2CHI A;  4Z3B A;  5I4J A;  3H7G A;  2FHA A;  5D8Y A;  2ZA7 A;  3UNO A;  3AJP A;  2CN7 A;  3U90 A;  3QHB A;  1JKV A;  3OJ5 A;  3KWO A;  4MN9 A;  4LYX A;  4YKH A;  4CVS A;  3IQ1 A;  3FI6 A;  3NP0 X;  3AK8 A;  1JGC A;  5FEJ A;  3RBC A;  1DVB A;  1YV1 A;  1TK6 A; 
#chains in the Genus database with same CATH topology
 5E1U A;  1F30 A;  2C2U A;  5JAC A;  3KDQ A;  3FVB A;  1TKP A;  5D8S A;  2XJN A;  4TW3 A;  1JRE A;  2G4H A;  3BVI A;  3E1Q A;  4RC5 A;  4RC6 B;  1VLG A;  3ISE A;  2X17 0;  5IX6 A;  2ZG7 X;  3E6R A;  2VZB A;  4EVE A;  4AM2 A;  4QUW A;  4ERU A;  1F33 A;  3GGZ A;  1MOJ A;  3R2O A;  5J8S A;  2IB0 A;  3ES3 A;  4ETR A;  4M33 A;  5FFC A;  3EGM A;  4ZKH A;  3QD8 A;  3V3K B;  5GOU A;  1Z6O M;  4TOF A;  2GYD A;  3BVF A;  4ITW A;  2V2S A;  3WVU A;  3GVY A;  1O9I A;  1MFR A;  3QHC A;  1TJO A;  3VVA A;  4REU A;  1VEL A;  4Y08 A;  1S30 A;  4YXJ A;  5JDO A;  3A68 A;  4LQJ A;  3EZ0 A;  2V2I A;  3SE1 A;  3QZ3 A;  1L8I A;  5GU3 X;  1RYT A;  1YUX A;  2CLU A;  2ITB A;  2HTN A;  4TOH A;  2JD8 0;  1BCF A;  4EVC A;  4LQN A;  2V2J A;  2Y44 A;  1VJX A;  3AF9 X;  3R2M A;  1UVH A;  5LS9 A;  2V8T A;  2CEI A;  2QF9 A;  4P18 A;  5JKL A;  4CVT A;  2WLA A;  4M35 A;  3RGD A;  1Z4A A;  4LQH A;  5JKL G;  5AXS A;  1H96 A;  3SHX A;  4W4L B;  2XJM A;  4PGK A;  4II4 A;  2V8U A;  4TOB A;  1LB3 A;  4LPN A;  2C41 A;  3PVT A;  1DAT A;  1IER A;  1FHA A;  3KA9 A;  3R2S A;  4ZKX A;  4DZ0 A;  5ERJ A;  4XKU A;  3AJQ A;  4TOD A;  2V2R A;  1JI4 A;  3NOZ X;  4KVR A;  4LQV A;  5HU6 D;  1R03 A;  5LG8 A;  5J8W A;  2OC5 A;  2V2P A;  3AF7 X;  4LYU A;  2BJY A;  5ERK A;  3KA3 A;  2YW7 A;  2ZUR X;  3F34 A;  4CMY A;  2WWX B;  3PW1 B;  4DAS A;  2F7N A;  4Z5S A;  2V2N A;  3Q4R A;  2V2O A;  1EUM A;  5CMR A;  3E2C A;  4E40 A;  3PVY B;  2CHP A;  4YVZ A;  4ZKW A;  4ZTT A;  3KHK A;  4RC6 A;  5FFD A;  1DPS A;  4PG1 A;  1Z6O A;  2GS4 A;  3KXU A;  2YJK A;  2CLB A;  5GU1 X;  4TOE A;  4U3G A;  4ML5 A;  1BG7 A;  2WLU A;  1JI5 A;  3F37 A;  2VXX A;  3F36 A;  1RCD A;  4EVB A;  3F33 A;  3PVR A;  4TOA A;  3R2H A;  1TKO A;  2C2J A;  5HQO A;  2FG8 A;  1NF6 A;  5D8R A;  4KVQ A;  2FG4 A;  3MPS A;  1B71 A;  5GU2 X;  1JKU A;  3R2K A;  2V2L A;  4CY9 A;  3E1P A;  4RC8 A;  3RE7 A;  1RCC A;  2PYB A;  4MKU A;  3KA4 A;  5D8X A;  5D8Q A;  3KA6 A;  5FFA A;  1RCI A;  4LPJ A;  3RAV A;  3BVK A;  4RC7 B;  5CMQ A;  3D19 A;  5CZU A;  3VV9 