3E1XB

The crystal structure of apo prostasin at 1.7 angstroms resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Prostasin
total genus 51
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e1xB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e1xB01
3QTOH 5B6OA 1KLTA 1M9UA 2QXGA 4MLFB 1YCPM 4ZHAA 1BTHH 1FONA 2ZDVH 3U8OH 3FFGA 2P3FH 2H2ZA 2OINA 1QR3E 5ESBA 3A8DA 1W3CA 1BT7A 1O3BA 3E8LA 1BMAA 1O2QA 1VZQH 4K8YA 1B5GH 3RXTA 3T25A 3PM3A 2ZKSA 5AHGH 3V0XA 2XCFA 1PQAA 1UJ1A 4Y7BA 1GJ6A 3RLYH 3PO1B 1DXWA 1GVZA 3H7OA 5GDSH 1Y3YA 4IMZA 4O97A 1V2ST 3KQCA 3QO6A 3SNAA 2QAAA 1O5BB 1LHFH 2ULLA 4OS6A 1NU7B 3MNBA 2FOMB 1ELEE 2ESTE 1ARCA 1WUNH 2FTMA 1HB0B 1LHGH 1TNIA 1GBTA 4MNXA 1SI5H 3W94A 1HDTH 1O2UA 1YCPH 1OYTH 2BOHB 5EU8A 5DP5A 1T4UH 4OS1A 5DP8A 1B7XB 1H9LB 1QURH 5FPTA 1LKAA 2ZFFH 1EAUA 3CP7A 3O8RA 4GHQA 2OC1A 3STIA 3AW1A 4NFFA 5DP4A 5EODA 2EC9H 1O3IA 5LPFA 3Q77A 4GHTA 1UHBB 2H6MA 1Y59T 2V3OH 1EAWA 5FHTA 1MKXK 1VR1H 1NC6A 2ANKH 2Q1JA 4H42U 1PJPA 4BTIB 1MTVA 3G01A 1DICA 2AMPA 1W7XH 2O9QA 1O36A 2BDAA 3SJ8A 4CBOA 1NRRH 3S9BA 1T4VH 3BTDE 1ACBE 3SNBA 2BXUH 2OC8A 1LO6A 3BG8A 1THSH 4R8TB 1PFXC 2FOAA 5J4QA 5JB8S 4O3UA 1T8MA 1AZZA 2CHAC 1IQEA 1ZMLA 3TK9A 1E37B 1GVLA 2DE9A 2FOFA 4Q80A 1WQVH 1LPZB 4F49A 4FU7A 2GT8A 3RXGA 1ORFA 4BOHA 4MPXA 1C1MA 1OYQA 3HPTB 3TJNA 2G51A 2J92A 1AMHA 3MO3A 2AIQA 1WOFA 1BHXB 1C1WH 3IITA 4RSPA 1NT1A 3QX5H 3ZV8A 1INCA 1GDUA 1SVPA 4A92A 1ZPZA 2ZU4A 1OXGA 3ZZ4A 2PTCE 1OWIA 3VXEH 4D8NA 3S9CA 3SORA 1QJ7B 3LIWA 2VVCA 1RTLA 2OQ5A 2FLRH 2PGBB 1TABE 5LH8A 1QA0A 4E7RG 3E1XB 1CQQA 1KYNA 4TWYA 1NESE 1ID5H 1XUKA 3P95A 2B9LA 3PROA 5IYTA 4AOQA 2Z9KA 4LK4A 3RXBA 1UCYE 1SFIA 1GJ7B 1O34A 1DFPA 1XVOA 5BPEA 5FAHA 2VIVA 3ZVDA 2VH6A 1CT2E 1A7SA 1BDAA 1NZQH 1ZGIA 3D65E 1LHDH 4WJG2 2JKHA 4DCDA 1SQAA 1W13U 6CHAC 4KKDA 3SV2H 2PKAA 1LTOA 5GCHF 3SU0A 1EPTA 3DFJA 3U9AH 3H5CB 3PTBA 1JBUH 3BV9B 1O3CA 1GMHF 4ABDA 3M61U 4RKJB 1C1OA 3RLWH 4NWLA 4F4OC 3MU8A 2OXSA 5JBCS 2ZNKH 3ZZ9A 1BA8B 2AEIH 1C5NH 2R2MB 1G3EA 1ZHMA 1FAXA 2WV4A 4ABGA 1LHEH 2ANWA 4LZ1H 3U1JB 1GHZA 3MHWU 5FBEA 4KTCA 3MFJA 4AB9A 3TGIE 1ZMNA 3ZZBA 3GY3A 4CH2B 3MO6A 4X6MA 1BCUH 3QUMP 1V2LT 2ZA5A 1NO9H 3BIVH 3URDA 2ZTZA 1DVAH 1HAVB 4AORA 3E0NB 3D62A 2QC2A 1C5QA 2HWLB 4NZQA 1KSNA 1G30B 3ZVEA 1EZXC 4DW2U 1XKAC 3O8CA 1DT2A 1ETRH 3A80A 4ABAA 1MZDA 5AF9H 3Q3KA 3PMHB 2QYIA 2ZHWH 1DWCH 4DIHH 2ZWLH 1NU9A 2QV1A 3TJVA 5JYIA 5PTPA 4CH8B 4AX9H 1C2MA 2Z9IA 2P95A 3RUOA 2Y5HA 5F8ZA 5JDUB 1TE0A 1D6WA 1JMOH 5T6DA 8GCHG 1GCDA 1Z8IB 1TPOA 4DURA 2QCYA 3E0PB 2BDYA 1C2DA 2ILNA 1P2IA 1GJ4H 1BRCE 2FXRA 1O2VA 2R0LA 1G3BA 4IBLH 1CHOG 1SPJA 1O2XA 1Z1JA 5EQQA 1S82A 1ZJDA 4JCNA 1IQFA 3NPSA 1MCTA 1A61H 4AB8A 5JBBS 2BX3A 2B7DH 3GDVA 3UTUH 2GCHG 2R9PA 3IG6B 3PTNA 1PQ7A 1O5FH 2ZGHA 3F9FA 1P9SA 4BXWA 4NA7A 5EOKA 2J38A 3N7OA 5E0HA 1HAIH 9ESTA 4I7YH 5FCKA 2BLWA 2WPKS 3ENSB 2WINI 4B2AA 5FPSA 5DO4H 3BTHE 5L6NH 3GY4A 5DGJA 5AVDA 9LPRA 3RXDA 6GCHG 3S9AA 4BANB 1FY3A 5L30H 1J9CH 2HALA 2ZZUH 5C2ZA 1EP6A 2VVUA 3ODFA 1DITH 5EW2H 2B8OH 2FM2A 1AWFH 1TPSA 1BHXF 4AFQA 1PPFE 4BXSA 2P8OC 3M5OA 3PLPA 1DSUA 3V12A 4CR9A 1YM0A 2VINA 4O9VA 3A7YA 1LVBA 3M3TA 1C1UH 1GHBG 2VWNA 1EXFA 1O0DH 5F6MA 1GJBB 3FVFB 1JIMA 4VGCB 1UTLM 2ZDLA 1K28D 2FYQA 3SGQE 2K1QA 3CS0A 3M36A 3UR9A 1AB9C 1ZGVA 2BYAX 2GMTC 4GPGA 1YF4A 3H7TA 3M7UA 1FLEE 4WY3A 1G32B 1O2JA 1LPGB 4FXGH 3PWCA 2XRCA 1TRYA 1FN6A 2NU4E 1KDQB 2ZHEH 4B76A 1XX9A 1ZTJA 3RXPA 1EAXA 4NA9H 2GZ8A 1YC0A 1L1NA 5ESTE 1PPCE 1MKWH 3GY8A 2Y80A 1SBWA 3R3GB 1QRZA 4GCHG 6ESTA 3B8JA 4E05H 1O2YA 4NGAH 1FY5A 4UONA 4FUIA 1SQOA 1Y3XA 4Y8XA 1SGCA 1GDNA 4ZROA 4KGAA 3FP7E 2GKVE 1HJAB 3VXFH 3BEIB 1RTKA 2UWOA 1NS3A 1A3EH 8KME2 2VIDA 1RS0A 5E0GA 1SGYE 1HIAB 1TX6A 1OOKB 3NWUA 3OTJE 3SV6A 3L3TA 4Q7YA 3R0FA 1C2LA 3PMBB 3LGVA 5A0AE 1GI5A 1JIRA 1IQJA 1GJ8B 1QTFA 3RXRA 1YPEH 2ZCLP 2WV5A 3SU5A 1MAYA 1C1SA 2BDHA 4A5TS 3SO3A 1DDJA 1SGEE 2FPZA 2XYAA 2Q6GA 1V2VT 1MU6B 1UVPA 5L2ZH 2XBWA 4AYYB 4K8BA 3RXFA 5GPIB 1F5KU 1T31A 4QT8C 1ELCA 2VIWA 3GOVB 4XOJA 3SJIA 1Q3XA 1ETSH 3A81A 1LHCH 1NFWA 2SGEE 1TGTA 3MH7A 3HGPA 3B9FH 3FAOA 4K69A 5C5NA 3GCTF 3E6PH 4AN7A 5LPEA 5LPRA 1TONA 3MNSA 4SGAE 2D1JA 1DY8A 1GI9B 1Y3UA 4IN1A 5JBAS 2THFB 1ZTLA 1ZSLA 1GMCG 3ATIA 4K2YA 1K21H 1CHGA 1NM6A 2FOHA 3UIRA 1LPKB 2XC5A 4TYDA 4MNVA 1RFNA 1ZMJA 1DANH 2HNTE 4NWKA 3OYPA 3P8NA 1P2QA 2C8ZB 3UQOA 1K1LA 3AASA 4XBBA 1GBCA 2WPLS 1DUEA 1K2I1 3TITA 1YPHE 5GWZA 1P12E 1J15A 3RXEA 3SJKA 3UQVA 1ZTKA 1LQEA 1TX7A 1HLTH 3SOSA 1CSOE 4I31A 4Q7ZA 2BLVA 1EJAA 1EJMA 1V2OT 3OSYA 1BTUA 1C5PA 2A31A 3RXUA 3ATLA 3AAVA 1PQ5A 3A8CA 2HNTF 3LDXH 1OX1A 3SNEA 2FOGA 1ZR0A 1KLIH 1NRQH 1O2MA 3TPIZ 2XWAA 1CE5A 2O8WA 1GI1A 4X8VH 2CMYA 2EA3A 4U01A 4A1TA 4ZAEA 4GVUA 4CR5A 3TLOA 4YZUA 1C9TA 1HXEH 1KDQA 1RJXB 1ELDE 2XTTB 5TCAA 1SGQE 1TGCA 2C90B 1S6HA 1P57B 4OS2A 2FEQH 4UE7H 5FX5A 3VGCB 3EYDA 1GG6B 4A7IB 1KXDA 2O8MA 2GCHF 4MVNA 4ABEA 1GBJA 3OY6U 1SGFG 1SGPE 1Y3WA 4NIXA 2FX6A 3OY5U 5JPMH 3ZVAA 3HATH 4FUDA 3T28A 1EKBB 2EEKA 1TFXA 2PKAB 3LU9B 4WH8A 4KP0A 1HAGE 1IQIA 1GL0E 2ZU5A 