3E26A

Crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
301
structure length
274
Chain Sequence
DTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVSREQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRVTELVARPLLAALRPELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFYTRHTWPVSLVDRPPMKVMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Mycobacterium tuberculosis glucosyl-3-phosphoglycerate synthase: structure of a key enzyme in methylglucose lipopolysaccharide biosynthesis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 91
structure length 274
sequence length 301
ec nomenclature ec 2.4.1.266: Glucosyl-3-phosphoglycerate synthase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3e26A00
1ZJ1A 4DE7A 5C1LA 4EVWA 1JVGA 1VGUA 1H5RB 4D0ZA 2Y6PA 2QH5A 2NXVA 2XWNA 1ZJ2A 2RJ8A 3T7OA 2YQSA 2FFVA 2MZBA 2O1GA 4AYJA 5CQLX 4MYBA 2ZU7A 4EEOA 3DK5A 1VICA 3O3PA 1V82A 3SPTA 1G23A 1LL3A 2X5ZA 4HO6A 1PZYB 5CQPA 2WVMA 1VZXA 4EEAA 5FYEA 3OH4A 2V0LA 2OI7A 4FRMA 1H7EA 3D5NA 1G2VA 3FWWA 2P6WA 5FU8A 4B4GA 1O0RA 3F1CA 1ZI5A 1ZDFA 1H7TA 5C4BA 4G87A 1VPAA 2RJ9A 4Y6UA 2XWMA 4NAKA 1QGQA 1G1LA 1TZFA 4R7PA 4D11A 1FOAA 1EYRA 2O1HA 2XWLA 1ZJ0A 3I0KA 3SXAA 5FV9A 2ICYA 1H5TA 4ECMA 1O7OA 3ZLLA 3LW6A 3IOJA 2RJ6A 1G9RA 4Y62A 4B3UA 5C3BA 1WSZA 5AJPA 2VFZA 2VXLA 2W0WA 4HO9A 3PKQA 2FY7A 1W77A 1VGWA 1FXJA 2AH9A 4Y7GA 1SS9A 3I0DA 3U2WA 4NAIA 4HO0A 2VS5A 1VM8A 1MP3A 1HM0A 5L6VA 1H7FA 3SXDA 4Y63A 1O7QA 1GX4A 4ASYA 1HJJA 1ZCTA 1WT1A 1R7XA 4FRPA 4ASJA 4DDZA 3U2VA 3ZLKA 2D7IA 4FRHA 3OAMA 4D0TA 2RIYA 2AGDA 2APCA 5CQNX 2PGVA 1G93A 1YP2A 1H7LA 5IDTA 1Z90A 3OC9A 3V90A 2AESA 1ZIZA 1JV1A 5C1HA 2A8WA 2JCKA 3U2UA 3POLA 4G3QA 4HO4A 1I52A 5BXCA 2WEEA 2ICXA 1TW1A 1JYLA 3V0LA 3I0CA 2Y4JA 2WE9A 3BCVA 5FU0A 4EE5A 4FRAA 3PNNA 4KC2A 2X5SA 4KQLA 2QKXA 3SXCA 2JCJA 1O23B 4Y64A 1QWJA 2XMEA 5CMHA 3SXBA 2YQHA 4M2AA 1FO9A 3OH2A 4HO5A 4FCEA 2V0KA 3CKJA 2JCOA 3ST8A 2W0VA 2RIXA 4B2WA 1FWYA 1LZJA 5AJNA 2VS3A 4YS8A 1G3LA 1FR9A 1H5SB 1H5SD 4KC4A 1R80A 3TZTA 3T7MA 3SX5A 5J49A 2Y4MA 3USQA 2E3DA 4ZDQA 2GGQA 2RITA 2I7BA 2V0HA 1H4DA 1VH3A 2GGOA 1XZ6A 1WVCA 3I0GA 3I0JA 2AM4A 3RMWA 1OMZA 1FG5N 1LL0A 3OGZA 3OKRA 3Q7UA 4FREA 1G8OA 3CGXA 1ZJ3A 4Y7VA 4D11C 3D98A 1FR8A 2VD4A 3D8VA 3SX3A 2BO4A 4P00A 1S4NA 5C4EA 5CMIA 1JYKA 4FROA 5CMFX 4Y7UA 4KNRA 1WT0A 2OEFA 4AC3A 2Z86A 2V0IA 1FRWA 4UEGA 1ZDGA 4BQHA 1FGXA 1YROB 1IINA 3F1YA 5I1FA 1JVDA 2O1FA 2RJ5A 3DUVA 2FYDB 1R81A 3V0PA 3U2XA 3JUKA 3EE5A 5IDSA 1QGSA 1R82A 1W55A 3I0IX 1H5RA 3IOHA 3R3IA 4GBPA 1LL2A 1ZJOA 1NMMB 4M4KA 3OH0A 1NHEB 1HM8A 1H5SA 1HJLA 2Z87A 3CKQA 5JQQA 1HV9A 2OI6A 3HL3A 4DECA 3CKVA 1K4VA 1GQCA 1S4PA 1WT2A 4B5BA 5C4FA 3Q4SA 3SXEA 2WVKA 5HS2A 2YQJA 2P73A 3I0FA 1GQ9A 4BMAA 4CVHA 3U0YA 1ZHJA 1MC3A 4KPXA 3NGWA 4IRQA 5FUHA 5C3AA 3GUEA 1ON6A 3CKNA 1FGGA 3BRKX 4Y6NA 4HO2A 4B42A 5C38A 1ZI1A 3Q80A 5CQMX 2YCMA 1H4CA 2PX7A 1GWWA 2PGYA 3RSBA 4Y9XA 4AAWA 1INJA 1VZUA 4D48A 3JTJA 2ZU9A 4HG6A 1JV3A 2BO7A 5C1GA 3U0XA 2I5EA 4G3SA 1LZIA 1V84A 2AM5A 4NALA 2PA4A 3SX8A 1E5KA 2WVLA 1OMXA 1ZCVA 5DDTA 1XHBA 1FZWA 4Y7FA 4MNDA 1NF5B 5AJOA 1H7QA 4B4BA 1H7HA 1S4OA 1VGTA 1ON8A 1NWGB 5L6SA 1R7UA 2WGZA 1H5TB 1VH1A 3E26A 3K8DA 3T7NA 5C48A 3ZF8A 3OH3A 2YC3A 2WAWA 4FQWA 2VXMA 4J18A 1IIMA 5C3DA 2RJ0A 2YESA 1VZTA 2OI5A 2V0JA 4XWIA 1NKHB 1ZCYA 3V8YA 1VGZA 3TQDA 3E25A 3RMVA 1EZIA 4IRPA 4FRQA 1G95A 2VSIA 1W57A 2FYAA 4B4MA 5FTSA 2AE7A 5C36A 4LW6A 3U2TA 3QVBA 1H7GA 1LZ7A 2CU2A 1GX0A 2I5KA 2YQCA 3K8EA 4FRBA 1HM9A 3V8ZA 1ZI3A 5EIYA 2QGIA 2DPWA 3I0LA 4L41C 3ZGFA 3SX7A 4ARWA 3V0MA 1WT3A 