3E1XB

The crystal structure of apo prostasin at 1.7 angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e1xB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e1xB01
4BXSA 4HZHA 1HAZB 4JYTA 1UTKA 4K60A 1O3BA 1C5TA 1EAXA 3ZVCA 1EPTA 2ZPQA 1QURH 4YT6H 1V2PT 5L2YH 1RTFB 2BYAX 2O9QA 2Z6BD 4FUDA 1QCPA 1C2GA 5DK1A 1HCGA 1MCTA 1O2JA 1GMDF 1JIRA 3L6PA 2Y5FA 3M5NA 4OS7A 1PQ8A 4H6TA 3A84A 1TLDA 3A80A 3SGQE 1AZZA 3SI4H 4X2YA 4D76A 1C5XB 3D49H 2ZI2H 3SNAA 2VWNA 3VPKA 4NWLA 1ZRKA 2STAE 1TNGA 1K2I1 1Y8TA 2XXLA 1DWCH 1NFYA 1JXPA 1QL9A 1A0LA 1EJMA 1EAIA 3SUEA 4DVAU 1BRAA 2B7DH 1DWBH 1G3CA 1KTSB 2GVFA 3URCA 1MAYA 4B75A 1C5UA 3V3MA 5EPYA 1ELVA 1P2KA 3E91A 1GL0E 1IHTH 2AGIX 2GV7A 1CGJE 3TLOA 2NU4E 1GHYH 1ANEA 1VITH 5F8TA 1W2KH 3RXLA 1ARBA 1L0ZA 2HLCA 1GHXH 1LKBA 4F49A 5CHAB 2VWMA 2VGCB 4Z6AH 5FPSA 1HFDA 3KIDU 4I32A 3URDA 3ZV8A 1QL7A 2H9EH 4ZKSU 1GBJA 1TX6A 3F6UH 2Q6GA 1AB9B 4TPYA 3GCHC 3A83A 4IBLH 1DOJA 3LC3A 1UTQA 1DX5M 1QJ1B 4GCHF 3MHWU 1Y5UT 2BXTH 2Y6TA 2SGFE 3P8FA 3ATMA 2Z7FE 3KCGH 5C5OA 2G81E 3TJVA 2FESH 1O3GA 2R2WU 3ZV9A 1ETSH 5L6NH 1YBWA 1TRNA 2W3KA 4YO9A 1W7GH 5EQSA 2WV5A 4KKDA 2B5TB 1MKWK 1TALA 4DY7B 1LHGH 2ZDLA 2JETB 4LOYH 3BEIB 1YPGH 2GKVE 2SGDE 4JZEH 4ASHA 3M7TA 3ZZBA 3A81A 5T3HA 3CS0A 1C2EA 1WUNH 4Y76A 1O2MA 3OSYA 1IQHA 5C3NA 2YNBA 5HMAA 3ZZ9A 1AHTH 1Y3XA 5A2MH 4ABEA 1G9IE 5GCHG 1AI8H 3PROA 1TMTH 1IQLA 2AMQA 1RTLA 2A7HA 3A7WA 1PJPA 1B0FA 1YCPM 4QT8C 1GBAA 1YM0A 1W0ZU 6GCHF 5A09A 1DPOA 2ZU3A 4MPWA 4RN6A 4K1TA 3RC4A 1GBTA 2FX6A 1OP2A 1NO9H 4BAMB 3QTVH 1DY8A 4ISLA 1BBRK 3ITIA 5DPAA 3PV4A 2P94A 1B5GH 7GCHF 3S9BA 1BZXE 8GCHG 4IC5A 2ZTXA 5ESTE 1NESE 1T32A 3GY4A 1UTOA 1FY1A 3UY9A 2R2MB 1F0SA 1CA0B 4K3JA 4ZMAH 1TNHA 1GCDA 2OXSA 1S81A 1P0SH 1ZTJA 5T6GA 5LH8A 1QJ6B 2XWBI 5PTPA 4JZ1A 3RXGA 5FX5A 3SQEE 4SGAE 1IQGA 3F9FA 2Q1JA 2BDCA 1SGTA 4TWYA 2FDAA 1GHZA 3RM2H 3NUMA 5DP7A 3SORA 1UK3A 1SHYA 2HRVA 5AVDA 1A3BH 2Z9IA 4OS2A 5TJXA 3SGAE 3SJIA 4ISOA 5F6MA 4X2WA 5EOKA 2ZU1A 5T6DA 5FAHA 4Y6DA 5GXPA 1E36B 4LZ1H 1ORFA 3RXEA 3ATKA 2BDAA 3RXOA 4U2WA 2V3HH 4YOGA 1C5VA 2PLXA 1QQUA 3SHAH 1HAPH 1K1IA 1SQTA 1C1VH 5CMXH 3EA8A 4WF8A 4NZLA 1MCVA 1F5RA 4BNRA 2W26A 1Z6JH 2V3OH 3SV7A 1DUAA 1LPZB 5ETXA 4IGDA 1GBHA 3LKWA 1TYNA 4FU7A 4K1SA 5EPNA 2PTNA 2PUQH 2UWPA 2R0LA 3O8CA 2BHGA 3BTME 1NFWA 2ANYA 3SJ9A 1L4DA 4X6MA 4GAWA 4BAQB 1WU1A 1P2NA 2ODQA 1LVBA 1UCYK 1C2MA 4MQAA 2GZ7A 3KQDA 3M36A 5DP5A 1MD7A 2ZGBH 3SU4A 1GCTC 6LPRA 5GDSH 3VB7A 3FFGA 3U1IB 1DDJA 1DY9A 2GDEH 1PPFE 3PMBB 4AOQA 4XE4A 4JZFH 1EX3A 3KNXA 3M3VA 2SGQE 3QGNB 2A4RA 3RLWH 1LHCH 3BTDE 2ZGXH 3MYWA 2QXIA 4BTIB 1WOFA 2QA9E 2F91A 5E2PA 4O03A 5LPEA 1E37B 4Y10E 3LGVA 1RIWB 3A8DA 1G2LA 2R3YA 2FYQA 2WPHS 3QK1A 1Z1IA 3LDXH 5G4BA 3SQHE 3T29A 3UTUH 1JRSA 1V2UT 4O3UA 1XUKA 4IN1A 3AW1A 1G3BA 3EAJA 2Z9KA 3RM0H 3T26A 1YPLH 3VXEH 1GDUA 1NU9A 1WBGB 2VB0A 4Y8ZA 1O2TA 1HXFH 1TB6H 1BTUA 1RS0A 4CRBA 2H5DA 1C4Y2 2ASUB 1TGTA 3F9HA 1A0HB 4NIVA 5AFZH 1MKWH 2RA3A 5FBEA 1C1QA 1DSUA 4NGAH 4ABIA 3M61U 1GVZA 3P8OA 2UWLA 3ZZDA 2G5NA 2BD4A 1TNJA 1NROH 1F2SE 3HATH 4YT7H 2G4UA 1SGIB 3BTWE 3FP6E 4NIXA 2C3SA 4UFFH 4CBNA 2BX4A 5C1XA 3RXIA 2BM2A 1EB2A 3SOSA 3B8JA 4FXGH 4RSPA 1FY8E 4DIIH 2G4TA 1GWAA 1RRKA 1EASA 1O35A 1S84A 3FP8E 3GY8A 2FXRA 1K28D 2VVVA 1YGCH 1AB9C 1SBWA 2WUBA 4SGBE 5J4QA 1GJ7B 2ZHEH 3HPTB 3GCTF 1BBRH 5FX6A 3BTFE 3E1XB 3MU4A 5TCAA 4WXVA 4B2AA 3EYDA 1AFQB 3BF6H 2GZ9A 1TRYA 4X6NA 1E38B 1O33A 1KXCA 2C8XB 1P2QA 1XM1A 3LGUA 3MNCA 3TPIZ 1XUIA 1GJBB 1A7SA 3RU4T 4JK5A 1F7ZA 2ZFFH 3RXAA 3KQCA 1SG8B 4Y0YE 1SHHB 3UWIA 2AYWA 1DICA 1NFUA 3BG8A 4ABBA 1C1PA 1PPGE 1G3EA 3VB6A 1OSSA 1XUGA 1SVPA 3K6YA 2FI3E 2EI6A 1VR1H 2JETC 3OY5U 2FOEA 1XKAC 1S83A 1EP5A 1BTXA 2Z9LA 4YOJA 1UVSH 3RU4D 2Y80A 1VJAU 3T28A 1C2DA 1P06A 3DFLA 1WV7H 2EA3A 1ZSKA 3CP7A 4AB8A 2GD4B 3U98H 1D6WA 1OX1A 1T8NA 3ZVGA 1BTYA 1IOEA 1C1WH 1THRH 1MTUA 4UE7H 2A5KA 2ZHWH 1H1BA 4FUEA 5JDUB 1C1OA 1KIGH 3TH4H 2ULLA 2A4QA 4R8TB 4AG1A 1AO5A 2GMTB 4A6LA 1P02A 2VIVA 5H4IB 2PKAB 4IS5A 1HJAB 3H5CB 2BVXH 1NPMA 1QIXB 2F9NA 4CRFA 9LPRA 1AVWA 1CA0C 1LTOA 3MH5A 3UOUA 3U9AH 3M7QA 3SU0A 1UCYH 1J9CH 4FU9A 4X6OA 8KME2 3GICB 2TIOA 2A32A 4IN2A 2AMDA 4XSKU 2V0BA 4D7GA 2ZTZA 2OCVB 7KMEH 2W7UA 3ZVFA 2CF8H 3FVFB 5ABWA 3NK8A 2FS9A 4I8KA 1HDTH 2D1JA 3MH6A 1FMGA 3BV9B 1AN1E 1XUFA 1CT0E 1O2XA 2Z9GA 1Y5AT 5FHTA 1PPCE 4M7GA 3SI3H 2WPMS 2ANWA 4MNXA 1V3XA 3AW0A 3FZZA 1ZMNA 4B71A 1RXPA 3RDZA 2I6QA 1YPEH 1P9SA 3RC5A 2ZQ2A 2Z94A 3MFJA 1ZGIA 4X1SU 1PPEE 1HJ9A 1O2SA 1QRZA 4WVPE 1L1GA 2BD7A 2GCTC 3RXKA 1CU1A 3SBKA 9ESTA 1XX9A 1LCYA 3V12A 1T8OA 1OWIA 1SGFG 1MQ6A 4X8UH 2XBXA 1UTLM 7ESTE 3U69H 4AFSA 1HRTH 2BY7X 1Y3UA 3I77A 3KEEA 3FP7E 1GDNA 1ZMLA 1TPPA 1FV9A 4AYYB 2OQ5A 1OXGA 1PPZA 4J2YB 4TY6A 3QUMP 1NN6A 1YPKH 3U8RH 1CE5A 2XC0A 4TYDA 2SGEE 2VIQA 3ZZ5A 4BAKB 1HV7A 3SV6A 3O8BA 4DW2U 1W14U 2YNAA 2ZA5A 1TBZH 1WCZA 3RMOH 1UTMA 1EPTB 2Y82A 1GBLA 2JH0D 4JK6A 3RXTA 2ZNKH 3TH3H 3IG6B 1A0JA 2BD3A 1H9IE 4ZUHA 2F9VA 1TA2A 2J95A 3A7ZA 2BDBA 3DD2H 1H9HE 4J1YA 1IQEA 2HGTH 1FONA 3RMNH 1ELAA 2FP7B 