3Q76A 1FY1A 1XXFA 3EA7A 1YGCH 3A88A 1AZ8A 1EPTC 1A46H 5DKMA 4AGKA 1NFXA 1O5CB 1D3TB 3K2UA 4TY6A 1NTPA 5G4BA 1OSSA 3UR6A 1ANEA 1D9IA 1LVMA 2ZO3H 5FCRA 1ESTA 1QL7A 1BBRE 4JZFH 4FUCA 3VGCC 3BG4B 5HM9A 2FZZA 2IJOB 1V3XA 2QGRA 2XC4A 3DUXH 1FZZA 2YOLA 2CF9H 3SI3H 5A8YA 5EGMA 3BEFB 5GCHG 2A32A 3RM0H 1QJ1B 1FAKH 3ELAH 1IHTH 4X1QU 3UOUA 1E38B 3ZZ3A 1GHVH 3SJOA 1SMFE 2C3SA 2GZ7A 3K65B 5EQRA 5AFZH 2YNAA 3ZZ5A 3JZ2B 1GBDA 3Q3YA 1JOUB 1S5SA 1FXYA 2Z3CA 4UFDH 1Z6JH 2IN2A 1DLKB 2FI3E 5E8EH 5DP6A 3O8DA 4A6LA 3Q00A 1B0EA 2ZP0H 2R3YA 2A2QH 2QA9E 4I8KA 4DIIH 1C2KA 1H9IE 3A84A 1ABIH 2Y82A 1SHYA 1D3PB 3F9GA 3DT0H 1O3PB 1FIWA 1MTNB 1VITH 3GCHC 1GJCB 1K1OA 2RCEA 8LPRA 2Y7ZA 4WF8A 2ZPRA 4Q2KA 1YYY1 2AFQB 1V2QT 4RKOB 1GI0A 2VWOA 2VB0A 3M5LA 1S0RA 5CHAB 2ASUB 2GV7A 2PR3A 3TJOA 1AE5A 1HYLA 2BZ6H 2BY7X 2J2UA 1DWEH 4YOGA 3BSQA 1DM4B 2F9NA 3FZZA 1QBNA 1KLJH 5EXLA 3KQEA 4GLYA 2G55A 3GYMA 2GD4B 1C2IA 3GY6A 1TBRH 5DPAA 3V13A 1DXPA 1O3FA 1MH0A 3RU4D 2BMGB 2ZU2A 3GCHB 1J8AA 1QGFA 1Y5AT 3GCOA 3FP8E 4ZUHA 4OGYA 2FLBH 4ABJA 2STAE 2RA0A 5C5OA 2RDLA 1Z8RA 3GY2A 4X2WA 1KY9A 3DA9B 3SQEE 2D26C 2ZC9H 1IQMA 1HIAA 4X1PU 3NXPA 2BVXH 1AY6H 1P8VC 2Z9JA 4D76A 4ZKSU 2RA3A 4NZLA 1BMNH 3RXQA 1MU8B 1OWHA 2F9VA 1C1RA 1C5WB 1P9UA 1C5SA 5I25A 4CREA 4PROA 4FUBA 4YOIA 4CRDA 3QZQA 1F92A 1NROH 3T27A 3PO1C 1K1NA 3PV4A 3GDUA 4DT7B 1P02A 3C27B 4AFZA 1G2MA 3TH3H 6LPRA 2H5DA 1LQDB 1F2SE 1BB0B 3SZNA 1CA8B 3BTGE 1BTXA 1W12U 2V35A 5C1UA 4Y11E 2JH5D 1GJDB 3GY5A 4IS5A 1TNHA 3DHKH 4AFUA 1C5YB 1NFYA 5HMAA 1E36B 2G81E 3E91A 3HK3B 2ZGCA 3SV7A 1CT0E 1EAIA 2H9TH 3SU4A 1HAHH 1N6XA 2TRMA 1ELTA 1JWTA 2EI8A 4NSVA 1JRSA 4OGXA 1WYKA 4E7NA 5K7RA 1SLXB 4Y0ZE 5C3NA 2J94A 4ISNA 5C1YA 2PFEA 2ZG0H 1GG6C 1O2LA 3MU5A 1AE8H 4BTTB 4IC6A 1MTWA 1MBQA 1W0YH 3QK1A 3T2NA 2O8TA 3RM2H 4FU8A 1RD3B 3RC4A 1UVSH 3NK8A 1DWBH 2VH0A 1ZPBA 3BF6H 3TK5A 3KIDU 3MWIU 1CGIE 2NU1E 1P2KA 5JB9S 1FN8A 2SFAA 2DUCA 2VWMA 3E3TA 1OP0A 2ZU1A 3RC6A 1FIZA 1NRNH 3BTQE 2TGTA 4UFFH 2AGEX 3U8RH 1C2JA 4D9RA 5EPYA 2Z9GA 3LH3A 1V2KT 4JYVH 1T32A 3HGNA 1GI3A 1CA0B 4GAWA 1UTKA 3SV8A 2ZHFH 2A4OA 4I8JA 7GCHG 2H5CA 3RP2A 1THPB 3A7XA 3ZYDA 2SGFE 4NFEA 1H8DH 5SGAE 3SQHE 1EUFA 4BAHB 3LGUA 1V2NT 1NY22 4FUEA 4WMFA 3SV9A 1HAOH 4WVPE 3RXAA 1VCPA 3UPEA 5E2PA 2PGQB 2AIPA 1AIXH 1GMDG 1N1LA 1GHYH 4BAKB 1AQ7A 4INKA 1BUIA 4NG9H 3AAUA 2F83A 2O8LA 1AVGH 4XBCA 1A4WH 2SNVA 4ISLA 4WMDA 3M7TA 2PKSB 1S81A 4GCHF 1ZJKA 1HCGA 1ZRKA 2OQUA 4Y7AA 1F5LA 1UK4A 4INLA 1AN1E 5K0HA 1D3QB 4OS5A 1VITF 1QRXA 2FODA 4MQAA 1ZSJA 1DE7H 4Z6AH 3MU4A 2W5EA 1SGDE 3HK6B 1FUJA 2V6NA 2G5NA 2FOBA 2BDCA 2ZQ1A 4BTUB 3KEEA 3RMOH 1AUTC 2OUAA 3P8FA 1WBGB 4AFSA 1BMMH 4YM9A 1GDQA 4B2BA 3RU4E 2G4TA 1BIOA 1LCYA 3ZZCA 1IHSH 1VGCB 8ESTE 1QL9A 3TGJE 4JZIA 3M35A 1O2TA 3UNSA 4ABBA 1AVWA 1CGHA 1QB6A 1FV9A 2UWLA 3BTFE 1SHHB 2QXHA 4KTUA 3CENA 1SGNE 4MG3A 2ZPQA 2ZDNA 3KCGH 1DS2E 3LJOA 1HXFH 3EAJA 2ZF0H 2GCTC 3M5NA 4K1SA 4DJZB 1TGSZ 1GBEA 4MPVA 1TWXB 2FX4A 2P93A 4JZEH 1V2MT 1WTGH 4YLUA 1EATA 1G36A 1SLUB 2ZGJA 1ARBA 4ZKNU 3T29A 2H9EH 4OS7A 2FS9A 1C5TA 1XXDA 1RRKA 4DGJA 2SNWA 1C5LH 2Y7XA 1QBVH 2Z3DA 1IQLA 3A7ZA 4MTBA 4X8UH 1MZAA 1ZOMA 1C5XB 3GISB 3EQ0H 2PLXA 1O3MA 1MQ6A 3TH4H 1V2RT 1UTMA 4YO9A 1VCWA 2BDBA 4NIYA 2OP9A 1BTWA 3RXSA 3OU0A 4JK5A 2R0KA 4YESB 3T62A 3MH5A 2D2DA 2UUJB 2G8TA 1CBWC 1DUAA 1C4U2 1C2EA 2P94A 2WPIS 2ALPA 4ABHA 1DLEA 1HJ9A 2P3TB 3QLPH 1QHRB 1GCTB 1BMLA 1EPTB 1EZUC 2B5TB 3RXMA 2HLCA 3LC3A 2F9PA 3RXKA 4FUFA 3PWBA 1L0ZA 2A45B 1YKTA 2AGIX 1GJ9B 1Q2WA 2GGVB 4B1TA 1YPGH 1SOTA 3DFLA 4FUGA 1C1VH 1F7ZA 1O3NA 4I8GA 4THNH 3PB1E 2AMDA 4ISOA 1ELGA 1A5GH 1P2NA 1V2PT 5HYOA 2IOTA 4Y71A 5CE1A 1A2CH 4Q7XA 2B0FA 1AD8H 2NU3E 1ANBA 2ODYB 2BD7A 2OCVB 5A8XA 1GI7B 1MCVA 3ODDA 2QN5T 1YPKH 3MU0A 3P70B 1BRBE 1Y3VA 3TH2H 2A5IA 2TIOA 4TY7A 5F8TA 3FP6E 4K3JA 2QF0A 3M3VA 4JZ1A 1O3HA 4UDWH 4CHAC 2G4UA 1SGTA 1WV7H 4CRFA 2P3UB 4ZHLU 2PSYA 1QQUA 3M3SA 4MDSA 1BJVA 1AHTH 1P06A 2ZCHP 3K6ZA 2VVVA 4ZMAH 2ODQA 4ZKOU 1YPJH 1ZRBA 2AS9A 1D4PB 1CGJE 5C1XA 2A0QB 3V3MA 1A1RA 1GL1A 1TQ0B 3LGYA 1TGBA 1SQTA 1P10A 2XC0A 1CA0C 1KXCA 1QQ4A 4LZ4B 2IPHA 2ZECA 5DJ7A 1GBFA 1ELBA 1B0FA 3SUEA 1WCZA 2ZFQH 2PV9B 1O2GH 3P8OA 4TPYA 1A5HA 2CHAB 1ELAA 2FP7B 1O2PA 1HJAC 3FANA 1QJ6B 1W7GH 2BD9A 4MPUA 2OC0A 4J2YB 3M37A 3PMAB 3K6YA 1OP2A 1OP8A 1UTOA 3ZZ8A 5ABWA 2XBXA 1C1NA 1EQ9A 1KXFA 4X2VA 3SNDA 1T7CA 1QL8A 4YLQH 1O37A 1A0LA 4B2CA 1TA2A 2BY6X 4I32A 1RTFB 1UMAH 2AYWA 3VEQB 4UEHH 1GJAB 2VJ1A 1C1PA 2ZTYA 4O3TA 3MYWA 1SC8U 2VU8E 1SSXA 3GCTG 2VIOA 4X0WU 3AVZA 4IGDA 1GWAA 3E90B 3PYHA 5FX6A 3E16B 2GVFA 1DOJA 1UVOA 2NU2E 4R0IA 1O39A 1Z8GA 4U2WA 1QNJA 4HTCH 3SGAE 1ZSKA 2Y81A 3ZV9A 4BAMB 4H6SB 1OWKA 1PPHE 2Y5FA 1ESAA 5A8ZA 4I33A 2STBE 1C5UA 3GY7A 1GBAA 1T8NA 2BDIA 5DP3A 5JBTA 1NN6A 2GDEH 1V6DA 1G37A 3QWCH 1V2WT 3MU1A 1TNGA 1P04A 3LGWA 1TOCB 1ZHRA 3RXHA 1TQ7B 5J4SA 2O8UA 3TNTA 2A7HA 1AFEH 3NKKA 3P6ZB 4BNRA 1BTYA 2UUYA 1EP5A 3L6PA 4K60A 4ZKRU 1C2GA 2A2XH 2PUQH 5F8XA 3UWJH 2J95A 3EA9A 1U6QA 1O3KA 1S6FA 2Q6DA 3F6UH 3KF2A 1L4DA 4H4FA 1S0QA 1KXAA 5I46H 1O2HA 2SGDE 