2XMHA 1INIA 2VS4A 4KXOA 3V0OA 2X65A 3SXGA 1TW5A 5FTVA 4EE4A 2YC5A 4Y7TA 3CU0A 1TVYA 2JCLA 1MP5A 1R7YA 1GWVA 3KIAA 5C4CA 1R7TA 2VSHA 4FCUA 4B2XA 4C2SA 4M28A 4NANA 4KNXA 2RIZA 4AYLA 2D7RA 1GA8A 2BO8A 4LW3A 3FOQA 4M2BA 1YP3A 5EJZA 1H5SC 3PKPA 3IOIA 1ZJPA 2Y4KA 3OH1A 5C8RA 4HO3A 4HOCA 1YP4A 1ZCUA 2Y4LA 5IFYA 4KT7A 3ZGGA 2D0JA 4EEGA 2Q4JA 4EE3A 4KPZA 4EEMA 3I0EA 2RJ4A 2FYCB 3CKOA 2AM3A 5DDVA 4G3PA 2P72A 2AECA 1ZI4A 2FYBA 2RJ1A 4E1KA 1LVWA 2X60A 5C49A 2RJ7A 1G97A 2FFUA 3USRA 5C47A 1PZTA 1G0RA 1NQIB 4KC1A 4FRDA 4CJ8A 1MP4A 1H3MA 4K6RA 5EJ1A 2BO6A 3JUJA 4P02A 2ZU8A 1FXOA 1V83A 2Y7AA 3V0QA 2A8UA 1H4EA 4HO8A 5CQOA 2E8BA 4FRLA 5CMGX 4JD0A 1QG8A 4JISA 3I0HA 1KWSA 3N9WA 1OQMB 5C4DA 4CJBA 3V91A 3R2WA 4HCQA 2OEGA 3V0NA 4CJCA 2UX8A 3DJ4A 4KRVA 5CMJA 1R7VA 1FO8A 1LZ0A
chains in the Genus database with same CATH superfamily
1ZJ1A 4DE7A 5C1LA 4EVWA 1JVGA 1VGUA 1H5RB 4D0ZA 2Y6PA 2QH5A 2NXVA 2XWNA 4O6NA 1ZJ2A 2RJ8A 3T7OA 2YQSA 2FFVA 2MZBA 2O1GA 4AYJA 5CQLX 4MYBA 2ZU7A 4EEOA 3DK5A 1VICA 3O3PA 1V82A 3SPTA 1G23A 1LL3A 2X5ZA 4HO6A 1PZYB 5CQPA 2WVMA 1VZXA 4EEAA 5FYEA 3OH4A 2V0LA 2OI7A 4FRMA 1H7EA 3D5NA 1G2VA 3FWWA 2P6WA 5FU8A 4B4GA 1O0RA 3F1CA 1ZI5A 1ZDFA 1H7TA 5C4BA 4G87A 1VPAA 2RJ9A 4Y6UA 2XWMA 4NAKA 1QGQA 1G1LA 1TZFA 4R7PA 4D11A 1FOAA 1EYRA 2O1HA 2XWLA 1ZJ0A 3I0KA 3SXAA 5FV9A 2ICYA 1H5TA 4ECMA 1O7OA 3ZLLA 3LW6A 3IOJA 2RJ6A 1G9RA 4Y62A 4B3UA 5C3BA 1WSZA 5AJPA 2VFZA 2VXLA 2W0WA 4FIYA 4HO9A 3PKQA 2FY7A 1W77A 1VGWA 1FXJA 2AH9A 4Y7GA 1SS9A 3I0DA 3U2WA 4NAIA 4HO0A 2VS5A 1VM8A 1MP3A 1HM0A 5L6VA 1H7FA 3SXDA 4Y63A 1O7QA 1GX4A 4ASYA 1HJJA 1ZCTA 1WT1A 1R7XA 4FRPA 4ASJA 4DDZA 3U2VA 3ZLKA 2D7IA 4FRHA 3OAMA 4D0TA 2RIYA 2AGDA 2APCA 5CQNX 2PGVA 1G93A 1YP2A 1H7LA 5IDTA 1Z90A 3OC9A 3V90A 2AESA 1ZIZA 1JV1A 5C1HA 2A8WA 2JCKA 3U2UA 3POLA 4G3QA 4HO4A 1I52A 5BXCA 2WEEA 2ICXA 1TW1A 1JYLA 3V0LA 3I0CA 2Y4JA 2WE9A 3BCVA 5FU0A 4EE5A 4FRAA 3PNNA 4KC2A 2X5SA 4KQLA 2QKXA 3SXCA 2JCJA 1O23B 4Y64A 1QWJA 2XMEA 5CMHA 5D92A 3SXBA 2YQHA 4M2AA 1FO9A 3OH2A 4HO5A 4FCEA 2V0KA 3CKJA 2JCOA 3ST8A 2W0VA 2RIXA 4B2WA 1FWYA 1LZJA 5AJNA 2VS3A 4YS8A 4FIXA 1G3LA 1FR9A 1H5SB 1H5SD 4KC4A 1R80A 3TZTA 3T7MA 3SX5A 5J49A 2Y4MA 3USQA 2E3DA 4ZDQA 2GGQA 2RITA 2I7BA 2V0HA 1H4DA 1VH3A 2GGOA 1XZ6A 1WVCA 3I0GA 3I0JA 2AM4A 2VK9A 3RMWA 1OMZA 1FG5N 1LL0A 3OGZA 3OKRA 3Q7UA 4FREA 1G8OA 3CGXA 1ZJ3A 4Y7VA 4D11C 3D98A 1FR8A 2VD4A 3D8VA 3SX3A 2BO4A 4P00A 2J0BA 1S4NA 5C4EA 5CMIA 1JYKA 4FROA 5CMFX 4Y7UA 4KNRA 1WT0A 2OEFA 4AC3A 2Z86A 2V0IA 4Q7CA 1FRWA 4UEGA 1ZDGA 4BQHA 1FGXA 1YROB 1IINA 3F1YA 5I1FA 1JVDA 2O1FA 2RJ5A 3DUVA 2FYDB 1R81A 3V0PA 3U2XA 3JUKA 3EE5A 5IDSA 1QGSA 1R82A 1W55A 3I0IX 1H5RA 3IOHA 3R3IA 4GBPA 1LL2A 1ZJOA 1NMMB 4M4KA 3OH0A 1NHEB 1HM8A 1H5SA 1HJLA 2Z87A 3CKQA 5JQQA 1HV9A 2OI6A 3HL3A 4DECA 3CKVA 1K4VA 1GQCA 1S4PA 1WT2A 4B5BA 5C4FA 3Q4SA 3SXEA 2WVKA 5HS2A 2YQJA 2P73A 3I0FA 1GQ9A 4BMAA 4CVHA 3U0YA 1ZHJA 1MC3A 4KPXA 3NGWA 4IRQA 5FUHA 5C3AA 3GUEA 1ON6A 3CKNA 1FGGA 3BRKX 4Y6NA 4HO2A 4B42A 5C38A 1ZI1A 3Q80A 5CQMX 2YCMA 1H4CA 2PX7A 1GWWA 2PGYA 3RSBA 4Y9XA 4AAWA 1INJA 1VZUA 4D48A 3JTJA 2ZU9A 4HG6A 1JV3A 2BO7A 5C1GA 3U0XA 2I5EA 4G3SA 1LZIA 1V84A 2AM5A 4NALA 2PA4A 3SX8A 1E5KA 2WVLA 1OMXA 1ZCVA 5DDTA 1XHBA 1FZWA 4Y7FA 4MNDA 1NF5B 5AJOA 1H7QA 4MIXA 1H7HA 4B4BA 1S4OA 1VGTA 1ON8A 1NWGB 5L6SA 1R7UA 2WGZA 1H5TB 1VH1A 3E26A 3K8DA 3T7NA 5C48A 3ZF8A 4O6MA 3OH3A 2YC3A 2WAWA 4FQWA 2VXMA 4J18A 1IIMA 5C3DA 2RJ0A 2YESA 1VZTA 2OI5A 2V0JA 4XWIA 1NKHB 1ZCYA 3V8YA 1VGZA 3TQDA 3E25A 3RMVA 1EZIA 4IRPA 4FRQA 1G95A 2VSIA 2J0AA 1W57A 2FYAA 4B4MA 5FTSA 