3UWJH 1GBKA 4DT7B 1S6FA 1O2LA 2XBVA 3W94A 1CBWB 4A92A 5JYIA 1O2HA 2QXHA 3A85A 4WH6A 3VEQB 4GPGA 3VGCB 4UEHH 3T25A 1C1RA 1V2WT 1P2JA 1O0DH 2KAIB 1OP8A 1NTPA 3M5MA 4FUIA 1AKSB 2A7JA 1VITG 1PQ5A 1FDPA 1HUTH 1J15A 1LVYA 4INLA 1MTNC 3PO1C 4JCNA 3SU5A 2BD2A 1T8LA 2OTVA 1C1SA 3MWIU 3HGPA 1GMHG 4VGCC 1AZ8A 1EOLA 1P3EA 2D26C 1ZHMA 2OUAA 1MZAA 3M5LA 3ATLA 1TNIA 5F03A 3HKJB 3V0XA 3E8LA 4GSOA 1O2WA 4WMDA 1O5EH 1V2TT 1MKXK 1C2LA 1YYY1 2Y5GA 1S0RA 1FQ3A 1N6YA 3WY8A 1FXYA 3A8AA 4NFEA 4D8NA 1TOCB 2G55A 2ZFQH 1O3AA 4MNWA 1C5WB 1YLCA 1OWJA 4ISHH 1AD8H 1V2ST 1ZZZA 6CHAC 1GHBF 2KAIA 3P8NA 1FZZA 1HAXB 1AKSA 1GHVH 1P2OA 2Q6FA 1S6HA 3ELAH 3MNXA 1T8MA 1WAYB 3HGNA 1O3KA 2OP9A 2J92A 4Y8XA 1D3DB 1O2NA 1EZSC 2D2DA 2P8OB 3UREA 5IDKA 1P8VC 3EA7A 5JBCS 1BTWA 2ZGHA 3KN2A 1O31A 5TCCA 4FUGA 1ANBA 1TWXB 2LPRA 4HGCA 1FIWA 2WPIS 3D62A 2OD3B 2UUYA 3LT3A 3GDUA 3GY7A 1YF4A 3MH4A 4K8BA 4ISIH 3RXHA 1D3PB 1ZLRA 1J17T 3NXPA 1DXWA 1BUIA 1MU8B 1VCQA 1CHOG 1DWDH 1O3MA 8ESTE 3F9EA 2QY0B 1C2KA 1MAXA 2BDIA 1ZJKA 4ZROA 3ZYDA 2ILNA 2GDDA 1QNJA 3TGIE 4CRGA 1GJ9B 4D7FA 4O97A 1W10U 2PTCE 1Z71A 1ZGVA 2SNWA 5E0JA 1ID5H 2J34A 3LGYA 3NCLA 1KLIH 1HAOH 5CE1A 1AUTC 1AVGH 2NWNA 2G52A 1O2UA 1JBUH 2P3TB 1O3CA 4ZAEA 3UNQA 1F0RA 1N8OB 1A1RA 1P9UA 1AE8H 1VGCB 1H9LB 4Y11E 4CBOA 1SC8U 1KDQB 2QF3A 4XBDA 1P09A 1NRQH 1C1TA 3BTHE 1QB6A 1QJ7B 3RUOA 2ZU2A 1WQVH 1YPMH 3LPRA 2FTLE 1TONA 2A31A 5SGAE 2P3FH 2J9NA 1HPGA 2B8OH 1GBEA 1GGDC 2BQ7B 4R0IA 1C5NH 3GY3A 5JBAS 2F3CE 4Y0ZE 5EODA 5B6OA 1AUJA 2FO9A 3BIUH 3PMJA 2FLRH 3LGIA 1GVKB 1HJAC 1QB1A 1OWDA 2F9BH 5C5NA 1OYQA 1G32B 1O3OA 1O2YA 1ZJDA 4ZXYH 2FMJA 3MU8A 2W7SA 1IQFA 3GY2A 1O3NA 1KDQA 3LGTA 2ANMH 3MO9A 1TNLA 1MUEB 1Y3WA 1QQ4A 2O8TA 3D65E 3PWCA 2EEKA 1G30B 1Q3XA 2BX3A 1WTGH 4CRCA 1A5GH 3S9AA 4YM9A 1P03A 1ELFA 1AVXA 1G2MA 4GUXA 1ETTH 1TGSZ 3EA9A 2M5TA 3H7OA 1ANCA 2CV3A 1ELEE 2AIPA 2H2ZA 3SNDA 1V2VT 3SU2A 4Q2KA 3SU1A 1TBRH 2OC8A 1BJVA 3O8RA 1P57B 1BTZA 1C5PA 1BIOA 1C5MD 1VCWA 3P17H 2WYJA 2DE9A 1C5OH 1GMCG 1KY9A 4XBCA 1TNKA 1PYTD 1TGNA 1MZDA 2F9UA 1UHBA 5EXMA 2VIOA 2F9OA 1GI1A 4X1PU 1RGQA 2CN0H 4CHAC 1D4PB 2XWAA 1O34A 4E05H 3I29A 4NA8A 1DVAH 4NCYA 1O3PB 1MKXH 2GP9B 1AY6H 2IJOB 4Q7ZA 1SGFA 1SOTA 2OC7A 3LOXA 1Z7KA 1FN8A 2AH4X 2A1DB 5DP6A 6ESTA 3ZZ4A 1JRTA 1EPTC 2FOAA 1ZPBA 1F92A 4FUJA 3VFEA 2AS9A 1H8IH 1RD3B 1VCPA 2TBSA 3GISB 1SGDE 2TRMA 3E3TA 1DANH 3P92A 1JOUB 1YC0A 1INCA 1HNEE 1SFIA 2UWOA 1C5LH 3ZZ3A 3NKKA 1QRXA 4K2YA 2XC5A 2C8WB 2JH6D 5BPEA 2OLGA 2AIQA 2IPHA 1SLVB 5IYTA 4YLUA 1FY5A 1ESAA 3UR9A 4X8TH 2VJ1A 3M35A 2A2XH 1CBWC 1UMAH 5HM9A 1M9UA 1ZOMA 5FCRA 5GCHF 1W3CA 3VGCC 8LPRA 2CF9H 5HGGA 1YPJH 1ARCA 4MTBA 2OINA 1GI0A 3ODDA 3M37A 4JYUH 3LJOA 1LVMA 3RXUA 1W11U 3LONA 1QB9A 2B0FA 5C1YA 1TE0A 1GJCB 1F0UA 1QBVH 1XUHA 4Z0KA 3TJUA 2GCHF 1W13U 1GHAF 5DKMA 8GCHF 2PSXA 1N6XA 1GG6B 2SNVA 4MG3A 1FUJA 3RXQA 1IQKA 1C5SA 2PUXB 4ISNA 3ZZAA 1EQ9A 1MD8A 1VJ9U 1C5RA 3KF2A 2Z3DA 1Y3VA 4INHA 4B76A 4LK4A 3LIWA 2YOLA 4UFDH 5FXLA 4CRAA 1GJAB 1KTTB 4DG4A 1FY3A 2A7CA 3SHCH 3SO3A 5C67A 1B7XB 2ZEBA 1ZTKA 1P01A 3SZNA 2H6MA 1Z8JB 1O5CB 1VZQH 3JZ1B 4ZHLU 4H42U 3SV8A 5AF9H 5JBTA 2AMPA 4RKJB 2RG3A 1K1OA 2J38A 2TGTA 2LNCA 2FOBA 2BY8X 3ESTA 1YCPK 5BRRE 1NRPH 2BDGA 2C8YB 2C93B 1CA8B 3UPEA 2BQ6B 1K1PA 3GYLB 3UQVA 4YZUA 1SOZA 1YPHC 4HI3A 1OP0A 4CREA 2ZP0H 4B1TA 2WPJS 2J4IA 1SGQE 3CS7A 1EOJA 1HGTH 4YLQH 1KXEA 2BLQA 2BZ6H 1C9PA 4K8YA 1TMBH 1FY4A 1A5HA 3Q3KA 2F9PA 1EJAA 1SGEE 2FODA 1QA0A 4TY7A 1CO7E 1ELDE 2FOMB 5HYOA 1H8DH 4Y7BA 4AFZA 2FPZA 2BMGB 1GJ5H 3A8BA 4D9QA 4I7YH 2ZWLH 2UUKB 5CHAC 4FVDA 2TGPZ 2VGCC 3GOVB 3Q77A 1HAYB 4X2XA 1MU6B 2SGPE 3R3GB 1P04A 1GI7B 5A0AE 1T4VH 1BBRE 1P05A 4XFQA 4NWKA 4HFPB 1O2RA 2QAAA 1QR3E 1C1UH 3ENSB 2QXGA 3KGPA 3PB1E 1GJ4H 2XCFA 4NA9H 3Q3YA 2P95A 3PLKA 1S5SA 1GBBA 1G3DA 4FUFA 1OWEA 1KSNA 2HNTC 1T4UH 1OWKA 1LPGB 1RFNA 3QWCH 2BQWB 1UVPA 3QX5H 2BY6X 3LH1A 4NSVA 1TMUH 1O3HA 5I25A 2H5CA 3AAUA 2IOTA 2PGBB 2ALPA 3KL6A 4XDEA 1FI8A 5I46H 1BJUA 1EUFA 2NU1E 3BEUA 4BAOB 1AU8A 4ABFA 4IW4E 3A7XA 2RA0A 4Y7AA 3GCHB 2ODPA 2O8LA 1ZYOA 3TK5A 1OS8A 2ZG0H 3ZZ6A 1KXAA 5DP3A 3TGJE 1C2IA 2UUJB 3SNCA 3TK9A 3H7TA 4ZXXH 4UFEH 2W3IA 1SLXB 1O3EA 1KXFA 1HLTH 1AWFH 1DS2E 2UUFB 3PTBA 5C20A 1MH0A 1TIOA 1XXDA 1UTPA 1FPHH 2ZGJA 1HB0B 2ZF0H 1V2QT 2R3UA 3SU6A 2ZHDA 1EATA 1QL8A 2O8WA 2XW9A 3LJJA 1V2JT 4UFGH 1MMJN 3U8TH 1HAIH 3PTNA 1XKBC 1Y3YA 2C90B 2FOGA 1Q31A 1GBCA 2AERH 1UCYE 3BTEE 1SR5C 2ZFRH 2GT7A 4AG2A 2ZDAH 1O2PA 1DWEH 1H4WA 5JB9S 2VWLA 2EI7A 2H9HA 1DUEA 2VIWA 4I33A 4WMFA 1EZUC 2A4OA 2Y7ZA 1UJ1A 2P16A 3L3TA 1P10A 3SNEA 2CJIA 3LH3A 2BD8A 1TFXA 2WPLS 1Q2WA 4BXWA 2HVXA 3RP2A 2SGAA 1ABIH 3IITA 2VVUA 3ODFA 2FOCA 1V2OT 1A5IA 4ABHA 1SSXA 2ZFPH 1YP9A 1ELGA 4KP0A 3SN8A 5DGJA 4WXIA 3ZVAA 1O2ZA 5EQRA 1LHFH 2GTBA 2VIDA 2VH6A 4ABDA 1EZXC 2PKSB 3BIVH 2VINA 4B2BA 4TPIZ 3RLYH 3ATWA 2QC2A 4X8VH 2RCEA 1EXFA 1GBDA 3S9CA 2QF0A 2JH5D 3DA9B 5GIBA 1ETRH 2R0KA 3UNRA 1GMDG 3ZVDA 1XVMA 3D23A 2BDYA 1IHSH 4GVUA 4MPVA 3GDVA 2CGAA 2BVRH 3A87A 2ZTYA 4UONA 3SV9A 2TPIZ 3SGBE 3RU4E 1P12E 1BRUP 