2WYGA 2ZQ2A 2OBOA 1G3CA 3UY9A 3SU6A 5H4IB 1FNIA 3S69A 2ZHDA 1HAYB 4ABIA 3WY8A 1D6RA 1SFQB 3KGPA 1HGTH 1QBOA 1W14U 2KAIB 2CF8H 3TIUA 1XUIA 3ZZ6A 5CMXH 1GI8B 1RGQA 5DG6A 1YPMH 1J17T 2Y6TA 3OX7U 2H1UA 4MNYA 3A83A 3UFAA 2BLOA 4INHA 1Q31A 1P11E 1YBWA 2UUFB 3I29A 5EXNA 1EOLA 1FDPA 1CT4E 7KMEH 1DPOA 2Z9LA 1GHXH 1TRMA 2A4GA 1GI4A 1UTQA 1L1GA 4YOJA 4IC5A 4ISIH 2ZDAH 4CRGA 2F9UA 3HKIB 5A0BA 2XBYA 3RU4T 1VITG 2UUKB 2OLGA 2ZGXH 3ZVFA 4LXBH 4CRBA 3ZZAA 1L2EA 1AFQC 1MTNC 2ANMH 2I6SA 3GYLB 1OPHB 1P2OA 2JETB 1O31A 2VIPA 3LPRA 2PUXB 4YT6H 2A5AA 1TBQH 1PPBH 1IQHA 3S7HB 3BTWE 2ZI2H 1C5RA 3ZVCA 2W3IA 2ZFSA 1FPCH 4I8HA 1P03A 1PPGE 2OD3B 1GBKA 1EZSC 1AKSB 2FTLE 1THRH 5BRRE 1TMTH 3RDZA 4B74A 4ZXXH 1QB9A 4XBDA 7LPRA 3LOXA 3NUMA 1PQ8A 1CBWB 1ANCA 4B75A 2BQ7B 1UK3A 3T26A 8GCHF 1Y5UT 2GV6A 1WSSH 1P09A 1AWHB 5T6FA 2ZDMA 3LT3A 3MNCA 4MPWA 4D7GA 1GBIA 3Q3XA 1RIWC 3QDZB 3SI4H 1HBTH 3UREA 1XUJA 2SGPE 1MMJN 2OBQA 1MKXH 1O3EA 4FUHA 4X2YA 4AGJA 2WPJS 1XUGA 3KHVA 3BG4C 1GMHG 1QFKH 3EDXB 1Y5BT 3RC5A 3LGTA 4ZHMU 4DY7B 4X8TH 1ZLRA 2J4IA 3HKJB 4ZH8A 3ZZ7A 4D9QA 2Y5GA 1GMDF 5T3HA 3URCA 2QXIA 2ZFRH 1TX8A 1O2OA 1GBBA 2A7CA 1TMBH 4DG4A 1KTTB 5L2YH 4M7GA 4Y8ZA 3TVJB 1BQYA 1E0FD 5E0JA 1GI2A 5AFYH 3U69H 1V2JT 3VB6A 1TNKA 1VJAU 1VCQA 2VGCC 1S83A 2RG3A 5HM2A 2M5TA 1TIOA 1MD8A 1XUHA 1H9HE 3SJ9A 1TOMH 4WWYA 2W7SA 2W3KA 4JZDH 2ZDKA 5CHAC 3KNXA 4OS4A 3P17H 1SOZA 2FIRH 2Z94A 1TALA 1YCPK 2BXTH 1HUTH 1O2KA 2A1DB 2F91A 3M5MA 1ESBA 3FZDA 4Y8YA 4A1XA 1TYNA 2XWBI 2BHGA 4UFEH 5TJXA 1LVYA 2OTVA 3A7VA 1AVXA 4XFQA 1GVKB 4NIVA 5E2OA 2A7JA 4Y79A 1TNLA 2GP9B 4D7FA 2BLQA 3U1IB 3T5FH 3MH6A 4ZXYH 1A0JA 1HV7A 1PPZA 1FPHH 4U30A 1T8LA 3RXOA 1TMUH 5A09A 1GCTC 1L4ZA 4HFPB 4HI3A 1SL3A 1LKBA 1TPAE 3BTTE 5GXPA 5HXFA 2BY8X 2ZPSA 3SHCH 1L1JA 1LVOA 4KELA 1O2SA 2TGPZ 3GCNA 1GI6A 1TAWA 1CU1A 1C5VA 1F0RA 1SG8B 2WPHS 4A1VA 3GDSA 3DD2H 2BTCE 2ANYA 2W26A 4IW4E 4GUXA 1KIGH 3EA8A 1HNEE 2FDAA 1O38A 1P05A 2WYJA 1BBRH 4JMYA 2LNCA 4KTSA 1V2UT 3A8BA 3NZIA 1YPHC 1H4WA 5F03A 1GBMA 5FPYA 1CO7E 2AMQA 6CHAB 3PLBA 4LOYH 1XVMA 2PW8H 3SUFA 1TA6A 1ETTH 4Y0YE 1E34B 1BJUA 3UUZA 3VB3A 1UVTH 1DY9A 4GSOA 1UTNA 1D3DB 1OKXA 1O3OA 1QY6A 3ATMA 1WQSA 2HGTH 2A4RA 4TPIZ 1C2FA 1ZYOA 3ATWA 4TWWA 3BEUA 1NRPH 3MOCA 2V3HH 2I6QA 3UNRA 1AGJA 3ZYEA 2FWWA 3TNSA 1TNJA 1BOQA 4X6NA 4NCYA 2YNBA 1MTUA 2F3CE 1ELFA 2H9HA 1PPEE 2F9OA 2D8WA 1P3EA 1SR5C 3BN9A 4E06H 2P59A 2ZFTA 4CBNA 3O8BA 2BD5A 1O3AA 3UOPA 4AZ2B 1HRTH 3UNQA 2GCTB 5C67A 3AW0A 2GMTB 1GHAF 1A0HB 3GICB 1T8OA 1V2TT 3B23B 1Z1IA 3SNCA 4K1TA 4Z0KA 1UHBA 2Z6BD 1HAZB 1J16A 1UVUH 2JH0D 2ZHQH 1FQ3A 4FVDA 2AH4X 1AUJA 2VWLA 1TB6H 1O2ZA 1MD7A 2DE8A 1J14A 3SHAH 1O3GA 2P8OB 1TLDA 4ESTE 3BTEE 3S7KB 5HGGA 4Y6DA 1AFQB 2PKSC 3F9HA 1IOEA 1AU8A 2J34A 3LGIA 1EB2A 3SUDA 4Y76A 1MBMA 4HZHA 2KAIA 1GJ5H 2PTNA 3ZVGA 4X2XA 2ALVA 2UWPA 1H1BA 3U8TH 1AB9B 3STJA 1GBLA 2ODPA 1BTZA 2BY9X 2CN0H 1BZXE 3VFEA 1HAPH 1XMNB 4X6OA 5FXLA 3RXLA 2GT7A 1EASA 3RXIA 1GBHA 1VJ9U 2G00A 1F0SA 1YLDA 1QIXB 2BD3A 3LH1A 2ZTXA 2NU0E 1ABJH 3P92A 1GPZA 3BTKE 1OWEA 2R2WU 3I77A 5EXMA 1K1MA 2C8XB 3NCLA 2FYRA 3QGJA 1S84A 1ZHPA 3BTME 1FJSA 1P0SH 1TGNA 3I78A 3S0NA 1N6YA 3D49H 3ITIA 2BDGA 1K9OE 4J1YA 2HPPH 2XBVA 4FUJA 2G52A 2BVRH 2BD8A 1VGCC 1MQ5A 1HFDA 2EI7A 3BIUH 4K1EA 1YPLH 1GGDC 3A82A 4IMQA 4XDEA 1O3LA 3SUGA 1Z7KA 5TCCA 1N8OC 1G3DA 4WXIA 5GJ4B 1C1TA 2C93B 1EX3A 5FBIA 1KTSB 1F0TA 2BZAA 3A7WA 1ELVA 2BD4A 1PYTD 1XKBC 4ISHH 1IAUA 2C8WB 2CV3A 3VPKA 2FS8A 2BY5X 2R3UA 2TGAA 3A87A 3L33A 3MNXA 1CHOF 3QTVH 2AGGX 3VB7A 1TRNA 1OS8A 1K1PA 1EB1H 1O5EH 2G5VA 4VGCC 3A89A 4IN2A 1RXPA 3KN2A 3SU3A 4CRAA 3JZ1B 2XXLA 4SGBE 3TU7H 1O33A 2BX4A 3W95A 1CVWH 1O2IA 1OWJA 4JK6A 1A3BH 1X7AC 2ZEBA 1W2KH 5T6GA 1BRUP 4JYTA 1EOJA 5ETXA 1DWDH 4NSYA 2QIQA 4UFGH 1UTJA 1DSTA 1FY8E 2FOEA 3SGBE 1UO6A 2VIQA 3SBKA 3A85A 2JETC 1BRAA 3A7TA 5EW1H 4H6TA 1NFUA 3C1KA 1HPGA 1MUEB 1P3CA 3LONA 1Y8TA 2JH6D 3VB4A 1QA7A 2OC7A 2WUCA 4HGCA 1HJ8A 1GHAG 1MAXA 4AG1A 2Q6FA 4FU9A 1C5MD 3U98H 1P2MA 4BAQB 2QY0B 4X6PA 1O5DH 2CXVA 3MO9A 1SLVB 1FI8A 1Z6EA 1AKSA 5A0CA 1KXEA 2XNIA 1W10U 1GMCF 3LKWA 2FESH 1UK2A 5DP9A 1IQNA 2BM2A 5A2MH 2GTBA 1IQGA 2HRVA 1EZQA 4ABFA 2TBSA 2FMJA 1F5RA 2C4FH 3MI4A 5GIBA 1UCYK 3RMLH 2FI4E 4FVBA 3TGKE 3RXCA 3ATKA 1SGFA 2A4QA 3PMJA 1BTPA 1RIWB 2AERH 1KXBA 2PSXA 2BOKA 2P16A 1C2HA 1C4V2 1O32A 1JXPA 2FI5E 3M7QA 4RN6A 3TK6A 2QF3A 3QGNB 3K9XB 3ZVBA 4UD9H 1FY4A 1Z71A 2VNTA 1E35B 4YT7H 4JYUH 4WH6A 3VB5A 2GDDA 1XM1A 2CJIA 1IQKA 2GZ9A 1G9IE 1W8BH 1MKWK 3KL6A 1QCPA 2ZIQH 1NPMA 3QZRA 4X1RU 4NIWA 2TPIZ 3A86A 1GGDB 1W11U 3TJUA 3SU2A 1DX5M 2V0BA 1SGRE 5EG4A 3EGKH 3F9EA 3SW2B 1ANDA 3F68H 3MH4A 3RMNH 3RMMH 3SU1A 2ZU3A 1O5AB 1YLCA 2BQWB 1O2RA 2BD2A 3PLKA 2A5KA 1LMWB 1O35A 1C4Y2 3EE0B 5DP7A 1NRSH 1O5GH 4CHAB 1SGIB 2VGCB 3LC5A 2XW9A 1AI8H 1F0UA 1K1JA 2WUBA 3F1SB 4CRCA 2SGAA 4Y10E 2WPMS 5EPNA 2BVSH 1ZPCA 1K1IA 4I8LA 2HNTC 3D23A 1C5OH 2QXJA 2EI6A 1SB1H 3QN7A 2TGDA 1TPPA 5DK1A 3IWMA 1N8OB 3ZZDA 4AG2A 4AYVB 4MNWA 1YP9A 2FO9A 2HOBA 2ZCKP 1Z8JB 2PHBA 1WTHD 4XE4A 4DOQA 4K5ZA 4X1SU 1C9PA 1FMGA 2LPRA 3LJJA 1HAXB 3RXVA 5LGOA 3UWIA 1MTSA 2SGQE 4O03A 2Z7FE 3MTYA 5IDKA 2ZFPH 1JRTA 1PYTC 5EQSA 1GHWH 4BAOB 4B71A 1O30A 1QB1A 2NWNA 1WU1A 1GHBF 4X1NU 4YTAA 1TBZH 3KQDA 2BQ6B 4U32A 3P8GA 3MMGA 7GCHF 4NA8A 4DVAU 1W0ZU 2CGAA 2F9BH 2XCNA 2ZGBH 5C20A 1HAVA 1P01A 1K22H 1LDTT 1O2NA 1O3DA 1AO5A 1P2JA 2FOCA 2J9NA 3V7TA 1O3JA 2W7UA 1BITA 4X8SH 1WAYB 4WXVA 1O2WA 1EJNA 1OWDA 2GX4A 4B73A 3A8AA 1C1QA 1SLWB 3CS7A 1ZZZA 2HPQH 1BBRK 1S85A 2BB4A 3KQBA 1QRWA 4ASHA 3ESTA 4XSKU 6GCHF 3SN8A 2HVXA 1UCYH 1A5IA 3RXJA 1XUFA 2C8YB 1G2LA 4WMEA 1UTPA 2Z3EA 2PWXA 1H8IH 1C5ZB 7ESTE