2AE7A 5C36A 4LW6A 3U2TA 3QVBA 1H7GA 1LZ7A 2CU2A 1GX0A 2I5KA 2YQCA 3K8EA 4FRBA 1HM9A 3V8ZA 1ZI3A 5EIYA 2QGIA 2DPWA 3I0LA 4L41C 5D91A 3ZGFA 3SX7A 4ARWA 3V0MA 1WT3A 2XMHA 1INIA 2VS4A 4KXOA 3V0OA 2X65A 3SXGA 1TW5A 5FTVA 4EE4A 2YC5A 4Y7TA 3CU0A 1TVYA 2JCLA 1MP5A 1R7YA 1GWVA 3KIAA 5C4CA 1R7TA 2VSHA 4FCUA 4B2XA 4C2SA 4M28A 4NANA 4KNXA 2RIZA 4AYLA 2D7RA 1GA8A 2BO8A 4LW3A 3FOQA 4M2BA 1YP3A 5EJZA 1H5SC 3PKPA 3IOIA 1ZJPA 2Y4KA 3OH1A 5C8RA 4HO3A 4HOCA 1YP4A 1ZCUA 2Y4LA 5IFYA 4KT7A 3ZGGA 2D0JA 4EEGA 2C0NA 2Q4JA 4EE3A 4KPZA 4EEMA 3I0EA 2RJ4A 2FYCB 3CKOA 2AM3A 5DDVA 4G3PA 2P72A 2AECA 1ZI4A 2FYBA 2RJ1A 4E1KA 1LVWA 2X60A 5C49A 2RJ7A 1G97A 2FFUA 3USRA 5C47A 1PZTA 1G0RA 1NQIB 4KC1A 4FRDA 4CJ8A 1MP4A 1H3MA 4K6RA 5EJ1A 2BO6A 3JUJA 4P02A 2ZU8A 1FXOA 1V83A 2Y7AA 3V0QA 2A8UA 1H4EA 4HO8A 5CQOA 2E8BA 4FRLA 5CMGX 4JD0A 1QG8A 4JISA 3I0HA 1KWSA 3N9WA 1OQMB 5C4DA 4CJBA 3V91A 3R2WA 4HCQA 2OEGA 3V0NA 4CJCA 2UX8A 3DJ4A 4KRVA 5CMJA 1R7VA 1FO8A 1LZ0A
chains in the Genus database with same CATH topology
1ZJ1A 4DE7A 5C1LA 4EVWA 1JVGA 1VGUA 1H5RB 4D0ZA 2Y6PA 2QH5A 2NXVA 2XWNA 4O6NA 1ZJ2A 2RJ8A 3T7OA 2YQSA 2FFVA 2MZBA 2O1GA 4AYJA 5CQLX 4MYBA 2ZU7A 4EEOA 3DK5A 1VICA 3O3PA 1V82A 3SPTA 1G23A 1LL3A 2X5ZA 4HO6A 1PZYB 5CQPA 2WVMA 1VZXA 4EEAA 5FYEA 3OH4A 2V0LA 2OI7A 4FRMA 1H7EA 3D5NA 1G2VA 3FWWA 2P6WA 5FU8A 4B4GA 1O0RA 3F1CA 1ZI5A 1ZDFA 1H7TA 5C4BA 4G87A 1VPAA 2RJ9A 4Y6UA 2XWMA 4NAKA 1QGQA 1G1LA 1TZFA 4R7PA 4D11A 1FOAA 1EYRA 2O1HA 2XWLA 1ZJ0A 3I0KA 3SXAA 5FV9A 2ICYA 1H5TA 4ECMA 1O7OA 3ZLLA 3LW6A 3IOJA 2RJ6A 1G9RA 4Y62A 4B3UA 5C3BA 1WSZA 5AJPA 2VFZA 2VXLA 2W0WA 4FIYA 4HO9A 3PKQA 2FY7A 1W77A 1VGWA 1FXJA 2AH9A 4Y7GA 1SS9A 3I0DA 3U2WA 4NAIA 4HO0A 2VS5A 1VM8A 1MP3A 1HM0A 5L6VA 1H7FA 3SXDA 4Y63A 1O7QA 1GX4A 4ASYA 1HJJA 1ZCTA 1WT1A 1R7XA 4FRPA 4ASJA 4DDZA 3U2VA 3ZLKA 2D7IA 4FRHA 3OAMA 4D0TA 2RIYA 2AGDA 2APCA 5CQNX 2PGVA 1G93A 1YP2A 1H7LA 5IDTA 1Z90A 3OC9A 3V90A 2AESA 1ZIZA 1JV1A 5C1HA 2A8WA 2JCKA 3U2UA 3POLA 4G3QA 4HO4A 1I52A 5BXCA 2WEEA 2ICXA 1TW1A 1JYLA 3V0LA 3I0CA 2Y4JA 2WE9A 3BCVA 5FU0A 4EE5A 4FRAA 3PNNA 4KC2A 2X5SA 4KQLA 2QKXA 3SXCA 2JCJA 1O23B 4Y64A 1QWJA 2XMEA 5CMHA 5D92A 3SXBA 2YQHA 4M2AA 1FO9A 3OH2A 4HO5A 4FCEA 2V0KA 3CKJA 2JCOA 3ST8A 2W0VA 2RIXA 4B2WA 1FWYA 1LZJA 5AJNA 2VS3A 4YS8A 4FIXA 1G3LA 1FR9A 1H5SB 1H5SD 4KC4A 1R80A 3TZTA 3T7MA 3SX5A 5J49A 2Y4MA 3USQA 2E3DA 4ZDQA 2GGQA 2RITA 2I7BA 2V0HA 1H4DA 1VH3A 2GGOA 1XZ6A 1WVCA 3I0GA 3I0JA 2AM4A 2VK9A 3RMWA 1OMZA 1FG5N 1LL0A 3OGZA 3OKRA 3Q7UA 4FREA 1G8OA 3CGXA 1ZJ3A 4Y7VA 4D11C 3D98A 1FR8A 2VD4A 3D8VA 3SX3A 2BO4A 4P00A 2J0BA 1S4NA 5C4EA 5CMIA 1JYKA 4FROA 5CMFX 4Y7UA 4KNRA 1WT0A 2OEFA 4AC3A 2Z86A 2V0IA 4Q7CA 1FRWA 4UEGA 1ZDGA 4BQHA 1FGXA 1YROB 1IINA 3F1YA 5I1FA 1JVDA 2O1FA 2RJ5A 3DUVA 2FYDB 1R81A 3V0PA 3U2XA 3JUKA 3EE5A 5IDSA 1QGSA 1R82A 1W55A 3I0IX 1H5RA 3IOHA 3R3IA 4GBPA 1LL2A 1ZJOA 1NMMB 4M4KA 3OH0A 1NHEB 1HM8A 1H5SA 1HJLA 2Z87A 3CKQA 5JQQA 1HV9A 2OI6A 3HL3A 4DECA 3CKVA 1K4VA 1GQCA 1S4PA 1WT2A 4B5BA 5C4FA 3Q4SA 3SXEA 2WVKA 5HS2A 2YQJA 2P73A 3I0FA 1GQ9A 4BMAA 4CVHA 3U0YA 1ZHJA 1MC3A 4KPXA 3NGWA 4IRQA 5FUHA 5C3AA 3GUEA 1ON6A 3CKNA 1FGGA 3BRKX 4Y6NA 4HO2A 4B42A 5C38A 1ZI1A 3Q80A 5CQMX 2YCMA 1H4CA 2PX7A 1GWWA 2PGYA 3RSBA 4Y9XA 4AAWA 1INJA 1VZUA 4D48A 3JTJA 2ZU9A 4HG6A 1JV3A 2BO7A 5C1GA 3U0XA 2I5EA 4G3SA 1LZIA 1V84A 2AM5A 4NALA 2PA4A 3SX8A 1E5KA 2WVLA 1OMXA 1ZCVA 5DDTA 1XHBA 1FZWA 4Y7FA 4MNDA 1NF5B 5AJOA 1H7QA 4MIXA 1H7HA 4B4BA 1S4OA 1VGTA 1ON8A 1NWGB 5L6SA 1R7UA 2WGZA 1H5TB 1VH1A 3E26A 3K8DA 3T7NA 5C48A 3ZF8A 4O6MA 3OH3A 2YC3A 2WAWA 