2CXVA 2FI5E 1FAKH 4UD9H 4X1RU 1YCPH 3EGKH 2BOKA 1KXBA 5DP9A 5E2OA 2HNTE 1F5LA 1BTPA 2ZO3H 3MNSA 2I6SA 1MBQA 1L1NA 3E0NB 1E0FD 1ESTA 4AGJA 1IQIA 4X8SH 2PWXA 2QN5T 1NFXA 1O39A 4MLFB 1T7CA 1XXFA 3OTJE 3LC5A 2XBWA 2ZC9H 3I78A 1GI2A 1BQYA 4KELA 2ZCLP 4NZQA 1O30A 1FNIA 2V35A 1BA8B 3LU9B 1Z6EA 1HJ8A 1TGCA 1HAVA 3G01A 2PHBA 4D9RA 3QZRA 2P3UB 2Z9JA 2ZCKP 3AASA 1UK2A 5E8EH 4LZ4B 2BVSH 3FZDA 1NRRH 3QZQA 3UFAA 5A0BA 1NM6A 3STIA 3MOCA 3NZIA 1PQAA 1RIWC 1GG6C 4H6SB 1O38A 1PFXC 3BTQE 1OYTH 3SV2H 2FM2A 2ZFTA 3OY6U 3UUZA 1BMAA 3MU0A 4KTUA 1O36A 3GDSA 3DFJA 3E6PH 2QYIA 3JZ2B 4WY3A 4NG9H 3HK3B 2FZZA 5L30H 5EQQA 3UR6A 1GJ8B 3KQBA 3TJNA 4GCHG 3M3SA 4MPXA 1ZMJA 4JZDH 1G37A 2VVCA 1C2HA 3C27B 1C5YB 1IQJA 4CR9A 3PMAB 4GHQA 3AAVA 4AYVB 3KHVA 4K1EA 4NIWA 3LGWA 5ESBA 1KLJH 1TOMH 4ZKOU 5A8XA 1XVOA 1C2JA 2WV4A 1QGFA 2FOHA 3RXVA 5AFYH 1GI6A 1LQDB 1MTSA 3Q00A 1UTJA 4DGJA 3MO3A 2G5VA 2ZZUH 2BLOA 1OWHA 2TGAA 1BT7A 1O5FH 1ESBA 5LGOA 1THSH 2ZU4A 4OS5A 2EI8A 1RTKA 1D6RA 1FLEE 2GGVB 1AE5A 1FJSA 4OGYA 3TJOA 1AFEH 4Y79A 1LQEA 3BEFB 4Q80A 5GPIB 2CMYA 2VWOA 3SUFA 5HM2A 3BG4B 1GJDB 2C4FH 1V2KT 1EB1H 2C8ZB 4GLYA 3QDZB 2STBE 6GCHG 3O8DA 1SMFE 3E90B 1Z8IB 3RMMH 1W8BH 3RMLH 4AX9H 3RXCA 4CR5A 2IN2A 5EU8A 1B0EA 1OKXA 1GBFA 1AFQC 2Z3EA 2GT8A 4THNH 7GCHG 4LXBH 2NU0E 3A8CA 2PSYA 3SUGA 2EC9H 2BLWA 4MNVA 2SFAA 1EJNA 2ZHFH 4MDSA 3BTGE 4BTTB 1A4WH 3GY6A 3HKIB 4TWWA 2HPQH 4H4FA 1DM4B 3ATIA 2TGDA 1O5DH 1UVUH 5GWZA 4OS4A 4AORA 1TX8A 2PR3A 4X1NU 4Y8YA 1QY6A 3EE0B 4JZIA 1ELBA 3T5FH 4OGXA 2ZPSA 3IWMA 4O9VA 1HBTH 2FWWA 1VITF 3AVZA 3PM3A 2G00A 1O32A 5F8ZA 1TBQH 1V2NT 1RJXB 1Y59T 1GI5A 3A88A 1ZSJA 1WYKA 1KYNA 2VNTA 1O37A 4ABGA 1GMHF 4GHTA 3PWBA 4CH8B 1O3DA 2A0QB 3V13A 2QV1A 2GMTC 3OU0A 1AQ7A 1W0YH 2ZQ1A 2D8WA 3GYMA 3B9FH 2Q6DA 1ABJH 1SGCA 2G51A 4FUHA 1A46H 1AGJA 1ZPCA 5C1UA 1C2FA 1PPHE 3P70B 5FBIA 4I8HA 3EQ0H 4E7RG 2G8TA 3PYHA 5EG4A 3VB4A 1SGPE 3A7VA 3QTOH 3B23B 4IMQA 4MPUA 2VU8E 3MI4A 3BN9A 4WMEA 1HYLA 2ALVA 2QGRA 1ELTA 3SW2B 1SQOA 4DURA 3VB3A 2AFQB 1YLDA 2HOBA 1QA7A 1UHBB 5FPTA 1BHXF 5LPFA 3UIRA 5EXLA 2FI4E 1DLEA 1KXDA 3C1KA 1C1NA 3F1SB 1HIAB 1SPJA 3OYPA 1ZHRA 1PYTC 1TPAE 3DUXH 2XTTB 3R0FA 1WQSA 2PKSC 1TA6A 5A0CA 1K1MA 1UK4A 4ZH8A 3TH2H 1ACBE 2GCHG 1GHAG 5E0GA 1CHOF 1LO6A 4FUBA 3FANA 5F8XA 5EW2H 1L2EA 2Y5HA 4WJG2 2H1UA 4OS1A 5L2ZH 2DE8A 1KLTA 3STJA 1P2MA 1A2CH 3PLBA 4KGAA 3TNTA 1EAUA 1C4U2 1MTWA 1ZPZA 1LPKB 2FLBH 3ZZ7A 2O8UA 4AZ2B 1CGIE 1PQ7A 4YTAA 1L1JA 1GPZA 3ZZCA 1P11E 4ESTE 2ZIQH 4A1VA 2J94A 3A86A 1D3TB 3SNBA 3RXMA 1BRCE 1NU7B 3TU7H 1GBMA 1O3IA 3VB5A 1P3CA 4AGKA 1C9TA 1EP6A 1DT2A 1HIAA 1EZQA 1O2IA 2FIRH 2QCYA 2A4GA 2P93A 3U8OH 3M5OA 3MNBA 1ZHPA 3T62A 4HTCH 2PGQB 1ZRBA 4U30A 1K9OE 2WINI 4PROA 1MBMA 4ABJA 1DXPA 1TPSA 1GI3A 1TAWA 2NU2E 1W7XH 1CT4E 1ANDA 1C4V2 1SGRE 3L33A 3M7UA 3RXBA 2BDHA 2GCTB 4BTUB 1A3EH 3PLPA 4WH8A 3A7TA 4DCDA 2H9TH 1HAGE 1QBOA 1TRMA 1Z8RA 5AHGH 4CRDA 3ZZ8A 1SL3A 2BY9X 4K5ZA 2CHAB 4MVNA 2F83A 5FCKA 4X2VA 1W12U 3M3TA 2XYAA 2BZAA 2VH0A 2ZDKA 1O2KA 3GCTG 1NY22 1QRWA 4KTSA 2WYGA 1E34B 1QTFA 1J8AA 2XRCA 3U1JB 1YKTA 4Q7YA 1IQMA 4FVBA 3TNSA 1BOQA 2BLVA 3SJKA 1C1MA 1TQ0B 1BITA 1P2IA 5K0HA 3T27A 4ZKRU 4O3TA 4X1QU 2WPKS 1BMNH 1EAWA 1V6DA 2FS8A 3ZVEA 1CVWH 2W5EA 3BTKE 4F4OC 2XCNA 2ZDNA 3BSQA 1BB0B 1GBIA 1U6QA 3F9GA 1O5AB 4DOQA 2BXUH 3Q3XA 3SJOA 1NS3A 5A8YA 1BTHH 3ZVBA 5DG6A 4DJZB 2PW8H 1BHXB 4FUCA 3A89A 3PMHB 1ZTLA 1TQ7B 3SJ8A 5A8ZA 1NRSH 2A2QH 3UOPA 2ZHQH 3F68H 5DO4H 1K1JA 2OBOA 3MMGA 1PPBH 2P8OC 4B74A 2OC0A 1GMCF 1O3FA 1MTNB 4WWYA 3BG4C 2JKHA 3PO1B 1O3LA 1GHWH 5E0HA 1TPOA 2V6NA 4AFUA 1J14A 2XBYA 4VGCB 4A5TS 3SU3A 1LVOA 1TX7A 1UO6A 2GX4A 2ZGCA 1XUJA 3K6ZA 1WTHD 1AMHA 4DIHH 1S0QA 1FPCH 3CENA 4E7NA 1DSTA 2THFB 1Y5BT 3P8GA 2XNIA 2OBQA 2A45B 2BD9A 6CHAB 2OQUA 4A1XA 1MTVA 1J16A 3P6ZB 2PV9B 2BB4A 3GY5A 1TABE 3S69A 1BRBE 2A5IA 1CGHA 3QO6A 4XOJA 1BMLA 3P95A 3A82A 1A61H 3NWUA 4NA7A 1C5QA 1N1LA 3NPSA 1IQNA 2QXJA 1G36A 5K7RA 1N8OC 1VGCC 2AGEX 4ZHMU 3RXRA 1NC6A 2HPPH 2AGGX 1QBNA 4AFQA 1CQQA 1GI9B 5EXNA 2FYRA 2ZFSA 4Y71A 4XBBA 4BANB 1SLUB 1FN6A 1JMOH 3S7HB 1Z8GA 1WSSH 4UDWH 4X6PA 1O5BB 1SFQB 1SB1H 1QHRB 1UVOA 1SGNE 2ZPRA 1V2MT 4NIYA 1EKBB 4BAHB 5J4SA 1AWHB 1UTNA 2HALA 1SGYE 2ZDMA 3E0PB 3GCNA 3TVJB 1UVTH 3K2UA 1BCUH 4YOIA 1GI8B 2Y7XA 1QFKH 3TIUA 1K1NA 3RXPA 2GV6A 4A7IB 1SI5H 3TGKE 2DUCA 3T2NA 1FAXA 3QLPH 2XC4A 3MU5A 3FAOA 3E16B 2Y81A 2WUCA 3RXSA 2AEIH 4B2CA 1TGBA 1OPHB 2ANKH 1K1LA 1GGDB 2J2UA 1IAUA 1NT1A 1NZQH 4AB9A 7LPRA 1SLWB 1YPHE 1THPB 1O2GH 3UNSA 2OC1A 5HXFA 1GVLA 2ZU5A 4INKA 1ELCA 1O2QA 2FTMA 2FX4A 2VIPA 1BMMH 4YESB 1X7AC 3V7TA 3RXJA 2A5AA 1DFPA 2ODYB 1ZSLA 5DP4A 3VXFH 3DT0H 4KTCA 4FU8A 5T6FA 2Z3CA 4U01A 2R9PA 3K65B 4RKOB 3K9XB 1V2LT 3QN7A 2ZKSA 4B73A 4NSYA 3SUDA 4I8JA 1HXEH 3RXDA 1NRNH 4BOHA 4ABAA 2BOHB 2B9LA 2ZDVH 3N7OA 5JBBS 1S85A 2BD5A 2HWLB 1F0TA 1CSOE 2NU3E 4NFFA 4K69A 3RXFA 4OS6A 5FPYA 1FIZA 2PKAA 2QIQA 1HAVB 1XMNB 1CHGA 1C5ZB 1SQAA 2ZECA 3DHKH 4ZHAA 4MNYA 1LKAA 1JIMA 1GHBG 3RC6A 3EDXB 1GJ6A 1O2VA 2RDLA 4A1TA 4CH2B 4X0WU 5JPMH 1ZR0A 1LMWB 1LHDH 1HAHH 4E06H 4JMYA 5C2ZA 1BDAA 5EW1H 1GL1A 4I8GA 3HK6B 3OX7U 1O5GH 2BY5X 1Z1JA 2CHAC 2P59A 1O2OA 3MO6A 3KQEA 3GCOA 1GDQA 2K1QA 4CHAB 1O3JA 1DITH 4Q7XA 2ZCHP 1K21H 1T31A 5JB8S 1D3QB 3UQOA 1LHEH 4IMZA 4I31A 1GI4A 1S82A 5EGMA 1K22H 2PFEA 3MTYA 3Q76A 1CT2E 2GZ8A 3S7KB 5LPRA 4AN7A 2O8MA 2FEQH 1MQ5A 2FOFA 1V2RT 4U32A 3BTTE 4JYVH 4ZKNU 2BTCE 2HNTF 4IC6A 1E35B 5GJ4B 3MH7A 1AIXH 1JWTA 5DP8A 3QGJA 3W95A 1DE7H 1F5KU 2ESTE 1OOKB 3ZYEA 1D9IA 1GCTB 3TK6A 1LDTT 3A7YA 3MU1A 3S0NA 1L4ZA 1DLKB 5DJ7A 4I8LA 3TITA