chains in the Genus database with same CATH superfamily
3QTOH 5B6OA 1KLTA 1M9UA 2QXGA 4MLFB 1YCPM 4ZHAA 1BTHH 1FONA 2ZDVH 3U8OH 3FFGA 2P3FH 2H2ZA 2OINA 1QR3E 5ESBA 3A8DA 1W3CA 1BT7A 1O3BA 3E8LA 1BMAA 1O2QA 1VZQH 4K8YA 1B5GH 3RXTA 3T25A 3PM3A 2ZKSA 5AHGH 3V0XA 2XCFA 1PQAA 3NRLA 1UJ1A 4Y7BA 1GJ6A 3RLYH 2K8IA 3PO1B 1DXWA 1GVZA 3H7OA 5GDSH 1Y3YA 4IMZA 4O97A 1V2ST 3KQCA 3QO6A 3SNAA 2QAAA 1O5BB 1LHFH 2ULLA 4OS6A 1NU7B 3MNBA 2FOMB 1ELEE 3UB0A 2ESTE 1ARCA 1WUNH 3WWBA 2FTMA 1HB0B 1LHGH 1TNIA 1GBTA 4MNXA 1SI5H 5DSFA 3W94A 1HDTH 1O2UA 1YCPH 1OYTH 2BOHB 5EU8A 5DP5A 1T4UH 4OS1A 5DP8A 1B7XB 1H9LB 1QURH 5FPTA 1LKAA 2ZFFH 1EAUA 3CP7A 3O8RA 4GHQA 2OC1A 3STIA 3AW1A 4NFFA 5DP4A 3WWFA 5EODA 2EC9H 1O3IA 5LPFA 3Q77A 4GHTA 1UHBB 2H6MA 1Y59T 2V3OH 2J98B 1EAWA 5FHTA 1MKXK 1VR1H 1NC6A 2ANKH 2Q1JA 4H42U 1PJPA 4BTIB 1MTVA 3G01A 1DICA 2AMPA 1W7XH 2O9QA 1O36A 2BDAA 3SJ8A 4CBOA 1NRRH 3S9BA 1T4VH 3BTDE 1ACBE 3SNBA 2BXUH 2OC8A 1LO6A 3BG8A 1THSH 4R8TB 1PFXC 2FOAA 5J4QA 5JB8S 2F43B 4O3UA 1T8MA 1AZZA 2CHAC 1IQEA 1ZMLA 3TK9A 1E37B 1GVLA 2DE9A 2FOFA 4Q80A 1WQVH 1LPZB 4F49A 4FU7A 2GT8A 3RXGA 1ORFA 4BOHA 4MPXA 1C1MA 1OYQA 3HPTB 3TJNA 5EIYA 2G51A 2J92A 1AMHA 3MO3A 5C0UA 2AIQA 1WOFA 1BHXB 1C1WH 3IITA 4RSPA 1NT1A 3QX5H 3ZV8A 1INCA 1GDUA 1SVPA 4A92A 1ZPZA 2ZU4A 1OXGA 3ZZ4A 2PTCE 1OWIA 3VXEH 4D8NA 3S9CA 3SORA 1QJ7B 3LIWA 2VVCA 1RTLA 2OQ5A 2FLRH 2PGBB 1TABE 3F0OA 2V7QD 5LH8A 1QA0A 4E7RG 3E1XB 1CQQA 1KYNA 4TWYA 1NESE 1ID5H 1XUKA 3P95A 2B9LA 3PROA 5IYTA 4AOQA 2Z9KA 4LK4A 4TT3D 3RXBA 1UCYE 1SFIA 1GJ7B 1O34A 1DFPA 2PP6A 1XVOA 5BPEA 5FAHA 2VIVA 3ZVDA 2VH6A 1CT2E 1A7SA 1BDAA 1NZQH 1ZGIA 3D65E 1LHDH 4WJG2 2JKHA 4DCDA 1SQAA 1W13U 6CHAC 4KKDA 3SV2H 2PKAA 1LTOA 5GCHF 3SU0A 1EPTA 3DFJA 3U9AH 3H5CB 3PTBA 1JBUH 3BV9B 1O3CA 1GMHF 4ABDA 3M61U 4RKJB 1C1OA 4Z1MD 3RLWH 3W1EA 4NWLA 4F4OC 3MU8A 4XRNA 2OXSA 5JBCS 2ZNKH 3ZZ9A 4ASUD 1BA8B 2AEIH 1C5NH 2R2MB 1G3EA 1ZHMA 1FAXA 2WV4A 4ABGA 3OTPA 1LHEH 1OHHD 2ANWA 4LZ1H 3U1JB 1GHZA 3MHWU 5FBEA 4KTCA 3MFJA 4AB9A 3TGIE 1ZMNA 3ZZBA 3GY3A 4CH2B 3MO6A 4X6MA 1BCUH 3QUMP 1V2LT 2ZA5A 1NO9H 3BIVH 3URDA 2ZTZA 1DVAH 1HAVB 4AORA 3E0NB 3D62A 2QC2A 1C5QA 1BMFD 2HWLB 4NZQA 1KSNA 2XOKD 1G30B 3ZVEA 1EZXC 1QZ8A 4DW2U 1XKAC 3O8CA 1DT2A 1ETRH 3A80A 4ABAA 1MZDA 5AF9H 3Q3KA 3PMHB 2QYIA 2ZHWH 1DWCH 4DIHH 2ZWLH 1NU9A 2QV1A 3TJVA 5JYIA 2WPDD 5PTPA 4CH8B 2GJGA 1C2MA 4AX9H 2Z9IA 2P95A 3RUOA 2Y5HA 5F8ZA 5JDUB 1TE0A 1D6WA 1JMOH 5T6DA 8GCHG 1GCDA 1Z8IB 1TPOA 4DURA 2QCYA 3E0PB 2BDYA 1C2DA 2ILNA 1P2IA 1GJ4H 1BRCE 2FXRA 1O2VA 2R0LA 1G3BA 4IBLH 1CHOG 1SPJA 1O2XA 1Z1JA 5EQQA 1S82A 1ZJDA 4JCNA 1IQFA 3NPSA 1MCTA 1A61H 4AB8A 5JBBS 2BX3A 2B7DH 3GDVA 3UTUH 2GCHG 2R9PA 3IG6B 3PTNA 1PQ7A 1O5FH 2ZGHA 3F9FA 1P9SA 4BXWA 4NA7A 5EOKA 2J38A 3N7OA 5C0TA 5E0HA 1HAIH 9ESTA 4I7YH 5FCKA 2BLWA 2WPKS 3ENSB 2WINI 4B2AA 5FPSA 5DO4H 3BTHE 5L6NH 3GY4A 5DGJA 5AVDA 9LPRA 3RXDA 6GCHG 3S9AA 4BANB 1FY3A 5L30H 1J9CH 2HALA 2ZZUH 5C2ZA 1EP6A 2VVUA 3ODFA 1DITH 5EW2H 2B8OH 2FM2A 1AWFH 1TPSA 1BHXF 4AFQA 1PPFE 4BXSA 2P8OC 3M5OA 3PLPA 1DSUA 2WZQA 3V12A 4CR9A 1MABB 1YM0A 2VINA 4O9VA 3A7YA 3MQKC 1LVBA 3M3TA 1C1UH 1GHBG 2VWNA 1EXFA 1O0DH 5F6MA 2IPQX 1GJBB 3FVFB 1JIMA 4VGCB 1UTLM 2ZDLA 1K28D 2FYQA 2J5UA 3SGQE 2K1QA 3CS0A 3M36A 3UR9A 1AB9C 1ZGVA 2BYAX 2GMTC 4GPGA 1YF4A 3H7TA 3M7UA 1FLEE 4WY3A 1G32B 1O2JA 1LPGB 4FXGH 3PWCA 2XRCA 1TRYA 1FN6A 2NU4E 1KDQB 2ZHEH 4B76A 4P02A 1XX9A 1ZTJA 3RXPA 1EAXA 4NA9H 2GZ8A 1YC0A 1L1NA 5ESTE 1PPCE 1MKWH 3GY8A 2Y80A 1SBWA 3R3GB 1QRZA 4GCHG 6ESTA 3B8JA 4E05H 3DSGA 1O2YA 4NGAH 1FY5A 4UONA 4FUIA 1SQOA 1Y3XA 4Y8XA 1SGCA 1GDNA 4ZROA 4KGAA 3FP7E 2GKVE 1HJAB 3VXFH 3BEIB 1RTKA 2UWOA 1NS3A 1A3EH 8KME2 2VIDA 1RS0A 5E0GA 1SGYE 1HIAB 1TX6A 1OOKB 3NWUA 3OTJE 2WSSD 3SV6A 3L3TA 3VG8A 4Q7YA 3R0FA 1C2LA 3PMBB 3LGVA 5A0AE 1GI5A 1JIRA 1IQJA 1GJ8B 1QTFA 3RXRA 1YPEH 2ZCLP 2WV5A 3SU5A 1MAYA 1C1SA 2BDHA 4A5TS 3SO3A 1DDJA 3F2GA 1SGEE 2FPZA 2W6ID 2XYAA 2Q6GA 1V2VT 1MU6B 1UVPA 5L2ZH 2XBWA 4AYYB 4K8BA 3RXFA 5GPIB 1F5KU 1T31A 4QT8C 1ELCA 2VIWA 3GOVB 4XOJA 3SJIA 1Q3XA 1ETSH 3A81A 1LHCH 1NFWA 2SGEE 1TGTA 3MH7A 3HGPA 3B9FH 3FAOA 4K69A 5C5NA 3GCTF 3E6PH 4AN7A 5LPEA 5LPRA 1TONA 3MNSA 4SGAE 2D1JA 1DY8A 1GI9B 1Y3UA 4IN1A 5JBAS 2THFB 1ZTLA 1ZSLA 1GMCG 3ATIA 1NBMD 4K2YA 1K21H 1CHGA 1NM6A 2FOHA 3UIRA 1LPKB 2XC5A 4TYDA 4MNVA 1RFNA 1ZMJA 1DANH 2HNTE 4NWKA 3OYPA 3P8NA 1P2QA 2C8ZB 3UQOA 1K1LA 3AASA 4XBBA 1GBCA 2WPLS 1DUEA 1K2I1 3TITA 1YPHE 5GWZA 1P12E 1J15A 