4FQWA 2VXMA 4J18A 1IIMA 5C3DA 2RJ0A 2YESA 1VZTA 2OI5A 2V0JA 4XWIA 1NKHB 1ZCYA 3V8YA 1VGZA 3TQDA 3E25A 3RMVA 1EZIA 4IRPA 4FRQA 1G95A 2VSIA 2J0AA 1W57A 2FYAA 4B4MA 5FTSA 2AE7A 5C36A 4LW6A 3U2TA 3QVBA 1H7GA 1LZ7A 2CU2A 1GX0A 2I5KA 2YQCA 3K8EA 4FRBA 1HM9A 3V8ZA 1ZI3A 5EIYA 2QGIA 2DPWA 3I0LA 4L41C 5D91A 3ZGFA 3SX7A 4ARWA 3V0MA 1WT3A 2XMHA 1INIA 2VS4A 4KXOA 3V0OA 2X65A 3SXGA 1TW5A 5FTVA 4EE4A 2YC5A 4Y7TA 3CU0A 1TVYA 2JCLA 1MP5A 1R7YA 1GWVA 3KIAA 5C4CA 1R7TA 2VSHA 4FCUA 4B2XA 4C2SA 4M28A 4NANA 4KNXA 2RIZA 4AYLA 2D7RA 1GA8A 2BO8A 4LW3A 3FOQA 4M2BA 1YP3A 5EJZA 1H5SC 3PKPA 3IOIA 1ZJPA 2Y4KA 3OH1A 5C8RA 4HO3A 4HOCA 1YP4A 1ZCUA 2Y4LA 5IFYA 4KT7A 3ZGGA 2D0JA 4EEGA 2C0NA 2Q4JA 4EE3A 4KPZA 4EEMA 3I0EA 2RJ4A 2FYCB 3CKOA 2AM3A 5DDVA 4G3PA 2P72A 2AECA 1ZI4A 2FYBA 2RJ1A 4E1KA 1LVWA 2X60A 5C49A 2RJ7A 1G97A 2FFUA 3USRA 5C47A 1PZTA 1G0RA 1NQIB 4KC1A 4FRDA 4CJ8A 1MP4A 1H3MA 4K6RA 5EJ1A 2BO6A 3JUJA 4P02A 2ZU8A 1FXOA 1V83A 2Y7AA 3V0QA 2A8UA 1H4EA 4HO8A 5CQOA 2E8BA 4FRLA 5CMGX 4JD0A 1QG8A 4JISA 3I0HA 1KWSA 3N9WA 1OQMB 5C4DA 4CJBA 3V91A 3R2WA 4HCQA 2OEGA 3V0NA 4CJCA 2UX8A 3DJ4A 4KRVA 5CMJA 1R7VA 1FO8A 1LZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJ1 A;  4DE7 A;  5C1L A;  4EVW A;  1JVG A;  1VGU A;  1H5R B;  4D0Z A;  2Y6P A;  2QH5 A;  2NXV A;  2XWN A;  1ZJ2 A;  2RJ8 A;  3T7O A;  2YQS A;  2FFV A;  2MZB A;  2O1G A;  4AYJ A;  5CQL X;  4MYB A;  2ZU7 A;  4EEO A;  3DK5 A;  1VIC A;  3O3P A;  1V82 A;  3SPT A;  1G23 A;  1LL3 A;  2X5Z A;  4HO6 A;  1PZY B;  5CQP A;  2WVM A;  1VZX A;  4EEA A;  5FYE A;  3OH4 A;  2V0L A;  2OI7 A;  4FRM A;  1H7E A;  3D5N A;  1G2V A;  3FWW A;  2P6W A;  5FU8 A;  4B4G A;  1O0R A;  3F1C A;  1ZI5 A;  1ZDF A;  1H7T A;  5C4B A;  4G87 A;  1VPA A;  2RJ9 A;  4Y6U A;  2XWM A;  4NAK A;  1QGQ A;  1G1L A;  1TZF A;  4R7P A;  4D11 A;  1FOA A;  1EYR A;  2O1H A;  2XWL A;  1ZJ0 A;  3I0K A;  3SXA A;  5FV9 A;  2ICY A;  1H5T A;  4ECM A;  1O7O A;  3ZLL A;  3LW6 A;  3IOJ A;  2RJ6 A;  1G9R A;  4Y62 A;  4B3U A;  5C3B A;  1WSZ A;  5AJP A;  2VFZ A;  2VXL A;  2W0W A;  4HO9 A;  3PKQ A;  2FY7 A;  1W77 A;  1VGW A;  1FXJ A;  2AH9 A;  4Y7G A;  1SS9 A;  3I0D A;  3U2W A;  4NAI A;  4HO0 A;  2VS5 A;  1VM8 A;  1MP3 A;  1HM0 A;  5L6V A;  1H7F A;  3SXD A;  4Y63 A;  1O7Q A;  1GX4 A;  4ASY A;  1HJJ A;  1ZCT A;  1WT1 A;  1R7X A;  4FRP A;  4ASJ A;  4DDZ A;  3U2V A;  3ZLK A;  2D7I A;  4FRH A;  3OAM A;  4D0T A;  2RIY A;  2AGD A;  2APC A;  5CQN X;  2PGV A;  1G93 A;  1YP2 A;  1H7L A;  5IDT A;  1Z90 A;  3OC9 A;  3V90 A;  2AES A;  1ZIZ A;  1JV1 A;  5C1H A;  2A8W A;  2JCK A;  3U2U A;  3POL A;  4G3Q A;  4HO4 A;  1I52 A;  5BXC A;  2WEE A;  2ICX A;  1TW1 A;  1JYL A;  3V0L A;  3I0C A;  2Y4J A;  2WE9 A;  3BCV A;  5FU0 A;  4EE5 A;  4FRA A;  3PNN A;  4KC2 A;  2X5S A;  4KQL A;  2QKX A;  3SXC A;  2JCJ A;  1O23 B;  4Y64 A;  1QWJ A;  2XME A;  5CMH A;  3SXB A;  2YQH A;  4M2A A;  1FO9 A;  3OH2 A;  4HO5 A;  4FCE A;  2V0K A;  3CKJ A;  2JCO A;  3ST8 A;  2W0V A;  2RIX A;  4B2W A;  1FWY A;  1LZJ A;  5AJN A;  2VS3 A;  4YS8 A;  1G3L A;  1FR9 A;  1H5S B;  1H5S D;  4KC4 A;  1R80 A;  3TZT A;  3T7M A;  3SX5 A;  5J49 A;  2Y4M A;  3USQ A;  2E3D A;  4ZDQ A;  2GGQ A;  2RIT A;  2I7B A;  2V0H A;  1H4D A;  1VH3 A;  2GGO A;  1XZ6 A;  1WVC A;  3I0G A;  3I0J A;  2AM4 A;  3RMW A;  1OMZ A;  1FG5 N;  1LL0 A;  3OGZ A;  3OKR A;  3Q7U A;  4FRE A;  1G8O A;  3CGX A;  1ZJ3 A;  4Y7V A;  4D11 C;  3D98 A;  1FR8 A;  2VD4 A;  3D8V A;  3SX3 A;  2BO4 A;  4P00 A;  1S4N A;  5C4E A;  5CMI A;  1JYK A;  4FRO A;  5CMF X;  4Y7U A;  4KNR A;  1WT0 