chains in the Genus database with same CATH superfamily
4BXSA 4HZHA 1HAZB 4JYTA 1UTKA 4K60A 1O3BA 1C5TA 1EAXA 3ZVCA 1EPTA 2ZPQA 1QURH 4YT6H 1V2PT 5L2YH 1RTFB 2BYAX 2O9QA 2Z6BD 4FUDA 2W6ID 1QCPA 2WV9A 1C2GA 5DK1A 1HCGA 1MCTA 1O2JA 4XRNA 1GMDF 1JIRA 3L6PA 2Y5FA 3M5NA 4OS7A 1PQ8A 4H6TA 2KCYA 3A84A 1TLDA 3A80A 3SGQE 1AZZA 3SI4H 4X2YA 4D76A 1C5XB 2KM0A 3D49H 2ZI2H 3SNAA 5HKKD 2VWNA 3VPKA 4NWLA 1ZRKA 3PV2A 2STAE 1TNGA 1K2I1 1Y8TA 2XXLA 1DWCH 1NFYA 1JXPA 1QL9A 1A0LA 1EJMA 1EAIA 3SUEA 4DVAU 1BRAA 2B7DH 1DWBH 1G3CA 1KTSB 2GVFA 3URCA 1MAYA 3PRBA 4B75A 1C5UA 3V3MA 5EPYA 1ELVA 1P2KA 3E91A 1GL0E 1IHTH 2AGIX 2GV7A 1CGJE 3TLOA 2NU4E 4ACAA 1GHYH 1ANEA 1VITH 5F8TA 1W2KH 3RXLA 1ARBA 1L0ZA 2HLCA 2CK3D 1GHXH 1LKBA 4F49A 5CHAB 2VWMA 2VGCB 4Z6AH 5FPSA 1HFDA 3KIDU 4I32A 3URDA 3ZV8A 1QL7A 2H9EH 4ZKSU 1GBJA 2KR7A 1TX6A 3F6UH 4HG6A 2Q6GA 1AB9B 4TPYA 3GCHC 3A83A 4IBLH 1DOJA 3LC3A 1UTQA 1DX5M 1QJ1B 4GCHF 3MHWU 1Y5UT 2BXTH 3MQKC 2Y6TA 2SGFE 3P8FA 3ATMA 2Z7FE 3KCGH 5C5OA 2G81E 3TJVA 2FESH 1O3GA 2R2WU 3DSGA 3ZV9A 1ETSH 5L6NH 1VKYA 1YBWA 1TRNA 2W3KA 4YO9A 1W7GH 5EQSA 2WV5A 4KKDA 2B5TB 1MKWK 1TALA 1E1QD 4DY7B 1LHGH 2ZDLA 2JETB 4LOYH 3BEIB 1YPGH 4I86A 2GKVE 2SGDE 4JZEH 4ASHA 3M7TA 3ZZBA 3A81A 5T3HA 3CS0A 1C2EA 1WUNH 4Y76A 1O2MA 3OSYA 1IQHA 5C3NA 2YNBA 5HMAA 3ZZ9A 1AHTH 1Y3XA 5A2MH 4ABEA 1G9IE 5GCHG 1AI8H 3PROA 1TMTH 1IQLA 2AMQA 1RTLA 2A7HA 3A7WA 1PJPA 5HIZA 1B0FA 1YCPM 4QT8C 1GBAA 3SYJA 1YM0A 1W0ZU 6GCHF 1UW7A 5A09A 1DPOA 2ZU3A 4MPWA 4RN6A 4K1TA 3RC4A 1GBTA 2FX6A 2YMSD 1OP2A 1NO9H 4BAMB 5C0UA 3QTVH 1DY8A 4ISLA 1BBRK 3ITIA 5DPAA 3PV4A 2P94A 1B5GH 7GCHF 3S9BA 1BZXE 8GCHG 4IC5A 2ZTXA 5ESTE 4RI0A 1NESE 1T32A 3GY4A 1UTOA 1FY1A 3UY9A 2R2MB 1F0SA 1CA0B 4K3JA 4ZMAH 1TNHA 1GCDA 2OXSA 1S81A 1P0SH 1ZTJA 5T6GA 5LH8A 1QJ6B 2XWBI 5PTPA 4JZ1A 3RXGA 5FX5A 3SQEE 4SGAE 1IQGA 3F9FA 2Q1JA 2BDCA 1SGTA 4TWYA 2FDAA 1GHZA 3RM2H 5DSFA 3NUMA 5IK2D 5DP7A 3SORA 1UK3A 1SHYA 2HRVA 5AVDA 1A3BH 2Z9IA 4OS2A 5TJXA 3SGAE 3SJIA 4ISOA 5F6MA 4X2WA 5EOKA 2ZU1A 5T6DA 5FAHA 4Y6DA 5GXPA 1E36B 4LZ1H 1ORFA 3RXEA 3ATKA 2BDAA 3RXOA 4U2WA 2V3HH 4YOGA 1C5VA 2PLXA 1QQUA 3SHAH 1HAPH 1K1IA 1SQTA 1C1VH 5CMXH 3EA8A 4WF8A 4NZLA 1MCVA 1F5RA 4BNRA 2W26A 1Z6JH 2V3OH 3SV7A 1DUAA 1LPZB 5ETXA 4IGDA 1GBHA 3LKWA 1TYNA 4FU7A 4K1SA 5EPNA 2PTNA 2PUQH 2UWPA 2R0LA 3O8CA 5C94A 2BHGA 3BTME 1NFWA 2ANYA 3SJ9A 1L4DA 4X6MA 4GAWA 4BAQB 1WU1A 1P2NA 2ODQA 1LVBA 1UCYK 1C2MA 4MQAA 2GZ7A 3KQDA 3M36A 5DP5A 1MD7A 2ZGBH 3SU4A 1GCTC 6LPRA 5GDSH 3VB7A 3FFGA 3U1IB 1DDJA 1DY9A 2GDEH 1PPFE 3PMBB 4AOQA 4XE4A 4JZFH 2HLDD 1EX3A 3KNXA 5KEDA 3M3VA 2SGQE 3QGNB 2A4RA 3RLWH 3OAAD 1LHCH 3BTDE 2ZGXH 3MYWA 2QXIA 4BTIB 1WOFA 2QA9E 2F91A 5E2PA 4O03A 5LPEA 1E37B 4Y10E 3LGVA 1RIWB 3A8DA 1G2LA 2R3YA 2FYQA 2WPHS 3QK1A 1Z1IA 3LDXH 5G4BA 3SQHE 3T29A 3UTUH 1JRSA 1V2UT 4O3UA 1XUKA 4IN1A 3AW1A 1G3BA 3EAJA 2Z9KA 3RM0H 3T26A 1YPLH 3VXEH 2KFWA 1GDUA 1NU9A 1WBGB 2VB0A 4Y8ZA 1O2TA 1HXFH 1TB6H 1BTUA 1RS0A 4CRBA 2H5DA 1C4Y2 2ASUB 1TGTA 3F9HA 1A0HB 4NIVA 5AFZH 1MKWH 2RA3A 5FBEA 1C1QA 1DSUA 4NGAH 4ABIA 3M61U 1GVZA 3P8OA 2UWLA 3ZZDA 2G5NA 2BD4A 1TNJA 3WW7A 1NROH 1F2SE 3HATH 4YT7H 2G4UA 1SGIB 3BTWE 3FP6E 4NIXA 2C3SA 4UFFH 4CBNA 2BX4A 5C1XA 3UAIC 3RXIA 2BM2A 1EB2A 3SOSA 3B8JA 4FXGH 4RSPA 1FY8E 2WSSD 4DIIH 2G4TA 1GWAA 1YY3A 1RRKA 1EASA 1O35A 1S84A 3FP8E 3GY8A 2FXRA 1K28D 2VVVA 1YGCH 1AB9C 1SBWA 2WUBA 4SGBE 5J4QA 1GJ7B 2ZHEH 3HPTB 3KQ5A 3GCTF 1BBRH 5FX6A 3BTFE 3E1XB 3MU4A 5TCAA 4WXVA 4ASUD 4B2AA 3EYDA 1AFQB 3BF6H 2GZ9A 1TRYA 4X6NA 1E38B 1O33A 1KXCA 2C8XB 1P2QA 3KYFA 1XM1A 3LGUA 3MNCA 3TPIZ 1XUIA 1GJBB 1A7SA 3RU4T 4JK5A 1F7ZA 2ZFFH 3RXAA 2LELA 3KQCA 1SG8B 4Y0YE 1SHHB 3UWIA 2AYWA 1DICA 1NFUA 3BG8A 4ABBA 1C1PA 1PPGE 1G3EA 3VB6A 1OSSA 1XUGA 1SVPA 3K6YA 4P00A 2FI3E 2EI6A 1VR1H 2JETC 3OY5U 2FOEA 1XKAC 1S83A 1EP5A 1BTXA 2Z9LA 4YOJA 1UVSH 3RU4D 2Y80A 1VJAU 4FOUC 3T28A 1C2DA 1P06A 3DFLA 1WV7H 2EA3A 1ZSKA 3CP7A 4AB8A 2GD4B 3U98H 1D6WA 1OX1A 1T8NA 3ZVGA 1BTYA 1IOEA 1C1WH 1THRH 1MTUA 4UE7H 2A5KA 2ZHWH 1H1BA 4FUEA 5JDUB 1C1OA 1KIGH 3TH4H 2ULLA 2A4QA 4R8TB 4AG1A 1AO5A 2GMTB 3CNRA 4A6LA 2YMSB 1P02A 2VIVA 2J98B 5H4IB 2PKAB 4IS5A 1HJAB 3H5CB 2BVXH 1NPMA 1QIXB 2F9NA 1BMFD 4CRFA 9LPRA 1AVWA 1CA0C 2JJ2D 4B6FA 1LTOA 3MH5A 3UOUA 3U9AH 3M7QA 3SU0A 1UCYH 1J9CH 4FU9A 4X6OA 8KME2 3GICB 2TIOA 2A32A 4IN2A 2AMDA 4XSKU 2V0BA 4D7GA 2ZTZA 2OCVB 4YXWD 7KMEH 2W7UA 3ZVFA 2CF8H 3FVFB 5ABWA 3NK8A 2FS9A 1WDIA 4I8KA 1HDTH 2D1JA 3MH6A 1FMGA 3PV5A 3BV9B 1AN1E 1XUFA 1CT0E 1O2XA 2Z9GA 