3RXEA 3SJKA 3UQVA 1ZTKA 1LQEA 1TX7A 1HLTH 3SOSA 1CSOE 4I31A 4Q7ZA 2BLVA 2KFWA 1EJAA 1EJMA 1V2OT 3OSYA 1BTUA 1C5PA 2A31A 3RXUA 3ATLA 3AAVA 1PQ5A 3A8CA 2HNTF 3LDXH 1OX1A 3SNEA 2FOGA 1ZR0A 1KLIH 1NRQH 1O2MA 3TPIZ 2XWAA 1CE5A 2O8WA 1GI1A 4X8VH 2CMYA 2EA3A 4U01A 4A1TA 4ZAEA 4GVUA 4CR5A 3TLOA 4YZUA 1C9TA 1HXEH 1KDQA 1RJXB 1ELDE 2XTTB 5TCAA 2QF4A 3H09A 1SGQE 1TGCA 2C90B 2KR7A 1S6HA 1P57B 4OS2A 2K0QA 2FEQH 4UE7H 5FX5A 3VGCB 3EYDA 1GG6B 4A7IB 1KXDA 2O8MA 2GCHF 4MVNA 4ABEA 1GBJA 3OY6U 1SGFG 1SGPE 1Y3WA 4NIXA 2FX6A 3OY5U 5JPMH 3ZVAA 3HATH 4FUDA 3T28A 2QF5A 1EKBB 2EEKA 1TFXA 2PKAB 4DT4A 3LU9B 4WH8A 4KP0A 1HAGE 1IQIA 1GL0E 2ZU5A 3Q76A 1FY1A 1XXFA 3EA7A 1YGCH 4B6EA 3A88A 1AZ8A 1EPTC 1A46H 5DKMA 4AGKA 1NFXA 1O5CB 1D3TB 3K2UA 4TY6A 1NTPA 5G4BA 1OSSA 3UR6A 1ANEA 1D9IA 1LVMA 2ZO3H 5FCRA 1ESTA 1QL7A 1BBRE 4JZFH 5C17A 4FUCA 3VGCC 3BG4B 5HM9A 2FZZA 2IJOB 1V3XA 2QGRA 2XC4A 3DUXH 1FZZA 2YOLA 2CF9H 3SI3H 5A8YA 5EGMA 3BEFB 5GCHG 2A32A 3RM0H 1QJ1B 1FAKH 3ELAH 1IHTH 4X1QU 3UOUA 1E38B 3GS9A 3ZZ3A 1GHVH 3SJOA 1SMFE 2C3SA 2GZ7A 3K65B 5EQRA 5AFZH 3KYFA 2YNAA 3ZZ5A 3JZ2B 1GBDA 3Q3YA 1JOUB 1S5SA 1FXYA 2Z3CA 4UFDH 1Z6JH 2IN2A 1DLKB 2FI3E 5E8EH 5DP6A 2XNDD 3O8DA 4A6LA 3Q00A 1B0EA 2ZP0H 2R3YA 2A2QH 2QA9E 4I8KA 5KGOA 4DIIH 1C2KA 1H9IE 3A84A 1ABIH 2Y82A 1SHYA 2YMSC 2QE7D 1D3PB 3F9GA 3DT0H 5HIZA 1O3PB 1FIWA 1MTNB 1VITH 3GCHC 5HKKD 1GJCB 1KMHB 1K1OA 2RCEA 8LPRA 2Y7ZA 4WF8A 2ZPRA 4Q2KA 4YXWD 1YYY1 2AFQB 1V2QT 3OFND 4RKOB 1SKYE 1VKYA 2IJD1 1GI0A 2VWOA 2VB0A 3M5LA 1S0RA 3SZEA 5CHAB 2ASUB 2GV7A 2PR3A 3TJOA 1AE5A 1HYLA 2BZ6H 2BY7X 2J2UA 1DWEH 1W0KD 4YOGA 3BSQA 1DM4B 2F9NA 3FZZA 1QBNA 1KLJH 5EXLA 3KQEA 4GLYA 2G55A 3GYMA 2RDEA 3N7DA 3OAAD 2GD4B 1C2IA 3GY6A 1TBRH 5DPAA 3V13A 3FO8D 1DXPA 1O3FA 1MH0A 3RU4D 2BMGB 2ZU2A 3GCHB 1J8AA 1QGFA 1Y5AT 3GCOA 3FP8E 4ZUHA 4OGYA 2FLBH 4ABJA 2STAE 2RA0A 5C5OA 2RDLA 1Z8RA 3GY2A 4X2WA 1KY9A 3DA9B 3SQEE 2D26C 2ZC9H 1IQMA 1HIAA 4X1PU 3NXPA 2BVXH 1H8HD 1AY6H 1P8VC 2Z9JA 4D76A 4ZKSU 2RA3A 4NZLA 1BMNH 3RXQA 1MU8B 3DSPA 1OWHA 2F9VA 1C1RA 1C5WB 1P9UA 1C5SA 5I25A 4CREA 4PROA 4FUBA 4YOIA 4CRDA 3QZQA 1F92A 1NROH 3T27A 3PO1C 1K1NA 3PV4A 3GDUA 4DT7B 1P02A 3C27B 4AFZA 1G2MA 3TH3H 6LPRA 2H5DA 1LQDB 1F2SE 1BB0B 3SZNA 1CA8B 3BTGE 1BTXA 4RT0A 1W12U 2WHXA 2V35A 5C1UA 4Y11E 2JH5D 1GJDB 3GY5A 4IS5A 1TNHA 3DHKH 4AFUA 1C5YB 1NFYA 5HMAA 1E36B 2G81E 3E91A 3HK3B 2ZGCA 3SV7A 1CT0E 1EAIA 2H9TH 3SU4A 1HAHH 1N6XA 2YMSB 2TRMA 1ELTA 1JWTA 2EI8A 4NSVA 1JRSA 4OGXA 1WYKA 2LP6A 4E7NA 5K7RA 1SLXB 4Y0ZE 5C3NA 2J94A 4ISNA 5C1YA 2PFEA 2ZG0H 1GG6C 1O2LA 3MU5A 1AE8H 4BTTB 4IC6A 1MTWA 1MBQA 1W0YH 3QK1A 3FN8A 3T2NA 2O8TA 2JJ2D 3RM2H 4FU8A 1RD3B 3RC4A 1UVSH 3NK8A 1DWBH 2VH0A 1ZPBA 3BF6H 3TK5A 3KIDU 3MWIU 1CGIE 2NU1E 1P2KA 5JB9S 4P00A 1FN8A 2SFAA 2KCYA 4ACBA 2DUCA 2VWMA 3E3TA 1OP0A 2ZU1A 3RC6A 1FIZA 1NRNH 3BTQE 2TGTA 4UFFH 2AGEX 3U8RH 1C2JA 4D9RA 5EPYA 2Z9GA 3LH3A 1V2KT 4JYVH 1T32A 3HGNA 2KZ4A 1GI3A 1CA0B 4GAWA 1UTKA 3SV8A 2ZHFH 2A4OA 4I8JA 7GCHG 2H5CA 3RP2A 1THPB 3A7XA 3ZYDA 2SGFE 4NFEA 1H8DH 5SGAE 3SQHE 5GNDA 1EUFA 4BAHB 3LGUA 1V2NT 1NY22 4FUEA 4WMFA 3SV9A 1HAOH 4WVPE 3RXAA 1VCPA 3UPEA 5E2PA 2PGQB 2AIPA 1AIXH 1GMDG 1N1LA 1GHYH 4TSFD 1AQ7A 4BAKB 2KX4A 4INKA 1BUIA 4NG9H 3AAUA 2F83A 2O8LA 1AVGH 4XBCA 1A4WH 2SNVA 4ISLA 4WMDA 3M7TA 2PKSB 1S81A 4GCHF 1ZJKA 1HCGA 1ZRKA 2OQUA 4Y7AA 1F5LA 1UK4A 4INLA 1AN1E 5K0HA 1D3QB 4OS5A 1VITF 1QRXA 2FODA 4MQAA 1ZSJA 1DE7H 4Z6AH 3OEED 3MU4A 2W5EA 1SGDE 3HK6B 1FUJA 2V6NA 2G5NA 2FOBA 2BDCA 2ZQ1A 4BTUB 3KEEA 3RMOH 1AUTC 2OUAA 3P8FA 1WBGB 4AFSA 1BMMH 4YM9A 1GDQA 4B2BA 3RU4E 2G4TA 1BIOA 1LCYA 3ZZCA 1IHSH 1VGCB 8ESTE 1QL9A 3TGJE 4JZIA 3M35A 1O2TA 3UNSA 4ABBA 1AVWA 1CGHA 1QB6A 1FV9A 2UWLA 3BTFE 1SHHB 2QXHA 4KTUA 4ACAA 3CENA 1SGNE 4MG3A 2ZPQA 2VBCA 2ZDNA 3KCGH 1DS2E 3LJOA 1HXFH 3EAJA 2ZF0H 2GCTC 3M5NA 4K1SA 4DJZB 1TGSZ 1GBEA 4MPVA 1TWXB 2FX4A 2P93A 4JZEH 1V2MT 1WTGH 4YLUA 1EATA 1G36A 1SLUB 2ZGJA 1ARBA 4ZKNU 3T29A 5KEDA 2H9EH 4OS7A 2FS9A 1C5TA 1XXDA 1RRKA 4DGJA 2SNWA 1C5LH 2Y7XA 1QBVH 2Z3DA 1IQLA 3A7ZA 4MTBA 4X8UH 1MZAA 1ZOMA 1C5XB 3GISB 3EQ0H 2PLXA 4F55A 1O3MA 1MQ6A 3TH4H 1V2RT 1UTMA 2JIZD 4YO9A 1VCWA 2BDBA 4NIYA 2OP9A 1BTWA 3RXSA 3OU0A 4JK5A 2R0KA 4YESB 3T62A 3MH5A 2D2DA 2UUJB 2G8TA 1CBWC 1DUAA 1C4U2 1C2EA 2P94A 2WPIS 2ALPA 4ABHA 1DLEA 1HJ9A 2P3TB 3QLPH 1QHRB 1GCTB 1BMLA 1EPTB 1EZUC 2EY4C 2B5TB 3RXMA 2HLCA 3LC3A 3PV2A 2F9PA 3RXKA 4FUFA 3PWBA 1L0ZA 2A45B 1YKTA 2AGIX 1GJ9B 1Q2WA 2GGVB 4B1TA 1YPGH 5B6LA 1SOTA 3DFLA 4FUGA 1C1VH 1F7ZA 1O3NA 4I8GA 4THNH 3PB1E 2AMDA 5EJ1A 4ISOA 1ELGA 1A5GH 1P2NA 1V2PT 5HYOA 2IOTA 4Y71A 5CE1A 1A2CH 4Q7XA 3CNRA 2B0FA 1AD8H 2NU3E 1ANBA 2ODYB 2BD7A 2OCVB 5A8XA 1GI7B 1K0HA 5IK2D 1MCVA 3ODDA 2QN5T 1YPKH 3MU0A 3P70B 1BRBE 1Y3VA 3TH2H 2A5IA 2TIOA 4TY7A 5F8TA 3FP6E 4K3JA 2QF0A 3M3VA 4JZ1A 1O3HA 4UDWH 4CHAC 2G4UA 1SGTA 1WV7H 4CRFA 2P3UB 4ZHLU 2PSYA 1QQUA 3M3SA 4MDSA 1BJVA 1AHTH 1P06A 2ZCHP 3K6ZA 2VVVA 4ZMAH 2F4LA 2ODQA 4ZKOU 1E1QD 1YPJH 1ZRBA 5KECA 2AS9A 1D4PB 1CGJE 5C1XA 2A0QB 3V3MA 1A1RA 1GL1A 1TQ0B 3LGYA 1TGBA 1SQTA 