A;  5FFB A;  2OH3 A;  2C2F A;  2Z5P A;  5J93 A;  3SID A;  4DYZ A;  2BK6 A;  4PGI A;  2GYQ A;  3WNW A;  3HL1 A;  4PG0 A;  3FRR A;  3AK9 A;  3EZU A;  4CYB A;  3UOI A;  1S2Z A;  4ISP A;  1N1Q A;  5E2D A;  3E1O A;  4AM4 A;  5JKM A;  2V2M A;  5JKM G;  4XKT A;  3BVE A;  2C6R A;  3SH6 A;  1YUZ A;  4MUD A;  2D5K A;  3Q4N A;  4EVD A;  5GN8 B;  3ERZ A;  2BKC A;  2G38 B;  1LKO A;  3E6S A;  3LKD A;  5HJH A;  3N6O A;  3UOF A;  2IU2 A;  4ISM A;  3E1L A;  4AM5 A;  2FL0 A;  3PW1 A;  1QGH A;  1GWG A;  2Z90 A;  3E1M A;  4CVR A;  3R2R A;  4ZLW A;  3M6J A;  2IY4 A;  3C1Z A;  1BFR A;  1NFV A;  1XZ1 A;  2JD6 0;  3T9J A;  2XKQ A;  3PVY A;  4MY7 A;  4W4K B;  1JTS A;  3PZA A;  3QB9 A;  2HR5 A;  3AF8 X;  4CYA A;  1RCG A;  2VXI A;  1QYB A;  2ZG8 X;  3KA8 A;  4IWJ A;  3KX9 A;  3OGH A;  1IES A;  1SOF A;  2AR0 A;  3Q4Q A;  4XGS A;  5HJF A;  3VNX A;  4CVP A;  3O7S A;  5LBH A;  3PW8 A;  4WJG 4;  3W54 A;  2YW6 A;  3F38 A;  4X0J A;  4KVS A;  4OYN A;  4TOC A;  2XGW A;  2Y3Q A;  4IXK A;  3E1J A;  3PWQ A;  1LKP A;  3PW8 C;  1O9R A;  4DYX A;  3UFB A;  4ZL6 A;  4M34 A;  4RC7 A;  4ZMC A;  2Z5R A;  4E6K A;  2CWL A;  5GU0 X;  4TO9 A;  2RBD A;  3PWQ C;  1KRQ A;  2MGY A;  4DYY A;  3NP2 X;  2CF7 A;  3C23 A;  1XZ3 A;  3IS8 A;  1VEI A;  2W0O A;  2UX1 A;  1AEW A;  1JIG A;  3F32 A;  3FRS A;  3RD0 A;  1OTK A;  3PVR B;  2CIH A;  5FFE A;  4R42 A;  3WVW A;  4RC5 B;  3BT5 A;  3E1N A;  3QVD A;  2ZA8 A;  3DBY A;  1NNQ A;  3GHQ A;  2N02 A;  5GN8 A;  1VEQ A;  2Z6M A;  1SQ3 A;  3WVV A;  1L8H A;  3GGY A;  2CN6 A;  1S3Q A;  3AJO A;  1LKM A;  4ZJK A;  4DE6 A;  1RCE A;  4XKS A;  3R2L A;  4KXR B;  3C21 A;  3ISF A;  3TA8 A;  5J9V A;  4ITT A;  3PWF A;  2FFX J;  2JD7 0;  3L0M A;  1NF4 A;  3JZ9 A;  3FSE A;  4TOG A;  2ZA6 A;  4YXM A;  3C1Y A;  1JYB A;  3BVL A;  5JDO B;  5D8O A;  5LG2 A;  2FZF A;  3Q4O A;  1ZS3 A;  4MJY A;  4DI0 A;  4MXP A;  4ZL5 A;  4M32 A;  2XJO A;  4CMY V;  3F35 A;  5K53 A;  3A9Q A;  5C6F A;  2FKZ A;  3IS7 A;  3HIU A;  2BW1 A;  2Z5Q A;  2FJC A;  1ZUJ A;  2QQY A;  4LPM A;  4IWK A;  2WTL A;  1J30 A;  5D8P A;  3O7R A;  2YJJ A;  3F39 A;  3GE4 A;  4DYU A;  3JZA B;  1UMN A;  4A25 A;  2ZG9 X;  4II4 B;  2V15 A;  3BKN A;  1HRS A;  3PVT B;  5K52 A;  2CHI A;  4Z3B A;  5I4J A;  3H7G A;  2FHA A;  5D8Y A;  2OKC A;  2ZA7 A;  3UNO A;  3AJP A;  2CN7 A;  3U90 A;  3QHB A;  1JKV A;  3OJ5 A;  3KWO A;  4MN9 A;  4LYX A;  4YKH A;  4CVS A;  3IQ1 A;  3FI6 A;  3NP0 X;  3AK8 A;  1JGC A;  5FEJ A;  3RBC A;  1DVB A;  1YV1 A;  1TK6 A; 