A;  2OEF A;  4AC3 A;  2Z86 A;  2V0I A;  1FRW A;  4UEG A;  1ZDG A;  4BQH A;  1FGX A;  1YRO B;  1IIN A;  3F1Y A;  5I1F A;  1JVD A;  2O1F A;  2RJ5 A;  3DUV A;  2FYD B;  1R81 A;  3V0P A;  3U2X A;  3JUK A;  3EE5 A;  5IDS A;  1QGS A;  1R82 A;  1W55 A;  3I0I X;  1H5R A;  3IOH A;  3R3I A;  4GBP A;  1LL2 A;  1ZJO A;  1NMM B;  4M4K A;  3OH0 A;  1NHE B;  1HM8 A;  1H5S A;  1HJL A;  2Z87 A;  3CKQ A;  5JQQ A;  1HV9 A;  2OI6 A;  3HL3 A;  4DEC A;  3CKV A;  1K4V A;  1GQC A;  1S4P A;  1WT2 A;  4B5B A;  5C4F A;  3Q4S A;  3SXE A;  2WVK A;  5HS2 A;  2YQJ A;  2P73 A;  3I0F A;  1GQ9 A;  4BMA A;  4CVH A;  3U0Y A;  1ZHJ A;  1MC3 A;  4KPX A;  3NGW A;  4IRQ A;  5FUH A;  5C3A A;  3GUE A;  1ON6 A;  3CKN A;  1FGG A;  3BRK X;  4Y6N A;  4HO2 A;  4B42 A;  5C38 A;  1ZI1 A;  3Q80 A;  5CQM X;  2YCM A;  1H4C A;  2PX7 A;  1GWW A;  2PGY A;  3RSB A;  4Y9X A;  4AAW A;  1INJ A;  1VZU A;  4D48 A;  3JTJ A;  2ZU9 A;  4HG6 A;  1JV3 A;  2BO7 A;  5C1G A;  3U0X A;  2I5E A;  4G3S A;  1LZI A;  1V84 A;  2AM5 A;  4NAL A;  2PA4 A;  3SX8 A;  1E5K A;  2WVL A;  1OMX A;  1ZCV A;  5DDT A;  1XHB A;  1FZW A;  4Y7F A;  4MND A;  1NF5 B;  5AJO A;  1H7Q A;  4B4B A;  1H7H A;  1S4O A;  1VGT A;  1ON8 A;  1NWG B;  5L6S A;  1R7U A;  2WGZ A;  1H5T B;  1VH1 A;  3E26 A;  3K8D A;  3T7N A;  5C48 A;  3ZF8 A;  3OH3 A;  2YC3 A;  2WAW A;  4FQW A;  2VXM A;  4J18 A;  1IIM A;  5C3D A;  2RJ0 A;  2YES A;  1VZT A;  2OI5 A;  2V0J A;  4XWI A;  1NKH B;  1ZCY A;  3V8Y A;  1VGZ A;  3TQD A;  3E25 A;  3RMV A;  1EZI A;  4IRP A;  4FRQ A;  1G95 A;  2VSI A;  1W57 A;  2FYA A;  4B4M A;  5FTS A;  2AE7 A;  5C36 A;  4LW6 A;  3U2T A;  3QVB A;  1H7G A;  1LZ7 A;  2CU2 A;  1GX0 A;  2I5K A;  2YQC A;  3K8E A;  4FRB A;  1HM9 A;  3V8Z A;  1ZI3 A;  5EIY A;  2QGI A;  2DPW A;  3I0L A;  4L41 C;  3ZGF A;  3SX7 A;  4ARW A;  3V0M A;  1WT3 A;  2XMH A;  1INI A;  2VS4 A;  4KXO A;  3V0O A;  2X65 A;  3SXG A;  1TW5 A;  5FTV A;  4EE4 A;  2YC5 A;  4Y7T A;  3CU0 A;  1TVY A;  2JCL A;  1MP5 A;  1R7Y A;  1GWV A;  3KIA A;  5C4C A;  1R7T A;  2VSH A;  4FCU A;  4B2X A;  4C2S A;  4M28 A;  4NAN A;  4KNX A;  2RIZ A;  4AYL A;  2D7R A;  1GA8 A;  2BO8 A;  4LW3 A;  3FOQ A;  4M2B A;  1YP3 A;  5EJZ A;  1H5S C;  3PKP A;  3IOI A;  1ZJP A;  2Y4K A;  3OH1 A;  5C8R A;  4HO3 A;  4HOC A;  1YP4 A;  1ZCU A;  2Y4L A;  5IFY A;  4KT7 A;  3ZGG A;  2D0J A;  4EEG A;  2Q4J A;  4EE3 A;  4KPZ A;  4EEM A;  3I0E A;  2RJ4 A;  2FYC B;  3CKO A;  2AM3 A;  5DDV A;  4G3P A;  2P72 A;  2AEC A;  1ZI4 A;  2FYB A;  2RJ1 A;  4E1K A;  1LVW A;  2X60 A;  5C49 A;  2RJ7 A;  1G97 A;  2FFU A;  3USR A;  5C47 A;  1PZT A;  1G0R A;  1NQI B;  4KC1 A;  4FRD A;  4CJ8 A;  1MP4 A;  1H3M A;  4K6R A;  5EJ1 A;  2BO6 A;  3JUJ A;  4P02 A;  2ZU8 A;  1FXO A;  1V83 A;  2Y7A A;  3V0Q A;  2A8U A;  1H4E A;  4HO8 A;  5CQO A;  2E8B A;  4FRL A;  5CMG X;  4JD0 A;  1QG8 A;  4JIS A;  3I0H A;  1KWS A;  3N9W A;  1OQM B;  5C4D A;  4CJB A;  3V91 A;  3R2W A;  4HCQ A;  2OEG A;  3V0N A;  4CJC A;  2UX8 A;  3DJ4 A;  4KRV A;  5CMJ A;  1R7V A;  1FO8 A;  1LZ0 A; 
#chains in the Genus database with same CATH topology