3DCLA 1P10A 2XC0A 1CA0C 1KXCA 1QQ4A 4LZ4B 2IPHA 2ZECA 5DJ7A 1GBFA 1ELBA 1B0FA 3SUEA 1WCZA 2ZFQH 2PV9B 1O2GH 3P8OA 5CDFE 4TPYA 1A5HA 2CHAB 1ELAA 2FP7B 1O2PA 2KCOA 1HJAC 3FANA 1QJ6B 1W7GH 2BD9A 4MPUA 2OC0A 4J2YB 3FKSD 3M37A 3PMAB 3K6YA 1OP2A 1OP8A 1UTOA 3ZZ8A 5ABWA 2XBXA 1C1NA 1EQ9A 1KXFA 4X2VA 3SNDA 1T7CA 1QL8A 4YLQH 1O37A 1A0LA 4HG6A 1TA2A 2BY6X 4I32A 4B2CA 1RTFB 1UMAH 2AYWA 3VEQB 4UEHH 1GJAB 2VJ1A 1C1PA 2ZTYA 4O3TA 3MYWA 1SC8U 2HLDD 2VU8E 1SSXA 3GCTG 2VIOA 4X0WU 3AVZA 4IGDA 1GWAA 5T1VA 3E90B 3PYHA 5FX6A 3E16B 2GVFA 1DOJA 1UVOA 2NU2E 5EJLA 4R0IA 1O39A 1Z8GA 4U2WA 1QNJA 4HTCH 3SGAE 1ZSKA 2Y81A 3ZV9A 4BAMB 4H6SB 1OWKA 1PPHE 2Y5FA 1ESAA 5A8ZA 4I33A 2CK3D 2STBE 1C5UA 3GY7A 1GBAA 1T8NA 2BDIA 5DP3A 5JBTA 1NN6A 2GDEH 1V6DA 1G37A 3QWCH 1V2WT 3MU1A 1TNGA 1P04A 3LGWA 1TOCB 1ZHRA 3RXHA 1TQ7B 5J4SA 2O8UA 3TNTA 2A7HA 1AFEH 3NKKA 3P6ZB 2M2AA 4BNRA 1BTYA 2UUYA 1EP5A 3L6PA 4K60A 4ZKRU 1C2GA 2A2XH 2KM0A 2PUQH 5F8XA 3UWJH 2J95A 3EA9A 1U6QA 1O3KA 1S6FA 2Q6DA 3F6UH 3KF2A 1L4DA 4H4FA 1S0QA 1KXAA 2KCPA 5I46H 1O2HA 2SGDE 2WYGA 2ZQ2A 2OBOA 1G3CA 3UY9A 3WW7A 3SU6A 3PRDA 5H4IB 1FNIA 3S69A 2ZHDA 1HAYB 4ABIA 3WY8A 1D6RA 1SFQB 3KGPA 1HGTH 1QBOA 1W14U 2KAIB 2CF8H 3TIUA 1XUIA 3ZZ6A 5CMXH 1GI8B 1RGQA 5DG6A 5CHBA 1YPMH 1J17T 2Y6TA 3OX7U 4AC9A 2H1UA 4MNYA 3A83A 3UFAA 2BLOA 4INHA 3F2HA 5FL7D 1Q31A 1WDIA 1P11E 2WV9A 1YBWA 2UUFB 4OM9A 3I29A 5EXNA 1EOLA 1FDPA 1CT4E 7KMEH 1DPOA 2Z9LA 1GHXH 1TRMA 2A4GA 1GI4A 1UTQA 1L1GA 4YOJA 4IC5A 2JJ1D 4ISIH 2ZDAH 4CRGA 2F9UA 3HKIB 5A0BA 2W6JD 2XBYA 3RU4T 1VITG 2UUKB 2OLGA 2ZGXH 3ZVFA 1YLNA 2HVYB 4LXBH 4CRBA 3ZZAA 1L2EA 1AFQC 1MTNC 2ANMH 2I6SA 3GYLB 1OPHB 1P2OA 2JETB 1O31A 2VIPA 3LPRA 2PUXB 4YT6H 2A5AA 1TBQH 1PPBH 1IQHA 3S7HB 3BTWE 2ZI2H 1C5RA 3ZVCA 2W3IA 2ZFSA 1FPCH 4I8HA 1P03A 1PPGE 2L74A 2OD3B 3ZIAD 1GBKA 1EZSC 1AKSB 2FTLE 1THRH 5BRRE 1TMTH 3RDZA 4B74A 4ZXXH 1QB9A 4XBDA 7LPRA 3LOXA 3NUMA 1PQ8A 1CBWB 4FETA 1ANCA 4B75A 2BQ7B 1UK3A 3T26A 8GCHF 1Y5UT 2GV6A 1WSSH 1P09A 1AWHB 5T6FA 2ZDMA 3LT3A 3MNCA 4MPWA 4D7GA 1GBIA 3Q3XA 1RIWC 3QDZB 3SI4H 5DN6D 1HBTH 3UREA 1XUJA 2SGPE 1MMJN 2OBQA 1MKXH 1O3EA 4FUHA 4X2YA 4AGJA 4I86A 2WPJS 1XUGA 3KHVA 3BG4C 1GMHG 1QFKH 3EDXB 1Y5BT 3RC5A 3LGTA 4ZHMU 4DY7B 4X8TH 1ZLRA 2J4IA 3HKJB 4ZH8A 3ZZ7A 4D9QA 2Y5GA 1GMDF 5T3HA 3URCA 1EFRD 2QXIA 2ZFRH 1TX8A 1O2OA 1GBBA 2A7CA 1TMBH 2OK5A 1KTTB 4DG4A 5L2YH 4M7GA 4Y8ZA 5F53A 3TVJB 1BQYA 1E0FD 5E0JA 1GI2A 5AFYH 3U69H 1V2JT 3VB6A 1TNKA 1VJAU 1VCQA 2VGCC 1S83A 2RG3A 5HM2A 2M5TA 1TIOA 1MD8A 1XUHA 1H9HE 3SJ9A 1TOMH 4WWYA 2W7SA 2W3KA 4JZDH 2ZDKA 5CHAC 3KNXA 4OS4A 3P17H 1SOZA 2FIRH 2Z94A 1NBME 1TALA 1YCPK 2BXTH 1HUTH 1O2KA 2A1DB 2F91A 3M5MA 4FOUC 1ESBA 3FZDA 4Y8YA 4A1XA 1TYNA 2V3MA 2XWBI 2BHGA 4UFEH 5TJXA 1LVYA 2OTVA 3A7VA 1AVXA 4XFQA 1GVKB 4NIVA 5E2OA 2A7JA 4Y79A 1TNLA 2GP9B 4D7FA 2BLQA 3U1IB 3T5FH 3MH6A 1H8ED 4ZXYH 3UAIC 1A0JA 1HV7A 1PPZA 1FPHH 4U30A 1T8LA 3RXOA 1TMUH 3F3BA 5A09A 1GCTC 1L4ZA 4HFPB 4HI3A 1SL3A 1LKBA 1TPAE 3BTTE 5GXPA 5HXFA 2BY8X 2ZPSA 3SHCH 1L1JA 1LVOA 4KELA 1O2SA 2TGPZ 3GCNA 1GI6A 1TAWA 2J97A 1CU1A 1C5VA 1F0RA 1SG8B 2WPHS 4A1VA 3GDSA 3DD2H 2BTCE 2ANYA 2W26A 4IW4E 4GUXA 1KIGH 3EA8A 1HNEE 2FDAA 1O38A 1P05A 2WYJA 1BBRH 4JMYA 2LNCA 4KTSA 1V2UT 3A8BA 3NZIA 1YPHC 1H4WA 5F03A 1GBMA 5FPYA 1CO7E 1YWUA 2AMQA 6CHAB 3PLBA 4LOYH 1XVMA 3KQ5A 2PW8H 3SUFA 1TA6A 1ETTH 4Y0YE 1E34B 1BJUA 3UUZA 3VB3A 1UVTH 1DY9A 4GSOA 1UTNA 1D3DB 1OKXA 1O3OA 1QY6A 3N99A 3ATMA 1WQSA 2HGTH 2A4RA 4TPIZ 1C2FA 1ZYOA 3ATWA 4TWWA 3BEUA 1NRPH 3MOCA 2V3HH 2I6QA 3UNRA 4M9FA 1AGJA 3ZYEA 2FWWA 3TNSA 1TNJA 1BOQA 4X6NA 4NCYA 2YNBA 1MTUA 2F3CE 1ELFA 2H9HA 1PPEE 2F9OA 3U28C 2D8WA 1P3EA 1SR5C 3BN9A 4E06H 2P59A 2ZFTA 4CBNA 3O8BA 2BD5A 1O3AA 3UOPA 4AZ2B 1HRTH 3UNQA 2GCTB 5C67A 3AW0A 2GMTB 1GHAF 1A0HB 3GICB 1T8OA 1V2TT 3B23B 1Z1IA 3SNCA 4K1TA 4Q4LA 4Z0KA 1UHBA 2Z6BD 5C94A 3AK5A 1HAZB 1J16A 1UVUH 2JH0D 2ZHQH 1FQ3A 4FVDA 2AH4X 1AUJA 2VWLA 1TB6H 3FOAA 1O2ZA 1MD7A 2DE8A 1J14A 3SHAH 1O3GA 2P8OB 1TLDA 4ESTE 3BTEE 3S7KB 5HGGA 4Y6DA 1AFQB 2PKSC 3F9HA 1IOEA 1AU8A 2J34A 3LGIA 1EB2A 3SUDA 4Y76A 1MBMA 4HZHA 2KAIA 1GJ5H 4F48B 2PTNA 3ZVGA 4X2XA 2ALVA 2EQNA 2UWPA 1H1BA 3U8TH 3DSOA 1UW7A 1AB9B 3STJA 1GBLA 2ODPA 1BTZA 2BY9X 2CN0H 1BZXE 3VFEA 1FX0B 1XMNB 1HAPH 4X6OA 5FXLA 1YY3A 3RXLA 2GT7A 1EASA 3RXIA 1GBHA 1VJ9U 2G00A 1F0SA 1YLDA 1QIXB 2BD3A 3LH1A 2ZTXA 2NU0E 1ABJH 3P92A 1GPZA 3BTKE 1OWEA 2R2WU 3N7EA 4RI0A 2AHME 3I77A 5EXMA 1K1MA 2C8XB 3NCLA 2FYRA 3QGJA 1S84A 1ZHPA 3BTME 1FJSA 1P0SH 1TGNA 3SYJA 3I78A 3S0NA 1N6YA 3D49H 3ITIA 2BDGA 1K9OE 4J1YA 2HPPH 2XBVA 4FUJA 5EJZA 2G52A 2BVRH 2BD8A 1VGCC 1MQ5A 1HFDA 2EI7A 3BIUH 4K1EA 1YPLH 1GGDC 3A82A 4IMQA 4XDEA 5HIYA 1O3LA 3SUGA 1Z7KA 5TCCA 1N8OC 1G3DA 4WXIA 5GJ4B 1C1TA 2C93B 1EX3A 5FBIA 1KTSB 1F0TA 2BZAA 3A7WA 1ELVA 2BD4A 1PYTD 1XKBC 4ISHH 1IAUA 2C8WB 2CV3A 3VPKA 2FS8A 2BY5X 2R3UA 2TGAA 3A87A 3L33A 3MNXA 1CHOF 3QTVH 2AGGX 3VB7A 1TRNA 1OS8A 1K1PA 1EB1H 3OE7D 1O5EH 2G5VA 4VGCC 3A89A 4IN2A 2KCAA 1RXPA 3KN2A 3SU3A 4CRAA 3JZ1B 2XXLA 4SGBE 3TU7H 1O33A 2BX4A 3W95A 1CVWH 