#chains in the Genus database with same CATH homology
 5E1U A;  1F30 A;  2C2U A;  5JAC A;  3KDQ A;  3FVB A;  1TKP A;  5D8S A;  2XJN A;  4TW3 A;  1JRE A;  2G4H A;  3BVI A;  3E1Q A;  4RC5 A;  4RC6 B;  1VLG A;  3ISE A;  2X17 0;  5IX6 A;  2ZG7 X;  3E6R A;  2VZB A;  4EVE A;  4AM2 A;  4QUW A;  4ERU A;  1F33 A;  3GGZ A;  1MOJ A;  3R2O A;  5J8S A;  2IB0 A;  3ES3 A;  4ETR A;  4M33 A;  5FFC A;  3EGM A;  4ZKH A;  3QD8 A;  3V3K B;  5GOU A;  1Z6O M;  4TOF A;  2GYD A;  3BVF A;  4ITW A;  2V2S A;  3WVU A;  3GVY A;  1O9I A;  1MFR A;  3QHC A;  1TJO A;  3VVA A;  4REU A;  1VEL A;  4Y08 A;  1S30 A;  4YXJ A;  5JDO A;  3A68 A;  4LQJ A;  3EZ0 A;  2V2I A;  3SE1 A;  3QZ3 A;  1L8I A;  5GU3 X;  1RYT A;  1YUX A;  2CLU A;  2ITB A;  2HTN A;  4TOH A;  2JD8 0;  1BCF A;  4EVC A;  4LQN A;  2V2J A;  2Y44 A;  1VJX A;  3AF9 X;  3R2M A;  1UVH A;  5LS9 A;  2V8T A;  2CEI A;  2QF9 A;  4P18 A;  5JKL A;  4CVT A;  2WLA A;  4M35 A;  3RGD A;  1Z4A A;  4LQH A;  5JKL G;  5AXS A;  1H96 A;  3SHX A;  4W4L B;  2XJM A;  4PGK A;  4II4 A;  2V8U A;  4TOB A;  1LB3 A;  4LPN A;  2C41 A;  3PVT A;  1DAT A;  1IER A;  1FHA A;  3KA9 A;  3R2S A;  4ZKX A;  4DZ0 A;  5ERJ A;  4XKU A;  3AJQ A;  4TOD A;  2V2R A;  1JI4 A;  3NOZ X;  4KVR A;  4LQV A;  5HU6 D;  1R03 A;  5LG8 A;  5J8W A;  2OC5 A;  2V2P A;  3AF7 X;  4LYU A;  2BJY A;  5ERK A;  3KA3 A;  2YW7 A;  2ZUR X;  3F34 A;  4CMY A;  2WWX B;  3PW1 B;  4DAS A;  2F7N A;  4Z5S A;  2V2N A;  3Q4R A;  2V2O A;  1EUM A;  5CMR A;  3E2C A;  4E40 A;  3PVY B;  2CHP A;  4YVZ A;  4ZKW A;  4ZTT A;  3KHK A;  4RC6 A;  5FFD A;  1DPS A;  4PG1 A;  1Z6O A;  2GS4 A;  3KXU A;  2YJK A;  2CLB A;  5GU1 X;  4TOE A;  4U3G A;  4ML5 A;  1BG7 A;  2WLU A;  1JI5 A;  3F37 A;  2VXX A;  3F36 A;  1RCD A;  4EVB A;  3F33 A;  3PVR A;  4TOA A;  3R2H A;  1TKO A;  2C2J A;  5HQO A;  2FG8 A;  1NF6 A;  5D8R A;  4KVQ A;  2FG4 A;  3MPS A;  1B71 A;  5GU2 X;  1JKU A;  3R2K A;  2V2L A;  4CY9 A;  3E1P A;  4RC8 A;  3RE7 A;  1RCC A;  2PYB A;  4MKU A;  3KA4 A;  5D8X A;  5D8Q A;  3KA6 A;  5FFA A;  1RCI A;  4LPJ A;  3RAV A;  3BVK A;  4RC7 B;  5CMQ A;  3D19 A;  5CZU A;  3VV9 A;  5FFB A;  2OH3 A;  2C2F A;  2Z5P A;  5J93 A;  3SID A;  4DYZ A;  2BK6 A;  4PGI A;  2GYQ A;  3WNW A;  3HL1 A;  4PG0 A;  3FRR A;  3AK9 A;  3EZU A;  4CYB A;  