1Y5AT 3F3BA 5FHTA 1PPCE 4M7GA 3SI3H 2WPMS 2ANWA 4MNXA 2J98A 1V3XA 3AW0A 3FZZA 1ZMNA 4B71A 1RXPA 3RDZA 2I6QA 1YPEH 1P9SA 3RC5A 2ZQ2A 2Z94A 3MFJA 1ZGIA 4X1SU 1PPEE 1HJ9A 2WPDD 1O2SA 1QRZA 4WVPE 1L1GA 2BD7A 2GCTC 3RXKA 1CU1A 3SBKA 9ESTA 1XX9A 1LCYA 4Q63A 3V12A 1T8OA 1OWIA 1SGFG 1MQ6A 3FOAA 2XBXA 4X8UH 1UTLM 7ESTE 3U69H 4AFSA 1HRTH 2BY7X 1Y3UA 3I77A 3KEEA 3FP7E 1GDNA 1ZMLA 1TPPA 1FV9A 4AYYB 2OQ5A 1OXGA 1PPZA 4J2YB 4TY6A 3QUMP 4TSFD 1NN6A 1YPKH 2EY4C 3U8RH 1CE5A 2XC0A 4TYDA 2SGEE 2VIQA 3ZZ5A 4BAKB 1HV7A 2GJGA 3SV6A 3O8BA 4DW2U 1W14U 2YNAA 2ZA5A 1TBZH 1WCZA 3RMOH 3N99A 1UTMA 5EJLA 1EPTB 2Y82A 1GBLA 2JH0D 4JK6A 3RXTA 2KZ4A 1NBME 2ZNKH 3TH3H 3IG6B 1A0JA 1OHHD 2V3MA 2BD3A 1H9IE 4ZUHA 2F9VA 1TA2A 2J95A 3A7ZA 2BDBA 3DD2H 1H9HE 4J1YA 1IQEA 2HGTH 1FONA 3RMNH 1ELAA 2FP7B 3UWJH 1GBKA 4DT7B 1S6FA 1O2LA 2XBVA 3W94A 1CBWB 4A92A 5JYIA 1O2HA 2QXHA 3A85A 4WH6A 3VEQB 4GPGA 3VGCB 4UEHH 3T25A 1C1RA 1V2WT 1P2JA 1O0DH 2KAIB 1OP8A 1NTPA 3M5MA 4FUIA 5CDFE 1AKSB 2A7JA 1VITG 1PQ5A 1FDPA 1HUTH 1J15A 1LVYA 4INLA 1MTNC 3PO1C 4JCNA 3SU5A 2BD2A 1T8LA 2OTVA 1C1SA 3MWIU 3HGPA 1GMHG 4VGCC 1AZ8A 1EOLA 1P3EA 2D26C 1ZHMA 2OUAA 1MZAA 3M5LA 3ATLA 1TNIA 5F03A 3HKJB 3V0XA 3E8LA 4GSOA 1O2WA 4WMDA 1O5EH 1V2TT 1MKXK 1C2LA 1YYY1 2Y5GA 1S0RA 1FQ3A 1N6YA 3WY8A 1FXYA 3A8AA 4NFEA 4D8NA 1TOCB 2G55A 2ZFQH 1O3AA 4MNWA 1C5WB 1YLCA 1OWJA 4ISHH 1AD8H 1V2ST 1ZZZA 6CHAC 1GHBF 2KAIA 3P8NA 1FZZA 1HAXB 1AKSA 1GHVH 1P2OA 2Q6FA 1S6HA 3ELAH 3MNXA 1T8MA 1WAYB 3HGNA 1O3KA 2OP9A 2J92A 4Y8XA 1D3DB 1O2NA 1EZSC 2D2DA 2P8OB 3UREA 5IDKA 1P8VC 4F55A 3EA7A 5JBCS 1BTWA 2ZGHA 3KN2A 1O31A 1K0HA 5TCCA 4FUGA 1ANBA 1TWXB 2LPRA 4HGCA 1FIWA 2WPIS 3D62A 2OD3B 2UUYA 3FO8D 3GDUA 3GY7A 1YF4A 3LT3A 3MH4A 4ISIH 4K8BA 3RXHA 1D3PB 1ZLRA 1J17T 3NXPA 1DXWA 1BUIA 1H8HD 1MU8B 2L74A 1VCQA 1CHOG 1DWDH 1O3MA 8ESTE 3F9EA 2QY0B 1C2KA 1MAXA 2BDIA 1ZJKA 4ZROA 3ZYDA 2ILNA 2OK5A 2GDDA 1QNJA 3TGIE 4CRGA 1GJ9B 4D7FA 4O97A 1W10U 2PTCE 1Z71A 1ZGVA 2SNWA 5E0JA 1ID5H 2J34A 3LGYA 3NCLA 1KLIH 1HAOH 5CE1A 1AUTC 1AVGH 2NWNA 2G52A 1O2UA 2RFKC 1JBUH 2P3TB 1O3CA 4ZAEA 3UNQA 2K8IA 1F0RA 1N8OB 1A1RA 1P9UA 3DCLA 1AE8H 1VGCB 1H9LB 4Y11E 4CBOA 1SC8U 1KDQB 2QF3A 4XBDA 1P09A 1NRQH 1C1TA 3BTHE 1QB6A 1QJ7B 3RUOA 2ZU2A 1WQVH 1YPMH 2KCAA 3LPRA 2FTLE 1TONA 2A31A 5SGAE 4M9FA 2P3FH 2J9NA 1HPGA 2B8OH 1GBEA 1GGDC 2BQ7B 4R0IA 1C5NH 3GY3A 5JBAS 2F3CE 4Y0ZE 5EODA 2YMSC 5B6OA 1AUJA 2FO9A 3BIUH 3PMJA 2FLRH 3LGIA 1GVKB 1HJAC 1QB1A 1OWDA 2F9BH 5C5NA 1OYQA 1G32B 1O3OA 1O2YA 1ZJDA 4ZXYH 2FMJA 3MU8A 2W7SA 1IQFA 3GY2A 1O3NA 1KDQA 3LGTA 2ANMH 2AHME 3MO9A 1TNLA 1MUEB 1Y3WA 1QQ4A 2O8TA 3D65E 3PWCA 2EEKA 2L6OA 1G30B 1Q3XA 2BX3A 1WTGH 4CRCA 1A5GH 3S9AA 4YM9A 1P03A 1ELFA 1YLNA 1AVXA 1G2MA 4GUXA 1ETTH 1TGSZ 3EA9A 2M5TA 3H7OA 1ANCA 2CV3A 1ELEE 2AIPA 2H2ZA 3SNDA 1V2VT 2J5UA 3SU2A 4Q2KA 3SU1A 1TBRH 2OC8A 1BJVA 3O8RA 1P57B 1BTZA 1C5PA 1BIOA 1C5MD 1VCWA 3P17H 2WYJA 2DE9A 1C5OH 1GMCG 1KY9A 4XBCA 2WZQA 1TNKA 1PYTD 1TGNA 1MZDA 2F9UA 1UHBA 5EXMA 2VIOA 2F9OA 1GI1A 4X1PU 1RGQA 2CN0H 4CHAC 1D4PB 2XWAA 1O34A 4E05H 3I29A 4NA8A 1DVAH 4NCYA 1O3PB 1MKXH 2GP9B 1AY6H 2IJOB 4Q7ZA 1SGFA 1SOTA 2OC7A 3LOXA 1Z7KA 1FN8A 2AH4X 2A1DB 5DP6A 3GS9A 6ESTA 3OFND 3ZZ4A 1JRTA 2LP6A 1EPTC 2FOAA 1ZPBA 1F92A 4FUJA 3VFEA 2AS9A 1H8IH 1RD3B 1VCPA 2TBSA 3GISB 1SGDE 2TRMA 3E3TA 1DANH 3P92A 1JOUB 1YC0A 1INCA 1HNEE 1SFIA 2UWOA 1C5LH 3ZZ3A 3NKKA 1QRXA 4K2YA 2XC5A 2C8WB 2JH6D 2KX4A 5BPEA 2OLGA 2AIQA 2IPHA 1SLVB 5IYTA 4YLUA 3F0PA 1FY5A 1ESAA 3UR9A 4X8TH 2VJ1A 3M35A 2A2XH 1CBWC 1UMAH 5HM9A 1SQRA 1M9UA 1ZOMA 5FCRA 3NRLA 1W3CA 5GCHF 3VGCC 8LPRA 2CF9H 5HGGA 5C17A 1YPJH 1ARCA 4MTBA 2OINA 1GI0A 3ODDA 3M37A 4JYUH 3LJOA 1LVMA 3RXUA 1W11U 3LONA 1QB9A 2B0FA 5C1YA 1TE0A 1GJCB 1F0UA 1QBVH 1XUHA 3H09A 4Z0KA 3TJUA 2GCHF 1W13U 1GHAF 5DKMA 8GCHF 2PSXA 1N6XA 5KGOA 1GG6B 2SNVA 4MG3A 1FUJA 3RXQA 1IQKA 1C5SA 2PUXB 4ISNA 4TT3D 3ZZAA 1EQ9A 1MD8A 1VJ9U 1C5RA 3KF2A 1SKYE 2Z3DA 1Y3VA 2PP6A 4INHA 4B76A 4LK4A 3LIWA 2YOLA 4UFDH 5FXLA 4CRAA 1GJAB 1KTTB 2VBCA 4DG4A 1FY3A 2A7CA 3SHCH 3SO3A 5C67A 1B7XB 2ZEBA 2IPQX 1ZTKA 1P01A 3SZNA 2H6MA 1Z8JB 1O5CB 1VZQH 3JZ1B 4ZHLU 4H42U 3SV8A 5AF9H 5JBTA 2AMPA 4RKJB 2RG3A 1K1OA 2J38A 2TGTA 2LNCA 2FOBA 2BY8X 3ESTA 1YCPK 5BRRE 1NRPH 2BDGA 2C8YB 2C93B 1CA8B 3UPEA 2BQ6B 1K1PA 3GYLB 3UQVA 4YZUA 1SOZA 1YPHC 3UB0A 4HI3A 1OP0A 2J97A 4CREA 2ZP0H 4B1TA 2WPJS 2J4IA 1SGQE 3CS7A 1EOJA 1HGTH 4YLQH 1KXEA 2BLQA 2BZ6H 1C9PA 4K8YA 1TMBH 1FY4A 1A5HA 3Q3KA 2F9PA 1EJAA 1SGEE 2FODA 1QA0A 4TY7A 1CO7E 1ELDE 2FOMB 3OE7D 5HYOA 1COWD 1H8DH 4Y7BA 4AFZA 2FPZA 2BMGB 1GJ5H 3A8BA 4D9QA 4I7YH 2ZWLH 2UUKB 4RT1A 5CHAC 4FVDA 2TGPZ 2VGCC 3GOVB 3Q77A 1HAYB 4X2XA 1MU6B 2SGPE 3R3GB 1P04A 2XOKD 1GI7B 5A0AE 1T4VH 1BBRE 1P05A 4XFQA 4NWKA 4HFPB 1O2RA 2QAAA 1QR3E 1C1UH 3ENSB 2QXGA 3KGPA 3PB1E 1GJ4H 2XCFA 4NA9H 3Q3YA 2P95A 3PLKA 1S5SA 1GBBA 1G3DA 3OEHD 4FUFA 1OWEA 1KSNA 2HNTC 1T4UH 1OWKA 1LPGB 1RFNA 3QWCH 2BQWB 1UVPA 3QX5H 2BY6X 3LH1A 4NSVA 1TMUH 1O3HA 5I25A 2KCOA 2H5CA 3AAUA 2IOTA 2PGBB 2ALPA 3KL6A 4XDEA 1FI8A 5I46H 1BJUA 