 1ZJ1 A;  4DE7 A;  5C1L A;  4EVW A;  1JVG A;  1VGU A;  1H5R B;  4D0Z A;  2Y6P A;  2QH5 A;  2NXV A;  2XWN A;  4O6N A;  1ZJ2 A;  2RJ8 A;  3T7O A;  2YQS A;  2FFV A;  2MZB A;  2O1G A;  4AYJ A;  5CQL X;  4MYB A;  2ZU7 A;  4EEO A;  3DK5 A;  1VIC A;  3O3P A;  1V82 A;  3SPT A;  1G23 A;  1LL3 A;  2X5Z A;  4HO6 A;  1PZY B;  5CQP A;  2WVM A;  1VZX A;  4EEA A;  5FYE A;  3OH4 A;  2V0L A;  2OI7 A;  4FRM A;  1H7E A;  3D5N A;  1G2V A;  3FWW A;  2P6W A;  5FU8 A;  4B4G A;  1O0R A;  3F1C A;  1ZI5 A;  1ZDF A;  1H7T A;  5C4B A;  4G87 A;  1VPA A;  2RJ9 A;  4Y6U A;  2XWM A;  4NAK A;  1QGQ A;  1G1L A;  1TZF A;  4R7P A;  4D11 A;  1FOA A;  1EYR A;  2O1H A;  2XWL A;  1ZJ0 A;  3I0K A;  3SXA A;  5FV9 A;  2ICY A;  1H5T A;  4ECM A;  1O7O A;  3ZLL A;  3LW6 A;  3IOJ A;  2RJ6 A;  1G9R A;  4Y62 A;  4B3U A;  5C3B A;  1WSZ A;  5AJP A;  2VFZ A;  2VXL A;  2W0W A;  4FIY A;  4HO9 A;  3PKQ A;  2FY7 A;  1W77 A;  1VGW A;  1FXJ A;  2AH9 A;  4Y7G A;  1SS9 A;  3I0D A;  3U2W A;  4NAI A;  4HO0 A;  2VS5 A;  1VM8 A;  1MP3 A;  1HM0 A;  5L6V A;  1H7F A;  3SXD A;  4Y63 A;  1O7Q A;  1GX4 A;  4ASY A;  1HJJ A;  1ZCT A;  1WT1 A;  1R7X A;  4FRP A;  4ASJ A;  4DDZ A;  3U2V A;  3ZLK A;  2D7I A;  4FRH A;  3OAM A;  4D0T A;  2RIY A;  2AGD A;  2APC A;  5CQN X;  2PGV A;  1G93 A;  1YP2 A;  1H7L A;  5IDT A;  1Z90 A;  3OC9 A;  3V90 A;  2AES A;  1ZIZ A;  1JV1 A;  5C1H A;  2A8W A;  2JCK A;  3U2U A;  3POL A;  4G3Q A;  4HO4 A;  1I52 A;  5BXC A;  2WEE A;  2ICX A;  1TW1 A;  1JYL A;  3V0L A;  3I0C A;  2Y4J A;  2WE9 A;  3BCV A;  5FU0 A;  4EE5 A;  4FRA A;  3PNN A;  4KC2 A;  2X5S A;  4KQL A;  2QKX A;  3SXC A;  2JCJ A;  1O23 B;  4Y64 A;  1QWJ A;  2XME A;  5CMH A;  5D92 A;  3SXB A;  2YQH A;  4M2A A;  1FO9 A;  3OH2 A;  4HO5 A;  4FCE A;  2V0K A;  3CKJ A;  2JCO A;  3ST8 A;  2W0V A;  2RIX A;  4B2W A;  1FWY A;  1LZJ A;  5AJN A;  2VS3 A;  4YS8 A;  4FIX A;  1G3L A;  1FR9 A;  1H5S B;  1H5S D;  4KC4 A;  1R80 A;  3TZT A;  3T7M A;  3SX5 A;  5J49 A;  2Y4M A;  3USQ A;  2E3D A;  4ZDQ A;  2GGQ A;  2RIT A;  2I7B A;  2V0H A;  1H4D A;  1VH3 A;  2GGO A;  1XZ6 A;  1WVC A;  3I0G A;  3I0J A;  2AM4 A;  2VK9 A;  3RMW A;  1OMZ A;  1FG5 N;  1LL0 A;  3OGZ A;  3OKR A;  3Q7U A;  4FRE A;  1G8O A;  3CGX A;  1ZJ3 A;  4Y7V A;  4D11 C;  3D98 A;  1FR8 A;  2VD4 A;  3D8V A;  3SX3 A;  2BO4 A;  4P00 A;  2J0B A;  1S4N A;  5C4E A;  5CMI A;  1JYK A;  4FRO A;  5CMF X;  4Y7U A;  4KNR A;  1WT0 A;  2OEF A;  4AC3 A;  2Z86 A;  2V0I A;  4Q7C A;  1FRW A;  4UEG A;  1ZDG A;  4BQH A;  1FGX A;  1YRO B;  1IIN A;  3F1Y A;  5I1F A;  1JVD A;  2O1F A;  2RJ5 A;  3DUV A;  2FYD B;  1R81 A;  3V0P A;  3U2X A;  3JUK A;  3EE5 A;  5IDS A;  1QGS A;  1R82 A;  1W55 A;  3I0I X;  1H5R A;  3IOH A;  3R3I A;  4GBP A;  1LL2 A;  1ZJO A;  1NMM B;  4M4K A;  3OH0 A;  1NHE B;  1HM8 A;  1H5S A;  1HJL A;  2Z87 A;  3CKQ A;  5JQQ A;  1HV9 A;  2OI6 A;  3HL3 A;  4DEC A;  3CKV A;  1K4V A;  1GQC A;  1S4P A;  1WT2 A;  4B5B A;  5C4F A;  3Q4S A;  3SXE A;  2WVK A;  5HS2 A;  2YQJ A;  2P73 A;  3I0F A;  1GQ9 A;  4BMA A;  4CVH A;  3U0Y A;  1ZHJ A;  1MC3 A;  4KPX A;  3NGW A;  4IRQ A;  5FUH A;  5C3A A;  3GUE A;  1ON6 A;  3CKN A;  1FGG A;  3BRK X;  4Y6N A;  4HO2 A;  4B42 A;  5C38 A;  1ZI1 A;  3Q80 A;  5CQM X;  2YCM A;  1H4C A;  2PX7 A;  1GWW A;  2PGY A;  3RSB A;  4Y9X A;  4AAW A;  1INJ A;  1VZU A;  4D48 A;  3JTJ A;  2ZU9 A;  4HG6 A;  1JV3 A;  2BO7 A;  5C1G A;  3U0X A;  2I5E A;  4G3S A;  1LZI A;  1V84 A;  2AM5 A;  4NAL A;  2PA4 A;  3SX8 A;  1E5K A;  2WVL A;  1OMX A;  1ZCV A;  5DDT A;  1XHB A;  1FZW A;  4Y7F A;  4MND A;  1NF5 B;  5AJO A;  1H7Q A;  4MIX A;  1H7H A;  4B4B A;  1S4O A;  1VGT A;  1ON8 A;  1NWG B;  5L6S A;  1R7U A;  2WGZ A;  1H5T B;  1VH1 A;  3E26 A;  3K8D A;  3T7N A;  5C48 A;  3ZF8 A;  4O6M A;  3OH3 A;  2YC3 A;  2WAW A;  4FQW A;  2VXM A;  4J18 A;  1IIM A;  5C3D A;  2RJ0 A;  2YES A;  1VZT A;  2OI5 A;  2V0J A;  4XWI A;  1NKH B;  1ZCY A;  3V8Y A;  1VGZ A;  3TQD A;  3E25 A;  3RMV A;  1EZI A;  4IRP A;  4FRQ A;  1G95 A;  2VSI A;  2J0A A;  1W57 