1O2IA 1OWJA 4JK6A 1A3BH 1X7AC 2ZEBA 1W2KH 5T6GA 1BRUP 4JYTA 1EOJA 5ETXA 2J98A 1DWDH 4NSYA 2QIQA 4XD7D 4UFGH 1UTJA 1DSTA 1FY8E 2FOEA 3SGBE 2RFKC 1UO6A 2VIQA 3SBKA 3A85A 2JETC 1BRAA 3A7TA 5EW1H 4H6TA 1NFUA 3C1KA 1HPGA 1MUEB 1P3CA 3LONA 1Y8TA 4ZCNA 2JH6D 3VB4A 1QA7A 2OC7A 2WUCA 4HGCA 1HJ8A 1GHAG 1MAXA 4AG1A 2Q6FA 4FU9A 1C5MD 3PV5A 3U98H 1P2MA 4BAQB 2QY0B 4X6PA 1O5DH 2CXVA 3MO9A 1SLVB 1FI8A 1Z6EA 1AKSA 3KYGA 5A0CA 1KXEA 2XNIA 1W10U 1GMCF 3LKWA 2FESH 1UK2A 5DP9A 1IQNA 2BM2A 5A2MH 2GTBA 1IQGA 2HRVA 3PRBA 1EZQA 4ABFA 2TBSA 2FMJA 1S6LA 1F5RA 2C4FH 3MI4A 5GIBA 1UCYK 3RMLH 2FI4E 4FVBA 3TGKE 3RXCA 3ATKA 1SGFA 2A4QA 3PMJA 1BTPA 1RIWB 2AERH 1KXBA 2PSXA 2BOKA 2P16A 1C2HA 1C4V2 1O32A 1JXPA 2FI5E 3M7QA 4RN6A 3TK6A 2QF3A 3QGNB 3K9XB 2L6OA 3ZVBA 4UD9H 1FY4A 1Z71A 2VNTA 1E35B 4YT7H 4JYUH 4WH6A 3VB5A 3F0PA 2GDDA 1XM1A 2CJIA 1IQKA 2GZ9A 1G9IE 1W8BH 1MKWK 3KL6A 1QCPA 2ZIQH 1NPMA 3QZRA 4X1RU 4NIWA 2TPIZ 3A86A 1GGDB 1W11U 3TJUA 3SU2A 1DX5M 2V0BA 1SGRE 5EG4A 2JDID 3EGKH 3F9EA 3SW2B 1ANDA 3F68H 3MH4A 3RMNH 3RMMH 3SU1A 2ZU3A 1O5AB 1YLCA 2BQWB 1O2RA 2BD2A 3PLKA 1E79D 2A5KA 1LMWB 1O35A 1C4Y2 3EE0B 5DP7A 1NRSH 1O5GH 4CHAB 1SGIB 2VGCB 3LC5A 2XW9A 1AI8H 1F0UA 1K1JA 1SQRA 2WUBA 3F1SB 4CRCA 2SGAA 4Y10E 2WPMS 5EPNA 2BVSH 1ZPCA 1COWD 1K1IA 4I8LA 2HNTC 3D23A 1C5OH 2QXJA 2EI6A 1SB1H 3QN7A 2TGDA 1TPPA 5DK1A 3IWMA 1N8OB 3ZZDA 4AG2A 4AYVB 4MNWA 1YP9A 2FO9A 2HOBA 2ZCKP 1Z8JB 2PHBA 1WTHD 4XE4A 4DOQA 4K5ZA 4X1SU 1C9PA 1FMGA 2LPRA 3LJJA 1HAXB 3RXVA 5LGOA 3UWIA 1MTSA 2SGQE 4O03A 2Z7FE 3MTYA 5IDKA 2ZFPH 1JRTA 3EE7A 1PYTC 5EQSA 1GHWH 4BAOB 4B71A 4Q63A 1O30A 1QB1A 2NWNA 1WU1A 1GHBF 4X1NU 4YTAA 1TBZH 3KQDA 1W0JD 2BQ6B 4U32A 3P8GA 3MMGA 7GCHF 4NA8A 4DVAU 1W0ZU 3F2FA 2CGAA 2F9BH 2XCNA 2ZGBH 5C20A 4RT1A 1HAVA 1P01A 1K22H 1LDTT 1O2NA 1O3DA 1AO5A 1P2JA 2FOCA 2J9NA 3V7TA 1O3JA 2W7UA 3OEHD 1BITA 2LELA 4X8SH 1WAYB 4WXVA 1O2WA 1EJNA 4B6FA 1OWDA 2GX4A 4B73A 3A8AA 1C1QA 1SLWB 3CS7A 1ZZZA 2HPQH 1BBRK 1S85A 2BB4A 3KQBA 1QRWA 2YMSD 4ASHA 1WXRA 3ESTA 4XSKU 6GCHF 3SN8A 2HVXA 1E1RD 1A5IA 1UCYH 1XUFA 3RXJA 2C8YB 1G2LA 4WMEA 1UTPA 2Z3EA 2PWXA 1H8IH 1C5ZB 7ESTE
chains in the Genus database with same CATH topology
3QTOH 5B6OA 1KLTA 1M9UA 2QXGA 4MLFB 1YCPM 4ZHAA 1BTHH 1FONA 2ZDVH 3U8OH 3FFGA 2P3FH 2H2ZA 2OINA 1QR3E 5ESBA 3A8DA 1W3CA 1BT7A 1O3BA 3E8LA 1BMAA 1O2QA 1VZQH 4K8YA 1B5GH 3RXTA 3T25A 3PM3A 2ZKSA 5AHGH 3V0XA 2XCFA 1PQAA 1UJ1A 4Y7BA 1GJ6A 3RLYH 3PO1B 1DXWA 1GVZA 3H7OA 5GDSH 1Y3YA 4IMZA 4O97A 1V2ST 3KQCA 3QO6A 3SNAA 2QAAA 1O5BB 1LHFH 2ULLA 4OS6A 1NU7B 3MNBA 2FOMB 1ELEE 2ESTE 1ARCA 1WUNH 2FTMA 1HB0B 1LHGH 1TNIA 1GBTA 4MNXA 1SI5H 3W94A 1HDTH 1O2UA 1YCPH 1OYTH 2BOHB 5EU8A 5DP5A 1T4UH 4OS1A 5DP8A 1B7XB 1H9LB 1QURH 5FPTA 1LKAA 2ZFFH 1EAUA 3CP7A 3O8RA 4GHQA 2OC1A 3STIA 3AW1A 4NFFA 5DP4A 5EODA 2EC9H 1O3IA 5LPFA 3Q77A 4GHTA 1UHBB 2H6MA 1Y59T 2V3OH 1EAWA 5FHTA 1MKXK 1VR1H 1NC6A 2ANKH 2Q1JA 4H42U 1PJPA 4BTIB 1MTVA 3G01A 1DICA 2AMPA 1W7XH 2O9QA 1O36A 2BDAA 3SJ8A 4CBOA 1NRRH 3S9BA 1T4VH 3BTDE 1ACBE 3SNBA 2BXUH 2OC8A 1LO6A 3BG8A 1THSH 4R8TB 1PFXC 2FOAA 5J4QA 5JB8S 4O3UA 1T8MA 1AZZA 2CHAC 1IQEA 1ZMLA 3TK9A 1E37B 1GVLA 2DE9A 2FOFA 4Q80A 1WQVH 1LPZB 4F49A 4FU7A 2GT8A 3RXGA 1ORFA 4BOHA 4MPXA 1C1MA 1OYQA 3HPTB 3TJNA 2G51A 2J92A 1AMHA 3MO3A 2AIQA 1WOFA 1BHXB 1C1WH 3IITA 4RSPA 1NT1A 3QX5H 3ZV8A 1INCA 1GDUA 1SVPA 4A92A 1ZPZA 2ZU4A 1OXGA 3ZZ4A 2PTCE 1OWIA 3VXEH 4D8NA 3S9CA 3SORA 1QJ7B 3LIWA 2VVCA 1RTLA 2OQ5A 2FLRH 2PGBB 1TABE 5LH8A 1QA0A 4E7RG 3E1XB 1CQQA 1KYNA 4TWYA 1NESE 1ID5H 1XUKA 3P95A 2B9LA 3PROA 5IYTA 4AOQA 2Z9KA 4LK4A 3RXBA 1UCYE 1SFIA 1GJ7B 1O34A 1DFPA 1XVOA 5BPEA 5FAHA 2VIVA 3ZVDA 2VH6A 1CT2E 1A7SA 1BDAA 1NZQH 1ZGIA 3D65E 1LHDH 4WJG2 2JKHA 4DCDA 1SQAA 1W13U 6CHAC 4KKDA 3SV2H 2PKAA 1LTOA 5GCHF 3SU0A 1EPTA 3DFJA 3U9AH 3H5CB 3PTBA 1JBUH 3BV9B 1O3CA 1GMHF 4ABDA 3M61U 4RKJB 1C1OA 3RLWH 4NWLA 4F4OC 3MU8A 2OXSA 5JBCS 2ZNKH 3ZZ9A 1BA8B 2AEIH 1C5NH 2R2MB 1G3EA 1ZHMA 1FAXA 2WV4A 4ABGA 1LHEH 2ANWA 4LZ1H 3U1JB 1GHZA 3MHWU 5FBEA 4KTCA 3MFJA 4AB9A 3TGIE 1ZMNA 3ZZBA 3GY3A 4CH2B 3MO6A 4X6MA 1BCUH 3QUMP 1V2LT 2ZA5A 1NO9H 3BIVH 3URDA 2ZTZA 1DVAH 1HAVB 4AORA 3E0NB 3D62A 2QC2A 1C5QA 2HWLB 4NZQA 1KSNA 1G30B 3ZVEA 1EZXC 4DW2U 1XKAC 3O8CA 1DT2A 1ETRH 3A80A 4ABAA 1MZDA 5AF9H 3Q3KA 3PMHB 2QYIA 2ZHWH 1DWCH 4DIHH 2ZWLH 1NU9A 2QV1A 3TJVA 5JYIA 5PTPA 4CH8B 4AX9H 1C2MA 2Z9IA 2P95A 3RUOA 2Y5HA 5F8ZA 5JDUB 1TE0A 1D6WA 1JMOH 5T6DA 8GCHG 1GCDA 1Z8IB 1TPOA 4DURA 2QCYA 3E0PB 2BDYA 1C2DA 2ILNA 1P2IA 1GJ4H 1BRCE 2FXRA 1O2VA 2R0LA 1G3BA 4IBLH 1CHOG 1SPJA 1O2XA 1Z1JA 5EQQA 1S82A 1ZJDA 4JCNA 1IQFA 3NPSA 1MCTA 1A61H 4AB8A 5JBBS 2BX3A 2B7DH 3GDVA 3UTUH 2GCHG 2R9PA 3IG6B 3PTNA 1PQ7A 1O5FH 2ZGHA 3F9FA 1P9SA 4BXWA 4NA7A 5EOKA 2J38A 3N7OA 5E0HA 1HAIH 9ESTA 4I7YH 5FCKA 2BLWA 2WPKS 3ENSB 2WINI 4B2AA 5FPSA 5DO4H 3BTHE 5L6NH 3GY4A 5DGJA 5AVDA 9LPRA 3RXDA 6GCHG 3S9AA 4BANB 1FY3A 5L30H 1J9CH 2HALA 2ZZUH 5C2ZA 1EP6A 2VVUA 3ODFA 1DITH 5EW2H 2B8OH 2FM2A 1AWFH 1TPSA 1BHXF 4AFQA 1PPFE 4BXSA 2P8OC 3M5OA 3PLPA 1DSUA 3V12A 4CR9A 1YM0A 