1EUFA 2NU1E 3BEUA 4BAOB 1AU8A 4ABFA 4IW4E 3A7XA 2RA0A 4Y7AA 3GCHB 3SZEA 4F48B 2ODPA 2O8LA 1ZYOA 3TK5A 1OS8A 2ZG0H 3ZZ6A 1KXAA 5DP3A 3TGJE 1C2IA 2UUJB 3SNCA 3TK9A 3H7TA 4ZXXH 4UFEH 2W3IA 5GNDA 1SLXB 1O3EA 1KXFA 1HLTH 1AWFH 1DS2E 2UUFB 3PTBA 5C20A 1MH0A 1TIOA 1XXDA 1UTPA 1FPHH 2ZGJA 1HB0B 2ZF0H 1V2QT 2R3UA 4B6EA 3SU6A 2ZHDA 1EATA 1QL8A 3F2GA 2O8WA 2XW9A 3LJJA 1V2JT 4UFGH 1MMJN 3U8TH 2WHXA 3WWBA 1HAIH 5DN6D 3PTNA 1XKBC 1Y3YA 2C90B 2FOGA 1Q31A 1GBCA 2AERH 1UCYE 3BTEE 1SR5C 2ZFRH 2GT7A 4AG2A 2ZDAH 1O2PA 1DWEH 1H4WA 5JB9S 2VWLA 2EI7A 2H9HA 1DUEA 2VIWA 4I33A 4WMFA 1EZUC 2A4OA 2Y7ZA 1UJ1A 2P16A 3L3TA 3DSPA 1P10A 3SNEA 2CJIA 3LH3A 2BD8A 1TFXA 2F43B 2V7QD 2WPLS 1Q2WA 4BXWA 2HVXA 3RP2A 2SGAA 1ABIH 3IITA 2VVUA 3ODFA 2FOCA 1V2OT 1A5IA 4ABHA 1SSXA 2ZFPH 1YP9A 1ELGA 4KP0A 3SN8A 5DGJA 4WXIA 3ZVAA 1O2ZA 5EQRA 1LHFH 2GTBA 2VIDA 2JIZD 2VH6A 4ABDA 1EZXC 2PKSB 3BIVH 2VINA 4B2BA 4TPIZ 3RLYH 3ATWA 2QC2A 4X8VH 2RCEA 1EXFA 1GBDA 3S9CA 2QF0A 2JH5D 3DA9B 5GIBA 1ETRH 2R0KA 3UNRA 1GMDG 3ZVDA 1XVMA 3D23A 2BDYA 1IHSH 4GVUA 4MPVA 3GDVA 2CGAA 2BVRH 3A87A 2ZTYA 4UONA 3SV9A 2TPIZ 3SGBE 3FN8A 3RU4E 1P12E 1BRUP 2CXVA 2FI5E 1FAKH 4UD9H 4X1RU 1YCPH 3EGKH 2BOKA 1KXBA 5DP9A 5E2OA 2HNTE 1F5LA 1BTPA 2ZO3H 3MNSA 2I6SA 3ZIAD 1MBQA 1L1NA 3E0NB 1E0FD 1ESTA 4AGJA 1IQIA 4X8SH 2PWXA 2QN5T 1NFXA 1O39A 4MLFB 1T7CA 1XXFA 3OTJE 3LC5A 2XBWA 2ZC9H 3I78A 1GI2A 1BQYA 4KELA 2ZCLP 4NZQA 1O30A 1FNIA 2V35A 1BA8B 3LU9B 1Z6EA 1HJ8A 1TGCA 1HAVA 3G01A 2IJD1 2PHBA 4D9RA 3QZRA 2P3UB 2Z9JA 2ZCKP 3AASA 1UK2A 5E8EH 4LZ4B 2QF5A 2BVSH 3FZDA 1NRRH 3QZQA 3UFAA 5A0BA 1NM6A 3STIA 3MOCA 3NZIA 1PQAA 1RIWC 5EIYA 1GG6C 4H6SB 1O38A 1PFXC 3BTQE 1OYTH 3SV2H 2FM2A 2ZFTA 3OY6U 3UUZA 1BMAA 3MU0A 4KTUA 1O36A 3GDSA 3DFJA 3E6PH 2QYIA 3JZ2B 4WY3A 4NG9H 3HK3B 2FZZA 5L30H 5EQQA 3UR6A 4DT4A 1GJ8B 3KQBA 3TJNA 4GCHG 3M3SA 4MPXA 1ZMJA 4JZDH 1G37A 2VVCA 1C2HA 3C27B 4RT0A 1C5YB 1IQJA 4CR9A 3PMAB 4GHQA 3AAVA 4AYVB 3KHVA 4K1EA 4NIWA 3LGWA 5ESBA 1KLJH 1TOMH 4ZKOU 5A8XA 1XVOA 1C2JA 2WV4A 4FETA 1QGFA 2FOHA 3RXVA 5AFYH 1GI6A 1LQDB 1MTSA 3Q00A 1UTJA 4DGJA 3MO3A 2G5VA 2ZZUH 2BLOA 3N7DA 3U28C 1OWHA 4Q4LA 2TGAA 1BT7A 1O5FH 1ESBA 5LGOA 1THSH 2ZU4A 4OS5A 2EI8A 1RTKA 1D6RA 1FLEE 2GGVB 1AE5A 1FJSA 4OGYA 3TJOA 1AFEH 4Y79A 1LQEA 3BEFB 4Q80A 5GPIB 2CMYA 2VWOA 3SUFA 5HM2A 3BG4B 1GJDB 2C4FH 1V2KT 1EB1H 2C8ZB 4GLYA 3QDZB 2STBE 6GCHG 3O8DA 1SMFE 3E90B 1S6LA 1Z8IB 3RMMH 1W8BH 3RMLH 4AX9H 3RXCA 4CR5A 2IN2A 5EU8A 1B0EA 1OKXA 1GBFA 1AFQC 2Z3EA 2GT8A 4THNH 7GCHG 4LXBH 2NU0E 2QF4A 3A8CA 1W0JD 2PSYA 3SUGA 3F2HA 3VG8A 2EC9H 2BLWA 4AC9A 4MNVA 2SFAA 1EJNA 2ZHFH 4MDSA 3BTGE 4BTTB 1A4WH 3GY6A 3HKIB 4TWWA 4OM9A 2HPQH 4H4FA 1DM4B 3ATIA 2TGDA 1O5DH 2RDEA 1UVUH 5GWZA 4OS4A 4AORA 1TX8A 2PR3A 4X1NU 4Y8YA 2M2AA 1QY6A 3EE0B 4JZIA 1ELBA 3WWFA 3T5FH 4OGXA 2ZPSA 3IWMA 4O9VA 1HBTH 2FWWA 1VITF 3AVZA 3PM3A 2G00A 1O32A 5F8ZA 1TBQH 1EFRD 1V2NT 1RJXB 1Y59T 1GI5A 3A88A 1ZSJA 1WYKA 1KYNA 2VNTA 1O37A 4ABGA 1GMHF 4GHTA 3PWBA 4CH8B 1O3DA 2A0QB 3V13A 2QV1A 2GMTC 3OU0A 1AQ7A 1QZ8A 1W0YH 2ZQ1A 2D8WA 3GYMA 3B9FH 2Q6DA 1ABJH 1SGCA 2G51A 4FUHA 1A46H 1AGJA 1WXRA 1ZPCA 5C1UA 1C2FA 1PPHE 3P70B 5FBIA 4I8HA 3EQ0H 4E7RG 2G8TA 3PYHA 5EG4A 3VB4A 1SGPE 3A7VA 3QTOH 3B23B 4IMQA 4MPUA 2VU8E 3MI4A 3BN9A 4WMEA 1HYLA 2ALVA 2QGRA 1ELTA 3SW2B 1SQOA 4DURA 3VB3A 2AFQB 1YLDA 2HOBA 1QA7A 1UHBB 5FPTA 1BHXF 5LPFA 3UIRA 5EXLA 2FI4E 1DLEA 1KXDA 3C1KA 1C1NA 3F1SB 1HIAB 1SPJA 3OYPA 1ZHRA 1PYTC 1TPAE 3DUXH 2XTTB 3R0FA 1WQSA 2PKSC 1TA6A 1E79D 1K1MA 1UK4A 4ZH8A 3TH2H 5A0CA 1ACBE 2GCHG 1GHAG 5E0GA 1CHOF 1LO6A 4FUBA 3FANA 1MABB 3DSOA 5F8XA 5EW2H 2HVYB 1L2EA 2Y5HA 4WJG2 2H1UA 4OS1A 5L2ZH 2DE8A 1KLTA 3STJA 1P2MA 1A2CH 3PLBA 4KGAA 3TNTA 1EAUA 1C4U2 1MTWA 1ZPZA 1LPKB 2FLBH 3ZZ7A 2O8UA 4AZ2B 1CGIE 1PQ7A 4YTAA 5C0TA 1L1JA 1GPZA 3ZZCA 1P11E 4ESTE 2ZIQH 4A1VA 2J94A 4ACBA 3A86A 1D3TB 3SNBA 3RXMA 1BRCE 1NU7B 3TU7H 1GBMA 1O3IA 3VB5A 3F0OA 1P3CA 4AGKA 1C9TA 1EP6A 1DT2A 1HIAA 1EZQA 1O2IA 2FIRH 2QCYA 3FKSD 2A4GA 2P93A 3U8OH 3M5OA 3MNBA 1ZHPA 5CHBA 3T62A 4HTCH 2PGQB 1ZRBA 4U30A 1K9OE 2WINI 4PROA 1MBMA 4ABJA 1DXPA 1TPSA 1GI3A 1TAWA 2NU2E 1W7XH 1CT4E 1ANDA 1C4V2 1SGRE 3L33A 3M7UA 3RXBA 2BDHA 2GCTB 4BTUB 3F2FA 1A3EH 3PLPA 4WH8A 2QE7D 3A7TA 4DCDA 2H9TH 1HAGE 1QBOA 1TRMA 1Z8RA 5AHGH 4CRDA 3ZZ8A 1SL3A 2BY9X 4K5ZA 2CHAB 4MVNA 2F83A 5FCKA 4X2VA 1W12U 3M3TA 2XYAA 2BZAA 2VH0A 2K0QA 2ZDKA 1O2KA 3GCTG 1NY22 1QRWA 4KTSA 2WYGA 1E34B 1QTFA 1J8AA 2XRCA 3U1JB 1YKTA 4Q7YA 1IQMA 4FVBA 3TNSA 1BOQA 2BLVA 3SJKA 1C1MA 1TQ0B 1BITA 1P2IA 5K0HA 3T27A 4ZKRU 4O3TA 4X1QU 2WPKS 1BMNH 1EAWA 1V6DA 2FS8A 3ZVEA 5KECA 1CVWH 2W5EA 3BTKE 4F4OC 2XCNA 2ZDNA 3BSQA 1BB0B 1GBIA 1U6QA 3F9GA 1O5AB 4DOQA 2BXUH 3Q3XA 3SJOA 1NS3A 5A8YA 1BTHH 3ZVBA 5DG6A 3EE7A 4DJZB 2PW8H 1BHXB 4FUCA 3A89A 3PMHB 1ZTLA 1TQ7B 3SJ8A 5A8ZA 2KCPA 1NRSH 2A2QH 3UOPA 2ZHQH 3F68H 5DO4H 1K1JA 1E1RD 2OBOA 3MMGA 1PPBH 2P8OC 4B74A 2OC0A 1GMCF 1O3FA 1MTNB 4WWYA 3BG4C 2JKHA 3PO1B 1O3LA 1GHWH 5E0HA 5FL7D 1TPOA 2V6NA 4AFUA 1J14A 2XBYA 4VGCB 4A5TS 3SU3A 1LVOA 1TX7A 1UO6A 