A;  2FYA A;  4B4M A;  5FTS A;  2AE7 A;  5C36 A;  4LW6 A;  3U2T A;  3QVB A;  1H7G A;  1LZ7 A;  2CU2 A;  1GX0 A;  2I5K A;  2YQC A;  3K8E A;  4FRB A;  1HM9 A;  3V8Z A;  1ZI3 A;  5EIY A;  2QGI A;  2DPW A;  3I0L A;  4L41 C;  5D91 A;  3ZGF A;  3SX7 A;  4ARW A;  3V0M A;  1WT3 A;  2XMH A;  1INI A;  2VS4 A;  4KXO A;  3V0O A;  2X65 A;  3SXG A;  1TW5 A;  5FTV A;  4EE4 A;  2YC5 A;  4Y7T A;  3CU0 A;  1TVY A;  2JCL A;  1MP5 A;  1R7Y A;  1GWV A;  3KIA A;  5C4C A;  1R7T A;  2VSH A;  4FCU A;  4B2X A;  4C2S A;  4M28 A;  4NAN A;  4KNX A;  2RIZ A;  4AYL A;  2D7R A;  1GA8 A;  2BO8 A;  4LW3 A;  3FOQ A;  4M2B A;  1YP3 A;  5EJZ A;  1H5S C;  3PKP A;  3IOI A;  1ZJP A;  2Y4K A;  3OH1 A;  5C8R A;  4HO3 A;  4HOC A;  1YP4 A;  1ZCU A;  2Y4L A;  5IFY A;  4KT7 A;  3ZGG A;  2D0J A;  4EEG A;  2C0N A;  2Q4J A;  4EE3 A;  4KPZ A;  4EEM A;  3I0E A;  2RJ4 A;  2FYC B;  3CKO A;  2AM3 A;  5DDV A;  4G3P A;  2P72 A;  2AEC A;  1ZI4 A;  2FYB A;  2RJ1 A;  4E1K A;  1LVW A;  2X60 A;  5C49 A;  2RJ7 A;  1G97 A;  2FFU A;  3USR A;  5C47 A;  1PZT A;  1G0R A;  1NQI B;  4KC1 A;  4FRD A;  4CJ8 A;  1MP4 A;  1H3M A;  4K6R A;  5EJ1 A;  2BO6 A;  3JUJ A;  4P02 A;  2ZU8 A;  1FXO A;  1V83 A;  2Y7A A;  3V0Q A;  2A8U A;  1H4E A;  4HO8 A;  5CQO A;  2E8B A;  4FRL A;  5CMG X;  4JD0 A;  1QG8 A;  4JIS A;  3I0H A;  1KWS A;  3N9W A;  1OQM B;  5C4D A;  4CJB A;  3V91 A;  3R2W A;  4HCQ A;  2OEG A;  3V0N A;  4CJC A;  2UX8 A;  3DJ4 A;  4KRV A;  5CMJ A;  1R7V A;  1FO8 A;  1LZ0 A; 
#chains in the Genus database with same CATH homology
 1ZJ1 A;  4DE7 A;  5C1L A;  4EVW A;  1JVG A;  1VGU A;  1H5R B;  4D0Z A;  2Y6P A;  2QH5 A;  2NXV A;  2XWN A;  4O6N A;  1ZJ2 A;  2RJ8 A;  3T7O A;  2YQS A;  2FFV A;  2MZB A;  2O1G A;  4AYJ A;  5CQL X;  4MYB A;  2ZU7 A;  4EEO A;  3DK5 A;  1VIC A;  3O3P A;  1V82 A;  3SPT A;  1G23 A;  1LL3 A;  2X5Z A;  4HO6 A;  1PZY B;  5CQP A;  2WVM A;  1VZX A;  4EEA A;  5FYE A;  3OH4 A;  2V0L A;  2OI7 A;  4FRM A;  1H7E A;  3D5N A;  1G2V A;  3FWW A;  2P6W A;  5FU8 A;  4B4G A;  1O0R A;  3F1C A;  1ZI5 A;  1ZDF A;  1H7T A;  5C4B A;  4G87 A;  1VPA A;  2RJ9 A;  4Y6U A;  2XWM A;  4NAK A;  1QGQ A;  1G1L A;  1TZF A;  4R7P A;  4D11 A;  1FOA A;  1EYR A;  2O1H A;  2XWL A;  1ZJ0 A;  3I0K A;  3SXA A;  5FV9 A;  2ICY A;  1H5T A;  4ECM A;  1O7O A;  3ZLL A;  3LW6 A;  3IOJ A;  2RJ6 A;  1G9R A;  4Y62 A;  4B3U A;  5C3B A;  1WSZ A;  5AJP A;  2VFZ A;  2VXL A;  2W0W A;  4FIY A;  4HO9 A;  3PKQ A;  2FY7 A;  1W77 A;  1VGW A;  1FXJ A;  2AH9 A;  4Y7G A;  1SS9 A;  3I0D A;  3U2W A;  4NAI A;  4HO0 A;  2VS5 A;  1VM8 A;  1MP3 A;  1HM0 A;  5L6V A;  1H7F A;  3SXD A;  4Y63 A;  1O7Q A;  1GX4 A;  4ASY A;  1HJJ A;  1ZCT A;  1WT1 A;  1R7X A;  4FRP A;  4ASJ A;  4DDZ A;  3U2V A;  3ZLK A;  2D7I A;  4FRH A;  3OAM A;  4D0T A;  2RIY A;  2AGD A;  2APC A;  5CQN X;  2PGV A;  1G93 A;  1YP2 A;  1H7L A;  5IDT A;  1Z90 A;  3OC9 A;  3V90 A;  2AES A;  1ZIZ A;  1JV1 A;  5C1H A;  2A8W A;  2JCK A;  3U2U A;  3POL A;  4G3Q A;  4HO4 A;  1I52 A;  5BXC A;  2WEE A;  2ICX A;  1TW1 A;  1JYL A;  3V0L A;  3I0C A;  2Y4J A;  2WE9 A;  3BCV A;  5FU0 A;  4EE5 A;  4FRA A;  3PNN A;  4KC2 A;  2X5S A;  4KQL A;  2QKX A;  3SXC A;  2JCJ A;  1O23 B;  4Y64 A;  1QWJ A;  2XME A;  5CMH A;  5D92 A;  3SXB A;  2YQH A;  4M2A A;  1FO9 A;  3OH2 A;  4HO5 A;  4FCE A;  2V0K A;  3CKJ A;  2JCO A;  3ST8 A;  2W0V A;  2RIX A;  4B2W A;  1FWY A;  1LZJ A;  5AJN A;  2VS3 A;  4YS8 A;  4FIX A;  1G3L A;  1FR9 A;  1H5S B;  1H5S D;  4KC4 A;  1R80 A;  3TZT A;  3T7M A;  3SX5 A;  5J49 A;  2Y4M A;  3USQ A;  2E3D A;  