2VINA 4O9VA 3A7YA 1LVBA 3M3TA 1C1UH 1GHBG 2VWNA 1EXFA 1O0DH 5F6MA 1GJBB 3FVFB 1JIMA 4VGCB 1UTLM 2ZDLA 1K28D 2FYQA 3SGQE 2K1QA 3CS0A 3M36A 3UR9A 1AB9C 1ZGVA 2BYAX 2GMTC 4GPGA 1YF4A 3H7TA 3M7UA 1FLEE 4WY3A 1G32B 1O2JA 1LPGB 4FXGH 3PWCA 2XRCA 1TRYA 1FN6A 2NU4E 1KDQB 2ZHEH 4B76A 1XX9A 1ZTJA 3RXPA 1EAXA 4NA9H 2GZ8A 1YC0A 1L1NA 5ESTE 1PPCE 1MKWH 3GY8A 2Y80A 1SBWA 3R3GB 1QRZA 4GCHG 6ESTA 3B8JA 4E05H 1O2YA 4NGAH 1FY5A 4UONA 4FUIA 1SQOA 1Y3XA 4Y8XA 1SGCA 1GDNA 4ZROA 4KGAA 3FP7E 2GKVE 1HJAB 3VXFH 3BEIB 1RTKA 2UWOA 1NS3A 1A3EH 8KME2 2VIDA 1RS0A 5E0GA 1SGYE 1HIAB 1TX6A 1OOKB 3NWUA 3OTJE 3SV6A 3L3TA 4Q7YA 3R0FA 1C2LA 3PMBB 3LGVA 5A0AE 1GI5A 1JIRA 1IQJA 1GJ8B 1QTFA 3RXRA 1YPEH 2ZCLP 2WV5A 3SU5A 1MAYA 1C1SA 2BDHA 4A5TS 3SO3A 1DDJA 1SGEE 2FPZA 2XYAA 2Q6GA 1V2VT 1MU6B 1UVPA 5L2ZH 2XBWA 4AYYB 4K8BA 3RXFA 5GPIB 1F5KU 1T31A 4QT8C 1ELCA 2VIWA 3GOVB 4XOJA 3SJIA 1Q3XA 1ETSH 3A81A 1LHCH 1NFWA 2SGEE 1TGTA 3MH7A 3HGPA 3B9FH 3FAOA 4K69A 5C5NA 3GCTF 3E6PH 4AN7A 5LPEA 5LPRA 1TONA 3MNSA 4SGAE 2D1JA 1DY8A 1GI9B 1Y3UA 4IN1A 5JBAS 2THFB 1ZTLA 1ZSLA 1GMCG 3ATIA 4K2YA 1K21H 1CHGA 1NM6A 2FOHA 3UIRA 1LPKB 2XC5A 4TYDA 4MNVA 1RFNA 1ZMJA 1DANH 2HNTE 4NWKA 3OYPA 3P8NA 1P2QA 2C8ZB 3UQOA 1K1LA 3AASA 4XBBA 1GBCA 2WPLS 1DUEA 1K2I1 3TITA 1YPHE 5GWZA 1P12E 1J15A 3RXEA 3SJKA 3UQVA 1ZTKA 1LQEA 1TX7A 1HLTH 3SOSA 1CSOE 4I31A 4Q7ZA 2BLVA 1EJAA 1EJMA 1V2OT 3OSYA 1BTUA 1C5PA 2A31A 3RXUA 3ATLA 3AAVA 1PQ5A 3A8CA 2HNTF 3LDXH 1OX1A 3SNEA 2FOGA 1ZR0A 1KLIH 1NRQH 1O2MA 3TPIZ 2XWAA 1CE5A 2O8WA 1GI1A 4X8VH 2CMYA 2EA3A 4U01A 4A1TA 4ZAEA 4GVUA 4CR5A 3TLOA 4YZUA 1C9TA 1HXEH 1KDQA 1RJXB 1ELDE 2XTTB 5TCAA 1SGQE 1TGCA 2C90B 1S6HA 1P57B 4OS2A 2FEQH 4UE7H 5FX5A 3VGCB 3EYDA 1GG6B 4A7IB 1KXDA 2O8MA 2GCHF 4MVNA 4ABEA 1GBJA 3OY6U 1SGFG 1SGPE 1Y3WA 4NIXA 2FX6A 3OY5U 5JPMH 3ZVAA 3HATH 4FUDA 3T28A 1EKBB 2EEKA 1TFXA 2PKAB 3LU9B 4WH8A 4KP0A 1HAGE 1IQIA 1GL0E 2ZU5A 3Q76A 1FY1A 1XXFA 3EA7A 1YGCH 3A88A 1AZ8A 1EPTC 1A46H 5DKMA 4AGKA 1NFXA 1O5CB 1D3TB 3K2UA 4TY6A 1NTPA 5G4BA 1OSSA 3UR6A 1ANEA 1D9IA 1LVMA 2ZO3H 5FCRA 1ESTA 1QL7A 1BBRE 4JZFH 4FUCA 3VGCC 3BG4B 5HM9A 2FZZA 2IJOB 1V3XA 2QGRA 2XC4A 3DUXH 1FZZA 2YOLA 2CF9H 3SI3H 5A8YA 5EGMA 3BEFB 5GCHG 2A32A 3RM0H 1QJ1B 1FAKH 3ELAH 1IHTH 4X1QU 3UOUA 1E38B 3ZZ3A 1GHVH 3SJOA 1SMFE 2C3SA 2GZ7A 3K65B 5EQRA 5AFZH 2YNAA 3ZZ5A 3JZ2B 1GBDA 3Q3YA 1JOUB 1S5SA 1FXYA 2Z3CA 4UFDH 1Z6JH 2IN2A 1DLKB 2FI3E 5E8EH 5DP6A 3O8DA 4A6LA 3Q00A 1B0EA 2ZP0H 2R3YA 2A2QH 2QA9E 4I8KA 4DIIH 1C2KA 1H9IE 3A84A 1ABIH 2Y82A 1SHYA 1D3PB 3F9GA 3DT0H 1O3PB 1FIWA 1MTNB 1VITH 3GCHC 1GJCB 1K1OA 2RCEA 8LPRA 2Y7ZA 4WF8A 2ZPRA 4Q2KA 1YYY1 2AFQB 1V2QT 4RKOB 1GI0A 2VWOA 2VB0A 3M5LA 1S0RA 5CHAB 2ASUB 2GV7A 2PR3A 3TJOA 1AE5A 1HYLA 2BZ6H 2BY7X 2J2UA 1DWEH 4YOGA 3BSQA 1DM4B 2F9NA 3FZZA 1QBNA 1KLJH 5EXLA 3KQEA 4GLYA 2G55A 3GYMA 2GD4B 1C2IA 3GY6A 1TBRH 5DPAA 3V13A 1DXPA 1O3FA 1MH0A 3RU4D 2BMGB 2ZU2A 3GCHB 1J8AA 1QGFA 1Y5AT 3GCOA 3FP8E 4ZUHA 4OGYA 2FLBH 4ABJA 2STAE 2RA0A 5C5OA 2RDLA 1Z8RA 3GY2A 4X2WA 1KY9A 3DA9B 3SQEE 2D26C 2ZC9H 1IQMA 1HIAA 4X1PU 3NXPA 2BVXH 1AY6H 1P8VC 2Z9JA 4D76A 4ZKSU 2RA3A 4NZLA 1BMNH 3RXQA 1MU8B 1OWHA 2F9VA 1C1RA 1C5WB 1P9UA 1C5SA 5I25A 4CREA 4PROA 4FUBA 4YOIA 4CRDA 3QZQA 1F92A 1NROH 3T27A 3PO1C 1K1NA 3PV4A 3GDUA 4DT7B 1P02A 3C27B 4AFZA 1G2MA 3TH3H 6LPRA 2H5DA 1LQDB 1F2SE 1BB0B 3SZNA 1CA8B 3BTGE 1BTXA 1W12U 2V35A 5C1UA 4Y11E 2JH5D 1GJDB 3GY5A 4IS5A 1TNHA 3DHKH 4AFUA 1C5YB 1NFYA 5HMAA 1E36B 2G81E 3E91A 3HK3B 2ZGCA 3SV7A 1CT0E 1EAIA 2H9TH 3SU4A 1HAHH 1N6XA 2TRMA 1ELTA 1JWTA 2EI8A 4NSVA 1JRSA 4OGXA 1WYKA 4E7NA 5K7RA 1SLXB 4Y0ZE 5C3NA 2J94A 4ISNA 5C1YA 2PFEA 2ZG0H 1GG6C 1O2LA 3MU5A 1AE8H 4BTTB 4IC6A 1MTWA 1MBQA 1W0YH 3QK1A 3T2NA 2O8TA 3RM2H 4FU8A 1RD3B 3RC4A 1UVSH 3NK8A 1DWBH 2VH0A 1ZPBA 3BF6H 3TK5A 3KIDU 3MWIU 1CGIE 2NU1E 1P2KA 5JB9S 1FN8A 2SFAA 2DUCA 2VWMA 3E3TA 1OP0A 2ZU1A 3RC6A 1FIZA 1NRNH 3BTQE 2TGTA 4UFFH 2AGEX 3U8RH 1C2JA 4D9RA 5EPYA 2Z9GA 3LH3A 1V2KT 4JYVH 1T32A 3HGNA 1GI3A 1CA0B 4GAWA 1UTKA 3SV8A 2ZHFH 2A4OA 4I8JA 7GCHG 2H5CA 3RP2A 1THPB 3A7XA 3ZYDA 2SGFE 4NFEA 1H8DH 5SGAE 3SQHE 1EUFA 4BAHB 3LGUA 1V2NT 1NY22 4FUEA 4WMFA 3SV9A 1HAOH 4WVPE 3RXAA 1VCPA 3UPEA 5E2PA 2PGQB 2AIPA 1AIXH 1GMDG 1N1LA 1GHYH 4BAKB 1AQ7A 4INKA 1BUIA 4NG9H 3AAUA 2F83A 2O8LA 1AVGH 4XBCA 1A4WH 2SNVA 4ISLA 4WMDA 3M7TA 2PKSB 1S81A 4GCHF 1ZJKA 1HCGA 1ZRKA 2OQUA 4Y7AA 1F5LA 1UK4A 4INLA 1AN1E 5K0HA 1D3QB 4OS5A 1VITF 1QRXA 2FODA 4MQAA 1ZSJA 1DE7H 4Z6AH 3MU4A 2W5EA 1SGDE 3HK6B 1FUJA 2V6NA 2G5NA 2FOBA 2BDCA 2ZQ1A 4BTUB 3KEEA 3RMOH 1AUTC 2OUAA 3P8FA 1WBGB 4AFSA 1BMMH 4YM9A 1GDQA 4B2BA 3RU4E 2G4TA 1BIOA 1LCYA 3ZZCA 1IHSH 1VGCB 8ESTE 1QL9A 3TGJE 4JZIA 3M35A 1O2TA 3UNSA 4ABBA 1AVWA 1CGHA 1QB6A 1FV9A 2UWLA 3BTFE 1SHHB 2QXHA 4KTUA 3CENA 1SGNE 4MG3A 2ZPQA 2ZDNA 3KCGH 1DS2E 3LJOA 1HXFH 3EAJA 2ZF0H 2GCTC 3M5NA 4K1SA 4DJZB 1TGSZ 1GBEA 4MPVA 1TWXB 2FX4A 2P93A 4JZEH 1V2MT 1WTGH 4YLUA 1EATA 1G36A 1SLUB 2ZGJA 1ARBA 4ZKNU 3T29A 2H9EH 4OS7A 2FS9A 1C5TA 1XXDA 1RRKA 4DGJA 2SNWA 1C5LH 2Y7XA 1QBVH 2Z3DA 1IQLA 3A7ZA 4MTBA