2GX4A 2ZGCA 1XUJA 3K6ZA 1WTHD 1AMHA 4DIHH 5EJ1A 1S0QA 1FPCH 3CENA 4E7NA 1DSTA 2THFB 1Y5BT 3P8GA 2XNIA 2OBQA 2JDID 2A45B 2BD9A 6CHAB 2OQUA 4A1XA 1MTVA 1J16A 3OEED 3P6ZB 2PV9B 2BB4A 2F4LA 3GY5A 1TABE 3S69A 1BRBE 2A5IA 1CGHA 3QO6A 4XOJA 1BMLA 3P95A 3A82A 1A61H 3NWUA 5HIYA 4NA7A 1C5QA 1N1LA 3NPSA 1IQNA 2QXJA 1G36A 5K7RA 1N8OC 1VGCC 2AGEX 4ZHMU 3RXRA 1KMHB 3N7EA 1NC6A 2HPPH 2AGGX 1QBNA 4AFQA 1CQQA 1GI9B 5EXNA 2FYRA 2ZFSA 4Y71A 4XBBA 4BANB 1SLUB 2W6JD 1FN6A 1JMOH 3S7HB 1Z8GA 1WSSH 4XD7D 4UDWH 4X6PA 1O5BB 1SFQB 1SB1H 1QHRB 1UVOA 1SGNE 2ZPRA 1V2MT 4NIYA 1EKBB 4BAHB 5J4SA 1AWHB 1UTNA 2HALA 1SGYE 2ZDMA 3E0PB 3GCNA 3TVJB 1UVTH 3K2UA 1BCUH 4YOIA 5F53A 1GI8B 2Y7XA 1QFKH 3TIUA 1K1NA 3RXPA 2GV6A 4A7IB 1SI5H 3TGKE 2DUCA 3T2NA 1FAXA 3OTPA 3QLPH 2XC4A 3MU5A 3FAOA 3E16B 3PRDA 4P02A 2Y81A 2WUCA 3RXSA 2AEIH 4B2CA 5B6LA 1TGBA 1OPHB 2ANKH 1K1LA 1GGDB 2J2UA 1IAUA 1NT1A 1NZQH 4AB9A 7LPRA 1SLWB 1YPHE 3KYGA 1THPB 1NBMD 2JJ1D 4ZCNA 1O2GH 3UNSA 2OC1A 5HXFA 1GVLA 2ZU5A 4INKA 1W0KD 1ELCA 1O2QA 2FTMA 2FX4A 2VIPA 1BMMH 4YESB 1X7AC 3V7TA 3RXJA 2A5AA 1DFPA 2ODYB 1ZSLA 5DP4A 3VXFH 3DT0H 4KTCA 3W1EA 4FU8A 5T6FA 2Z3CA 4U01A 2R9PA 3K65B 4RKOB 3K9XB 1V2LT 3QN7A 2ZKSA 4B73A 4NSYA 3SUDA 4I8JA 1HXEH 3RXDA 1NRNH 4BOHA 4ABAA 2BOHB 2B9LA 2ZDVH 3N7OA 5JBBS 1S85A 2BD5A 2HWLB 1F0TA 1CSOE 2NU3E 4NFFA 4K69A 3RXFA 4OS6A 5FPYA 1FIZA 2PKAA 2QIQA 1HAVB 1XMNB 1CHGA 1C5ZB 2EQNA 3AK5A 1SQAA 2ZECA 3DHKH 4ZHAA 4MNYA 1LKAA 1JIMA 1GHBG 3RC6A 3EDXB 1GJ6A 1O2VA 2RDLA 4A1TA 4CH2B 4X0WU 5JPMH 1ZR0A 1LMWB 1LHDH 1HAHH 4E06H 4JMYA 5C2ZA 1BDAA 5EJZA 5EW1H 1GL1A 4I8GA 3HK6B 3OX7U 1O5GH 2BY5X 1Z1JA 2CHAC 2P59A 1O2OA 4Z1MD 3MO6A 3KQEA 3GCOA 1GDQA 2K1QA 2XNDD 4CHAB 1O3JA 1DITH 4Q7XA 1H8ED 2ZCHP 1K21H 1T31A 5JB8S 1D3QB 3UQOA 1LHEH 4IMZA 4I31A 1GI4A 1S82A 5EGMA 1K22H 2PFEA 3MTYA 3Q76A 1CT2E 2GZ8A 3S7KB 5LPRA 4AN7A 2O8MA 2FEQH 1MQ5A 2FOFA 1V2RT 4U32A 3BTTE 4JYVH 4ZKNU 2BTCE 2HNTF 4IC6A 1E35B 5GJ4B 3MH7A 1AIXH 1JWTA 5DP8A 3QGJA 3W95A 1DE7H 1F5KU 2ESTE 1OOKB 3ZYEA 1D9IA 1GCTB 5T1VA 3TK6A 1LDTT 3A7YA 3MU1A 3S0NA 1L4ZA 1DLKB 1YWUA 5DJ7A 1FX0B 4I8LA 3TITA
chains in the Genus database with same CATH topology
4BXSA 4HZHA 1HAZB 4JYTA 1UTKA 4K60A 1O3BA 1C5TA 1EAXA 3ZVCA 1EPTA 2ZPQA 1QURH 4YT6H 1V2PT 5L2YH 1RTFB 2BYAX 2O9QA 2Z6BD 4FUDA 1QCPA 1C2GA 5DK1A 1HCGA 1MCTA 1O2JA 1GMDF 1JIRA 3L6PA 2Y5FA 3M5NA 4OS7A 1PQ8A 4H6TA 3A84A 1TLDA 3A80A 3SGQE 1AZZA 3SI4H 4X2YA 4D76A 1C5XB 3D49H 2ZI2H 3SNAA 2VWNA 3VPKA 4NWLA 1ZRKA 2STAE 1TNGA 1K2I1 1Y8TA 2XXLA 1DWCH 1NFYA 1JXPA 1QL9A 1A0LA 1EJMA 1EAIA 3SUEA 4DVAU 1BRAA 2B7DH 1DWBH 1G3CA 1KTSB 2GVFA 3URCA 1MAYA 4B75A 1C5UA 3V3MA 5EPYA 1ELVA 1P2KA 3E91A 1GL0E 1IHTH 2AGIX 2GV7A 1CGJE 3TLOA 2NU4E 1GHYH 1ANEA 1VITH 5F8TA 1W2KH 3RXLA 1ARBA 1L0ZA 2HLCA 1GHXH 1LKBA 4F49A 5CHAB 2VWMA 2VGCB 4Z6AH 5FPSA 1HFDA 3KIDU 4I32A 3URDA 3ZV8A 1QL7A 2H9EH 4ZKSU 1GBJA 1TX6A 3F6UH 2Q6GA 1AB9B 4TPYA 3GCHC 3A83A 4IBLH 1DOJA 3LC3A 1UTQA 1DX5M 1QJ1B 4GCHF 3MHWU 1Y5UT 2BXTH 2Y6TA 2SGFE 3P8FA 3ATMA 2Z7FE 3KCGH 5C5OA 2G81E 3TJVA 2FESH 1O3GA 2R2WU 3ZV9A 1ETSH 5L6NH 1YBWA 1TRNA 2W3KA 4YO9A 1W7GH 5EQSA 2WV5A 4KKDA 2B5TB 1MKWK 1TALA 4DY7B 1LHGH 2ZDLA 2JETB 4LOYH 3BEIB 1YPGH 2GKVE 2SGDE 4JZEH 4ASHA 3M7TA 3ZZBA 3A81A 5T3HA 3CS0A 1C2EA 1WUNH 4Y76A 1O2MA 3OSYA 1IQHA 5C3NA 2YNBA 5HMAA 3ZZ9A 1AHTH 1Y3XA 5A2MH 4ABEA 1G9IE 5GCHG 1AI8H 3PROA 1TMTH 1IQLA 2AMQA 1RTLA 2A7HA 3A7WA 1PJPA 1B0FA 1YCPM 4QT8C 1GBAA 1YM0A 1W0ZU 6GCHF 5A09A 1DPOA 2ZU3A 4MPWA 4RN6A 4K1TA 3RC4A 1GBTA 2FX6A 1OP2A 1NO9H 4BAMB 3QTVH 1DY8A 4ISLA 1BBRK 3ITIA 5DPAA 3PV4A 2P94A 1B5GH 7GCHF 3S9BA 1BZXE 8GCHG 4IC5A 2ZTXA 5ESTE 1NESE 1T32A 3GY4A 1UTOA 1FY1A 3UY9A 2R2MB 1F0SA 1CA0B 4K3JA 4ZMAH 1TNHA 1GCDA 2OXSA 1S81A 1P0SH 1ZTJA 5T6GA 5LH8A 1QJ6B 2XWBI 5PTPA 4JZ1A 3RXGA 5FX5A 3SQEE 4SGAE 1IQGA 3F9FA 2Q1JA 2BDCA 1SGTA 4TWYA 2FDAA 1GHZA 3RM2H 3NUMA 5DP7A 3SORA 1UK3A 1SHYA 2HRVA 5AVDA 1A3BH 2Z9IA 4OS2A 5TJXA 3SGAE 3SJIA 4ISOA 5F6MA 4X2WA 5EOKA 2ZU1A 5T6DA 5FAHA 4Y6DA 5GXPA 1E36B 4LZ1H 1ORFA 3RXEA 3ATKA 2BDAA 3RXOA 4U2WA 2V3HH 4YOGA 1C5VA 2PLXA 1QQUA 3SHAH 1HAPH 1K1IA 1SQTA 1C1VH 5CMXH 3EA8A 4WF8A 4NZLA 1MCVA 1F5RA 4BNRA 2W26A 1Z6JH 2V3OH 3SV7A 1DUAA 1LPZB 5ETXA 4IGDA 1GBHA 3LKWA 1TYNA 4FU7A 4K1SA 5EPNA 2PTNA 2PUQH 2UWPA 2R0LA 3O8CA 2BHGA 3BTME 1NFWA 2ANYA 3SJ9A 1L4DA 4X6MA 4GAWA 4BAQB 1WU1A 1P2NA 2ODQA 1LVBA 1UCYK 1C2MA 4MQAA 2GZ7A 3KQDA 3M36A 5DP5A 1MD7A 2ZGBH 3SU4A 1GCTC 6LPRA 5GDSH 3VB7A 3FFGA 3U1IB 1DDJA 1DY9A 2GDEH 1PPFE 3PMBB 4AOQA 4XE4A 4JZFH 1EX3A 3KNXA 3M3VA 2SGQE 3QGNB 2A4RA 3RLWH 1LHCH 3BTDE 2ZGXH 3MYWA 2QXIA 4BTIB 1WOFA 2QA9E 2F91A 5E2PA 4O03A 5LPEA 1E37B 4Y10E 3LGVA 1RIWB 3A8DA 1G2LA 2R3YA 2FYQA 2WPHS 3QK1A 1Z1IA 3LDXH 5G4BA 3SQHE 3T29A 3UTUH 1JRSA 1V2UT 4O3UA 1XUKA 4IN1A 3AW1A 1G3BA 3EAJA 2Z9KA 3RM0H 3T26A 1YPLH 3VXEH 1GDUA 1NU9A 1WBGB 2VB0A 4Y8ZA 1O2TA 1HXFH 1TB6H 1BTUA 1RS0A 4CRBA 2H5DA 1C4Y2 2ASUB 1TGTA 3F9HA 1A0HB 4NIVA 5AFZH 1MKWH 2RA3A 5FBEA 1C1QA 1DSUA 4NGAH 4ABIA 3M61U 1GVZA 3P8OA 2UWLA 3ZZDA 2G5NA 2BD4A 