4ZDQ A;  2GGQ A;  2RIT A;  2I7B A;  2V0H A;  1H4D A;  1VH3 A;  2GGO A;  1XZ6 A;  1WVC A;  3I0G A;  3I0J A;  2AM4 A;  2VK9 A;  3RMW A;  1OMZ A;  1FG5 N;  1LL0 A;  3OGZ A;  3OKR A;  3Q7U A;  4FRE A;  1G8O A;  3CGX A;  1ZJ3 A;  4Y7V A;  4D11 C;  3D98 A;  1FR8 A;  2VD4 A;  3D8V A;  3SX3 A;  2BO4 A;  4P00 A;  2J0B A;  1S4N A;  5C4E A;  5CMI A;  1JYK A;  4FRO A;  5CMF X;  4Y7U A;  4KNR A;  1WT0 A;  2OEF A;  4AC3 A;  2Z86 A;  2V0I A;  4Q7C A;  1FRW A;  4UEG A;  1ZDG A;  4BQH A;  1FGX A;  1YRO B;  1IIN A;  3F1Y A;  5I1F A;  1JVD A;  2O1F A;  2RJ5 A;  3DUV A;  2FYD B;  1R81 A;  3V0P A;  3U2X A;  3JUK A;  3EE5 A;  5IDS A;  1QGS A;  1R82 A;  1W55 A;  3I0I X;  1H5R A;  3IOH A;  3R3I A;  4GBP A;  1LL2 A;  1ZJO A;  1NMM B;  4M4K A;  3OH0 A;  1NHE B;  1HM8 A;  1H5S A;  1HJL A;  2Z87 A;  3CKQ A;  5JQQ A;  1HV9 A;  2OI6 A;  3HL3 A;  4DEC A;  3CKV A;  1K4V A;  1GQC A;  1S4P A;  1WT2 A;  4B5B A;  5C4F A;  3Q4S A;  3SXE A;  2WVK A;  5HS2 A;  2YQJ A;  2P73 A;  3I0F A;  1GQ9 A;  4BMA A;  4CVH A;  3U0Y A;  1ZHJ A;  1MC3 A;  4KPX A;  3NGW A;  4IRQ A;  5FUH A;  5C3A A;  3GUE A;  1ON6 A;  3CKN A;  1FGG A;  3BRK X;  4Y6N A;  4HO2 A;  4B42 A;  5C38 A;  1ZI1 A;  3Q80 A;  5CQM X;  2YCM A;  1H4C A;  2PX7 A;  1GWW A;  2PGY A;  3RSB A;  4Y9X A;  4AAW A;  1INJ A;  1VZU A;  4D48 A;  3JTJ A;  2ZU9 A;  4HG6 A;  1JV3 A;  2BO7 A;  5C1G A;  3U0X A;  2I5E A;  4G3S A;  1LZI A;  1V84 A;  2AM5 A;  4NAL A;  2PA4 A;  3SX8 A;  1E5K A;  2WVL A;  1OMX A;  1ZCV A;  5DDT A;  1XHB A;  1FZW A;  4Y7F A;  4MND A;  1NF5 B;  5AJO A;  1H7Q A;  4MIX A;  1H7H A;  4B4B A;  1S4O A;  1VGT A;  1ON8 A;  1NWG B;  5L6S A;  1R7U A;  2WGZ A;  1H5T B;  1VH1 A;  3E26 A;  3K8D A;  3T7N A;  5C48 A;  3ZF8 A;  4O6M A;  3OH3 A;  2YC3 A;  2WAW A;  4FQW A;  2VXM A;  4J18 A;  1IIM A;  5C3D A;  2RJ0 A;  2YES A;  1VZT A;  2OI5 A;  2V0J A;  4XWI A;  1NKH B;  1ZCY A;  3V8Y A;  1VGZ A;  3TQD A;  3E25 A;  3RMV A;  1EZI A;  4IRP A;  4FRQ A;  1G95 A;  2VSI A;  2J0A A;  1W57 A;  2FYA A;  4B4M A;  5FTS A;  2AE7 A;  5C36 A;  4LW6 A;  3U2T A;  3QVB A;  1H7G A;  1LZ7 A;  2CU2 A;  1GX0 A;  2I5K A;  2YQC A;  3K8E A;  4FRB A;  1HM9 A;  3V8Z A;  1ZI3 A;  5EIY A;  2QGI A;  2DPW A;  3I0L A;  4L41 C;  5D91 A;  3ZGF A;  3SX7 A;  4ARW A;  3V0M A;  1WT3 A;  2XMH A;  1INI A;  2VS4 A;  4KXO A;  3V0O A;  2X65 A;  3SXG A;  1TW5 A;  5FTV A;  4EE4 A;  2YC5 A;  4Y7T A;  3CU0 A;  1TVY A;  2JCL A;  1MP5 A;  1R7Y A;  1GWV A;  3KIA A;  5C4C A;  1R7T A;  2VSH A;  4FCU A;  4B2X A;  4C2S A;  4M28 A;  4NAN A;  4KNX A;  2RIZ A;  4AYL A;  2D7R A;  1GA8 A;  2BO8 A;  4LW3 A;  3FOQ A;  4M2B A;  1YP3 A;  5EJZ A;  1H5S C;  3PKP A;  3IOI A;  1ZJP A;  2Y4K A;  3OH1 A;  5C8R A;  4HO3 A;  4HOC A;  1YP4 A;  1ZCU A;  2Y4L A;  5IFY A;  4KT7 A;  3ZGG A;  2D0J A;  4EEG A;  2C0N A;  2Q4J A;  4EE3 A;  4KPZ A;  4EEM A;  3I0E A;  2RJ4 A;  2FYC B;  3CKO A;  2AM3 A;  5DDV A;  4G3P A;  2P72 A;  2AEC A;  1ZI4 A;  2FYB A;  2RJ1 A;  4E1K A;  1LVW A;  2X60 A;  5C49 A;  2RJ7 A;  1G97 A;  2FFU A;  3USR A;  5C47 A;  1PZT A;  1G0R A;  1NQI B;  4KC1 A;  4FRD A;  4CJ8 A;  1MP4 A;  1H3M A;  4K6R A;  5EJ1 A;  2BO6 A;  3JUJ A;  4P02 A;  2ZU8 A;  1FXO A;  1V83 A;  2Y7A A;  3V0Q A;  2A8U A;  1H4E A;  4HO8 A;  5CQO A;  2E8B A;  4FRL A;  5CMG X;  4JD0 A;  1QG8 A;  4JIS A;  3I0H A;  1KWS A;  3N9W A;  1OQM B;  5C4D A;  4CJB A;  3V91 A;  3R2W A;  4HCQ A;  2OEG A;  3V0N A;  4CJC A;  2UX8 A;  3DJ4 A;  4KRV A;  5CMJ A;  1R7V A;  1FO8 A;  1LZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...