3UOI A;  1S2Z A;  4ISP A;  1N1Q A;  5E2D A;  3E1O A;  4AM4 A;  5JKM A;  2V2M A;  5JKM G;  4XKT A;  3BVE A;  2C6R A;  3SH6 A;  1YUZ A;  4MUD A;  2D5K A;  3Q4N A;  4EVD A;  5GN8 B;  3ERZ A;  2BKC A;  2G38 B;  1LKO A;  3E6S A;  3LKD A;  5HJH A;  3N6O A;  3UOF A;  2IU2 A;  4ISM A;  3E1L A;  4AM5 A;  2FL0 A;  3PW1 A;  1QGH A;  1GWG A;  2Z90 A;  3E1M A;  4CVR A;  3R2R A;  4ZLW A;  3M6J A;  2IY4 A;  3C1Z A;  1BFR A;  1NFV A;  1XZ1 A;  2JD6 0;  3T9J A;  2XKQ A;  3PVY A;  4MY7 A;  4W4K B;  1JTS A;  3PZA A;  3QB9 A;  2HR5 A;  3AF8 X;  4CYA A;  1RCG A;  2VXI A;  1QYB A;  2ZG8 X;  3KA8 A;  4IWJ A;  3KX9 A;  3OGH A;  1IES A;  1SOF A;  2AR0 A;  3Q4Q A;  4XGS A;  5HJF A;  3VNX A;  4CVP A;  3O7S A;  5LBH A;  3PW8 A;  4WJG 4;  3W54 A;  2YW6 A;  3F38 A;  4X0J A;  4KVS A;  4OYN A;  4TOC A;  2XGW A;  2Y3Q A;  4IXK A;  3E1J A;  3PWQ A;  1LKP A;  3PW8 C;  1O9R A;  4DYX A;  3UFB A;  4ZL6 A;  4M34 A;  4RC7 A;  4ZMC A;  2Z5R A;  4E6K A;  2CWL A;  5GU0 X;  4TO9 A;  2RBD A;  3PWQ C;  1KRQ A;  2MGY A;  4DYY A;  3NP2 X;  2CF7 A;  3C23 A;  1XZ3 A;  3IS8 A;  1VEI A;  2W0O A;  2UX1 A;  1AEW A;  1JIG A;  3F32 A;  3FRS A;  3RD0 A;  1OTK A;  3PVR B;  2CIH A;  5FFE A;  4R42 A;  3WVW A;  4RC5 B;  3BT5 A;  3E1N A;  3QVD A;  2ZA8 A;  3DBY A;  1NNQ A;  3GHQ A;  2N02 A;  5GN8 A;  1VEQ A;  2Z6M A;  1SQ3 A;  3WVV A;  1L8H A;  3GGY A;  2CN6 A;  1S3Q A;  3AJO A;  1LKM A;  4ZJK A;  4DE6 A;  1RCE A;  4XKS A;  3R2L A;  4KXR B;  3C21 A;  3ISF A;  3TA8 A;  5J9V A;  4ITT A;  3PWF A;  2FFX J;  2JD7 0;  3L0M A;  1NF4 A;  3JZ9 A;  3FSE A;  4TOG A;  2ZA6 A;  4YXM A;  3C1Y A;  1JYB A;  3BVL A;  5JDO B;  5D8O A;  5LG2 A;  2FZF A;  3Q4O A;  1ZS3 A;  4MJY A;  4DI0 A;  4MXP A;  4ZL5 A;  4M32 A;  2XJO A;  4CMY V;  3F35 A;  5K53 A;  3A9Q A;  5C6F A;  2FKZ A;  3IS7 A;  3HIU A;  2BW1 A;  2Z5Q A;  2FJC A;  1ZUJ A;  2QQY A;  4LPM A;  4IWK A;  2WTL A;  1J30 A;  5D8P A;  3O7R A;  2YJJ A;  3F39 A;  3GE4 A;  4DYU A;  3JZA B;  1UMN A;  4A25 A;  2ZG9 X;  4II4 B;  2V15 A;  3BKN A;  1HRS A;  3PVT B;  5K52 A;  2CHI A;  4Z3B A;  5I4J A;  3H7G A;  2FHA A;  5D8Y A;  2OKC A;  2ZA7 A;  3UNO A;  3AJP A;  2CN7 A;  3U90 A;  3QHB A;  1JKV A;  3OJ5 A;  3KWO A;  4MN9 A;  4LYX A;  4YKH A;  4CVS A;  3IQ1 A;  3FI6 A;  3NP0 X;  3AK8 A;  1JGC A;  5FEJ A;  3RBC A;  1DVB A;  1YV1 A;  1TK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...