1TNJA 1NROH 1F2SE 3HATH 4YT7H 2G4UA 1SGIB 3BTWE 3FP6E 4NIXA 2C3SA 4UFFH 4CBNA 2BX4A 5C1XA 3RXIA 2BM2A 1EB2A 3SOSA 3B8JA 4FXGH 4RSPA 1FY8E 4DIIH 2G4TA 1GWAA 1RRKA 1EASA 1O35A 1S84A 3FP8E 3GY8A 2FXRA 1K28D 2VVVA 1YGCH 1AB9C 1SBWA 2WUBA 4SGBE 5J4QA 1GJ7B 2ZHEH 3HPTB 3GCTF 1BBRH 5FX6A 3BTFE 3E1XB 3MU4A 5TCAA 4WXVA 4B2AA 3EYDA 1AFQB 3BF6H 2GZ9A 1TRYA 4X6NA 1E38B 1O33A 1KXCA 2C8XB 1P2QA 1XM1A 3LGUA 3MNCA 3TPIZ 1XUIA 1GJBB 1A7SA 3RU4T 4JK5A 1F7ZA 2ZFFH 3RXAA 3KQCA 1SG8B 4Y0YE 1SHHB 3UWIA 2AYWA 1DICA 1NFUA 3BG8A 4ABBA 1C1PA 1PPGE 1G3EA 3VB6A 1OSSA 1XUGA 1SVPA 3K6YA 2FI3E 2EI6A 1VR1H 2JETC 3OY5U 2FOEA 1XKAC 1S83A 1EP5A 1BTXA 2Z9LA 4YOJA 1UVSH 3RU4D 2Y80A 1VJAU 3T28A 1C2DA 1P06A 3DFLA 1WV7H 2EA3A 1ZSKA 3CP7A 4AB8A 2GD4B 3U98H 1D6WA 1OX1A 1T8NA 3ZVGA 1BTYA 1IOEA 1C1WH 1THRH 1MTUA 4UE7H 2A5KA 2ZHWH 1H1BA 4FUEA 5JDUB 1C1OA 1KIGH 3TH4H 2ULLA 2A4QA 4R8TB 4AG1A 1AO5A 2GMTB 4A6LA 1P02A 2VIVA 5H4IB 2PKAB 4IS5A 1HJAB 3H5CB 2BVXH 1NPMA 1QIXB 2F9NA 4CRFA 9LPRA 1AVWA 1CA0C 1LTOA 3MH5A 3UOUA 3U9AH 3M7QA 3SU0A 1UCYH 1J9CH 4FU9A 4X6OA 8KME2 3GICB 2TIOA 2A32A 4IN2A 2AMDA 4XSKU 2V0BA 4D7GA 2ZTZA 2OCVB 7KMEH 2W7UA 3ZVFA 2CF8H 3FVFB 5ABWA 3NK8A 2FS9A 4I8KA 1HDTH 2D1JA 3MH6A 1FMGA 3BV9B 1AN1E 1XUFA 1CT0E 1O2XA 2Z9GA 1Y5AT 5FHTA 1PPCE 4M7GA 3SI3H 2WPMS 2ANWA 4MNXA 1V3XA 3AW0A 3FZZA 1ZMNA 4B71A 1RXPA 3RDZA 2I6QA 1YPEH 1P9SA 3RC5A 2ZQ2A 2Z94A 3MFJA 1ZGIA 4X1SU 1PPEE 1HJ9A 1O2SA 1QRZA 4WVPE 1L1GA 2BD7A 2GCTC 3RXKA 1CU1A 3SBKA 9ESTA 1XX9A 1LCYA 3V12A 1T8OA 1OWIA 1SGFG 1MQ6A 4X8UH 2XBXA 1UTLM 7ESTE 3U69H 4AFSA 1HRTH 2BY7X 1Y3UA 3I77A 3KEEA 3FP7E 1GDNA 1ZMLA 1TPPA 1FV9A 4AYYB 2OQ5A 1OXGA 1PPZA 4J2YB 4TY6A 3QUMP 1NN6A 1YPKH 3U8RH 1CE5A 2XC0A 4TYDA 2SGEE 2VIQA 3ZZ5A 4BAKB 1HV7A 3SV6A 3O8BA 4DW2U 1W14U 2YNAA 2ZA5A 1TBZH 1WCZA 3RMOH 1UTMA 1EPTB 2Y82A 1GBLA 2JH0D 4JK6A 3RXTA 2ZNKH 3TH3H 3IG6B 1A0JA 2BD3A 1H9IE 4ZUHA 2F9VA 1TA2A 2J95A 3A7ZA 2BDBA 3DD2H 1H9HE 4J1YA 1IQEA 2HGTH 1FONA 3RMNH 1ELAA 2FP7B 3UWJH 1GBKA 4DT7B 1S6FA 1O2LA 2XBVA 3W94A 1CBWB 4A92A 5JYIA 1O2HA 2QXHA 3A85A 4WH6A 3VEQB 4GPGA 3VGCB 4UEHH 3T25A 1C1RA 1V2WT 1P2JA 1O0DH 2KAIB 1OP8A 1NTPA 3M5MA 4FUIA 1AKSB 2A7JA 1VITG 1PQ5A 1FDPA 1HUTH 1J15A 1LVYA 4INLA 1MTNC 3PO1C 4JCNA 3SU5A 2BD2A 1T8LA 2OTVA 1C1SA 3MWIU 3HGPA 1GMHG 4VGCC 1AZ8A 1EOLA 1P3EA 2D26C 1ZHMA 2OUAA 1MZAA 3M5LA 3ATLA 1TNIA 5F03A 3HKJB 3V0XA 3E8LA 4GSOA 1O2WA 4WMDA 1O5EH 1V2TT 1MKXK 1C2LA 1YYY1 2Y5GA 1S0RA 1FQ3A 1N6YA 3WY8A 1FXYA 3A8AA 4NFEA 4D8NA 1TOCB 2G55A 2ZFQH 1O3AA 4MNWA 1C5WB 1YLCA 1OWJA 4ISHH 1AD8H 1V2ST 1ZZZA 6CHAC 1GHBF 2KAIA 3P8NA 1FZZA 1HAXB 1AKSA 1GHVH 1P2OA 2Q6FA 1S6HA 3ELAH 3MNXA 1T8MA 1WAYB 3HGNA 1O3KA 2OP9A 2J92A 4Y8XA 1D3DB 1O2NA 1EZSC 2D2DA 2P8OB 3UREA 5IDKA 1P8VC 3EA7A 5JBCS 1BTWA 2ZGHA 3KN2A 1O31A 5TCCA 4FUGA 1ANBA 1TWXB 2LPRA 4HGCA 1FIWA 2WPIS 3D62A 2OD3B 2UUYA 3LT3A 3GDUA 3GY7A 1YF4A 3MH4A 4K8BA 4ISIH 3RXHA 1D3PB 1ZLRA 1J17T 3NXPA 1DXWA 1BUIA 1MU8B 1VCQA 1CHOG 1DWDH 1O3MA 8ESTE 3F9EA 2QY0B 1C2KA 1MAXA 2BDIA 1ZJKA 4ZROA 3ZYDA 2ILNA 2GDDA 1QNJA 3TGIE 4CRGA 1GJ9B 4D7FA 4O97A 1W10U 2PTCE 1Z71A 1ZGVA 2SNWA 5E0JA 1ID5H 2J34A 3LGYA 3NCLA 1KLIH 1HAOH 5CE1A 1AUTC 1AVGH 2NWNA 2G52A 1O2UA 1JBUH 2P3TB 1O3CA 4ZAEA 3UNQA 1F0RA 1N8OB 1A1RA 1P9UA 1AE8H 1VGCB 1H9LB 4Y11E 4CBOA 1SC8U 1KDQB 2QF3A 4XBDA 1P09A 1NRQH 1C1TA 3BTHE 1QB6A 1QJ7B 3RUOA 2ZU2A 1WQVH 1YPMH 3LPRA 2FTLE 1TONA 2A31A 5SGAE 2P3FH 2J9NA 1HPGA 2B8OH 1GBEA 1GGDC 2BQ7B 4R0IA 1C5NH 3GY3A 5JBAS 2F3CE 4Y0ZE 5EODA 5B6OA 1AUJA 2FO9A 3BIUH 3PMJA 2FLRH 3LGIA 1GVKB 1HJAC 1QB1A 1OWDA 2F9BH 5C5NA 1OYQA 1G32B 1O3OA 1O2YA 1ZJDA 4ZXYH 2FMJA 3MU8A 2W7SA 1IQFA 3GY2A 1O3NA 1KDQA 3LGTA 2ANMH 3MO9A 1TNLA 1MUEB 1Y3WA 1QQ4A 2O8TA 3D65E 3PWCA 2EEKA 1G30B 1Q3XA 2BX3A 1WTGH 4CRCA 1A5GH 3S9AA 4YM9A 1P03A 1ELFA 1AVXA 1G2MA 4GUXA 1ETTH 1TGSZ 3EA9A 2M5TA 3H7OA 1ANCA 2CV3A 1ELEE 2AIPA 2H2ZA 3SNDA 1V2VT 3SU2A 4Q2KA 3SU1A 1TBRH 2OC8A 1BJVA 3O8RA 1P57B 1BTZA 1C5PA 1BIOA 1C5MD 1VCWA 3P17H 2WYJA 2DE9A 1C5OH 1GMCG 1KY9A 4XBCA 1TNKA 1PYTD 1TGNA 1MZDA 2F9UA 1UHBA 5EXMA 2VIOA 2F9OA 1GI1A 4X1PU 1RGQA 2CN0H 4CHAC 1D4PB 2XWAA 1O34A 4E05H 3I29A 4NA8A 1DVAH 4NCYA 1O3PB 1MKXH 2GP9B 1AY6H 2IJOB 4Q7ZA 1SGFA 1SOTA 2OC7A 3LOXA 1Z7KA 1FN8A 2AH4X 2A1DB 5DP6A 6ESTA 3ZZ4A 1JRTA 1EPTC 2FOAA 1ZPBA 1F92A 4FUJA 3VFEA 2AS9A 1H8IH 1RD3B 1VCPA 2TBSA 3GISB 1SGDE 2TRMA 3E3TA 1DANH 3P92A 1JOUB 1YC0A 1INCA 1HNEE 1SFIA 2UWOA 1C5LH 3ZZ3A 3NKKA 1QRXA 4K2YA 2XC5A 2C8WB 2JH6D 5BPEA 2OLGA 2AIQA 2IPHA 1SLVB 5IYTA 4YLUA 1FY5A 1ESAA 3UR9A 4X8TH 2VJ1A 3M35A 2A2XH 1CBWC 1UMAH 5HM9A 1M9UA 1ZOMA 5FCRA 5GCHF 1W3CA 3VGCC 8LPRA 2CF9H 5HGGA 1YPJH 1ARCA 4MTBA 2OINA 1GI0A 3ODDA 3M37A 4JYUH 3LJOA 1LVMA 3RXUA 1W11U 3LONA 1QB9A 2B0FA 5C1YA 1TE0A 1GJCB 1F0UA 1QBVH 1XUHA 4Z0KA 3TJUA 2GCHF 1W13U 1GHAF 5DKMA 8GCHF 2PSXA 1N6XA 1GG6B 2SNVA 4MG3A 1FUJA 3RXQA 1IQKA 1C5SA 2PUXB 4ISNA 3ZZAA 1EQ9A 1MD8A 1VJ9U 1C5RA 3KF2A 2Z3DA 1Y3VA 4INHA 4B76A 4LK4A 3LIWA 2YOLA 4UFDH 5FXLA 4CRAA 1GJAB 1KTTB 4DG4A 1FY3A 2A7CA 3SHCH 3SO3A 5C67A 1B7XB